-
2018-10-30
14/873,706
2015-10-02
US 10,113,152 B1
2018-10-30
-
-
Yong D Pak
Dana M. Gordon | Foley Hoag LLP
2035-10-02
Smart Summary: Variant polypeptides are special proteins that can change aliphatic alpha keto acids into aliphatic alpha amino acids. These proteins are created using specific genetic instructions and can be produced in a lab. They are useful for various applications, including screening and synthetic methods in chemistry. Previous methods for making a specific amino acid, (S)-2-aminonon-8-enoic acid, have been complicated and not very efficient. The new variant polypeptides offer a better way to produce this amino acid more effectively. đ TL;DR
Disclosed are, among other things, variant polypeptides, nucleic acids encoding the polypeptides, production of the variant polypeptides, and use of the variant polypeptides in various applications, such as screening and synthetic methods. For example, the variant polypeptides, or enzymatically-active fragments thereof, are useful for converting aliphatic keto acids to aliphatic alpha amino acids.
Get notified when new applications in this technology area are published.
C12N9/0016 » CPC main
Enzymes; Proenzymes; Compositions thereof ; Processes for preparing, activating, inhibiting, separating or purifying enzymes; Oxidoreductases (1.) acting on nitrogen containing compounds as donors (1.4, 1.5, 1.6, 1.7) acting on the CH-NH group of donors (1.4) with NAD or NADP as acceptor (1.4.1)
C12Y104/01009 » CPC further
Oxidoreductases acting on the CH-NH2 group of donors (1.4) with NAD+ or NADP+ as acceptor (1.4.1) Leucine dehydrogenase (1.4.1.9)
C07H21/04 IPC
Compounds containing two or more mononucleotide units having separate phosphate or polyphosphate groups linked by saccharide radicals of nucleoside groups, e.g. nucleic acids with deoxyribosyl as saccharide radical
C12N15/00 IPC
Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
This application claims the benefit of priority to U.S. Provisional Patent Application Ser. No. 62/059,538, filed Oct. 3, 2014.
The instant application contains a Sequence Listing which has been submitted electronically in ASCII format and is hereby incorporated by reference in its entirety. Said ASCII copy, created on Nov. 25, 2015, is named AVR-036.01(31941.03601)_SL.txt and is 59,277 bytes in size.
Synthesis of (S)-2-aminonon-8-enoic acid has been reported in the literature. Faucher, et al., reported a six step synthetic sequence for (S)-2-aminonon-8-enoic acid, which involves catalytic hydrogenation of an enamine substrate utilizing a DUPHOS ligand system as the key step for introduction of Îą-amino acid chirality (Org. Lett. 2004, 6, 2901-2904). Subsequently, Wang, et al., reported an enzymatic approach for the preparation of (S)-2-aminonon-8-enoic acid using acylase for the selective kinetic hydrolysis of a racemic acetamide substrate, with a theoretical step yield of 50%, in a six-step sequence (Org. Process Res. Dev. 2007, 11, 60-63). In 2008, an alternate approach involving a whole-cell catalytic system was disclosed for preparation of enantiomerically enriched (S)-2-aminonon-8-enoic acid from the corresponding hydantoin substrate (WO 2008/067981 A2). Subsequently, a different approach was reported (WO 2010/050516 A1; WO 2008/067981 A2) for (S)-2-aminonon-8-enoic acid, which was also based on selective kinetic hydrolysis of a racemic succinyl amide substrate using an L-succinylase enzyme (amidase), with a theoretical 50% step yield.
Previously disclosed methods are neither efficient nor best suited for the large-scale preparation of (S)-2-aminonon-8-enoic acid, as some of them involve multiple steps, with individual steps within a sequence possessing the limitation of a maximum 50% theoretical step yield. Thus, there is a need in the art for an improved process for preparing (S)-2-aminonon-8-enoic acid.
The disclosure provides, among other things, polypeptides and enzymatically-active fragments thereof capable of aminating an aliphatic keto acid (e.g., aliphatic 2-keto acids). The enzymatic activity of the polypeptides and fragments exhibits a high level of enantioselectivity for the (S)-enantiomer form of aliphatic amino acids so aminated. The polypeptides and fragments are useful for, e.g., converting 2-oxonon-8-enoic acid, in the presence of an ammonia source, to 2-aminonon-8-enoic acid (LCAA).
Accordingly, in one aspect, the disclosure features a polypeptide comprising the amino acid sequence depicted in SEQ ID NO:2 or 13-18, wherein X is not leucine.
In another aspect, the disclosure features a polypeptide comprising an amino acid sequence that is at least 90% identical to: (i) amino acids 6 to 238 of SEQ ID NO:2; (ii) amino acids 7 to 237 of SEQ ID NO:13; (iii) amino acids 4 to 236 of SEQ ID NO:14; (iv) amino acids 4 to 236 of SEQ ID NO:15; (v) amino acids 4 to 236 of SEQ ID NO:16; (vi) amino acids 4 to 236 of SEQ ID NO:17; or (vii) amino acids 4 to 236 of SEQ ID NO:18, wherein X is not leucine.
In another aspect, the disclosure features a polypeptide comprising an amino acid sequence that is at least 90% identical to: (i) amino acids 6 to 298 of SEQ ID NO:2; (ii) amino acids 7 to 297 of SEQ ID NO:13; (iii) amino acids 4 to 296 of SEQ ID NO:14; (iv) amino acids 4 to 296 of SEQ ID NO:15; (v) amino acids 4 to 296 of SEQ ID NO:16; (vi) amino acids 4 to 296 of SEQ ID NO:17; or (vii) amino acids 4 to 296 of SEQ ID NO:18, wherein X is not leucine.
In another aspect, the disclosure features a polypeptide comprising an amino acid sequence having at least two amino acid substitutions, deletions, or insertions relative to SEQ ID NO:2, wherein the amino acid sequence comprises the amino acid X at position 42, and wherein X is not leucine.
In another aspect, the disclosure features a polypeptide comprising an amino acid sequence having at least two amino acid substitutions, deletions, or insertions relative to SEQ ID NO:13, wherein the amino acid sequence comprises the amino acid X at position 43, and wherein X is not leucine.
In another aspect, the disclosure features a polypeptide comprising an amino acid sequence having at least two amino acid substitutions, deletions, or insertions relative to SEQ ID NO:14, wherein the amino acid sequence comprises the amino acid X at position 40, and wherein X is not leucine.
In another aspect, the disclosure features a polypeptide comprising an amino acid sequence having at least two amino acid substitutions, deletions, or insertions relative to SEQ ID NO:15, wherein the amino acid sequence comprises the amino acid X at position 40, and wherein X is not leucine.
In another aspect, the disclosure features a polypeptide comprising an amino acid sequence having at least two amino acid substitutions, deletions, or insertions relative to SEQ ID NO:16, wherein the amino acid sequence comprises the amino acid X at position 40, and wherein X is not leucine.
In another aspect, the disclosure features a polypeptide comprising an amino acid sequence having at least two amino acid substitutions, deletions, or insertions relative to SEQ ID NO:17, wherein the amino acid sequence comprises the amino acid X at position 40, and wherein X is not leucine.
In another aspect, the disclosure features a polypeptide comprising an amino acid sequence having at least two amino acid substitutions, deletions, or insertions relative to SEQ ID NO:18, wherein the amino acid sequence comprises the amino acid X at position 40, and wherein X is not leucine.
In yet another aspect, the disclosure features a polypeptide comprising the amino acid sequence depicted in SEQ ID NO: 4, 5, 6, or 20.
In yet another aspect, the disclosure features a polypeptide comprising at least ten (e.g., at least 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 25, 30, 35, 40, 45, 50, 55, 60, 65, 70, 75, 80, 85, 90, 95, 100, 110, 120, 130, 140, 150, 160, 170, 180, 190, 200, 210, 220, 230, 240, 250, 260, 270, 280, 290, or 300 or more) consecutive amino acids of SEQ ID NO:2, inclusive of the amino acid at position 42, wherein X is not leucine.
In yet another aspect, the disclosure features a polypeptide comprising at least ten (e.g., at least 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 25, 30, 35, 40, 45, 50, 55, 60, 65, 70, 75, 80, 85, 90, 95, 100, 110, 120, 130, 140, 150, 160, 170, 180, 190, 200, 210, 220, 230, 240, 250, 260, 270, 280, 290, or 300 or more) consecutive amino acids of SEQ ID NO:13, inclusive of the amino acid at position 43, wherein X is not leucine.
In yet another aspect, the disclosure features a polypeptide comprising at least ten (e.g., at least 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 25, 30, 35, 40, 45, 50, 55, 60, 65, 70, 75, 80, 85, 90, 95, 100, 110, 120, 130, 140, 150, 160, 170, 180, 190, 200, 210, 220, 230, 240, 250, 260, 270, 280, 290, or 300 or more) consecutive amino acids of SEQ ID NO:14, inclusive of the amino acid at position 40, wherein X is not leucine.
In yet another aspect, the disclosure features a polypeptide comprising at least ten (e.g., at least 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 25, 30, 35, 40, 45, 50, 55, 60, 65, 70, 75, 80, 85, 90, 95, 100, 110, 120, 130, 140, 150, 160, 170, 180, 190, 200, 210, 220, 230, 240, 250, 260, 270, 280, 290, or 300 or more) consecutive amino acids of SEQ ID NO:15, inclusive of the amino acid at position 40, wherein X is not leucine.
In yet another aspect, the disclosure features a polypeptide comprising at least ten (e.g., at least 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 25, 30, 35, 40, 45, 50, 55, 60, 65, 70, 75, 80, 85, 90, 95, 100, 110, 120, 130, 140, 150, 160, 170, 180, 190, 200, 210, 220, 230, 240, 250, 260, 270, 280, 290, or 300 or more) consecutive amino acids of SEQ ID NO:16, inclusive of the amino acid at position 40, wherein X is not leucine.
In yet another aspect, the disclosure features a polypeptide comprising at least ten (e.g., at least 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 25, 30, 35, 40, 45, 50, 55, 60, 65, 70, 75, 80, 85, 90, 95, 100, 110, 120, 130, 140, 150, 160, 170, 180, 190, 200, 210, 220, 230, 240, 250, 260, 270, 280, 290, or 300 or more) consecutive amino acids of SEQ ID NO:17, inclusive of the amino acid at position 40, wherein X is not leucine.
In yet another aspect, the disclosure features a polypeptide comprising at least ten (e.g., at least 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 25, 30, 35, 40, 45, 50, 55, 60, 65, 70, 75, 80, 85, 90, 95, 100, 110, 120, 130, 140, 150, 160, 170, 180, 190, 200, 210, 220, 230, 240, 250, 260, 270, 280, 290, or 300 or more) consecutive amino acids of SEQ ID NO:18, inclusive of the amino acid at position 40, wherein X is not leucine.
In some embodiments, any of the polypeptides described herein comprise the amino acid sequence: GPAXGG (SEQ ID NO:3), wherein X is not leucine.
In some embodiments, any of the polypeptides described herein comprise at least 50 consecutive amino acids of SEQ ID NO:2. In some embodiments, any of the polypeptides described herein comprise at least 100 consecutive amino acids of SEQ ID NO:2.
In some embodiments, any of the polypeptides described herein have an enzymatic activity that converts 2-oxonon-8-enoic acid to (S)-2-aminonon-8-enoic acid (LCAA). For example, a polypeptide described herein can, in the presence of an ammonia source, convert 2-oxonon-8-enoic acid to (S)-2-aminonon-8-enoic acid (LCAA), e.g., under the assay conditions described herein and exemplified in the working examples. In some embodiments, a polypeptide described herein has an enhanced enzymatic activity to convert 2-oxonon-8-enoic acid to (S)-2-aminonon-8-enoic acid (LCAA), as compared to wild-type, full-length B. cereus LDH, e.g., SEQ ID NO:1.
In some embodiments of any of the polypeptides described herein, e.g., SEQ ID NO:2, 3, or any one of 13-18, X is isoleucine. In some embodiments of any of the polypeptides described herein, e.g., SEQ ID NO:2, 3, or any one of 13-18, X is valine. In some embodiments of any of the polypeptides described herein, e.g., SEQ ID NO:2, 3, or 13-18, X is glycine. In some embodiments of any of the polypeptides described herein, e.g., SEQ ID NO:2, 3, or any one of 13-18, X is alanine. In some embodiments of any of the polypeptides described herein, e.g., SEQ ID NO:2, 3, or any one of 13-18, X is serine. In some embodiments of any of the polypeptides described herein, e.g., SEQ ID NO:2, 3, or 13-18, X is threonine. In some embodiments of any of the polypeptides described herein, e.g., SEQ ID NO:2, 3, or 13-18, X can be, e.g., isoleucine, valine, glycine, alanine, serine, or threonine.
In some embodiments, the polypeptides described herein can be isolated polypeptides.
In yet another aspect, the disclosure features a nucleic acid encoding any one or more of the polypeptides described herein. Also featured are expression vectors (e.g., prokaryotic or eukaryotic) expression vectors comprising the nucleic acid. In another aspect, the disclosure features a cell, plurality of cells, or culture of cells, comprising the nucleic acid or expression vector. In another aspect, the disclosure features a method for producing a polypeptide, such as any of the polypeptides described herein. The method includes culturing the aforementioned cell, plurality of cells, or culture of cells comprising the expression vector under conditions suitable for protein expression to thereby produce a polypeptide. The method can, optionally, further include isolating the polypeptide from the cell (plurality of cells or cell culture) or from media in which the cell or cells is/are cultured.
In yet another aspect, the disclosure features a kit comprising any one of the polypeptides described herein. In some embodiments, the kit includes instructions for aminating an aliphatic keto acid. In some embodiments, the kit includes an aliphatic keto acid, one or more reaction buffers, an ammonia source, a glucose dehydrogenase, glucose, nicotinamide adenine dinucleotide (NAD; e.g., a reduced form of NAD), or combinations of any of the foregoing.
âPolypeptide,â âpeptide,â and âproteinâ are used interchangeably and mean any peptide-linked chain of amino acids, regardless of length or post-translational modification.
Unless otherwise defined, all technical and scientific terms used herein have the same meaning as commonly understood by one of ordinary skill in the art to which this disclosure pertains. Preferred methods and materials are described below, although methods and materials similar or equivalent to those described herein can also be used in the practice or testing of the presently disclosed methods and compositions. All publications, patent applications, patents, and other references mentioned herein are incorporated by reference in their entirety.
Other features and advantages of the present disclosure, e.g., methods for reductive amination of an aliphatic keto acid, will be apparent from the following description, the examples, and from the claims.
SEQ ID NO:1 is an exemplary amino acid sequence for wild-type B. cereus leucine dehydrogenase.
SEQ ID NO:2 is an exemplary amino acid sequence for a variant B. cereus leucine dehydrogenase (substitution X at position 42).
SEQ ID NO:3 is a six amino acid conserved region from bacterial leucine dehydrogenase polypeptides.
SEQ ID NO:4 depicts an exemplary amino acid sequence for the variant B. cereus LDH-L42I polypeptide.
SEQ ID NO:5 depicts an exemplary amino acid sequence for the variant B. cereus LDH-L42V polypeptide.
SEQ ID NO:6 depicts an exemplary amino acid sequence for the variant B. cereus LDH-L42G polypeptide.
SEQ ID NO:7 is an exemplary amino acid sequence for wild-type Chlamydia pneumoniae leucine dehydrogenase.
SEQ ID NO:8 is an exemplary amino acid sequence for wild-type Thermoactinomyces intermedius leucine dehydrogenase.
SEQ ID NO:9 is an exemplary amino acid sequence for wild-type Bacillus subtilis leucine dehydrogenase.
SEQ ID NO:10 is an exemplary amino acid sequence for wild-type Bacillus licheniformis leucine dehydrogenase.
SEQ ID NO:11 is an exemplary amino acid sequence for wild-type Geobacillus stearothermophilus leucine dehydrogenase.
SEQ ID NO:12 is an exemplary amino acid sequence for wild-type Bacillus sphaericus leucine dehydrogenase.
SEQ ID NO:13 is an exemplary amino acid sequence for a variant Chlamydia pneumoniae leucine dehydrogenase (substitution X at position 43).
SEQ ID NO:14 is an exemplary amino acid sequence for a variant Thermoactinomyces intermedius leucine dehydrogenase (substitution X at position 40).
SEQ ID NO:15 is an exemplary amino acid sequence for a variant Bacillus subtilis leucine dehydrogenase (substitution X at position 40).
SEQ ID NO:16 is an exemplary amino acid sequence for a variant Bacillus licheniformis leucine dehydrogenase (substitution X at position 40).
SEQ ID NO:17 is an exemplary amino acid sequence for a variant Geobacillus stearothermophilus leucine dehydrogenase (substitution X at position 40).
SEQ ID NO:18 is an exemplary amino acid sequence for a variant Bacillus sphaericus leucine dehydrogenase (substitution X at position 40).
SEQ ID NO:19 is a three amino acid conserved region from bacterial leucine dehydrogenase polypeptides.
SEQ ID NO:20 depicts an exemplary amino acid sequence for the variant B. cereus LDH-L42A polypeptide.
FIG. 1 depicts the alignment of the amino acid sequences of leucine dehydrogenases from Bacillus cereus (BC) (SEQ ID NO:1), Chlamydia pneumoniae (CP) (SEQ ID NO:7), Thermoactinomyces intermedius (TI) (SEQ ID NO:8), Bacillus subtilis (BS) (SEQ ID NO:9), Bacillus licheniformis (BL) (SEQ ID NO:10), Geobacillus stearothermophilus (GS) (SEQ ID NO:11), and Bacillus sphaericus (BSph) (SEQ ID NO:12). Sequence identity is indicated by â*â. Sequence conservation (e.g., conservative substitutions) between species is indicated by â:â. The alignment was performed using the ClustalW2⢠software provided by the European Bioinformatics Institute (EBI) of the European Molecular Biology Laboratory (EMBL).
FIG. 2 depicts a reaction scheme for converting 2-oxonon-8-enoic acid, in the presence of an ammonia source, to 2-aminonon-8-enoic acid (LCAA). Also depicted, in conjunction with the amination reaction, are glucose dehydrogenase (GDH) and glucose, which are used to regenerate a catalytic amount of the NADH cofactor.
FIG. 3 is a line graph depicting the rate of conversion of 2-oxonon-8-enoic acid (substrate) to (S)-LCAA (product) using wild-type, full-length Bacillus cereus LDH. The Y-axis represents the percent conversion of substrate to product. The X-axis represents time in minutes.
FIG. 4 is a chromatograph depicting the percentage of (S)-enantiomer of LCAA produced by the LDH-driven enzymatic reaction. Analyses of a racemic standard having both (S) and (R) forms, as well as chemically synthesized (S)-LCAA, were also performed (and shown) for reference.
FIG. 5 is a line graph depicting the relative reaction rates of wild-type LDH and L32I, L42V, and L42G LDH variants for converting 2-oxonon-8-enoic acid (substrate) to (S)-LCAA. The Y-axis represents the relative percent conversion of substrate to product. The X-axis represents time.
The disclosure relates to, among other things, polypeptides (e.g., variant polypeptides and enzymatically-active fragments thereof), nucleic acids encoding the polypeptides, production of the polypeptides, and use of the polypeptides in various applications, such as screening and synthetic methods. For example, the variant polypeptides, or enzymatically-active fragments thereof, are useful for converting aliphatic keto acids to aliphatic alpha amino acids. While in no way intended to be limiting, exemplary variant polypeptides, fragments, and methods for making and using any of the foregoing are elaborated on below.
Polypeptides
The polypeptides described herein include variants of leucine dehydrogenase (LDH) and enzymatically-active fragments of such variants. In some embodiments, the polypeptide is a variant of a LDH expressed by Bacillus cereus, or an enzymatically-active fragment of the variant. An exemplary amino acid sequence for the full-length, wild-type LDH polypeptide from Bacillus cereus is as follows:
| (SEQâIDâNO:â1) |
| MTLEIFEYLEKYDYEQVVFCQDKESGLKAIIAIHDTTLGPALGGTRMWTY |
| DSEEAAIEDALRLAKGMTYKNAAAGLNLGGAKTVIIGDPRKDKSEAMFRA |
| LGRYIQGLNGRYITAEDVGTTVDDMDIIHEETDFVTGISPSFGSSGNPSP |
| VTAYGVYRGMKAAAKEAFGTDNLEGKVIAVQGVGNVAYHLCKHLHAEGAK |
| LIVTDINKEAVQRAVEEFGASAVEPNEIYGVECDIYAPCALGATVNDETI |
| PQLKAKVIAGSANNQLKEDRHGDIIHEMGIVYAPDYVINAGGVINVADEL |
| YGYNRERALKRVESIYDTIAKVIEISKRDGIATYVAADRLAEERIASLKN |
| SRSTYLRNGHDIISRRâ(UniProtâIDâNo.âP0A392). |
In some embodiments, the polypeptide is a variant of a LDH expressed by Chlamydia pneumoniae, or an enzymatically-active fragment of the variant. An exemplary amino acid sequence for the full-length, wild-type LDH polypeptide from Chlamydia pneumoniae is as follows:
| (SEQâIDâNO:â7) |
| MKYSLNFKEIKIDDYERVIEVTCSKVRLHAIIAIHQTAVGPALGGVRASL |
| YSSFEDACTDALRLARGMTYKAIISNTGTGGGKSVIILPQDAPSLTEDML |
| RAFGQAVNALEGTYICAEDLGVSINDISIVAEETPYVCGIADVSGDPSIY |
| TAHGGFLCIKETAKYLWGSSSLRGKKIAIQGIGSVGRRLLQSLFFEGAEL |
| YVADVLERAVQDAARLYGATIVPTEEIHALECDIFSPCARGNVIRKDNLA |
| DLNCKAIVGVANNQLEDSSAGMMLHERGILYGPDYLVNAGGLLNVAAAIE |
| GRVYAPKEVLLKVEELPIVLSKLYNQSKTTGKDLVALSDSFVEDKLLAYT |
| Sâ(UniProtâIDâNo.âQ9Z6Y7). |
In some embodiments, the polypeptide is a variant of a LDH expressed by Thermoactinomyces intermedius, or an enzymatically-active fragment of the variant. An exemplary amino acid sequence for the full-length, wild-type LDH polypeptide from Thermoactinomyces intermedius is as follows:
| (SEQâIDâNO:â8) |
| MKIFDYMEKYDYEQLVMCQDKESGLKAIICIHVTTLGPALGGMRMWTYAS |
| EEEAIEDALRLGRGMTYKNAAAGLNLGGGKTVIIGDPRKDKNEAMFRALG |
| RFIQGLNGRYITAEDVGTTVEDMDIIHEETRYVTGVSPAFGSSGNPSPVT |
| AYGVYRGMKAAAKEAFGDDSLEGKVVAVQGVGHVAYELCKHLHNEGAKLI |
| VTDINKENADRAVQEFGAEFVHPDKIYDVECDIFAPCALGAIINDETIER |
| LKCKVVAGSANNQLKEERHGKMLEEKGIVYAPDYVINAGGVINVADELLG |
| YNRERAMKKVEGIYDKILKVFEIAKRDGIPSYLAADRMAEERIEMMRKTR |
| STFLQDQRNLINFNNKâ(UniProtâIDâNo.âQ60030). |
In some embodiments, the polypeptide is a variant of a LDH expressed by Bacillus subtilis, or an enzymatically-active fragment of the variant. An exemplary amino acid sequence for the full-length, wild-type LDH polypeptide from Bacillus subtilis is as follows:
| (SEQâIDâNO:â9) |
| MELFKYMEKYDYEQLVFCQDEQSGLKAIIAIHDTTLGPALGGTRMWTYEN |
| EEAAIEDALRLARGMTYKNAAAGLNLGGGKTVIIGDPRKDKNEEMFRAFG |
| RYIQGLNGRYITAEDVGTTVEDMDIIHDETDYVTGISPAFGSSGNPSPVT |
| AYGVYRGMKAAAKAAFGTDSLEGKTIAVQGVGNVAYNLCRHLHEEGANLI |
| VTDINKQSVQRAVEDFGARAVDPDDIYSQDCDIYAPCALGATINDDTIKQ |
| LKAKVIAGAANNQLKETRHGDQIHEMGIVYAPDYVINAGGVINVADELYG |
| YNAERALKKVEGIYGNIERVLEISQRDGIPAYLAADRLAEERIERMRRSR |
| SQFLQNGHSVLSRRâ(UniProtâIDâNo.âP54531). |
In some embodiments, the polypeptide is a variant of a LDH expressed by Bacillus licheniformis, or an enzymatically-active fragment of the variant. An exemplary amino acid sequence for the full-length, wild-type LDH polypeptide from Bacillus licheniformis is as follows:
| (SEQâIDâNO:â10) |
| MELFRYMEQYDYEQLVFCQDKQSGLKAIIAIHDTTLGPALGGTRMWTYES |
| EEAAIEDALRLARGMTYKNAAAGLNLGGGKTVIIGDPRKDKNEEMFRAFG |
| RYIQGLNGRYITAEDVGTTVEDMDIIHDETDFVTGISPAFGSSGNPSPVT |
| AYGVYKGMKAAAKAAFGTDSLEGKTVAVQGVGNVAYNLCRHLHEEGAKLI |
| VTDINKEAVERAVAEFGARAVDPDDIYSQECDIYAPCALGATINDDTIPQ |
| LKAKVIAGAANNQLKETRHGDQIHDMGIVYAPDYVINAGGVINVADELYG |
| YNSERALKKVEGIYGNIERVLEISKRDRIPTYLAADRLAEERIERMRQSR |
| SQFLQNGHHILSRRâ(UniProtâIDâNo.âQ65HK5). |
In some embodiments, the polypeptide is a variant of a LDH expressed by Geobacillus stearothermophilus, or an enzymatically-active fragment of the variant. An exemplary amino acid sequence for the full-length, wild-type LDH polypeptide from Geobacillus stearothermophilus is as follows:
| (SEQâIDâNO:â11) |
| MELFKYMETYDYEQVLFCQDKESGLKAIIAIHDTTLGPALGGTRMWMYNS |
| EEEALEDALRLARGMTYKNAAAGLNLGGGKTVIIGDPRKDKNEAMFRAFG |
| RFIQGLNGRYITAEDVGTTVADMDIIYQETDYVTGISPEFGSSGNPSPAT |
| AYGVYRGMKAAAKEAFGSDSLEGKVVAVQGVGNVAYHLCRHLHEEGAKLI |
| VTDINKEVVARAVEEFGAKAVDPNDIYGVECDIFAPCALGGIINDQTIPQ |
| LKAKVIAGSADNQLKEPRHGDIIHEMGIVYAPDYVINAGGVINVADELYG |
| YNRERAMKKIEQIYDNIEKVFAIAKRDNIPTYVAADRMAEERIETMRKAR |
| SPFLQNGHHILSRRRARâ(UniProtâIDâNo.âP13154). |
In some embodiments, the polypeptide is a variant of a LDH expressed by Bacillus sphaericus, or an enzymatically-active fragment of the variant. An exemplary amino acid sequence for the full-length, wild-type LDH polypeptide from Bacillus sphaericus is as follows:
| (SEQâIDâNO:â12) |
| MEIFKYMEKYDYEQLVFCQDEASGLKAIIAIHDTTLGPALGGARMWTYAT |
| EENAIEDALRLARGMTYKNAAAGLNLGGGKTVIIGDPFKDKNEEMFRALG |
| RFIQGLNGRYITAEDVGTTVTDMDLIHEETNYVTGISPAFGSSGNPSPVT |
| AYGVYRGMKAAAKEAFGTDMLEGRTISVQGLGNVAYKLCEYLHNEGAKLV |
| VTDINQAAIDRVVNDFGATAVAPDEIYSQEVDIFSPCALGAILNDETIPQ |
| LKAKVIAGSANNQLQDSRHGDYLHELGIVYAPDYVINAGGVINVADELYG |
| YNRERALKRVDGIYDSIEKIFEISKRDSIPTYVAANRLAEERIARVAKSR |
| SQFLKNEKNILNGRâ(UniProtâIDâNo.âQ76GS2). |
The variant polypeptides described herein comprise one or more amino acid substitutions, insertions, or deletions, relative to the wild-type LDH polypeptides from which they were derived. In some embodiments, a variant polypeptide comprises at least two (e.g., at least three, four, five, six, seven, eight, nine, 10, 15, 20, 25, 30, 35, 40, 45, 50, 55, 60, 65, 70, 75, 80, 85, 90, 95, 100, or more than 100) amino acid substitutions, deletions, or insertions, relative to the wild-type, full-length LDH polypeptide from which it was derived. In some embodiments, a variant polypeptide comprises no more than 150 (e.g., no more than 145, 140, 135, 130, 125, 120, 115, 110, 105, 100, 95, 90, 85, 80, 75, 70, 65, 60, 55, 50, 45, 40, 35, 30, 25, 24, 23, 22, 21, 20, 19, 18, 17, 16, 15, 14, 13, 12, 11, 10, 9, 8, 7, 6, 5, 4, 3, or 2) amino acid substitutions, deletions, or insertions, relative to the wild-type, full-length LDH polypeptide from which it was derived. In some embodiments, a variant polypeptide described herein, or a fragment thereof, includes an amino acid substitution at amino acid position 42 relative to SEQ ID NO:1, e.g., a substitution of leucine at position 42 with another amino acid. The amino acid at position 42, leucine, relative to SEQ ID NO:1 is one of several amino acids (GPAXGG (SEQ ID NO:3)) highly conserved among bacterial leucine dehydrogenase polypeptides (FIG. 1). However, the exact position of these amino acid residues in a given polypeptide varies from species to species and with truncations or extension of the naturally-occurring sequence. One of skill in the art would therefore appreciate that references herein to a variant polypeptide (or a fragment thereof) comprising an amino acid substitution at position 42 relative to SEQ ID NO:1, include, e.g., an amino acid substitution at position 43 of SEQ ID NO:7; an amino acid substitution at position 40 of SEQ ID NO:8; an amino acid substitution at position 40 of SEQ ID NO:9; an amino acid substitution at position 40 of SEQ ID NO:10; an amino acid substitution at position 40 of SEQ ID NO:11; or an amino acid substitution at position 40 of SEQ ID NO:12, i.e., position X in SEQ ID NOs:13-18.
In some embodiments, any of the variant polypeptides or fragments described herein comprise the amino acid sequence NVA (SEQ ID NO:19), which corresponds to amino acids 295 to 297 of SEQ ID NO:1. In some embodiments, a variant polypeptide or fragment thereof comprises the amino acid sequences depicted in SEQ ID NO:3 and SEQ ID NO:19.
As used herein, the term âconservative substitutionâ refers to the replacement of an amino acid present in the native sequence in a given polypeptide with a naturally or non-naturally occurring amino acid having similar steric properties. Where the side-chain of the native amino acid to be replaced is either polar or hydrophobic, the conservative substitution should be with a naturally occurring amino acid, a non-naturally occurring amino acid that is also polar or hydrophobic, and, optionally, with the same or similar steric properties as the side-chain of the replaced amino acid. Conservative substitutions typically include substitutions within the following groups: glycine and alanine; valine, isoleucine, and leucine; aspartic acid and glutamic acid; asparagine, glutamine, serine and threonine; lysine, histidine and arginine; and phenylalanine and tyrosine. One letter amino acid abbreviations are as follows: alanine (A); arginine (R); asparagine (N); aspartic acid (D); cysteine (C); glycine (G); glutamine (Q); glutamic acid (E); histidine (H); isoleucine (I); leucine (L); lysine (K); methionine (M); phenylalanine (F); proline (P); serine (S); threonine (T); tryptophan (W), tyrosine (Y); and valine (V).
The phrase ânon-conservative substitutionsâ as used herein refers to replacement of the amino acid as present in the parent sequence by another naturally or non-naturally occurring amino acid, having different electrochemical and/or steric properties. Thus, the side chain of the substituting amino acid can be significantly larger (or smaller) than the side chain of the native amino acid being substituted and/or can have functional groups with significantly different electronic properties than the amino acid being substituted.
In some embodiments, the variant polypeptide, or fragment thereof, comprises the amino acid sequence GPAXGG (SEQ ID NO:3), wherein X is any amino acid except for leucine. In some embodiments, X is glycine. In some embodiments, X is valine. In some embodiments, X is isoleucine. In some embodiments, X is alanine. In some embodiments, X is serine. In some embodiments, X is threonine. In some embodiments, X can be, e.g., glycine, valine, isoleucine, alanine, serine, or threonine.
In some embodiments, the variant polypeptide is a variant of Bacillus cereus LDH comprising the following amino acid sequence:
| (SEQâIDâNO:â2) |
| MTLEIFEYLEKYDYEQVVFCQDKESGLKAIIAIHDTTLGPAXGGTRMWTY |
| DSEEAAIEDALRLAKGMTYKNAAAGLNLGGAKTVIIGDPRKDKSEAMFRA |
| LGRYIQGLNGRYITAEDVGTTVDDMDIIHEETDFVTGISPSFGSSGNPSP |
| VTAYGVYRGMKAAAKEAFGTDNLEGKVIAVQGVGNVAYHLCKHLHAEGAK |
| LIVTDINKEAVQRAVEEFGASAVEPNEIYGVECDIYAPCALGATVNDETI |
| PQLKAKVIAGSANNQLKEDRHGDIIHEMGIVYAPDYVINAGGVINVADEL |
| YGYNRERALKRVESIYDTIAKVIEISKRDGIATYVAADRLAEERIASLKN |
| SRSTYLRNGHDIISRR, |
wherein X is any amino acid except for leucine. In some embodiments, X is glycine. In some embodiments, X is valine. In some embodiments, X is isoleucine. In some embodiments, X is alanine. In some embodiments, X is serine. In some embodiments, X is threonine. In some embodiments, X can be, e.g., glycine, valine, isoleucine, alanine, serine, or threonine.
In some embodiments, the variant polypeptide comprises, or consists of, one of the following amino acid sequences:
| (1) |
| (SEQâIDâNO:â4) |
| MTLEIFEYLEKYDYEQVVFCQDKESGLKAIIAIHDTTLGPAIGGTRMWTY |
| DSEEAAIEDALRLAKGMTYKNAAAGLNLGGAKTVIIGDPRKDKSEAMFRA |
| LGRYIQGLNGRYITAEDVGTTVDDMDIIHEETDFVTGISPSFGSSGNPSP |
| VTAYGVYRGMKAAAKEAFGTDNLEGKVIAVQGVGNVAYHLCKHLHAEGAK |
| LIVTDINKEAVQRAVEEFGASAVEPNEIYGVECDIYAPCALGATVNDETI |
| PQLKAKVIAGSANNQLKEDRHGDIIHEMGIVYAPDYVINAGGVINVADEL |
| YGYNRERALKRVESIYDTIAKVIEISKRDGIATYVAADRLAEERIASLKN |
| SRSTYLRNGHDIISRR; |
| (2) |
| (SEQâIDâNO:â5) |
| MTLEIFEYLEKYDYEQVVFCQDKESGLKAIIAIHDTTLGPAVGGTRMWTY |
| DSEEAAIEDALRLAKGMTYKNAAAGLNLGGAKTVIIGDPRKDKSEAMFRA |
| LGRYIQGLNGRYITAEDVGTTVDDMDIIHEETDFVTGISPSFGSSGNPSP |
| VTAYGVYRGMKAAAKEAFGTDNLEGKVIAVQGVGNVAYHLCKHLHAEGAK |
| LIVTDINKEAVQRAVEEFGASAVEPNEIYGVECDIYAPCALGATVNDETI |
| PQLKAKVIAGSANNQLKEDRHGDIIHEMGIVYAPDYVINAGGVINVADEL |
| YGYNRERALKRVESIYDTIAKVIEISKRDGIATYVAADRLAEERIASLKN |
| SRSTYLRNGHDIISRR; |
| (3) |
| (SEQâIDâNO:â6) |
| MTLEIFEYLEKYDYEQVVFCQDKESGLKAIIAIHDTTLGPAGGGTRMWTY |
| DSEEAAIEDALRLAKGMTYKNAAAGLNLGGAKTVIIGDPRKDKSEAMFRA |
| LGRYIQGLNGRYITAEDVGTTVDDMDIIHEETDFVTGISPSFGSSGNPSP |
| VTAYGVYRGMKAAAKEAFGTDNLEGKVIAVQGVGNVAYHLCKHLHAEGAK |
| LIVTDINKEAVQRAVEEFGASAVEPNEIYGVECDIYAPCALGATVNDETI |
| PQLKAKVIAGSANNQLKEDRHGDIIHEMGIVYAPDYVINAGGVINVADEL |
| YGYNRERALKRVESIYDTIAKVIEISKRDGIATYVAADRLAEERIASLKN |
| SRSTYLRNGHDIISRR; |
| or |
| (4) |
| (SEQâIDâNO:â20) |
| MTLEIFEYLEKYDYEQVVFCQDKESGLKAIIAIHDTTLGPAAGGTRMWTY |
| DSEEAAIEDALRLAKGMTYKNAAAGLNLGGAKTVIIGDPRKDKSEAMFRA |
| LGRYIQGLNGRYITAEDVGTTVDDMDIIHEETDFVTGISPSFGSSGNPSP |
| VTAYGVYRGMKAAAKEAFGTDNLEGKVIAVQGVGNVAYHLCKHLHAEGAK |
| LIVTDINKEAVQRAVEEFGASAVEPNEIYGVECDIYAPCALGATVNDETI |
| PQLKAKVIAGSANNQLKEDRHGDIIHEMGIVYAPDYVINAGGVINVADEL |
| YGYNRERALKRVESIYDTIAKVIEISKRDGIATYVAADRLAEERIASLKN |
| SRSTYLRNGHDIISRR. |
In some embodiments, a variant polypeptide described herein, or a fragment thereof, comprises at least ten (e.g., at least 11, 12, 13, 14, 15, 20, 25, 30, 35, 40, 45, 50, 55, 60, 65, 70, 75, 80, 85, 90, 95, 100, 105, 110, 115, 120, 130, 140, 150, 160, 170, 180, 190, 200, 210, 220, 230, 240, 250, 260, 270, 280, 290, or 300 or more) consecutive amino acids of SEQ ID NO:2, inclusive of the amino acid at position 42, wherein X is not leucine.
In some embodiments, a variant polypeptide described herein, or a fragment thereof, comprises at least ten (e.g., at least 11, 12, 13, 14, 15, 20, 25, 30, 35, 40, 45, 50, 55, 60, 65, 70, 75, 80, 85, 90, 95, 100, 105, 110, 115, 120, 130, 140, 150, 160, 170, 180, 190, 200, 210, 220, 230, 240, 250, 260, 270, 280, 290, or 300 or more) consecutive amino acids of SEQ ID NO:13, inclusive of the amino acid at position 43, wherein X is not leucine. The amino acid sequence of SEQ ID NO:13 is as follows:
| MKYSLNFKEIKIDDYERVIEVTCSKVRLHAIIAIHQTAVGPAXGGVRASL |
| YSSFEDACTDALRLARGMTYKAIISNTGTGGGKSVIILPQDAPSLTEDML |
| RAFGQAVNALEGTYICAEDLGVSINDISIVAEETPYVCGIADVSGDPSIY |
| TAHGGFLCIKETAKYLWGSSSLRGKKIAIQGIGSVGRRLLQSLFFEGAEL |
| YVADVLERAVQDAARLYGATIVPTEEIHALECDIFSPCARGNVIRKDNLA |
| DLNCKAIVGVANNQLEDSSAGMMLHERGILYGPDYLVNAGGLLNVAAAIE |
| GRVYAPKEVLLKVEELPIVLSKLYNQSKTTGKDLVALSDSFVEDKLLAYT |
| S. |
In some embodiments, a variant polypeptide described herein, or a fragment thereof, comprises at least ten (e.g., at least 11, 12, 13, 14, 15, 20, 25, 30, 35, 40, 45, 50, 55, 60, 65, 70, 75, 80, 85, 90, 95, 100, 105, 110, 115, 120, 130, 140, 150, 160, 170, 180, 190, 200, 210, 220, 230, 240, 250, 260, 270, 280, 290, or 300 or more) consecutive amino acids of SEQ ID NO:14, inclusive of the amino acid at position 40, wherein X is not leucine. The amino acid sequence of SEQ ID NO:14 is as follows:
| MKIFDYMEKYDYEQLVMCQDKESGLKAIICIHVTTLGPAXGGMRMWTYAS |
| EEEAIEDALRLGRGMTYKNAAAGLNLGGGKTVIIGDPRKDKNEAMFRALG |
| RFIQGLNGRYITAEDVGTTVEDMDIIHEETRYVTGVSPAFGSSGNPSPVT |
| AYGVYRGMKAAAKEAFGDDSLEGKVVAVQGVGHVAYELCKHLHNEGAKLI |
| VTDINKENADRAVQEFGAEFVHPDKIYDVECDIFAPCALGAIINDETIER |
| LKCKVVAGSANNQLKEERHGKMLEEKGIVYAPDYVINAGGVINVADELLG |
| YNRERAMKKVEGIYDKILKVFEIAKRDGIPSYLAADRMAEERIEMMRKTR |
| STFLQDQRNLINFNNK. |
In some embodiments, a variant polypeptide described herein, or a fragment thereof, comprises at least ten (e.g., at least 11, 12, 13, 14, 15, 20, 25, 30, 35, 40, 45, 50, 55, 60, 65, 70, 75, 80, 85, 90, 95, 100, 105, 110, 115, 120, 130, 140, 150, 160, 170, 180, 190, 200, 210, 220, 230, 240, 250, 260, 270, 280, 290, or 300 or more) consecutive amino acids of SEQ ID NO:15, inclusive of the amino acid at position 40, wherein X is not leucine. The amino acid sequence of SEQ ID NO:15 is as follows:
| MELFKYMEKYDYEQLVFCQDEQSGLKAIIAIHDTTLGPAXGGTRMWTYEN |
| EEAAIEDALRLARGMTYKNAAAGLNLGGGKTVIIGDPRKDKNEEMFRAFG |
| RYIQGLNGRYITAEDVGTTVEDMDIIHDETDYVTGISPAFGSSGNPSPVT |
| AYGVYRGMKAAAKAAFGTDSLEGKTIAVQGVGNVAYNLCRHLHEEGANLI |
| VTDINKQSVQRAVEDFGARAVDPDDIYSQDCDIYAPCALGATINDDTIKQ |
| LKAKVIAGAANNQLKETRHGDQIHEMGIVYAPDYVINAGGVINVADELYG |
| YNAERALKKVEGIYGNIERVLEISQRDGIPAYLAADRLAEERIERMRRSR |
| SQFLQNGHSVLSRR. |
In some embodiments, a variant polypeptide described herein, or a fragment thereof, comprises at least ten (e.g., at least 11, 12, 13, 14, 15, 20, 25, 30, 35, 40, 45, 50, 55, 60, 65, 70, 75, 80, 85, 90, 95, 100, 105, 110, 115, 120, 130, 140, 150, 160, 170, 180, 190, 200, 210, 220, 230, 240, 250, 260, 270, 280, 290, or 300 or more) consecutive amino acids of SEQ ID NO:16, inclusive of the amino acid at position 40, wherein X is not leucine. The amino acid sequence of SEQ ID NO:16 is as follows:
| MELFRYMEQYDYEQLVFCQDKQSGLKAIIAIHDTTLGPAXGGTRMWTYES |
| EEAAIEDALRLARGMTYKNAAAGLNLGGGKTVIIGDPRKDKNEEMFRAFG |
| RYIQGLNGRYITAEDVGTTVEDMDIIHDETDFVTGISPAFGSSGNPSPVT |
| AYGVYKGMKAAAKAAFGTDSLEGKTVAVQGVGNVAYNLCRHLHEEGAKLI |
| VTDINKEAVERAVAEFGARAVDPDDIYSQECDIYAPCALGATINDDTIPQ |
| LKAKVIAGAANNQLKETRHGDQIHDMGIVYAPDYVINAGGVINVADELYG |
| YNSERALKKVEGIYGNIERVLEISKRDRIPTYLAADRLAEERIERMRQSR |
| SQFLQNGHHILSRR. |
In some embodiments, a variant polypeptide described herein, or a fragment thereof, comprises at least ten (e.g., at least 11, 12, 13, 14, 15, 20, 25, 30, 35, 40, 45, 50, 55, 60, 65, 70, 75, 80, 85, 90, 95, 100, 105, 110, 115, 120, 130, 140, 150, 160, 170, 180, 190, 200, 210, 220, 230, 240, 250, 260, 270, 280, 290, or 300 or more) consecutive amino acids of SEQ ID NO:17, inclusive of the amino acid at position 40, wherein X is not leucine. The amino acid sequence of SEQ ID NO:17 is as follows:
| MELFKYMETYDYEQVLFCQDKESGLKAIIAIHDTTLGPAXGGTRMWMYNS |
| EEEALEDALRLARGMTYKNAAAGLNLGGGKTVIIGDPRKDKNEAMFRAFG |
| RFIQGLNGRYITAEDVGTTVADMDIIYQETDYVTGISPEFGSSGNPSPAT |
| AYGVYRGMKAAAKEAFGSDSLEGKVVAVQGVGNVAYHLCRHLHEEGAKLI |
| VTDINKEVVARAVEEFGAKAVDPNDIYGVECDIFAPCALGGIINDQTIPQ |
| LKAKVIAGSADNQLKEPRHGDIIHEMGIVYAPDYVINAGGVINVADELYG |
| YNRERAMKKIEQIYDNIEKVFAIAKRDNIPTYVAADRMAEERIETMRKAR |
| SPFLQNGHHILSRRRAR. |
In some embodiments, a variant polypeptide described herein, or a fragment thereof, comprises at least 10 (e.g., at least 11, 12, 13, 14, 15, 20, 25, 30, 35, 40, 45, 50, 55, 60, 65, 70, 75, 80, 85, 90, 95, 100, 105, 110, 115, 120, 130, 140, 150, 160, 170, 180, 190, 200, 210, 220, 230, 240, 250, 260, 270, 280, 290, or 300 or more) consecutive amino acids of SEQ ID NO:18, inclusive of the amino acid at position 40, wherein X is not leucine. The amino acid sequence of SEQ ID NO:18 is as follows:
| MEIFKYMEKYDYEQLVFCQDEASGLKAIIAIHDTTLGPAXGGARMWTYAT |
| EENAIEDALRLARGMTYKNAAAGLNLGGGKTVIIGDPFKDKNEEMFRALG |
| RFIQGLNGRYITAEDVGTTVTDMDLIHEETNYVTGISPAFGSSGNPSPVT |
| AYGVYRGMKAAAKEAFGTDMLEGRTISVQGLGNVAYKLCEYLHNEGAKLV |
| VTDINQAAIDRVVNDFGATAVAPDEIYSQEVDIFSPCALGAILNDETIPQ |
| LKAKVIAGSANNQLQDSRHGDYLHELGIVYAPDYVINAGGVINVADELYG |
| YNRERALKRVDGIYDSIEKIFEISKRDSIPTYVAANRLAEERIARVAKSR |
| SQFLKNEKNILNGR. |
In some embodiments of any of the variants described herein, X is glycine, isoleucine, alanine, or valine. In some embodiments, X is serine. In some embodiments, X is threonine. In some embodiments, X can be, e.g., glycine, valine, isoleucine, alanine, serine, and threonine.
In some embodiments, a variant polypeptide described herein, or a fragment thereof, has an amino acid sequence that is at least 80 (e.g., at least 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 94, 95, 96, 97, 98, or 99) % identical to: (i) amino acids 6 to 238 of SEQ ID NO:2; (ii) amino acids 7 to 237 of SEQ ID NO:13; (iii) amino acids 4 to 236 of SEQ ID NO:14; (iv) amino acids 4 to 236 of SEQ ID NO:15; (v) amino acids 4 to 236 of SEQ ID NO:16; (vi) amino acids 4 to 236 of SEQ ID NO:17; or (vii) amino acids 4 to 236 of SEQ ID NO:18, with the proviso that the variant polypeptide or fragment thereof comprises the amino acid sequence at position X, and X is not leucine. In some embodiments, the variant polypeptide or fragment thereof comprises the amino acid sequence depicted in SEQ ID NO:3, wherein X is not leucine.
In some embodiments, a variant polypeptide described herein, or a fragment thereof, has an amino acid sequence that is at least 80 (e.g., at least 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 94, 95, 96, 97, 98, or 99) % identical to: (i) amino acids 6 to 298 of SEQ ID NO:2; (ii) amino acids 7 to 297 of SEQ ID NO:13; (iii) amino acids 4 to 296 of SEQ ID NO:14; (iv) amino acids 4 to 296 of SEQ ID NO:15; (v) amino acids 4 to 296 of SEQ ID NO:16; (vi) amino acids 4 to 296 of SEQ ID NO:17; or (vii) amino acids 4 to 296 of SEQ ID NO:18, with the proviso that the variant polypeptide or fragment thereof comprises the amino acid sequence at position X, and X is not leucine. In some embodiments, the variant polypeptide or fragment thereof comprises the amino acid sequence depicted in SEQ ID NO:3, wherein X is not leucine.
Percent (%) amino acid sequence identity is defined as the percentage of amino acids in a candidate sequence that are identical to the amino acids in a reference sequence, after aligning the sequences and introducing gaps, if necessary, to achieve the maximum percent sequence identity. Alignment for purposes of determining percent sequence identity can be achieved in various ways that are within the skill in the art, for instance, using publicly available computer software, such as BLAST software or ClustalW2 (above). Appropriate parameters for measuring alignment, including any algorithms needed to achieve maximal alignment over the full-length of the sequences being compared can be determined by known methods.
Leucine dehydrogenase from B. cereus exists in solution as a homo-octomer, with each subunit folding into two domains, and separated by a deep cleft. See Baker et al. (1995) Current Biol 3:693-705, which describes the crystal structure of leucine dehydrogenase from B. sphaericus (SEQ ID NO:12). The quaternary structure of the complex adopts the shape of a hollow cylinder. Leucine dehydrogenase comprises both a dehydrogenase superfamily domain (e.g., amino acids 10 to 130) and a nicotinamide adenine dinucleotide-cofactor binding domain (e.g., amino acids 150 to 350). In some embodiments, a variant polypeptide or enzymatically-active fragment described herein retains at least 5 (e.g., at least 10, 15, 20, 25, 30, 35, 40, 45, 50, 55, 60, 65, 70, 75, 80, 85, 90, 95, or 100) % of the ability of the corresponding full-length, wild-type LDH polypeptide from which the variant or fragment was derived to bind to a nucleotide cofactor (e.g., NAD or NADH). Methods for detecting or measuring the interaction between NAD and NAD-dependent enzymes are known in the art and described in, e.g., Kovar and Klukanova (1984) Biochim Biophys Acta 788(1):98-109, and Lesk (1995) Curr Opin Struct Biol 5(6):775-783.
As described above, the variant polypeptides described herein, as well as enzymatically-active fragments thereof, possess an enzymatic activity capable of reductive amination of an aliphatic keto acid (e.g., aliphatic 2-keto acids). For example, such polypeptides can convert 2-oxonon-8-enoic acid, in the presence of an ammonia source, to LCAA, e.g., (S)-LCAA. In some embodiments, a variant polypeptide, or enzymatically-active fragment thereof, retains at least 5 (e.g., at least 10, 15, 20, 25, 30, 35, 40, 45, 50, 55, 60, 65, 70, 75, 80, 85, 90, 95, or 100) % of the ability of the corresponding full-length, wild-type LDH polypeptide from which the variant or fragment was derived to convert 2-oxonon-8-enoic acid, in the presence of an ammonia source, to LCAA. In some embodiments, a variant polypeptide, or enzymatically-active fragment thereof, retains at least 5 (e.g., at least 10, 15, 20, 25, 30, 35, 40, 45, 50, 55, 60, 65, 70, 75, 80, 85, 90, 95, or 100) % of the ability of full-length, wild-type Bacillus cereus LDH octomer complex to convert 2-oxonon-8-enoic acid, in the presence of an ammonia source, to LCAA, e.g., under the assay conditions described and exemplified in the working examples.
In some embodiments, a variant polypeptide, or enzymatically-active fragment thereof, possesses enhanced ability to convert 2-oxonon-8-enoic acid, in the presence of an ammonia source, to LCAA, relative to the activity of full-length, wild-type Bacillus cereus LDH. For example, the variant polypeptide or enzymatically-active fragment thereof can have at least a 5 (e.g., 10, 15, 20, 25, 30, 35, 40, 45, 50, 55, 60, 65, 70, 75, 80, 85, 90, 95, or 100) % greater activity (e.g., reaction rate) than full-length, wild-type Bacillus cereus LDH to convert 2-oxonon-8-enoic acid, in the presence of an ammonia source, to LCAA. In some embodiments, the activity (e.g., the reaction rate) of the variant polypeptide or enzymatically-active fragment thereof is at least 1.5 (e.g., at least 2, 2.5, 3, 4, 5, 6, 7, 8, 9, 10, 20, 30, 40, 50, 100, 150, 200, 500, or even 1000) times greater than that of full-length, wild-type Bacillus cereus LDH, e.g., under the conditions described and exemplified in the working examples. Exemplary variant polypeptides exhibiting enhanced activity relative to full-length, wild-type B. cereus LDH include the L42I, L42V, L42G, and L32A variant polypeptides having amino acid sequences: SEQ ID NOs:4, 5, 6, and 20, respectively (see Example 2).
Recombinant Protein Expression and Purification
The variant polypeptides (or fragments) described herein can be produced using a variety of techniques known in the art of molecular biology and protein chemistry. (See, e.g., Current Protocols in Molecular Biology, Wiley & Sons, and Molecular CloningâA Laboratory Manualâ3rd Ed., Cold Spring Harbor Laboratory Press, New York (2001)). For example, a nucleic acid encoding the variant polypeptide or fragment can be inserted into an expression vector that contains transcriptional and translational regulatory sequences, which include, e.g., promoter sequences, ribosomal binding sites, transcriptional start and stop sequences, translational start and stop sequences, transcription terminator signals, polyadenylation signals, and enhancer or activator sequences. The regulatory sequences include a promoter and transcriptional start and stop sequences. In addition, the expression vector can include more than one replication system such that it can be maintained in two different organisms, for example in mammalian or insect cells for expression and in a prokaryotic host for cloning and amplification. In addition, the choice of codons, suitable expression vectors and suitable host cells will vary depending on a number of factors, and may be easily optimized as needed.
The variant polypeptides or fragments thereof can be produced from the cells by culturing a host cell transformed with the expression vector containing nucleic acid encoding the proteins or fragments, under conditions, and for an amount of time, sufficient to allow expression of the proteins. Such conditions for protein expression will vary with the choice of the expression vector and the host cell, and will be easily ascertained by one skilled in the art through routine experimentation. For example, proteins expressed in E. coli can be refolded from inclusion bodies (see, e.g., Hou et al. (1998) Cytokine 10:319-30). Bacterial expression systems and methods for their use are well known in the art (see Current Protocols in Molecular Biology, Wiley & Sons, and Molecular CloningâA Laboratory Manualâ3rd Ed., Cold Spring Harbor Laboratory Press, New York (2001), supra).
A number of expression systems for use in prokaryotic host cells have been described, e.g., Terpe et al. (2006) Appl Microbiol Biotechnol 72:211-222. Commonly used expression systems for bacterial host cells (e.g., E. coli) include: the lac promoter, trc and tac promoter systems, T7 systems, phage promoter PL, tetA promoter/operator, araBAD promoter, and rhaPBAD promoter systems. See, e.g., Polisky et al. (1976) Proc Natl Acad Sci USA 73:3900-3904; De Boer et al. (1983) Proc Natl Acad Sci USA 80:21-25; Brosius et al. (1985) J Biol Chem 260:3539-3541; Amann et al. (1983) Gene 25:167-178; and Quick and Wright (2002) Proc Natl Acad Sci USA 99:8597-8601. Another widely-used bacterial expression system is the pET vector expression system. Studier et al. (1986) J Mol Biol 189:113-130; Dietrich et al. (1991) Eur J Biochem 201:399-407; Lathrop et al. (1992) Protein Expr Purif 3:512-517; and Aukhil et al. (1993) J Biol Chem 268:2542-2553.
Several possible vector systems are available for the expression of recombinant polypeptides from nucleic acids in mammalian cells. One class of vectors relies upon the integration of the desired gene sequences into the host cell genome. Cells which have stably integrated DNA can be selected by simultaneously introducing drug resistance genes such as E. coli gpt (Mulligan and Berg (1981) Proc Natl Acad Sci USA 78:2072) or Tn5 neo (Southern and Berg (1982) Mol Appl Genet 1:327). The selectable marker gene can be either linked to the DNA gene sequences to be expressed, or introduced into the same cell by co-transfection (Wigler et al. (1979) Cell 16:77). A second class of vectors utilizes DNA elements which confer autonomously replicating capabilities to an extrachromosomal plasmid. These vectors can be derived from animal viruses, such as bovine papillomavirus (Sarver et al. (1982) Proc Natl Acad Sci USA, 79:7147), cytomegalovirus, polyoma virus (Deans et al. (1984) Proc Natl Acad Sci USA 81:1292), or SV40 virus (Lusky and Botchan (1981) Nature 293:79).
The expression vectors can be introduced into cells in a manner suitable for subsequent expression of the nucleic acid. The method of introduction is largely dictated by the targeted cell type. Exemplary methods include CaPO4 precipitation, liposome fusion, cationic liposomes, electroporation, viral infection, dextran-mediated transfection, polybrene-mediated transfection, protoplast fusion, and direct microinjection.
Appropriate host cells for the expression of recombinant proteins include yeast, bacteria, insect, plant, and mammalian cells. Of particular interest are bacteria such as E. coli, fungi such as Saccharomyces cerevisiae and Pichia pastoris, insect cells such as SF9, mammalian cell lines (e.g., human cell lines), as well as primary cell lines. In addition to E. coli, other commonly-used prokaryotic host cells include bacilli strains B. megaterium, B. subtlis, B. brevis, and Caulobacter crescentus.
A variant polypeptide or fragment thereof described herein can be expressed in mammalian cells or in other expression systems including but not limited to yeast, baculovirus, and even in vitro expression systems (see, e.g., Kaszubska et al. (2000) Protein Expression and Purification 18:213-220).
Following expression, the recombinant proteins can be isolated. The term âpurifiedâ or âisolatedâ as applied to any of the proteins described herein refers to a polypeptide that has been separated or purified from components (e.g., proteins or other naturally-occurring biological or organic molecules) which naturally accompany it, e.g., other proteins, lipids, and nucleic acid in a prokaryotic or eukaryotic cell expressing the proteins. Typically, a polypeptide is purified when it constitutes at least 60 (e.g., at least 65, 70, 75, 80, 85, 90, 92, 95, 97, or 99) %, by weight, of the total protein in a sample.
The recombinant proteins can be isolated or purified in a variety of ways known to those skilled in the art depending on what other components are present in the sample. Standard purification methods include electrophoretic, molecular, immunological, and chromatographic techniques, including ion exchange, hydrophobic, affinity, and reverse-phase HPLC chromatography. Ultrafiltration and diafiltration techniques, in conjunction with protein concentration, are also useful. See, e.g., Scopes (1994) âProtein Purification, 3rd edition,â Springer-Verlag, New York City, N.Y. The degree of purification necessary will vary depending on the desired use. In some instances, no purification of the expressed proteins will be necessary.
Methods for determining the yield or purity of a purified protein are known in the art and include, e.g., Bradford assay, UV spectroscopy, Biuret protein assay, Lowry protein assay, amido black protein assay, high performance liquid chromatography (HPLC), mass spectrometry (MS), and gel electrophoretic methods (e.g., using a protein stain such as Coomassie Blue or colloidal silver stain).
Exemplary methods for producing, expressing, and isolating a LDH from E. coli are exemplified in the working examples. Additional methods for producing a recombinant LDH (e.g., recombinant LDH from B. sphaericus) are described in, e.g., Li et al. (2009) Appl Biochem Biotechnol 158:343-351.
Applications
The variant polypeptides and enzymatically-active fragments thereof are useful in a number of applications. For example, the polypeptides and fragments can be used as control enzymes in screening methods designed to identify additional variant polypeptides and fragments capable of converting 2-oxonon-8-enoic acid, in the presence of an ammonia source, to LCAA, e.g., (S)-LCAA. Such methods would include, optionally, generating one or more (e.g., a library of) test variant leucine dehydrogenase polypeptides (e.g., substitution, insertion, or deletion variants of any one of SEQ ID NOs:1, 2, or 4-18). Methods for generating test variant polypeptides are described herein (supra) and exemplified in the working examples. The test variant polypeptides can be screened, e.g., using the LCAA production reaction described in Examples 1 and 2 below.
In addition, the variant polypeptides and enzymatically-active fragments thereof described herein are useful as enzyme catalysts for the conversion of 2-oxonon-8-enoic acid to (S)-LCAA. Such methods are described herein and exemplified in the working examples.
Kits
Also provided herein are kits containing one or more of the variant polypeptides or enzymatically-active fragments thereof and, optionally, instructions for carrying out a reaction to aminate an aliphatic keto acid. The variant polypeptides or fragments can be provided in solution, e.g., aqueous solution, or in lyophilized form. In the latter case, the kit can optionally include one or more buffers for reconstituting the lyophilized protein.
In some embodiments, the kits can include nicotinamide adenine dinucleotide (NAD), e.g., a reduced form of NAD and, optionally, appropriate reaction buffers. In some embodiments, the kits can include glucose. In some embodiments, the kits can further include a glucose dehydrogenase.
The following examples are intended to illustrate, not limit, the disclosure.
E. coli cells were transformed with an expression vector encoding wild-type, B. cereus leucine dehydrogenase (LDH; having the amino acid sequence depicted in SEQ ID NO:1). LDH protein was expressed at 37° C. using standard molecular biology techniques. Briefly, seed cultures of 10 mL of LB media with 50 Οg/mL ampicillin were inoculated with frozen cell stocks of E. coli containing the expression vector. The cultures were incubated at 37° C. and 250 rpm overnight. Expression cultures were inoculated with the seed culture at a 1:200 dilution and grown at 37° C. and 250 rotations per minute (rpm) until the culture reached an OD600 of 0.5, at which time they were induced with 0.5 ΟL of 0.2 M IPTG. After induction, cultures were incubated at 37° C. for 18-24 hours.
Following expression, cultures were harvested by centrifugation (14,000 rpm for 3 min) and resuspended with 1/10th the original culture volume in B-PER⢠Protein Extraction Reagent (Thermo Scientific, Rockford, Ill.). Alternatively, cell cultures could also be lysed by resuspension in buffer (i.e. 0.1 M phosphate buffer pH 7) followed by sonication. The resulting cell lysate was clarified by centrifugation at 14,000 rpm for 3 min. The supernatant was reserved as the cell-free extract LDH enzyme solution.
To produce (S)-LCAA from 2-oxonon-8-enoic acid, a reaction was performed under the following conditions. In 200 mL total volume and a buffered pH of 9.5, the aqueous reaction mixture contained 10 mM 2-oxonon-8-enoic acid, 12 mM glucose, 1 mM NAD+, 50 mg of purified glucose dehydrogenase (GDH-105; Codexis, Redwood City, Calif.), 2 M NH4Cl/OH, and approximately 60 mL/L of purified leucine dehydrogenase cell-free extract. FIG. 2 depicts the reaction scheme for converting 2-oxonon-8-enoic acid to (S)-LCAA using leucine dehydrogenase. The mixture was incubated at 30° C. and with shaking at 150 rpm for four hours.
Enzyme activity was measured spectrophotometrically by monitoring the consumption of NADH in the reductive amination at 340 nm. Activity was defined as the number of micromoles of NADH consumed in 1 minute (Îźmol minâ1). Aliquots of the reaction mixture were obtained periodically during the course of the reaction and subjected to analysis by high performance liquid chromatography (HPLC). As shown in FIG. 3, greater than 99.5% conversion of the substrate to LCAA was achieved by four hours.
To determine what percentage of the LCAA reaction product of the reaction was (S)-LCAA, aliquots of the reaction mixture were analyzed using high performance liquid chromatography (HPLC). As shown in FIG. 4, greater than 99.5% of the reaction product was the desired (S)-enantiomer.
To increase the affinity of LDH for the 2-oxonon-8-enoic acid substrate and, thus, enhance the enzyme's activity for producing (S)-LCAA, amino acid substitutions were made within the region of LDH that binds to the substrate. Specifically, amino acid substitutions were introduced at position 42 of B. cereus leucine dehydrogenase (SEQ ID NO:1) using standard mutagenesis techniques. Wild-type B. cereus LDH, along with 19 variants (one for each amino acid substitution at position 42) were expressed and isolated as described in Example 1. The enzymatic activity of the variant proteins was evaluated alongside wild-type B. cereus LDH in the reaction described in Example 1. As shown in FIG. 5, three of the substitution variants (L42I, L42V, and L42G) exhibited significantly enhanced activity (a greater reaction rate), relative to wild-type B. cereus LDH. L42G and L42V exhibited an approximately 1Ă103 increase in reaction rate, relative to wild-type B. cereus LDH. The L42A, L42T, and L42S variants also exhibited enhanced activity relative to wild-type B. cereus LDH. The L42A variant had a similar level of enzymatic activity to the L42V variant LDH enzyme. By contrast, L42D, L42K, L42Y, and L42H variants possessed reduced activity, relative to wild-type B. cereus LDH, under these reaction conditions. While the disclosure is not bound by any particular theory or mechanism of action, the substitutions that increased the enzymatic activity of the LDH enzyme are believed to have increased the depth of the substrate binding pocket in LDH and thereby increased the affinity of LDH for the 2-oxonon-8-enoic acid substrate.
While the present disclosure has been described with reference to the specific embodiments thereof, it should be understood by those skilled in the art that various changes may be made and equivalents may be substituted without departing from the true spirit and scope of the disclosure. In addition, many modifications may be made to adapt a particular situation, material, composition of matter, process, process step or steps, to the objective, spirit and scope of the present disclosure. All such modifications are intended to be within the scope of the disclosure.
1. A polypeptide, comprising:
(a) the amino acid sequence of any one of SEQ ID NOS:2 and 13-18, wherein X is not leucine;
(b) an amino acid sequence that is at least 95% identical to: (i) amino acids 6 to 238 of SEQ ID NO:2; (ii) amino acids 7 to 237 of SEQ ID NO:13; (iii) amino acids 4 to 236 of SEQ ID NO:14; (iv) amino acids 4 to 236 of SEQ ID NO:15; (v) amino acids 4 to 236 of SEQ ID NO:16; (vi) amino acids 4 to 236 of SEQ ID NO:17; or (vii) amino acids 4 to 236 of SEQ ID NO:18, wherein X is not leucine;
(c) an amino acid sequence that is at least 95% identical to: (i) amino acids 6 to 298 of SEQ ID NO:2; (ii) amino acids 7 to 297 of SEQ ID NO:13; (iii) amino acids 4 to 296 of SEQ ID NO:14; (iv) amino acids 4 to 296 of SEQ ID NO:15; (v) amino acids 4 to 296 of SEQ ID NO:16; (vi) amino acids 4 to 296 of SEQ ID NO:17; or (vii) amino acids 4 to 296 of SEQ ID NO:18, wherein X is not leucine; or
(d) the amino acid sequence of SEQ ID NO: 4, 5, 6, or 20;
wherein the polypeptide is isolated and wherein the polypeptide has the ability to convert 2-oxonon-8-enoic acid, in the presence of an ammonia source, to 2-aminonon-8-enoic acid; and
X is isoleucine, valine, glycine, alanine, serine, or threonine.
2. The polypeptide of claim 1, wherein X is isoleucine.
3. The polypeptide of claim 1, wherein X is valine.
4. The polypeptide of claim 1, wherein X is glycine.
5. The polypeptide of claim 1, wherein X is alanine.
6. The polypeptide of claim 1, wherein X is serine or threonine.
7. The polypeptide of claim 1, wherein the polypeptide comprises the amino acid sequence of any one of SEQ ID NOS:2 and 13-18.
8. The polypeptide of claim 1, wherein the polypeptide comprises an amino acid sequence that is at least 95% identical to: (i) amino acids 6 to 238 of SEQ ID NO:2; (ii) amino acids 7 to 237 of SEQ ID NO:13; (iii) amino acids 4 to 236 of SEQ ID NO:14; (iv) amino acids 4 to 236 of SEQ ID NO:15; (v) amino acids 4 to 236 of SEQ ID NO:16; (vi) amino acids 4 to 236 of SEQ ID NO:17; or (vii) amino acids 4 to 236 of SEQ ID NO:18.
9. The polypeptide of claim 1, wherein the polypeptide comprises an amino acid sequence that is at least 95% identical to: (i) amino acids 6 to 298 of SEQ ID NO:2; (ii) amino acids 7 to 297 of SEQ ID NO:13; (iii) amino acids 4 to 296 of SEQ ID NO:14; (iv) amino acids 4 to 296 of SEQ ID NO:15; (v) amino acids 4 to 296 of SEQ ID NO:16; (vi) amino acids 4 to 296 of SEQ ID NO:17; or (vii) amino acids 4 to 296 of SEQ ID NO:18.
10. The polypeptide of claim 1, wherein the polypeptide comprises the amino acid sequence of SEQ ID NO: 4, 5, 6, or 20.
11. The polypeptide of claim 1, wherein the polypeptide comprises an amino acid sequence that is at least 95% identical to amino acids 6 to 238 of SEQ ID NO:2.
12. The polypeptide of claim 11, wherein X is alanine.
13. The polypeptide of claim 7, wherein the amino acid sequence is SEQ ID NO:2.
14. The polypeptide of claim 13, wherein X is alanine.