Patent application title:

antigens

Publication number:

-

Publication date:
Application number:

10/324,143

Filed date:

2002-12-20

✅ Patent granted

Patent number:

US 7,262,024 B2

Grant date:

2007-08-28

PCT filing:

-

PCT publication:

-

Examiner:

Jennifer Graser

Adjusted expiration:

2024-03-27

Abstract:

The present invention relates to polypeptides of Streptococcus pneumoniae which may be used for prophylaxis, diagnostic and/or therapy purposes.

Inventors:

Assignee:

Interested in similar patents?

Get notified when new applications in this technology area are published.

Classification:

C12P21/06 IPC

Preparation of peptides or proteins produced by the hydrolysis of a peptide bond, e.g. hydrolysate products

Description

The present application incorporates by reference U.S. patent application Ser. No. 09/884,465 filed on Jun. 20, 2001, now issued as U.S. Pat. No. 7,074,415 on Jul. 11, 2006, and/or corresponding PCT CA01/00908 filed on Jun. 19, 2001. This application claims priority to U.S. Provisional Application Ser. No. 60/341,252, filed Dec. 20, 2001.

FIELD OF THE INVENTION

The present invention is related to polypeptides, antigens, epitopes and antibodies directed to these epitopes, more particularly polypeptide antigens of Streptococcus pneumoniae pathogen which may be useful for prophylaxis, diagnostic or treatment of streptococcal infection.

BACKGROUND OF THE INVENTION

S. pneumoniae is an important agent of disease in man especially among infants, the elderly and immunocompromised persons. It is a bacterium frequently isolated from patients with invasive diseases such as bacteraemia/septicaemia, pneumonia, meningitis with high morbidity and mortality throughout the world. Even with appropriate antibiotic therapy, pneumococcal infections still result in many deaths. Although the advent of antimicrobial drugs has reduced the overall mortality from pneumococcal disease, the presence of resistant pneumococcal organisms has become a major problem in the world today. Effective pneumococcal vaccines could have a major impact on the morbidity and mortality associated with S. pneumoniae disease. Such vaccines would also potentially be useful to prevent otitis media in infants and young children.

Efforts to develop a pneumococcal vaccine have generally concentrated on generating immune responses to the pneumococcal capsular polysaccharide. More than 80 pneumococcal capsular serotypes have been identified on the basis of antigenic differences. The currently available pneumococcal vaccine, comprising 23 capsular polysaccharides that most frequently caused disease, has significant shortcomings related primarily to the poor immunogenicity of some capsular polysaccharides, the diversity of the serotypes and the differences in the distribution of serotypes over time, geographic areas and age groups. In particular, the failure of existing vaccines and capsular conjugate vaccines currently in development to protect young children against all serotypes spurres evaluation of other S. pneumoniae components. Although immunogenicity of capsular polysaccharides can be improved, serotype specificity will still represent a major limitation of polysaccharide-based vaccines. The use of a antigenically conserved immunogenic pneumococcal protein antigen, either by itself or in combination with additional components, offers the possibility of a protein-based pneumococcal vaccine.

PCT WO 98/18930 published May 7, 1998 entitled “Streptococcus Pneumoniae antigens and vaccines” describes certain polypeptides which are claimed to be antigenic. However, no biological activity of these polypeptides is reported. Similarly, no sequence conservation is reported, which is a necessary species common vaccine candidate.

PCT WO 00/39299 describes polypeptides and polynucleotides encoding these polypeptides. PCT WO 00/39299 demonstrates that polypeptides designated as BVH-3 and BVH-11 provide protection against fatal experimental infection with pneumococci.

There remains an unmet need for Streptococcus antigens that may be used as components for the prophylaxis, diagnostic and/or therapy of Streptococcus infection.

SUMMARY OF THE INVENTION

An isolated polynucleotide comprising a polynucleotide chosen from:

  • (a) a polynucleotide encoding a polypeptide having at least 70% identity to a second polypeptide chosen from: SEQ ID 1, 2, 3, 90 to 115, 141 to 148 or fragments, analogs or derivatives thereof;
  • (b) a polynucleotide encoding a polypeptide having at least 95% identity to a second polypeptide chosen from: SEQ ID 1, 2, 3, 90 to 115, 141 to 148 or fragments, analogs or derivatives thereof;
  • (c) a polynucleotide encoding a polypeptide having an amino sequence chosen from SEQ ID 1, 2, 3, 90 to 115, 141 to 148 or fragments, analogs or derivatives thereof;
  • (d) a polynucleotide encoding a polypeptide capable of raising antibodies having binding specificity for a polypeptide having a sequence chosen from: SEQ ID 1, 2, 3, 90 to 115, 141 to 148 or fragments, analogs or derivatives thereof;
  • (e) a polynucleotide encoding an epitope bearing portion of a polypeptide chosen from SEQ ID 1, 2, 3, 90 to 115, 141 to 148 or fragments, analogs or derivatives thereof;
  • (f) a polynucleotide comprising a sequence chosen from SEQ ID NOS: 4, 5 or 6;
  • (g) a polynycleotide complementary to a polynucleotide in (a), (b), (c), (d), (e) or (f)

In other aspects, there are provided polypeptides encoded by polynucleotides of the invention, pharmaceutical compositions, vaccine compositions, vectors comprising polynucleotides of the invention operably linked to an expression control region, as well as host cells transfected with said vectors and processes for producing polypeptides comprising culturing said host cells under conditions suitable for expression.

BRIEF DESCRIPTION OF THE DRAWINGS

FIG. 1 represents the amino acid sequence of New 136 polypeptide; SEQ ID NO: 1.

FIG. 2 represents the amino acid sequence of VP 139 (also called New 139 when fused to an Histidine tag) polypeptide; SEQ ID NO: 2.

FIG. 3 represents the amino acid sequence of VP147 (also called New 147 when fused to an Histidine tag) polypeptide; SEQ ID NO: 3.

FIG. 4 represents the DNA sequence of New 136 gene; SEQ ID NO: 4.

FIG. 5 represents the DNA sequence of New 139 (also called VP139) gene; SEQ ID NO: 5.

FIG. 6 represents the DNA sequence of VP147 (also called New 147) gene; SEQ ID NO: 6.

FIG. 7 illustrates the construct evolution from BVH-3 and BVH-11-2 to the chimeric VP147.

FIG. 8A-8D depicts the comparison of the amino acid sequences of VP147 (SEQ ID NO:149), VP147-R1 (SEQ ID NO:150), VP147-R2 (SEQ ID NO:151), VP147-R3 (SEQ ID NO:152), VP147-L1 (SEQ ID NO:153), VP147-L2 (SEQ ID NO:154), VP-147-L3 (SEQ ID NO:155), VP147-L4 (SEQ ID NO:156), and VP147-R2-L4 (SEQ ID NO:157) by using the program Align X from Vector NTI® sequence analysis software (version 7.0). The consensus sequence corresponds to the sequence set forth in SEQ ID NO:158.

FIG. 9A-9C represents the amino acid sequence of BVH-3 polypeptide; SEQ ID NO: 7.

FIG. 10A-10C represents the amino acid sequence of BVH-11 polypeptide; SEQ ID NO: 8.

FIG. 11A-11C represents the amino acid sequence of BVH-11-2 polypeptide; SEQ ID NO: 9.

FIG. 12 represents the DNA sequence of New 43 gene; SEQ ID NO: 10.

FIG. 13 represents the amino acid sequence of New 43 polypeptide; SEQ ID NO: 11.

FIG. 14A-14B represents the amino acid sequence of New 56 polypeptide; SEQ ID NO: 12.

FIG. 15 represents the amino acid sequence of New88 polypeptide; SEQ ID NO: 13.

DETAILED DESCRIPTION OF THE INVENTION

It was determined that portions of the BVH-3 and BVH-11 polypeptides were internal. Other portions were not present in important strains such as encapsulated S.pneumoniae causing disease strains. When large portions of a polypeptide are internal, these portions are not exposed on the bacteria. However, these portions can be very immunogenic in a recombinant polypeptide and will not confer protection against infections. It would be advantageous to have a polypeptide that comprises a portion that is not internal. It would also be advantageous to have a polypeptide that comprises a portion that is present in most strains.

The present invention is concerned with polypeptides in which undesired portions have been deleted and/or modified in order to obtain a specific immune response.

The polypeptides designated NEW include additional tag sequences at the carboxyl end. In contrast, the polypeptides designated VP are produced with another expression vector and therefore do not have a His tag.

In accordance with the present invention, there are also provided polypeptides or polynucleotides encoding such polypeptides comprising protective domains.

Surprisingly, when specific portions of the polypeptides are deleted or modified, the polypeptides have desired biological properties. This is surprising in view of the fact that some of these portions were described as being epitope bearing portion in the patent application PCT WO 98/18930. In other publications such as PCT WO 00/37105, portions identified as histidine triad and coil coiled regions were said to be of importance. The present inventors have found that variants of the polypeptide BVH-3 and BVH-11 in which certain portions were deleted and/or modified and chimeras of these polypeptides have biological properties and generate a specific immune response.

According to one aspect, the present invention provides an isolated polynucleotide encoding a polypeptide having at least 70% identity to a second polypeptide comprising a sequence as disclosed in the present application, the tables and figures. According to one aspect, the present invention provides an isolated polynucleotide encoding a polypeptide having at least 80% identity to a second polypeptide comprising a sequence as disclosed in the present application, the tables and figures.

According to one aspect, the present invention provides an isolated polynucleotide encoding a polypeptide having at least 90% identity to a second polypeptide comprising a sequence as disclosed in the present application, the tables and figures.

According to one aspect, the present invention provides an isolated polynucleotide encoding a polypeptide having at least 98% identity to a second polypeptide comprising a sequence as disclosed in the present application, the tables and figures.

According to one aspect, the present invention provides an isolated polynucleotide encoding a polypeptide having at least 99% identity to a second polypeptide comprising a sequence as disclosed in the present application, the tables and figures.

According to one aspect, the present invention provides an isolated polynucleotide encoding a polypeptide comprising a sequence as disclosed in the present application, the tables and figures.

In accordance with one aspect of the present invention, there is provided an isolated polynucleotide comprising a polynucleotide chosen from;

    • (a) a polynucleotide encoding a polypeptide having at least 70% identity to a second polypeptide chosen from: SEQ ID 1, 2, 3, 90 to 115, 141 to 148 or fragments, analogs or derivatives thereof;
    • (b) a polynucleotide encoding a polypeptide having at least 95% identity to a second polypeptide chosen from: SEQ ID 1, 2, 3, 90 to 115, 141 to 148 or fragments, analogs or derivatives thereof;
    • (c) a polynucleotide encoding a polypeptide having an amino sequence chosen from SEQ ID 1, 2, 3, 90 to 115, 141 to 148 or fragments, analogs or derivatives thereof;
    • (d) a polynucleotide encoding a polypeptide capable of raising antibodies having binding specificity for a polypeptide having a sequence chosen from: SEQ ID 1, 2, 3, 90 to 115, 141 to 148 or fragments, analogs or derivatives thereof;
    • (e) a polynucleotide encoding an epitope bearing portion of a polypeptide chosen from SEQ ID 1, 2, 3, 90 to 115, 141 to 148 or fragments, analogs or derivatives thereof;
    • (f) a polynucleotide comprising a sequence chosen from SEQ ID NOS: 4, 5, 6 or fragments, analogs or derivatives thereof;
    • (g) a polynycleotide complementary to a polynucleotide in (a), (b), (c), (d), (e) or (f).

In accordance with one aspect of the present invention, there is provided an isolated polynucleotide comprising a polynucleotide chosen from;

    • (a) a polynucleotide encoding a polypeptide having at least 70% identity to a second polypeptide chosen from: SEQ ID 1, 2, 3, 90 to 115 or 141 to 148;
    • (b) a polynucleotide encoding a polypeptide having at least 95% identity to a second polypeptide chosen from: SEQ ID 1, 2, 3, 90 to 115 or 141 to 148;
    • (c) a polynucleotide encoding a polypeptide having an amino sequence chosen from SEQ ID 1, 2, 3, 90 to 115 or 141 to 148;
    • (d) a polynucleotide encoding a polypeptide capable of raising antibodies having binding specificity for a polypeptide having a sequence chosen from: SEQ ID 1, 2, 3, 90 to 115 or 141 to 148;
    • (e) a polynucleotide encoding an epitope bearing portion of a polypeptide chosen from SEQ ID 1, 2, 3, 90 to 115 or 141 to 148;
    • (f) a polynucleotide comprising a sequence chosen from SEQ ID NOS: 4, 5 or 6; and
    • (g) a polynycleotide complementary to a polynucleotide in (a), (b), (c), (d), (e) or (f).

According to one aspect, the present invention provides an isolated polynucleotide encoding a polypeptide having at least 70% identity to a second polypeptide comprising a sequence chosen from SEQ ID 1, 2, 3, 90 to 115, 141 to 148 or fragments, analogues or derivatives thereof.

According to one aspect, the present invention provides an isolated polynucleotide encoding a polypeptide having at least 95% identity to a second polypeptide comprising a sequence chosen from SEQ ID 1, 2, 3, 90 to 115, 141 to 148 or fragments, analogues or derivatives thereof.

According to one aspect, the present invention provides an isolated polynucleotide encoding a polypeptide having at least 98% identity to a second polypeptide comprising a sequence chosen from SEQ ID 1, 2, 3, 90 to 115, 141 to 148 or fragments, analogues or derivatives thereof.

According to one aspect, the present invention provides an isolated polynucleotide encoding a polypeptide having at least 99% identity to a second polypeptide comprising a sequence chosen from SEQ ID 1, 2, 3, 90 to 115, 141 to 148 or fragments, analogues or derivatives thereof.

According to one aspect, the present invention provides an isolated polynucleotide encoding a polypeptide having a sequence chosen from SEQ ID 1, 2, 3, 90 to 115, 141 to 148 or fragments, analogues or derivatives thereof.

According to one aspect, the present invention relates to polypeptides characterised by the amino acid sequence chosen from SEQ ID 1, 2, 3, 90 to 115, 141 to 148 or fragments, analogues or derivatives thereof.

According to one aspect, the present invention provides an isolated polynucleotide having a sequence comprising a sequence chosen from SEQ ID Nos: 4, 5, 6 or fragments or analogs thereof;

According to one aspect, the present invention provides an isolated polynucleotide encoding a polypeptide having at least 70% identity to a second polypeptide comprising a sequence chosen from SEQ ID 1, 2, 3, 90 to 115 or 141 to 148.

According to one aspect, the present invention provides an isolated polynucleotide encoding a polypeptide having at least 95% identity to a second polypeptide comprising a sequence chosen from SEQ ID 1, 2, 3, 90 to 115 or 141 to 148.

According to one aspect, the present invention provides an isolated polynucleotide encoding a polypeptide having at least 98% identity to a second polypeptide comprising a sequence chosen from SEQ ID 1, 2, 3, 90 to 115 or 141 to 148.

According to one aspect, the present invention provides an isolated polynucleotide encoding a polypeptide having at least 99% identity to a second polypeptide comprising a sequence chosen from SEQ ID 1, 2, 3, 90 to 115 or 141 to 148.

According to one aspect, the present invention provides an isolated polynucleotide encoding a polypeptide having a sequence chosen from SEQ ID 1, 2, 3, 90 to 115 or 141 to 148.

According to one aspect, the present invention relates to polypeptides characterised by the amino acid sequence chosen from SEQ ID 1, 2, 3, 90 to 115 or 141 to 148.

According to one aspect, the present invention provides an isolated polynucleotide having a sequence comprising a sequence chosen from SEQ ID Nos: 4, 5 or 6.

According to one aspect, the present invention relates to an isolated polypeptide comprising a polypeptide chosen from:

  • (a) a polypeptide having at least 70% identity to a second polypeptide having an amino acid sequence chosen from: SEQ ID NO: 1, 2, 3, 90 to 115, 141 to 148 or fragments, analogs or derivatives thereof;
  • (b) a polypeptide having at least 95% identity to a second polypeptide having an amino acid sequence chosen from: SEQ ID NO: 1, 2, 3, 90 to 115, 141 to 148 or fragments, analogs or derivatives thereof;
  • (c) a polypeptide having an amino acid sequence chosen from SEQ ID NO: 1, 2, 3, 90 to 115, 141 to 148 or fragments, analogs or derivatives thereof;
  • (d) a polypeptide capable of raising antibodies having binding specificity for a second polypeptide having a sequence chosen from SEQ ID NO: 1, 2, 3, 90 to 115, 141 to 148 or fragments, analogs or derivatives thereof;
  • (e) an epitope bearing portion of a polypeptide having an amino acid sequence chosen from: SEQ ID NO: 1, 2, 3, 90 to 115, 141 to 148 or fragments, analogs or derivatives thereof;
  • (f) the polypeptide of (a), (b), (c), (d) or (e) wherein the N-terminal Met residue is deleted; or
  • (g) the polypeptide of (a), (b), (c), (d), (e) or (f) wherein the secretory amino acid sequence is deleted.

According to one aspect, the present invention relates to an isolated polypeptide comprising a member chosen from:

  • (a) a polypeptide having at least 70% identity to a second polypeptide having an amino acid sequence chosen from: SEQ ID NO: 1, 2, 3, 90 to 115 or 141 to 148;
  • (b) a polypeptide having at least 95% identity to a second polypeptide having an amino acid sequence chosen from: SEQ ID NO: 1, 2, 3, 90 to 115 or 141 to 148;
  • (c) a polypeptide having an amino acid sequence chosen from SEQ ID NO: 1, 2, 3, 90 to 115 or 141 to 148;
  • (d) a polypeptide capable of raising antibodies having binding specificity for a second polypeptide having a sequence chosen from SEQ ID NO: 1, 2, 3, 90 to 115 or 141 to 148;
  • (e) an epitope bearing portion of a polypeptide having an amino acid sequence chosen from: SEQ ID NO: 1, 2, 3, 90 to 115 or 141 to 148;
  • (f) the polypeptide of (a), (b), (c), (d) or (e) wherein the N-terminal Met residue is deleted; or
  • (g) the polypeptide of (a), (b), (c), (d), (e), or (f) wherein the secretory amino acid sequence is deleted.

A BVH-11-2 polypeptide construction is made up of 4 fragments (A, B, C, D) from the original BVH-11 polypeptide described in PCT WO 00/39299, linked by 3 fusion sites: - - - A - - - fusion site - - - B - - - fusion site - - - C - - - fusion site - - -D - - -

These fusion sites were in fact depending on the restriction enzyme chosen.

In NEW 139 these 3 fusion sites have been mutated for pairs of Glycine residues to facilitate movement and reduce the possibility of creating new epitopes.

In accordance with the present invention, all nucleotides of the present invention encoding polypeptides and chimeric polypeptides are within the scope of the present invention.

In a further embodiment, the present invention relates to chimeric polypeptides made of at least 2 polypeptides, the first one contains a Methionine codon for translation, the following ones do not need to start with a Methionine codon.

A stop codon can be added at the end of the chimeric polypeptide so that the polypeptides are produced without a tag.

In a further embodiment, the present invention relates to chimeric polypeptides comprising to or more polypeptides comprising a sequence chosen from SEQ ID NOS: 1, 2, 3, 90 to 115 or 141 to 148 or fragments, analogs or derivatives thereof provided that the polypeptides are linked as to form a chimeric polypeptide.

In a further embodiment, the present invention relates to chimeric polypeptides comprising to or more polypeptides comprising a sequence chosen from SEQ ID NOS: 1, 2, 3, 90 to 115 or 141 to 148 provided that the polypeptides are linked as to form a chimeric polypeptide.

In a further embodiment, the chimeric polypeptide is made of at least 2 polypeptides, chosen from BVH-3, BVH-11-1 and/or BVH-11-2 polypeptides.

In a preferred embodiment, the chimeras are made up of a BVH-3 fragment and a BVH-11-2 fragment linked together by optional amino acids such as Glycine-Proline or Glycine-Glycine.

In VP 147, which is a chimera, made up of VP56 (or New56) and NEW 139, these 2 fragments are linked by glycine residues (GG).

Those skilled in the art will appreciate that the invention includes DNA molecules, i.e. polynucleotides and their complementary sequences that encode analogs such as mutants, variants, homologues and derivatives of such polypeptides, as described herein in the present patent application. The invention also includes RNA molecules corresponding to the DNA molecules of the invention. In addition to the DNA and RNA molecules, the invention includes the corresponding polypeptides and monospecific antibodies that specifically bind to such polypeptides.

In a further embodiment, the polypeptides or chimeric polypeptides in accordance with the present invention are antigenic.

In a further embodiment, the polypeptides or chimeric polypeptides in accordance with the present invention are immunogenic.

In a further embodiment, the polypeptides or chimeric polypeptides in accordance with the present invention can elicit an immune response in an individual.

In a further embodiment, the present invention also relates to polypeptides which are able to raise antibodies having binding specificity to the polypeptides or chimeric polypeptides of the present invention as defined above.

In one embodiment, the polypeptides of the invention comprise at least one epitope bearing portion.

In a further embodiment, the fragments of the polypeptides of the present invention will comprise at least 10 contiguous amino acid of the polypeptides of SEQ ID NO 1, 2, 3, 90 to 115 or 141 to 148. The fragment will comprises at least 15 contiguous amino acid of the polypeptides of SEQ ID NO 1, 2, 3, 90 to 115 or 141 to 148. The fragment will comprises at least 20 contiguous amino acid of the polypeptides of SEQ ID NO 1, 2, 3, 90 to 115 or 141 to 148.

An antibody that “has binding specificity” is an antibody that recognises and binds the selected polypeptide but which does not substantially recognise and bind other molecules in a sample, such as a biological sample. Specific binding can be measured using an ELISA assay in which the selected polypeptide is used as an antigen.

In accordance with the present invention, “protection” in the biological studies is defined by a significant increase in the survival curve, rate or period. Statistical analysis using the Log rank test to compare survival curves, and Fisher exact test to compare survival rates and numbers of days to death, respectively, might be useful to calculate P values and determine whether the difference between the two groups is statistically significant. P values smaller than 0.05 are regarded as not significant.

As used herein, “fragments”, “derivatives” or “analogues” of the polypeptides of the invention include those polypeptides in which one or more of the amino acid residues are substituted with a conserved or non-conserved amino acid residue (preferably conserved) and which may be natural or unnatural. In one embodiment, derivatives and analogues of polypeptides of the invention will have about 70% identity with those sequences illustrated in the figures or fragments thereof. That is, 70% of the residues are the same. In a further embodiment, polypeptides will have greater than 75% homology. In a further embodiment, polypeptides will have greater than 80% homology. In a further embodiment, polypeptides will have greater than 85% homology. In a further embodiment, polypeptides will have greater than 90% homology. In a further embodiment, polypeptides will have greater than 95% homology. In a further embodiment, polypeptides will have greater than 99% homology. In a further embodiment, derivatives and analogues of polypeptides of the invention will have less than about 20 amino acid residue substitutions, modifications or deletions and more preferably less than 10. Preferred substitutions are those known in the art as conserved i.e. the substituted residues share physical or chemical properties such as hydrophobicity, size, charge or functional groups.

The skilled person will appreciate that analogues or derivatives of the proteins or polypeptides of the invention will also find use in the context of the present invention, i.e. as antigenic/immunogenic material. Thus, for instance proteins or polypeptides which include one or more additions, deletions, substitutions or the like are encompassed by the present invention. In addition, it may be possible to replace one amino acid with another of similar “type”. For instance replacing one hydrophobic amino acid with another hydrophilic amino acid.

One can use a program such as the CLUSTAL program to compare amino acid sequences. This program compares amino acid sequences and finds the optimal alignment by inserting spaces in either sequence as appropriate. It is possible to calculate amino acid identity or similarity (identity plus conservation of amino acid type) for an optimal alignment. A program like BLASTx will align the longest stretch of similar sequences and assign a value to the fit. It is thus possible to obtain a comparison where several regions of similarity are found, each having a different score. Both types of identity analysis are contemplated in the present invention.

It is well known that it is possible to screen an antigenic polypeptide to identify epitopic regions, i.e. those regions which are responsible for the polypeptide's antigenicity or immunogenicity. Methods for carrying out such screening are well known in the art. Thus, the fragments of the present invention should include one or more such epitopic regions or be sufficiently similar to such regions to retain their antigenic/immunogenic properties.

In an alternative approach, the analogues or derivatives could be fusion proteins, incorporating moieties which render purification easier, for example by effectively tagging the desired protein or polypeptide, It may be necessary to remove the “tag” or it may be the case that the fusion protein itself retains sufficient antigenicity to be useful.

In an additional aspect of the invention there are provided antigenic/immunogenic fragments of the proteins or polypeptides of the invention, or of analogues or derivatives thereof.

The fragments of the present invention should include one or more such epitopic regions or be sufficiently similar to such regions to retain their antigenic/immunogenic properties. Thus, for fragments according to the present invention the degree of identity is perhaps irrelevant, since they may be 100% identical to a particular part of a protein or polypeptide, analogue or derivative as described herein. The key issue, once again, is that the fragment retains the antigenic/immunogenic properties.

Thus, what is important for analogues, derivatives and fragments is that they possess at least a degree of the antigenicity/immunogenic of the protein or polypeptide from which they are derived.

In accordance with the present invention, polypeptides of the invention include both polypeptides and chimeric polypeptides.

Also included are polypeptides which have fused thereto other compounds which alter the polypeptides biological or pharmacological properties i.e. polyethylene glycol (PEG) to increase half-life; leader or secretory amino acid sequences for ease of purification; prepro- and pro-sequences; and (poly)saccharides.

Furthermore, in those situations where amino acid regions are found to be polymorphic, it may be desirable to vary one or more particular amino acids to more effectively mimic the different epitopes of the different Streptococcus strains.

Moreover, the polypeptides of the present invention can be modified by terminal —NH2 acylation (e.g. by acetylation, or thioglycolic acid amidation, terminal carboxy amidation, e.g. with ammonia or methylamine) to provide stability, increased hydrophobicity for linking or binding to a support or other molecule.

Also contemplated are hetero and homo polypeptide multimers of the polypeptide fragments, analogues and derivatives. These polymeric forms include, for example, one or more polypeptides that have been cross-linked with cross-linkers such as avidin/biotin, gluteraldehyde or dimethylsuperimidate. Such polymeric forms also include polypeptides containing two or more tandem or inverted contiguous sequences, produced from multicistronic mRNAs generated by recombinant DNA technology.

Preferably, a fragment, analogue or derivative of a polypeptide of the invention will comprise at least one antigenic region i.e. at least one epitope.

In order to achieve the formation of antigenic polymers (i.e. synthetic multimers), polypeptides may be utilised having bishaloacetyl groups, nitroarylhalides, or the like, where the reagents being specific for thio groups. Therefore, the link between two mercapto groups of the different peptides may be a single bond or may be composed of a linking group of at least two, typically at least four, and not more than 16, but usually not more than about 14 carbon atoms.

In a particular embodiment, polypeptide fragments, analogues and derivatives of the invention do not contain a methionine (Met) or valine (Val) starting residue. Preferably, polypeptides will not incorporate a leader or secretory sequence (signal sequence). The signal portion of a polypeptide of the invention may be determined according to established molecular biological techniques. In general, the polypeptide of interest may be isolated from a Streptococcus culture and subsequently sequenced to determine the initial residue of the mature protein and therefore the sequence of the mature polypeptide.

According to another aspect of the invention, there are also provided (i) a composition of matter containing a polypeptide of the invention, together with a carrier, diluent, adjuvant or liposome; (ii) a pharmaceutical composition comprising a polypeptide of the invention and a pharmaceutically acceptable carrier, diluent, adjuvant or liposome; (iii) a vaccine comprising a polypeptide of the invention and a pharmaceutically acceptable carrier, diluent, adjuvant or liposome; (iv) a method for inducing an immune response against Streptococcus, in a host, by administering to the host, an immunogenically effective amount of a polypeptide of the invention to elicit an immune response, e.g., a protective immune response to Streptococcus; and particularly, (v) a method for preventing and/or treating a Streptococcus infection, by administering a prophylactic or therapeutic amount of a polypeptide of the invention to a host in need; and (vi) a method for preventing and/or treating a Streptococcus infection by administering a prophylactic or therapeutic amount of an antibody directed to a polypeptide of the invention to a host in need.

According to another aspect of the invention, there are also provided (i) a composition of matter containing a polynucleotide of the invention, together with a carrier, diluent, adjuvant or liposome; (ii) a pharmaceutical composition comprising a polynucleotide of the invention and a pharmaceutically acceptable carrier, diluent, adjuvant or liposome; (iii) a method for inducing an immune response against Streptococcus, in a host, by administering to the host, an immunogenically effective amount of a polynucleotide of the invention to elicit an immune response, e.g., a protective immune response to Streptococcus; and particularly, (iv) a method for preventing and/or treating a Streptococcus infection, by administering a prophylactic or therapeutic amount of a polynucleotide of the invention to a host in need.

Before immunization, the polypeptides of the invention can also be coupled or conjugated to carrier proteins such as tetanus toxin, diphtheria toxin, hepatitis B virus surface antigen, poliomyelitis virus VP1 antigen or any other viral or bacterial toxin or antigen or any suitable proteins to stimulate the development of a stronger immune response. This coupling or conjugation can be done chemically or genetically. A more detailed description of peptide-carrier conjugation is available in Van Regenmortel, M. H. V., Briand J. P., Muller S., Plaué S., <<Synthetic Polypeptides as antigens>> in Laboratory Techniques in Biochemistry and Molecular Biology, Vol.19 (ed.) Burdou, R. H. & Van Knippenberg P. H. (1988), Elsevier New York.

According to another aspect, there are provided pharmaceutical compositions comprising one or more Streptococcus polypeptides of the invention in a mixture with a pharmaceutically acceptable adjuvant. Suitable adjuvants include (1) oil-in-water emulsion formulations such as MF59™, SAF™, Ribi™; (2) Freund's complete or incomplete adjuvant; (3) salts i.e. AlK(SO4)2, AlNa(SO4)2, AlNH4(SO4)2, Al(OH)3, AlPO4, silica, kaolin; (4) saponin derivatives such as Stimulon™ or particles generated therefrom such as ISCOMs (immunostimulating complexes); (5) cytokines such as interleukins, interferons, macrophage colony stimulating factor (M-CSF), tumor necrosis factor (TNF); (6) other substances such as carbon polynucleotides i.e. poly IC and poly AU, detoxified cholera toxin (CTB) and E. coli heat labile toxin for induction of mucosal immunity; (7) liposomes. A more detailed description of adjuvant is available in a review by M. Z. I Khan et al. in Pharmaceutical Research, vol. 11, No. 1 (1994) pp 2-11, and also in another review by Gupta et al., in Vaccine, Vol. 13, No. 14, pp 1263-1276 (1995) and in WO 99/24578. Preferred adjuvants include QuilA™, QS21™, Alhydrogel™ and Adjuphos™.

According to another aspect, there are provided pharmaceutical compositions comprising one or more Streptococcus polypeptides of the invention in admixture with a pharmaceutically acceptable carrier diluent or adjuvant. Suitable adjuvants include oils i.e. Freund's complete or incomplete adjuvant; salts i.e. AlK(SO4)2, AlNa(SO4)2, AlNH4(SO4)2, silica, kaolin, carbon polynucleotides i.e. poly IC and poly AU. Preferred adjuvants include QuilA and Alhydrogel.

Pharmaceutical compositions or vaccines of the invention may be administered parenterally by injection, rapid infusion, nasopharyngeal absorption, dermoabsorption, or bucal or oral.

Pharmaceutically acceptable carriers also include tetanus toxoid.

The term “pharmaceutical composition” is also meant to include antibodies. In accordance with the present invention, there is also provided the use of one or more antibodies having binding specificity for the polypeptides of the present invention for the treatment or prophylaxis of Streptococcus infection and/or diseases and symptoms mediated by Streptococcus infection.

Pharmaceutical compositions of the invention are used for the treatment or prophylaxis of Streptococcus infection and/or diseases and symptoms mediated by Streptococcus infection as described in P. R. Murray (Ed, in chief), E. J. Baron, M. A. Pfaller, F. C. Tenover and R. H. Yolken. Manual of Clinical Microbiology, ASM Press, Washington, D.C. sixth edition, 1995, 1482p which are herein incorporated by reference. In one embodiment, vaccine compositions of the present invention are used for the treatment or prophylaxis of meningitis, otitis media, bacteremia or pneumonia.

In one embodiment, the invention provides a method for therapeutic or prophylactic treatment of meningitis, otitis media, bacteremia or pneumonia infection in an individual susceptible to meningitis, otitis media, bacteremia or pneumonia infection comprising administering to said individual a therapeutic or prophylactic amount of a composition of the invention.

In one embodiment, the invention provides a method for therapeutic or prophylactic treatment of streptococcal bacterial infection in an individual susceptible to streptococcal infection comprising administering to said individual a therapeutic or prophylactic amount of a composition of the invention.

In one embodiment, pharmaceutical compositions, or vaccine compositions of the invention are used for the treatment or prophylaxis of streptococcus infection and/or diseases and symptoms mediated by streptococcus infection, in particular S. pneumoniae, group A streptococcus (pyogenes), group B streptococcus (GBS or agalactiae), dysgalactiae, uberis, nocardia as well as Staphylococcus aureus. In a further embodiment, the Streptococcus infection is S. pneumoniae.

In a particular embodiment, pharmaceutical compositions are administered to those individuals at risk of Streptococcus infection such as infants, elderly and immunocompromised individuals.

As used in the present application, the term “individuals” include mammals. In a further embodiment, the mammal is human.

Pharmaceutical compositions are preferably in unit dosage form of about 0.001 to 100 μg/kg (antigen/body weight) and more preferably 0.01 to 10 μg/kg and most preferably 0.1 to 1 μg/kg 1 to 3 times with an interval of about 1 to 6 week intervals between immunizations.

Pharmaceutical compositions are preferably in unit dosage form of about 0.1 μg to 10 mg and more preferably 1 μg to 1 mg and most preferably 10 to 100 μg 1 to 3 times with an interval of about 1 to 6 week intervals between immunizations.

It will be appreciated that the polynucleotide sequences illustrated in the figures may be altered with degenerate codons yet still encode the polypeptides of the invention. Accordingly the present invention further provides polynucleotides which hybridise to the polynucleotide sequences herein above described (or the complement sequences thereof) having 50% identity between sequences. In one embodiment, at least 70% identity between sequences. In one embodiment, at least 75% identity between sequences. In one embodiment, at least 80% identity between sequences. In one embodiment, at least 85% identity between sequences. In one embodiment, at least 90% identity between sequences. In a further embodiment, polynucleotides are hybridizable under stringent conditions i.e. having at least 95% identity. In a further embodiment, more than 97% identity.

Suitable stringent conditions for hybridation can be readily determined by one of skilled in the art (see for example Sambrook et al., (1989) Molecular cloning: A Laboratory Manual, 2nd ed, Cold Spring Harbor, N.Y.; Current Protocols in Molecular Biology, (1999) Edited by Ausubel F. M. et al., John Wiley & Sons, Inc., N.Y.).

In a further embodiment, the present invention provides polynucleotides that hybridise under stringent conditions to either

    • (a) a DNA sequence encoding a polypeptide or
    • (b) the complement of a DNA sequence encoding a polypeptide;
      wherein said polypeptide comprising a sequence chosen from SEQ ID 1, 2, 3, 90 to 115 or 141 to 148 or fragments or analogues thereof.

In a further embodiment, the present invention provides polynucleotides that hybridise under stringent conditions to either

    • (a) a DNA sequence encoding a polypeptide or
    • (b) the complement of a DNA sequence encoding a polypeptide;
      wherein said polypeptide comprising a sequence chosen from SEQ ID 1, 2, 3, 90 to 115 or 141 to 148.

In a further embodiment, the present invention provides polynucleotides that hybridise under stringent conditions to either

    • (a) a DNA sequence encoding a polypeptide or
    • (b) the complement of a DNA sequence encoding a polypeptide;
      wherein said polypeptide comprises at least 10 contiguous amino acid residues from a polypeptide comprising a sequence chosen from SEQ ID 1, 2, 3, 90 to 115 or 141 to 148 or fragments or analogues thereof.

In a further embodiment, the present invention provides polynucleotides that hybridise under stringent conditions to either

    • (a) a DNA sequence encoding a polypeptide or
    • (b) the complement of a DNA sequence encoding a polypeptide;
      wherein said polypeptide comprises at least 10 contiguous amino acid residues from a polypeptide comprising a sequence chosen from SEQ ID 1, 2, 3, 90 to 115 or 141 to 148.

As will be readily appreciated by one skilled in the art, polynucleotides include both DNA and RNA.

The present invention also includes polynucleotides complementary to the polynucleotides described in the present application.

In a further aspect, polynucleotides encoding polypeptides of the invention, or fragments, analogues or derivatives thereof, may be used in a DNA immunization method. That is, they can be incorporated into a vector which is replicable and expressible upon injection thereby producing the antigenic polypeptide in vivo. For example polynucleotides may be incorporated into a plasmid vector under the control of the CMV promoter which is functional in eukaryotic cells. Preferably the vector is injected intramuscularly.

According to another aspect, there is provided a process for producing polypeptides of the invention by recombinant techniques by expressing a polynucleotide encoding said polypeptide in a host cell, culturing said host cell under conditions suitable for expression of said polypeptide and recovering the expressed polypeptide product. Alternatively, the polypeptides can be produced according to established synthetic chemical techniques i.e. solution phase or solid phase synthesis of oligopeptides which are ligated to produce the full polypeptide (block ligation).

General methods for obtention and evaluation of polynucleotides and polypeptides are described in the following references: Sambrook et al, Molecular Cloning: A Laboratory Manual, 2nd ed, Cold Spring Harbor, N.Y., 1989; Current Protocols in Molecular Biology, Edited by Ausubel F. M. et al., John Wiley and Sons, Inc. New York; PCR Cloning Protocols, from Molecular Cloning to Genetic Engineering, Edited by White B. A., Humana Press, Totowa, N.J., 1997, 490 pages; Protein Purification, Principles and Practices, Scopes R. K., Springer-Verlag, New York, 3rd Edition, 1993, 380 pages; Current Protocols in Immunology, Edited by Coligan J. E. et al., John Wiley & Sons Inc., New York which are herein incorporated by reference.

For recombinant production, host cells are transfected with vectors which encode the polypeptide, and then cultured in a nutrient media modified as appropriate for activating promoters, selecting transformants or amplifying the genes. Suitable vectors are those that are viable and replicable in the chosen host and include chromosomal, non-chromosomal and synthetic DNA sequences e.g. bacterial plasmids, phage DNA, baculovirus, yeast plasmids, vectors derived from combinations of plasmids and phage DNA. The polypeptide sequence may be incorporated in the vector at the appropriate site using restriction enzymes such that it is operably linked to an expression control region comprising a promoter, ribosome binding site (consensus region or Shine-Dalgarno sequence), and optionally an operator (control element). One can select individual components of the expression control region that are appropriate for a given host and vector according to established molecular biology principles (Sambrook et al, Molecular Cloning: A Laboratory Manual, 2nd ed, Cold Spring Harbor, N.Y., 1989; Current Protocols in Molecular Biology, Edited by Ausubel F. M. et al., John Wiley and Sons, Inc. New York incorporated herein by reference). Suitable promoters include but are not limited to LTR or SV40 promoter, E. coli lac, tac or trp promoters and the phage lambda PL promoter. Vectors will preferably incorporate an origin of replication as well as selection markers i.e. ampicilin resistance gene. Suitable bacterial vectors include pET, pQE70, pQE60, pQE-9, pbs, pD10 phagescript, psiX174, pbluescript SK, pbsks, pNH8A, pNH16a, pNH18A, pNH46A, ptrc99a, pKK223-3, pKK233-3, pDR540, pRIT5 and eukaryotic vectors pBlueBacIII, pWLNEO, pSV2CAT, pOG44, pXT1, pSG, pSVK3, pBPV, pMSG and pSVL. Host cells may be bacterial i.e. E. coli, Bacillus subtilis, Streptomyces; fungal i.e. Aspergillus niger, Aspergillus nidulins; yeast i.e. Saccharomyces or eukaryotic i.e. CHO, COS.

Upon expression of the polypeptide in culture, cells are typically harvested by centrifugation then disrupted by physical or chemical means (if the expressed polypeptide is not secreted into the media) and the resulting crude extract retained to isolate the polypeptide of interest. Purification of the polypeptide from culture media or lysate may be achieved by established techniques depending on the properties of the polypeptide i.e. using ammonium sulfate or ethanol precipitation, acid extraction, anion or cation exchange chromatography, phosphocellulose chromatography, hydrophobic interaction chromatography, hydroxylapatite chromatography and lectin chromatography. Final purification may be achieved using HPLC.

The polypeptide may be expressed with or without a leader or secretion sequence. In the former case the leader may be removed using post-translational processing (see U.S. Pat. No. 4,431,739; U.S. Pat. No. 4,425,437; and U.S. Pat. No. 4,338,397 incorporated herein by reference) or be chemically removed subsequent to purifying the expressed polypeptide.

According to a further aspect, the Streptococcus polypeptides of the invention may be used in a diagnostic test for Streptococcus infection, in particular S. pneumoniae infection.

Several diagnostic methods are possible, for example detecting streptococcus organism in a biological sample, the following procedure may be followed:

a) obtaining a biological sample from a patient;

b) incubating an antibody or fragment thereof reactive with a Streptococcus polypeptide of the invention with the biological sample to form a mixture; and

c) detecting specifically bound antibody or bound fragment in the mixture which indicates the presence of streptococcus.

Alternatively, a method for the detection of antibody specific to a streptococcus antigen in a biological sample containing or suspected of containing said antibody may be performed as follows:

a) obtaining a biological sample from a patient;

b) incubating one or more Streptococcus polypeptides of the invention or fragments thereof with the biological sample to form a mixture; and

c) detecting specifically bound antigen or bound fragment in the mixture which indicates the presence of antibody specific to streptococcus.

One of skill in the art will recognize that this diagnostic test may take several forms, including an immunological test such as an enzyme-linked immunosorbent assay (ELISA), a radioimmunoassay or a latex agglutination assay, essentially to determine whether antibodies specific for the polypeptide are present in an organism.

The DNA sequences encoding polypeptides of the invention may also be used to design DNA probes for use in detecting the presence of streptococcus in a biological sample suspected of containing such bacteria. The detection method of this invention comprises:

a) obtaining the biological sample from a patient;

b) incubating one or more DNA probes having a DNA sequence encoding a polypeptide of the invention or fragments thereof with the biological sample to form a mixture; and

c) detecting specifically bound DNA probe in the mixture which indicates the presence of streptococcus bacteria.

The DNA probes of this invention may also be used for detecting circulating Streptococcus i.e. S. pneumoniae nucleic acids in a sample, for example using a polymerase chain reaction, as a method of diagnosing streptococcus infections. The probe may be synthesized using conventional techniques and may be immobilized on a solid phase, or may be labelled with a detectable label. A preferred DNA probe for this application is an oligomer having a sequence complementary to at least about 6 contiguous nucleotides of the streptococcus pneumoniae polypeptides of the invention.

Another diagnostic method for the detection of streptococcus in a patient comprises:

a) labelling an antibody reactive with a polypeptide of the invention or fragment thereof with a detectable label;

b) administering the labelled antibody or labelled fragment to the patient; and

c) detecting specifically bound labelled antibody or labelled fragment in the patient which indicates the presence of streptococcus.

A further aspect of the invention is the use of the Streptococcus polypeptides of the invention as immunogens for the production of specific antibodies for the diagnosis and in particular the treatment of Streptococcus infection.

Suitable antibodies may be determined using appropriate screening methods, for example by measuring the ability of a particular antibody to passively protect against streptococcus infection in a test model. One example of an animal model is the mouse model described in the examples herein. The antibody may be a whole antibody or an antigen-binding fragment thereof and may belong to any immunoglobulin class. The antibody or fragment may be of animal origin, specifically of mammalian origin and more specifically of murine, rat or human origin. It may be a natural antibody or a fragment thereof, or if desired, a recombinant antibody or antibody fragment. The term recombinant antibody or antibody fragment means antibody or antibody fragment which was produced using molecular biology techniques. The antibody or antibody fragments may be polyclonal, or preferably monoclonal. It may be specific for a number of epitopes associated with the Streptococcus pneumoniae polypeptides but is preferably specific for one.

A further aspect of the invention is the use of the antibodies directed to the streptococcus polypeptides of the invention for passive immunization. One could use the antibodies described in the present application.

The use of a polynucleotide of the invention in genetic immunization will preferably employ a suitable delivery method or system such as direct injection of plasmid DNA into muscles [Wolf et al. H M G (1992) 1: 363; Turnes et al., Vaccine (1999), 17: 2089; Le et al., Vaccine (2000) 18: 1893; Alves et al., Vaccine (2001) 19: 788], injection of plasmid DNA with or without adjuvants [Ulmer et al., Vaccine (1999) 18: 18; MacLaughlin et al., J. Control Release (1998) 56: 259; Hartikka et al., Gene Ther. (2000) 7: 1171-82; Benvenisty and Reshef, PNAS USA (1986) 83:9551; Singh et al., PNAS USA (2000) 97: 811], targeting cells by delivery of DNA complexed with specific carriers [Wa et al., J Biol Chem (1989) 264: 16985; Chaplin et al., Infect. Immun. (1999) 67: 6434], injection of plasmid complexed or encapsulated in various forms of liposomes [Ishii et al., AIDS Research and Human Retroviruses (1997) 13: 142; Perrie et al., Vaccine (2001) 19: 3301], administration of DNA with different methods of bombardment [Tang et al., Nature (1992) 356: 152; Eisenbraun et al., DNA Cell Biol (1993) 12: 791; Chen et al., Vaccine (2001) 19: 2908], and administration of DNA with lived vectors [Tubulekas et al., Gene (1997) 190: 191; Pushko et al., Virology (1997) 239: 389; Spreng et al. FEMS (2000) 27: 299; Dietrich et al., Vaccine (2001) 19: 2506].

According to one aspect, the present invention provides the use of an antibody for prophylaxis and/or treatment of streptococcus infections.

According to one aspect, the present invention provides the use of the pharmaceutical composition of the invention for the prophylactic or therapeutic treatment of Streptococcal infection in an animal susceptible to or infected with streptococcal infection comprising administering to said animal a prophylactic or therapeutic amount of the composition.

In a further embodiment, the invention provides the use of a pharmaceutical composition of the invention in the manufacture of a medicament for the prophylactic or therapeutic treatment of streptococcus infection.

In a further embodiment, the invention provides a kit comprising a polypeptide of the invention for detection or diagnosis of streptococcus infection.

Unless otherwise defined, all technical and scientific terms used herein have the same meaning as commonly understood by one of ordinary skill in the art to which this invention belongs. All publications, patent applications, patents, and other references mentioned herein are incorporated by reference in their entirety. In case of conflict, the present specification, including definitions, will control. In addition, the materials, methods, and examples are illustrative only and not intended to be limiting.

EXAMPLE 1

This example describes the bacterial strains, plasmids, PCR primers, recombinant proteins and hybridoma antibodies used herein.

S. pneumoniae SP64 (serogroup 6) and SP63 (serogroup 9) clinical isolates were provided by the Laboratoire de la Santé Publique du Québec, Sainte-Anne-de-Bellevue; Rx1 strain, a nonencapsulated derivative of the type 2 strain D39 and the type 3 strain WU2 were provided by David E. Briles from University of Alabama, Birmingham and the type 3 clinical isolate P4241 was provided by the Centre de Recherche en Infectiologie du Centre Hospitalier de l'Université Laval, Sainte-Foy. E. coli strains DH5α (Gibco BRL, Gaithesburg, Md.); AD494 (λDE3) (Novagen, Madison, Wis.) and BL21 (λDE3) (Novagen) as well as plasmid superlinker pSL301 vector (Invitrogen, San Diego, Calif.); pCMV-GH vector (gift from Dr. Stephen A. Johnston, Department for Biochemistry, University of Texas, Dallas, Tex.); pET32 and pET21 (Novagen) and pURV22.HIS expression vectors (FIG. 30) were used in this study. The pURV22.HIS vector contains a cassette of the bacteriophage λ cI857 temperature-sensitive repressor gene from which the functional PR promoter has been deleted. The inactivation of the cI857 repressor by a temperature increase from the range of 30-37° C. to 37-42° C. results in the induction of the gene under the control of promoter λPL. The PCR primers used for the generation of the recombinant plasmids had a restriction endonuclease site at the 5′ end, thereby allowing directional cloning of the amplified product into the digested plasmid vector.

Molecular biology techniques were performed according to standard methods. See for example, Sambrook, J., Fritsch, E. F., Maniatis, T., “Molecular cloning. A laboratory manual” Vol.1-2-3 (second edition) Cold Spring Harbour Laboratory Press, 1989, New York, which is herein incorporated by reference. PCR-amplified products were digested with restriction endonucleases and ligated to either linearized plasmid pSL301, pCMV-GH, pET or pURV22.HIS expression vector digested likewise or digested with enzymes that produce compatible cohesive ends. Recombinant pSL301 and recombinant pCMV-GH plasmids were digested with restriction enzymes for the in-frame cloning in pET expression vector. When pET vectors were used, clones were first stabilized in E. coli DH5α before introduction into E. coli BL21(λDE3) or AD494 (λDE3) for expression of full-length or truncated BVH-3 (SEQ ID NO:7), BVH-11 (SEQ ID NO:8) or BVH-11-2 (SEQ ID NO:9) molecules. Each of the resultant plasmid constructs was confirmed by nucleotide sequence analysis. The recombinant proteins were expressed as N-terminal fusions with the thioredoxin and His-tag (pET32 expression system); as C-terminal fusions with an His-tag (pET21 expression system); or as N-terminal fusions with an His-tag (pURV22.HIS expression system). The expressed recombinant proteins were purified from supernatant fractions obtained after centrifugation of sonicated IPTG- (pET systems) or heat- (pURV22.HIS) induced E. coli using a His-Bind metal chelation resin (QIAgen, Chatsworth, Calif.). The gene products generated from S. pneumoniae SP64 are listed in the following Table 1. The gene fragment encoding BVH-3-Sp63 protein was generated from S. pneumoniae SP63 using the PCR-primer sets OCRR479-OCRR480 and the cloning vector pSL301. The recombinant pSL301-BVH-3Sp63 was digested for the in-frame cloning in pET32 vector for the expression of the BVH-3-Sp63 molecule.

TABLE 1
Lists of truncated BVH-3, BVH-11, BVH-11-2 and
Chimeric gene products generated from S. pneumoniae SP64
Protein Encoded amino acids Cloning SEQ ID
designation Identification (SEQ ID No 7, 8 or 9) vector NO:
BVH-3M BVH-3 w/o ss  21-1039 pSL301 14
BVH-3AD BVH-3 N′end w/o ss 21-509 pSL301 15
L-BVH-3AD BVH-3 N′end  1-509 pET-21(+) 16
BVH-3B BVH-3 C′end 512-1039 pSL301 17
BVH-3C BVH-3 N′end w/o ss 21-225 pET-32c(+) 18
BVH-11M BVH-11 w/o ss 20-840 pCMV-GH 19
BVH-11A BVH-11 N′end w/o ss 20-353 pET-32c(+) 20
BVH-11B BVH-11 C′end 354-840  pET-32a(+) 21
BVH-11C BVH-11 C′end 228-840  pET-32a(+) 22
NEW1 BVH-3 C′end 472-1039 pET-21b(+) 23
NEW2 BVH-3 C′end 472-800  pET-21b(+) 24
NEW3 BVH-3 C′end 800-1039 pET-21b(+) 25
NEW4 BVH-11 C′end 286-840  pET-21d(+) 26
NEW5 BVH-11 internal 286-713  pET-21d(+) 27
NEW6 BVH-11 internal 672-792  pET-21d(+) 28
NEW7 BVH-11 C′end 709-840  pET-21d(+) 29
NEW8 BVH-11 internal 286-511  pET-21d(+) 30
NEW9 BVH-11 internal 511-713  pET-21d(+) 31
BVH-11-2M BVH-11-2 w/o ss 20-838 pSL301 32
NEW10 BVH-11-2 C′end 271-838  pET-21d(+) 33
NEW11 BVH-11-2 C′end 699-838  pET-21d(+) 34
NEW13 BVH-11 C′end 354-840  pET-21b(+) 35
NEW14 BVH-11-2 internal 227-699  pET-21d(+) 36
NEW15 BVH-3 N′end w/o ss 21-800 pET-21b(+) 37
NEW16 BVH-11 N′end w/o ss 20-709 pET-21d(+) 38
NEW18 BVH-11-2 internal 227-520  pET21d(+) 39
NEW19 BVH-11-2 C′end 497-838  pET21d(+) 40
NEW21 BVH-3 C′end 396-1039 pET21b(+) 41
NEW22 BVH-3 internal 233-446  pET-21a(+) 42
NEW23 BVH-3 internal 398-509  pET-21b(+) 43
NEW24 BVH-11-2 C′end 227-838  pET-21d(+) 44
NEW25 BVH-3 C′end 233-1039 pET-21b(+) 45
NEW12 Chimera* M- NEW 1 -KL - pET 21b(+) 46
NEW 13
NEW17 Chimera* M- NEW 5 -GP - pET 21d(+) 47
NEW 1
NEW20 Chimera* M- NEW 1 -GP - pET 21d(+) 48
NEW 5
NEW26 Chimera* M- NEW 10 -GP - pET 21d(+) 49
NEW 25
NEW27 Chimera* M- NEW 19 -GP - pET 21d(+) 50
NEW 25
NEW28 Chimera* M- NEW 10 -GP - pET 21d(+) 51
NEW 1
NEW29 Chimera* M- NEW 5 -GP - pET 21d(+) 52
NEW 25
NEW30 Chimera* M- NEW 4 -GP - pET 21d(+) 53
NEW 25
NEW31 Chimera* M- NEW 4 -GP - pET 21d(+) 54
NEW 1
NEW32 Chimera* M- NEW 19 -GP - pET 21d(+) 55
NEW 1
w/o ss: without signal sequence. Analysis of the BVH-3, BVH-11 and BVH-11-2 protein sequences suggested the presence of putative hydrophobic leader sequences.
*encoded amino acids for the chimeras are expressed as the gene product, additional non essential amino acids residue were added
M is methionine,
K is lysine,
L is leucine,
G is glycine and
P is proline.

Monoclonal antibody (Mab)-secreting hybridomas were obtained by fusions of spleen cells from immunized mice and non-secreting, HGPRT-deficient mouse myeloma SP2/0 cells by the methods of Fazekas De St-Groth and Scheidegger (J Immunol Methods 35: 1-21, 1980) with modifications (J. Hamel et al. J Med Microbiol 23 163-170, 1987). Female BALB/c mice (Charles River, St-Constant, Quebec, Canada) were immunized with either BVH-3M (thioredoxin-His•Tag-BVH-3M fusion protein/pET32 system), BVH-11M (thioredoxin-His•Tag-BVH-11M fusion protein/pET32 system), BVH-11-2M (thioredoxin-His•Tag-BVH-11-2M fusion protein/pET32 system), BVH-11B (thioredoxin-His•Tag-BVH-11B fusion protein/pET32 system), BVH-3M (His•Tag-BVH-3 fusion protein/pURV22.HIS system) or NEW1 (NEW1-His•Tag fusion protein/pET21 system) gene products from S. pneumoniae strain SP64 to generate the Mab series H3-, H11-, H112-, H11B-, H3V-, and HN1-, respectively. Culture supernatants of hybridomas were initially screened by enzyme-linked-immunoassay (ELISA) according to the procedure described by Hamel et al. (Supra) using plates coated with preparations of purified recombinant BVH-3, BVH-11 and/or BVH-11-2 proteins or suspensions of heat-killed S. pneumoniae cells. The class and subclass of Mab immunoglobulins were determined by ELISA using commercially available reagents (Southern Biotechnology Associates, Birmingham, Ala.).

Furthermore, the cloning and expression of chimeric gene(s) encoding for chimeric polypeptides and the protection observed after vaccination with these chimeric polypeptides are described.

BVH-3 and BVH-11 gene fragments corresponding to the 3′ end of the genes were amplified by PCR using pairs of oligonucleotides engineered to amplify gene fragments to be included in the chimeric genes. The primers used had a restriction endonuclease site at the 5′ end, thereby allowing directional in-frame cloning of the amplified product into digested plasmid vectors. PCR-amplified products were digested with restriction endonucleases and ligated to linearized plasmid pET21 or pSL301 vector. The resultant plasmid constructs were confirmed by nucleotide sequence analysis. The recombinant pET21 plasmids containing a PCR product were linearized by digestion with restriction enzymes for the in-frame cloning of a second DNA fragment and the generation of a chimeric gene encoding for a chimeric pneumococcal protein molecule. Recombinant pSL301 plasmids containing a PCR product were digested with restriction enzymes for the obtention of the DNA inserts. The resulting insert DNA fragments were purified and inserts corresponding to a given chimeric gene were ligated into pET21 vector for the generation of a chimeric gene. The recombinant chimeric polypeptides were as C-terminal fusion with an His-tag. The expressed recombinant proteins were purified from supernatant fractions obtained from centrifugation of sonicated IPTG-induced E. coli cultures using a His-Bind metal chelation resin (QIAgen, Chatsworth, Calif.).

Groups of 8 female BALB/c mice (Charles River) were immunized subcutaneously two times at three-week intervals with 25 μg of either affinity purified His•Tag-fusion protein identifed in presence of 15-20 μg of QuilA adjuvant. Ten to 14 days following the last immunization, the mice were challenged challenged intravenously with 10E5-10E6 CFU of S. pneumoniae type 3 strain WU2.

EXAMPLE 2

This example describes the identification of peptide domains carrying target epitopes using Mabs and recombinant truncated polypeptides described in example 1.

Hybridomas were tested by ELISA against truncated BVH-3, BVH-11 or BVH-11-2 gene products in order to characterize the epitopes recognized by the Mabs. The truncated gene products were generated from S. pneumoniae SP64 strain except for BVH-3-Sp63 which was generated from S. pneumoniae SP63 strain. As a positive control, the reactivity of each antibody was examined with full-length BVH-3, BVH-11 or BVH-11-2 recombinant proteins. In some cases, the Mab reactivity was evaluated by Western immunoblotting after separation of the gene product by SDS-PAGE and transfer on nitrocellulose paper.

BVH-3-reactive Mabs can be divided into two groups BVH-3A- and BVH-3B-reactive Mabs with the exception of Mabs H11-7G11 and H3V-15A10 which reacted with both, BVH-3A and BVH-3B molecules. The BVH-3A-reactive Mabs can be subdivided in two subgroups of antibodies depending of their reactivity or lack of reactivity with BVH-3C recombinant protein. Mab reactive with BVH-3C protein recognized epitopes shared by both, BVH-3 and BVH-11 proteins. These BVH-3- and BVH-11-cross-reactive Mabs were also reactive with BVH-11A and BVH-11-2M recombinant proteins. BVH-3B-reactive Mabs can be subdivided into three subgroups according to their reactivity with NEW1, NEW2 and NEW3 recombinant proteins. Some Mabs were only reactive with the NEW1 protein while other Mabs were reactive with either, NEW1 and NEW2 or NEW1 and NEW3 recombinant proteins.

Mabs H11-7G11 and H3V-15A10 react with epitopes in more than one position on BVH-3. The reactivity of H11-7G11 with BVH-3AD, BVH-3B, BVH-3C, BVH-11A and BVH-11-2M molecules suggests that H11-7G11 epitope might comprised HXXHXH sequence. This sequence is repeated, respectively, 6 and 5 times in BVH-3 (see SEQ ID NO: 159) and BVH-11/BVH-11-2 protein sequences. The lack of reactivity of Mab H11-7G11 with NEW 10 molecule suggests that the epitope includes the HGDHXH sequence (see SEQ ID NO: 160). Multiple-position mapping of H3V-15A10 epitope on BVH-3 is suggested by the reactivity of the Mab with two BVH-3 fragments that do not overlap.

Interestingly, Mabs H3-7G2, H3V-9C6 and H3V-16A7 were not reactive with BVH-3 Sp63 thus allowing the location of their corresponding epitopes on a 177-amino acid fragment comprised between amino acids 244 and 420 on BVH-3 molecule of S. pneumoniae SP64.

The Mabs that are reactive with BVH-11- and/or BVH-11-2 and that do not recognize BVH-3 molecules can be divided into three groups according to their reactivities with BVH-11A and NEW10 recombinant proteins. Some Mabs reacted exclusively with either BVH-11A or NEW10 protein while other Mabs were reactive with both, BVH-11A and NEW10 recombinant proteins.

Furthermore, the peptide sequences obtained from the screening of BVH-3 and BVH-11-2 gene libraries with the Mabs are in agreement with the Mab ELISA reactivities against the truncated gene products. As expected, the amino acid sequences obtained from H11-7G11 contained the sequence HGDHXH (SEQ ID NO: 160). These findings provide additional evidence for the location of epitopes recognized with the Mabs. Interestingly, although the Mabs H112-10G9, H112-10A2 and H11B-11B8 were reactive against the same peptide sequence (amino acid residues 594 to 679 on BVH-11-2 protein sequence), clones corresponding to the sequence spanning from amino acid residues 658 to 698 were only picked up by Mab H11B-11B8 thus revealing the location of H11B-11B8 epitope between amino acid residues 658 to 679. Mabs H112-10G9, H112-10A2, and H11B-11B8 are directed against 3 distinct non overlapping epitopes located closely on the peptide sequence corresponding to amino acid residues 594 to 679.

EXAMPLE 3

This example describes truncated variant BVH-3 gene products generated from S. pneumoniae SP64

Further BVH-3 fragments or variants thereof were designed in the purpose to develop a universal highly effective vaccine that would target the immune response to ubiquitous surface-exposed protective epitopes. BVH-3 gene fragments designated NEW1 (encoding amino acid residues 472 to 1039 from SEQ ID NO: 7) and NEW40 (encoding amino acid residues 408 to 1039 from SEQ ID NO: 7) were amplified from the S. pneumoniae strain SP64 by PCR using pairs of oligonucleotides engineered for the amplification of the appropriate gene fragment.

TABLE 2
List of truncated variant BVH-3 gene products
generated from S. pneumoniae SP64
Protein Gene/Protein
designation SEQ ID NO Protein Identification*
NEW1-mut1** 56 NEW1
NEW35A 57 NEW1 550-SGDGTS-555
NEW42 58 NEW40  55-SGDSNS-60 144-SGDGTS-149
NEW49 59 NEW40  55-SGDHNH-60
NEW50 60 NEW40  55-SGDSNH-60
NEW51 61 NEW40  55-SGDHNH-60 144-SGDHHH-149
NEW52 62 NEW40  55-SGDSNH-60 144-SGDGHH-149
NEW53 63 NEW40  55-HGDHNH-60 144-SGDHHH-149
NEW54 64 NEW40  55-HGDHNH-60 144-SGDGHH-149
NEW55 65 NEW1 550-HGDGHH-555
NEW56 66 NEW40  55-HGDSNH-60 144-SGDHHH-149
NEW56-mut2** 67 NEW56
NEW56-mut3** 68 NEW56
NEW57 69 NEW40  55-HGDHNS-60 144-SGDHHH-149
NEW63 70 NEW40  55-HGDSNH-60 144-HGDHHH-149
NEW64 71 NEW40  55-HGDHNS-60 144-HGDHHH-149
NEW65 72 NEW40  55-HGDSNH-60 144-HGDGHH-149
NEW66 73 NEW40  55-HGDHNS-60 144-HGDGHH-149
NEW76 74 NEW40  55-HGDHNS-60 144-SGDGHH-149
NEW105 75 NEW40  55-      -60
NEW106 76 New40 144-      -149
NEW107 77 NEW40  55-      -60 144-      -149
*The underlined amino acid residues represent the modification in protein sequence. Nucleotides/amino acid residues are deleted in NEW105, NEW106 and NEW107 constructs.
**silent mutation, i.e. the polypeptide is the same as New1 or New56.

EXAMPLE 4

This example describes NEW43 variant gene products generated from S. pneumoniae SP64.

Four BVH-11-2 gene segments were fused together to generate New43 gene and protein molecule. Restriction enzymes SpeI, SacII and KpnI allowed the directional in-frame cloning of the fragments. In a series of New43-related molecules (see in Table 4, New133, New134, New135, New139, New139Y, New142, New143 and New144), mutagenesis steps were performed to modify the pairs of codons created by the addition of the resctriction sites at each junction site of the four BVH-11-2 regions. Variants from NEW43 (SEQ ID NO: 11) were generated by mutagenesis using the Quickchange Site-Directed Mutagenesis kit from Stratagene and the oligonucleotides designed to incorporate the appropriate mutation. The presence of 6 histidine tag residues on the C-terminus of the recombinant molecules simplified the purification of the proteins by nickel chromatography. The following table 3 describes the NEW43 variant gene products generated.

TABLE 3
List of NEW43 variant gene products
generated from S. pneumoniae SPG4
Gene used
Polypeptide Polypeptide Polypeptide PCR for
designation SEQ ID NO identification* primer set mutagenesis
NEW60 78 NEW43 109-SYDHYH-114 1 NEW43
NEW61 79 NEW43 109-HYDSYH-114 26 NEW43
NEW62 80 NEW43 109-HYDHYS-114 27 NEW43
NEW80 81 NEW43 109-SYDSYH-114 2 NEW60
NEW81 82 NEW43 109-SYDSYS-114 3 NEW80
NEW82 83 NEW43 109-HYDSYS-114 29 NEW61
NEW83 84 NEW43 109-SYDHYS-114 30 NEW60
NEW84 85 NEW43 109-SKDHYH-114 31 NEW60
NEW85 86 NEW43 109-HKDSYH-114 32 NEW61
NEW88D1 87 NEW43 109-  DHYH-114 33 NEW43
NEW88D2 88 NEW43 109-    YH-114 34 NEW88D1
NEW88 89 NEW43 109-      -114 35 NEW88D2
*The underlined amino acid residues represent the modification in protein sequence. Nucleotides/amino acid residues are deleted in NEW88D1, NEW88D2 and NEW88 constructs.

EXAMPLE 5

This example describes the cloning and expression of chimeric gene(s) encoding for chimeric polypeptides.

BVH-3 and BVH-11 gene fragments corresponding to the 3′ end of the genes were amplified by PCR using pairs of oligonucleotides engineered to amplify gene fragments to be included in the chimeric genes. The primers used had a restriction endonuclease site at the 5′ end, thereby allowing directional in-frame cloning of the amplified product into digested plasmid vectors. PCR-amplified products were digested with restriction endonucleases and ligated to linearized plasmid pET21 or pSL301 vector. The resultant plasmid constructs were confirmed by nucleotide sequence analysis. The recombinant pET21 plasmids containing a PCR product were linearized by digestion with restriction enzymes for the in-frame cloning of a second DNA fragment and the generation of a chimeric gene encoding for a chimeric pneumococcal protein molecule. Recombinant pSL301 plasmids containing a PCR product were digested with restriction enzymes for the obtention of the DNA inserts. The resulting insert DNA fragments were purified and inserts corresponding to a given chimeric gene were ligated into pET21 vector for the generation of a chimeric gene. The recombinant chimeric polypeptides listed in Table 4 were as C-terminal fusion with an His-tag. The expressed recombinant proteins were purified from supernatant fractions obtained from centrifugation of sonicated IPTG-induced E. coli cultures using a His-Bind metal chelation resin (QIAgen, Chatsworth, Calif.).

TABLE 4
Chimera constructions
Chimeras
with BVH-11 SEQ ID
and BVH-3 Polypeptide SEQ NO
New 108 M*-New56-G*P*-New88 90
New 109 M*-New88-G*P*-NEW56 91
New 133 New 43 Spe1  GG 92
New 134 New 43 Kpn1  GG 93
New 135 New 43 Spe1, SacII, Kpn1  GG 94
New 136 New 43 109-HHDHYH-114 1
New 136Y New 43 109-HHDHYY-114 95
New 136Y1 New 43 109-YHDHYY-114 96
New 137 New 43 109-HYDHHH-114 97
New 138 New 43 109-HHDHHH-114 98
New 139 New 136 Spe1, SacII, Kpn1  GG 2
New 139Y New 136Y Spe1, SacII, Kpn1  GG 99
New 142 New 88 Spe1  GG 100
New 143 New 88 Kpn1  GG 101
New 144 New 88 Spe1, SacII, Kpn1  GG 102
New 145 New88-GG-New56 103
New 146 New144-GG-New 56 104
New 147 New139-GG-New56 3
New 148 New140-GG-New56 105
New 149 New141-GG-New56 106
New 150 New139Y-GG-New56 107
New 150 A M*-New136-G*P*-New56 108
New 150 B M*-New136-G*G*-New56 109
New 150 C M*-VP56-G*P*-New136 110
New 150 D M*-VP56-G*G*-New136 111
New 150 E M*-VP56-G*P*-New139 112
New 150 F M*-VP56-G*G*-New139 113
New 150 G M*-New139-G*G*-VP56 114
New 150 H M*-New139-G*P*-VP56 115
*OPTIONAL AMINO ACID
M: met;
G: gly;
P: pro

EXAMPLE 6

This example describes an ELISA reactivity experiment made with protective Mab:

The reactivity of the molecules was evaluated by ELISA using a panel of monoclonal antibodies (Mabs) raised against BVH-11-2 (Mabs H112-10A2, H112-14H6, H112-10G9, H112-10C5, H56-10B11, H112-4G9, H11B-11B8, H11B-13D5). The results are presented in Table 5 and Table 6 (Example 7). The improvement in the reactivity of Mab-epitopes was demonstrated by the significant increase in Elisa signals of some Mabs with New136, New139 and New147 in comparison to those obtained with New43 antigen.

TABLE 5
Elisa reactivity with protective Mab
Molecules Elisa reactivity with protective Mab
(SEQ ID No) H112-10G9 H112-10A2 H11B-11B8 H56-10B11
New 43 (HYDHYD) (11) 2+ 4+ 2+ 4+
New 88 (—————) (89) 2+ 1+ 0 0
→ to be inserted in VP109
New 136 (HHDHYH) (95) 4+ 4+ 4+ 4+
NEW 139 (HHDHYH)-GG 4+ 4+ 4+ 4+
(100) → to be inserted in VP147
NEW 147 (HHDHYH)-GG (107) 4+ 4+ 4+ 4+

EXAMPLE 7

The reactivity of the New43-derived molecules was evaluated by ELISA using a panel of monoclonal antibodies (Mabs) raised against BVH-11-2 (Mabs H112-10A2, H112-14H6, H112-10G9, H112-10C5, H56-10B11, H112-4G9, H11B-11B8, H11B-13D5) antigens and mouse or monkey sera.

TABLE 6
Antigenic properties of New43-derived molecules in ELISA
Mouse Monkey Monkey Monkey
anti- anti- anti- anti-
New 41 New 19 New 19 New 43
New43- Sp 327 Sp 335 Sp 335 Sp 335
derived TB2 Gr D 5066CQ C93072F C93005F
molecules H112- H112- H11B- H56- Diluted TB3a TB3a TB3a
(SEQ ID No) Polypeptide sequence 10G9 10A2 11B8 10B11 1/10000 1/12500 1/12500 1/12500
New 43 (11) BVH11-2 internal chimeric 1.570 3.960 0.702 1.118 3.036 0.912 0.678 1.417
109- HYDHYH-114
with internal sites Spe1-SacII-
Kpn1
New 60 (78) New 43 109- SYDHYH-114 2.740 0.647 0.432 0.856
New 133 (92) New 43 Spe1  GG 3.196 0.910 0.692 1.396
New 134 (93) New 43 Kpn1  GG 3.107 0.947 0.698 1.379
New 135 (94) New 43 Spe1, SacII, 3.294 0.968 0.669 1.368
Kpn1  GG
New 136 (1 New 43 109- HHDHYH-114 1.518 3.944 1.566 1.231 3.333 1.029 0.713 1.201
New 136Y (95) New 43 109- HHDHYY-114 3.316 0.888 0.562 0.712
New 136Y1 New 43 109- YHDHYY-114 2.847 0.696 0.433 0.618
(96)
New 137 (97) New 43 109- HYDHHH-114 3.121 1.028 0.733 1.422
New 138 (98) New 43 109- HHDHHH-114 2.955 1.058 0.701 0.982
New 139 (2) New 136 Spe1, SacII, Kpn1 1.564 3.915 1.790 1.089 3.167 1.022 0.684 0.984
 GG
New 139Y New 136Y Spe1, Sac11, Kpn1 3.070 0.728 0.452 0.599
(99)  GG
New 86 (149) New 43 HHH Sma1 2.664 0.633 0.383 0.604
New 88 (89) New 43 HHH deletion 0.755 3.960 0.062 0.057 1.975 0.549 0.423 0.551
New 142 (100) New 88 Spe1  GG 2.049 0.757 0.586 0.804
New 143 (101) New 88 Kpn1  GG 2.044 0.629 0.444 0.621
New 144 (102) New 88 Spe1, SacII, 2.280 0.638 0.440 0.613
Kpn1  GG
VP 109 (91) New88-GP-New 56 1.570 3.960 0.057 0.064 2.554 0.773 0.351 0.593
New 145 (103) New88-GG-New56 1.064 3.958 0.058 0.088 2.770 0.863 0.444 0.693
New 146 (104) New144-GG-New 56 1.162 3.691 0.065 0.072
New 56 (12) New 40 (472-1039) HSH 0.052 0.075 0.055 0.067 0.169 0.276 0.396 0.173
SHHH
New 90 (150) New43-GP-New56 3.838 1.594 1.122 2.113
New 147 (3) New139-GG-New56 1.950 3.960 2.132 1.394 3.820 1.507 0.865 1.490
New 148 (105) New140-GG-New56
New 149 (106) New141-GG-New56 1.993 3.959 0.878 1.795
New 150 (107) New139Y-GG-New56

EXAMPLE 8

This example illustrates that immunization with chimeric vaccine VP147 generates protective immunity against lethal experimental pneumococcal disease.

Previous studies have clearly established that pneumococcal BVH-3 and BVH-11-2 proteins were simultaneously expressed at the surface of the bacteria and elicited protective immune responses when used as immunogens. To generate the VP147 vaccine molecule, the DNA region corresponding to the conserved surface exposed protective region from BVH-3 (called VP56) was fused in-frame at the 5′ end with four conserved gene regions from BVH-11-2 (called VP139; SEQ ID NO:2)(FIG. 5). The chimeric VP147 molecule was made from one BVH-3 and four BVH-11-2 fragments linked at junction sites by pairs of glycine residues which are known to facilitate movement (gene and protein sequences correspond to SEQ ID NO:3 and 4, respectively).

Groups of 8 female BALB/c mice (Charles River, St-Constant, Canada) were immunized subcutaneously three times at three-week intervals with 5 to 25 μg of recombinant protein in presence of QuilA (Cedarlane Laboratories Ltd, Hornby, Canada) or Alhydrogel® (AlOH) adjuvant or, as control, with adjuvant alone in PBS. Blood samples were collected from the orbital sinus on day 1, 22 and 43 prior to each immunization and seven days (day 50) following the third injection. Five to seven days later, the mice were challenged with varying CFU numbers (from 103 to 105CFU) of the type 3 S. pneumoniae strain P4241 in order to evaluate the protection conferred by vaccination. Samples of the S. pneumoniae challenge inoculum were plated on chocolate agar plates to determine the CFU and to verify the challenge dose. Deaths were recorded for a period of 14 days and on day 14 post-challenge, the surviving mice were sacrificed and blood samples tested for the presence of S. pneumoniae organisms.

The survival data are shown in Table 7A. In these experiments, all control mice injected with adjuvant alone succumbed to infection while significant protection against deadly infection was observed in mice vaccinated with VP56 or VP139 and other New43 derivative molecules. The significant difference in VP56 and VP147 survival curves (Experiment 4 from Table 7A) indicated that VP147 could generate better immune responses than VP56. Moreover, the higher survival rate observed in experiment 5 (Table 7A) corresponds to mice vaccinated with VP147 with 6 out of 8 survivors thus suggesting that the VP147 protein affords equivalent if not superior protection than a combination of VP56 and VP139. These data indicated that VP147 could be a very useful antigen to prevent pneumococcal disease in humans.

The superiority of VP147 over VP56 was also demonstrated by performing standard immunoassays such as ELISA, Western immunoblotting and flow cytometry using sera from mice immunized with Alhydrogel® or QuilA adjuvanted vaccine formulations. These studies clearly indicated that immunization with recombinant VP147 protein produced in E. coli elicited antibodies reactive with recombinant and native pneumococcal BVH-3 and BVH-11-2 protein antigens as opposed to VP56 which generated exclusively BVH-3-reactive antibodies. Flow cytometry studies allowed the detection of the antibodies that bound specifically to surface exposed epitopes on the pneumococcal cells. Because opsonophagocytosis is a major mechanism of protection against pneumococcal infection, the antibodies detected in flow cytometry would likely be the most biologically relevant antibodies. The fluorescence index derived from flow cytometric evaluation of anti-VP147 antibodies was significantly greater to that detected with anti-VP56 antibodies (Table 7B). The binding to both, BVH-3 and BVH-11-2, surface proteins was confirmed in inhibition cytometric studies using VP56, VP139 and VP147 as inhibitors. Preincubation of serum raised to VP147 with soluble VP147 completely blocked the antibody surface labeling while partial inhibition (40 to 74% inhibition) was observed when soluble VP56 or New 139 was used. In contrast, VP56 and VP147 proteins were able to completely eliminate the binding of anti-VP56 antibody with no significant inhibition with New139, as expected. Altogether these results indicate an improvement in surface epitope labeling afforded by antibodies raised to VP147 over those generated to VP56 and support the use of VP147 as vaccine for the protection of humans from pneumococcal disease.

TABLE 7A
Protection mediated by recombinant VP147 in
experimental pneumococcal pneumonia.
Experiment Immunogen Alive:Dead Days to death post-infection P valuesa
1 QuilA alone 0:8 4, 5, 5, 5, 5, 6, 6, 6
New 43 7:1 9, 7 X >14 <0.0001
New 135 8:0 8 X >14 <0.0001
New 136 8:0 8 X >14 <0.0001
New 137 7:1 8, 7 X >14 <0.0001
New 138 8:0 8 X >14 <0.0001
2 QuilA alone 0:8 4, 4, 4, 4, 4, 5, 5, 5
New 135 8:0 8 X >14 <0.0001
New 139 6:2 5, 6, >14, >14, >14, >14, >14, >14 0.0003
QuilA alone 0:8 4, 4, 4, 4, 4, 5, 5, 5
3 VP56 8:0 8 X >14 <0.0001
VP147 6:2 6, 7, >14, >14, >14, >14, >14, >14 <0.0001
4 AlOH alone 0:8 4, 4, 4, 4, 4, 5, 5, 5
VP56 1:7 5, 5, 5, 5, 5, 5, 6, >14 0.012
VP147 4:4 5, 6, 7, 9, >14, >14, >14, >14 0.0005b
5 AlOH alone 0:8 4, 4, 5, 5, 5, 5, 5, 5
VP56 4:3 4, 5, 5, >14, >14, >14, >14 0.040
VP139 2:6 4, 5, 5, 5, 6, 6, >14, >14 0.047
VP56 + 4:3 5, 5, 5, >14, >14, >14 0.011
VP139
VP147 6:2 6, 7, >14, >14, >14, >14, >14, >14 0.008
aFor statistical analysis, P values were calculated using the logrank test to compare the survival curves for immunized mice to controls injected with adjuvant alone.
bThere was a significant difference (P = 0.031) between VP147 and VP56 survival curves.

TABLE 7B
Comparison of surface antibody labeling obtained
with antibodies raised against VP56 and VP147 formulated to
Alhydrogel or QuilA and percentage inhibition values using
VP56, New 139 and VP147 competitors demonstrating the
specificity of the surface labeling antibody for BVH-3
(VP56) or BVH-11-2 (New139) epitopes.
Mouse serum competitor Fluorescence Indexa % inhibition
rVP56-QuilA None 13.47
(mouse 1) New139 13.44 0.2
VP56 0.04 99.7
VP147 0.07 99.5
rVP56-QuilA None 16.90
(mouse 2) New139 NAb
VP56 0.03 99.8
VP147 0.11 99.3
rVP147-QuilA None 24.59
(mouse 1) New139 14.43 41.3
VP56 7.85 68.1
VP147 0.07 99.7
rVP147-QuilA None 25.06
(mouse 2) New139 14.86 40.7
VP56 6.48 74.1
VP147 0.09 99.6
rVP56-AlOH None 11.09
(mouse 1) New139 11.15 0.0
VP56 0.03 99.7
VP147 0.05 99.6
rVP56-AlOH None 13.25
(mouse 2) New139 14.55 0.0
VP56 0.00 100.0
VP147 0.00 100.0
rVP147-AlOH None 18.78
(mouse 1) New139 8.67 53.8
VP56 9.43 50.0
VP147 0.06 99.7
rVP147-AlOH None 16.27
(mouse 2) New139 8.18 49.7
VP56 6.25 61.6
VP147 0.04 99.8
aThe background value (Fl = 1.00) obtained with conjugate alone was subtracted from the test values.
bNA, not available data

EXAMPLE 9

This example illustrates the generation of chimeric gene products made from BVH-3 and BVH-11-2 fragments linked to each other by peptide linkers.

Replacement in the chimeric VP147 of the glycine residues at the junction sites between the BVH-3 and BVH-11-2 gene fragments resulted in variant forms which could differ in protein production, protein stability, antigenicity, immunogenicity and biological activity such as protective immunity. Here, we report the generation of sequence linkers to modify the fusion sites located at amino acid residues 223-224 and residues 273-274 of the VP147 molecule (SEQ ID NO:3).

Table 8 describes the sequences of the linkers generated during this study. Linkers R1, R2, R3, L2 and L4 were designed based on BVH-3 gene/protein sequence. The R1 linker is composed of BVH-3 amino acid residues 814 to 836, whereas the R2 linker is composed of amino acid residues 468 to 490 of the BVH-3 protein in which the Phe residue in position 468 was substituted for a Gln residue. The R3 linker is composed of BVH-3 amino acid residues 818 to 836. The L2 linker is composed of amino acids 507 to 531 of the BVH-3 protein. In this case, residues 514, 515, 519, 520, 525 and 526 corresponding to Asp, Leu, Ile, Glu, Gly and Ile were substituted for Glu, Ala, Ala, Gln, Glu and Ala, respectively. The L4 linker is composed of BVH-3 amino acids 849 to 859. The L1 and L3 linkers are flexible linkers composed of 26 and 12 amino acid residues, respectively, that show no significant similarity with any known protein present in the available data banks.

TABLE 8
List of the linker polypeptide sequences.
Linker SEQ
identification ID NO: Linker peptide sequence
R1 116 SILPQFKRNKAQENSKLDEKVEE
R2 117 QFKKDLTEEQIKAAQKHLEEVKT
R3 118 QFKRNKAQENSKLDEKVEE
L1 119 GDAAAKEAAAKEAAAKEAAAKEAAAK
L2 120 GNAKEMKEADKKAQEKIAEAMKQYG
L3 121 GSTNQYGNQTSG
L4 122 SETGNSTSNST

To create variant VP147 molecules modified by insertion of linker sequences at the fusions sites, the DNA sequences encoding for the peptide linkers were inserted in the recombinant pET vector pET21b-new147 by PCR using the primer sets listed in Table 9. Two complementary primers were used for each PCR mutagenesis. Variants of VP147 were generated by mutagenesis using the QuikChange® Site-Directed Mutagenesis Kit (Stratagene, Cedar Creek, Tex.). Clones were first stabilized in E. coli XL1-Blue before introduction into E. coli BL21 (λDE3) for expression of the new chimeric proteins. The presence of a hexahistidine tag at the C-terminus of the recombinant molecules allowed the purification of the proteins by nickel chromatography.

The primers used for the creation of variants VP147-R1, VP147-R2, VP147-R3, VP147-L3 and VP147-L4 were composed of one linker and annealing zones complementary to 30 bp-long regions upstream and downstream of the insertional site, respectively.

The L1 and L2 linkers to create the chimeric VP147-L1 and VP147-L2 proteins were long, and a two-step mutagenesis strategy was preferred to the one-step strategy described above. A first step of mutagenesis incorporated half of the linker sequences. With a second round of mutagenesis, the full-length linkers were incorporated in the constructs. For the first mutagenesis step, primers were composed of the first half of the linker and annealing zones complementary to 30 bp-long regions upstream and downstream of the insertional site, respectively, on each side of the linker sequence. For the second mutagenesis step, primers were composed of the second half of the linker and annealing zones, about 30 bp-long, corresponding to a region in the first half of the linker and a region downstream of the insertional site, respectively, on each side of the added linker sequence. To eliminate the risk of annealing between the linkers composed of a BVH-3 section and the sequence coding for the VP56 portion of VP147, the linker's sequences were degenerated. Table 9 describes sequences of the primers used for the mutagenesis experiments and the corresponding variant gene products, respectively. FIG. 8 shows an alignment of amino acid sequences of VP147 and variants thereof.

TABLE 9
List of PCR oligonucleotide primer sets used to generate VP147 variants.
Primer Primer SEQ
set identification ID No: Primer SEQUENCE
1 CHAN262 123 5′-GAAGATACCACAGATGAGGCTGAAATTCCTTCCATCTTGCCTCAGTTCAAGCGAAACAAAGCTCAGGAGAAT
TCCAAACTCGACGAAAAAGTCGAAGAGCCTAGTATTAGACAAAATGCTATGGAGACA-3′
CHAN263 124 5′-TGTCTCCATAGCATTTTGTCTAATACTAGGCTCTTCGACTTTTTCGTCGAGTTTGGAATTCTCCTGAGCTTT
GTTTCGCTTGAACTGAGGCAAGATGGAAGGAATTTCAGCCTCATCTGTGGTATCTTC-3′
2 CHAN264 125 5′-GAAGATACCACAGATGAGGCTGAAATTCCTCAATTCAAGAAAGATCTCACGGAGGAACAGATCAAAGCAGCA
CAGAAGCACCTGGAAGAGGTCAAGACCCCTAGTATTAGACAAAATGCTATGGAGACA-3′
CHAN265 126 5′-TGTCTCCATAGCATTTTGTCTAATACTAGGGGTCTTGACCTCTTCCAGGTGCTTCTGTGCTGCTTTGATCTG
TTCCTCCGTGAGATCTTTCTTGAATTGAGGAATTTCAGCCTCATCTGTGGTATCTTC-3′
3 CHAN266 127 5′-GAAGATACCACAGATGAGGCTGAAATTCCTCAATTCAAGCGCAACAAGGCTCAAGAGAATTCCAAGTTGGAC
GAGAAAGTCGAGGAACCTAGTATTAGACAAAATGCTATGGAGACA-3′
CHAN267 128 5′-TGTCTCCATAGCATTTTGTCTAATACTAGGTTCCTCGACTTTCTCGTCCAACTTGGAATTCTCTTGAGCCTT
GTTGCGCTTGAATTGAGGAATTTCAGCCTCATCTGTGGTATCTTC-3′
4 CHAN260 129 5′-AAAGAAAGTCAACCGGCTCCTATACAAGGTTCCACCAATCAGTACGGCAATCAAACCTCTGGGCAAATTGGG
CAACCGACTCTTCCAAACAAT-3′
CHAN261 130 5′-ATTGTTTGGAAGAGTCGGTTGCCCAATTTGCCCAGAGGTTTGATTGCCGTACTGATTGGTGGAACCTTGTAT
AGGAGCCGGTTGACTTTCTTT-3′
5 CHAN248 131 5′-TTAAAAGAAAGTCAACCGGCTCCTATACAGTCCGAGACAGGTAACTCTACGTCCAACAGCACGCAAATTGGG
CAACCGACTCTTCCAAACAAT-3′
CHAN249 132 5′-ATTGTTTGGAAGAGTCGGTTGCCCAATTTGCGTGCTGTTGGACGTAGAGTTACCTGTCTCGGACTGTATAGG
AGCCGGTTGACTTTCTTTTAA-3′
6 CHAN277 133 5′-AAAGAAAGTCAACCGGCTCCTATACAAGGTGACGCCGCAGCTAAGGAGGCAGCTGCCAAGGAGGCGCAAATT
GGGCAACCGACTCTTCCAAACAAT-3′
CHAN278 134 5′-ATTGTTTGGAAGAGTCGGTTGCCCAATTTGCGCCTCCTTGGCAGCTGCCTCCTTAGCTGCGGCGTCACCTTG
TATAGGAGCCGGTTGACTTTCTTT-3′
7 CHAN279 135 5′-GCAGCTAAGGAGGCAGCTGCCAAGGAGGCGGCAGCCAAAGAAGCAGCAGCGAAGGAGGCAGCAGCGAAGCAA
ATTGGGCAACCGACTCTTCCAAACAAT-3′
CHAN280 136 5′-ATTGTTTGGAAGAGTCGGTTGCCCAATTTGCTTCGCTGCTGCCTCCTTCGCTGCTGCTTCTTTGGCTGCCGC
CTCCTTGGCAGCTGCCTCCTTAGCTGC-3′
8 CHAN281 137 5′-AAAGAAAGTCAACCGGCTCCTATACAAGGTAACGCCAAAGAGATGAAGGAGGCGGATAAGAAGGCTCAAATT
GGGCAACCGACTCTTCCAAACAAT-3′
CHAN282 138 5′-ATTGTTTGGAAGAGTCGGTTGCCCAATTTGAGCCTTCTTATCCGCCTCCTTCATCTCTTTGGCGTTACCTTG
TATAGGAGCCGGTTGACTTTCTTT-3′
9 CHAN283 139 5′-GCCAAAGAGATGAAGGAGGCGGATAAGAAGGCTCAGGAGAAGATCGCAGAAGCTATGAAGCAGTACGGTCAA
ATTGGGCAACCGACTCTTCCAAACAAT-3′
CHAN284 140 5′-ATTGTTTGGAAGAGTCGGTTGCCCAATTTGACCGTACTGCTTCATAGCTTCTGCGATCTTCTCCTGAGCCTT
CTTATCCGCCTCCTTCATCTCTTTGGC-3′

TABLE 10
List of VP147 variants generated.
PCR
Protein SEQ ID primer set
designation NO: Protein Identificationa (ref. Table 9)
VP147   -R1 141 218-DEAIPSILPQFKRNKAQENSKLDEKVEEPSIRQ 1
VP147   -R2 142 218-DEAIPQFKKDLTEEQIKAAQKHLEEVKTPSIRQ 2
VP147   -R3 143 218-DEAIPQFKRNKAQENSKLDEKVEEPSIRQ 3
VP147   -L1 144 268-PAPIQGDAAAKEAAAKEAAAKEAAAKEAAAKQIGQ 6, 7
VP147   -L2 145 268-PAPIQGNAKEMKEADKKAQEKIAEAMKQYGQIGQ 8, 9
VP147   -L3 146 268-PAPIQGSTNQYGNQTSGQIGQ 4
VP147   -L4 147 268-PAPIQSETGNSTSNSTQIGQ 5
VP147-R2-L4 148 218-DEAIPQFKKDLTEEQIKAAQKHLEEVKT 2, 5
147 268-PAPIQSETGNSTSNSTQIGQ
aUnderlined amino acid residues correspond to the linker peptide sequence inserted into VP147. The numbers correspond to the location on VP147 (SEQ ID NO:3) of the pair of glycine residues which was substituted for the indicated peptide linker sequence.

EXAMPLE 10

This example illustrates the influence of the linker sequences on the reactivity of monoclonal antibodies with their corresponding epitopes.

The reactivity of the chimeric molecule VP147 and variants thereof was evaluated by ELISA using a panel of monoclonal antibodies (Mabs) raised against BVH-11-2 (Mabs H112-10A2, H112-14H6, H112-10G9, H112-lOC5, H56-10B11, H112-4G9, H11B-11B8, H11B-13D5) or BVH-3 (HN1-14F6, HN1-3E5, H3V-4F3, H3V-2F2, HN1-12D8, H3V-7F4, HN52-6C6, HN1-2G2, H3-4D3, HN1-1G2) antigens. The results shown in Table 11 indicate that the insertion of peptide linker sequences could significantly improve the ELISA reactivity of several BVH-3- and BVH-11-2-reactive antibodies.

TABLE 11
ELISA reactivity of monoclonal antibodies with VP147
and variants thereof having inserted linker polypeptide sequences
ELISA ELISA OD values obtained with MAbs
coating H112- H112- H112- H112- H56- H112- HN1- H3V- HN1-
antigen 10A2 14H6 10G9 10C5 10B11 4G9 14F6 4F3 3E5
VP147-L1 1.56 0.25 0.81 1.10 0.45 0.09 2.78 1.75 0.46
VP147-R2 1.00 0.78 0.48 0.90 0.22 0.34 2.50 1.50 1.39
VP147-L4 1.65 0.27 0.88 1.25 0.43 0.11 2.78 2.01 0.40
VP147-R2-L4 2.06 1.48 1.32 2.14 0.60 1.05 3.06 2.34 2.13
VP147 1.54 0.26 0.84 1.01 0.34 0.09 1.94 1.92 0.39

Moreover, when variant molecules were used to immunize animals, specific immune responses were generated as evaluated by ELISA using heat-killed pneumococci cells or recombinant antigens as coating antigens. ELISA antibody titer was defined as the reciprocal sera dilution giving an OD value 0.1 over the background. ELISA antibody titers against RX-1 pneumococci cells were always greater than 104 for sera from mice vaccinated with VP147 or variants of. Flow cytometry analysis using live encapsulated pneumococci revealed that the antibodies raised against the chimeric molecules bound to surface epitopes on both, BVH-3 and BVH-11-2 proteins.

Claims

What is claimed is:

1. An isolated polynucleotide comprising a polynucleotide sequence encoding a polypeptide that comprises the amino acid sequence set forth in SEQ ID NO:3, or the complement of the full-length polynucleotide sequence.

2. An isolated polynucleotide comprising a polynucleotide sequence at least 95% identical to the polynucleotide sequence set forth in SEQ ID NO:6, or the complement of the frill-length polynucleotide sequence, wherein the polynucleotide encodes a polypeptide that elicits an immune response to Streptococcus in an individual and that is capable of eliciting an antibody that specifically binds to the polypeptide comprising the amino acid sequence set forth in SEQ ID NO:3.

3. The isolated polynucleotide according to claim 2 comprising a polynucleotide sequence at least 97% identical to the polynucleotide sequence set forth in SEQ ID NO:6, or the complement of the full-length polynucleotide sequence.

4. The polynucleotide according to claim 2 comprising the polynucleotide sequence set forth in SEQ ID NO:6, or the complement of the full-length polynucleotide sequence.

5. The polynucleotide according to any one of claims 1-4 wherein the polynucleotide is DNA.

6. The polynucleotide according to any one of claims 1-4 wherein the polynucleotide is RNA.

7. A vector comprising the polynucleotide of any one of claims 1-4, wherein the polynucleotide is operably linked to an expression control region.

8. A host cell comprising the vector according to claim 7.

9. A process for producing a polypeptide, said process comprising culturing a host cell according to claim 8 under conditions suitable for expression of the polypeptide.

10. The process according to claim 9, further comprising isolating the expressed polypeptide.

11. The isolated polynucleotide according to claim 2 wherein the Streptococcus is Streptococcus pneumoniae, Streptococcus pyogenes, Streptococcus agalactiae, Streptococcus dysgalactiae, or Streptococcus uberis.

12. The isolated polynucleotide according to claim 2 wherein the Streptococcus is Streptococcus pneumoniae.

Resources

Images & Drawings included:

Sources:

Similar patent applications:

Recent applications in this class:

Recent applications for this Assignee: