US20190216063A1
2019-07-18
16/371,824
2019-04-01
The present invention relates to a genetically edited animal, especially to a genetically edited pig in which expression or activity of the RELA protein has been modified. Such pigs have at least partial protection against the African Swine Fever Virus. The invention also provides, a cell nucleus, germ cell, stem cell, gamete, blastocyst, embryo, foetus and/or donor cell of a non-human animal comprising a genetic modification which alters the expression or function of RELA protein, methods for editing the genome of animals and methods for screening the efficacy of a pharmaceutical agent in such an animal.
Get notified when new applications in this technology area are published.
A01K67/0275 » CPC further
Rearing or breeding animals, not otherwise provided for; New breeds of animals; New breeds of vertebrates Genetically modified vertebrates, e.g. transgenic
A01K67/0276 » CPC main
Rearing or breeding animals, not otherwise provided for; New breeds of animals; New breeds of vertebrates; Genetically modified vertebrates, e.g. transgenic Knockout animals
C07K14/47 IPC
Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates from mammals
C07K14/4702 » CPC further
Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates from mammals not used Regulators; Modulating activity
A01K2227/108 » CPC further
Animals characterised by species; Mammal Swine
A01K2217/075 » CPC further
Genetically modified animals; Animals genetically altered by homologous recombination inducing loss of function, i.e. knock out
A01K2267/03 » CPC further
Animals characterised by purpose Animal model, e.g. for test or diseases
A01K2217/072 » CPC further
Genetically modified animals; Animals genetically altered by homologous recombination maintaining or altering function, i.e. knock in
A01K2267/02 » CPC further
Animals characterised by purpose Animal zootechnically ameliorated
A01K2217/07 » CPC further
Genetically modified animals Animals genetically altered by homologous recombination
A01K67/027 IPC
Rearing or breeding animals, not otherwise provided for; New breeds of animals New breeds of vertebrates
C12N9/22 » CPC further
Enzymes; Proenzymes; Compositions thereof ; Processes for preparing, activating, inhibiting, separating or purifying enzymes; Hydrolases (3) acting on ester bonds (3.1) Ribonucleases RNAses, DNAses
The present invention relates to a genetically edited non-human animal. In particular the invention relates to a genetically edited mammal, and particularly to a genetically edited pig. The animal is less affected by pathogen infection; in particular the animal is less likely to develop disease pathology upon virus infection. The genetically edited animal has altered RELA (p65) expression or activity. The altered RELA activity is preferably caused by a mutation affecting the transactivation domain encoding sequences of RELA. Pigs with altered RELA activity can be tolerant of viral infection, in particular infection by African Swine Fever Virus (ASFV).
Infectious disease adversely affects livestock production and animal welfare, and often has major impacts upon human health and public perception of livestock production. For example, the costs of existing endemic diseases are estimated as 17% of turnover of livestock industries in the developed world and 35-50% in the developing world. Furthermore, epidemics, particularly in the developed countries, incur further major costs and profound impacts upon the rural economy and on public confidence in livestock production. Biomolecular approaches to enhance the underlying genetic ability of an animal to combat infectious disease will enhance animal production regimes. Such technologies, along with traditional disease control measures, will enable more effective and sustainable disease control.
Central to the immune response a mammal activates up pathogen infection is the gene transcription pathway utilising the transcription factor NFkappaB, which is an obligate dimer protein. This transcription factor regulates, amongst other signalling pathways, the pathogen induced cytokine response that is central to the animal's immune response upon infection. The predominant components of the NFkappaB dimer are the RELA (p65) and NFKB1 proteins. The RELA protein is encoded by a gene which displays polymorphic variation within pig species. In particular African and Eurasian pigs display different allelic versions of RELA and functional studies indicate that the African RELA variant displays a reduced NFkappaB activity that is generally equivalent to the animal carrying only one copy of the âEurasianâ gene. It is known from mouse studies that animals that carry a single copy of the RELA gene are viable.
Pigs succumb to many pathogens including a typically lethal haemorrhagic fever due to infection by ASFV. African swine fever is a highly infectious disease of domestic pigs, with virulent isolates causing a rapid fatal haemorrhagic fever. However, in contrast to domestic pigs, the porcine species native to Africa tolerate infection.
ASFV is notifiable to the World Organization for Animal Health (01E), placing it in the highest category of infectious animal pathogens. It exhibits remarkable potential for transboundary spread, and outbreaks in domestic pig populations have a serious socioeconomic impact worldwide. Furthermore, ASF is considered to be the major limiting factor to pig production in Africa. ASFV is a large, double-stranded DNA virus and the only member of the Asfarviridae family, suggesting that it may carry novel genes that are not carried by other virus families. The ability of the virus to persist in one host while killing another genetically related host implies that disease severity may be, at least in part, modulated by host genetic variation. Such viruses attempt to evade the host immune response through the action of virus-encoded immune modulators. ASFV encodes several such factors, one of which interacts with the NFAT and NFkappaB signalling pathways. Sequencing of components of these pathways has indicated a very high degree of homology between pig species except in the sequence of RELA. In particular, allelic variation exists within the gene sequence encoding the transactivation domains of RELA. Palgrave et al. (Journal of Virology, June 2011, p. 6008-6014, Vol. 85, No. 12), which is incorporated herein by reference, describes polymorphisms in the RELA gene which seem to correlate with increased tolerance to ASFV in warthogs.
Such variation in RELA is notable given the absence of sequence variation that exists in other components of the NFkappaB and similar pathways between pig species, for example PPIA, NFATC1 regulatory domain and NFKBIA genes.
The present invention provides a genetically edited animal that has altered RELA expression or activity. These animals can be generated by an efficient biomolecular approach utilising genome editing technology. Differences in NFkappaB activity that reflect the level of p65 activity are likely to affect how an individual animal responds to pathogen challenge and to other forms of biological stress or insult. In particular, this genetic variation is highly likely to impact on how pigs respond to ASFV and, potentially, other viruses in addition to infection by other forms of pathogen. Additionally, animals with altered NFkappaB levels or activity are likely to exhibit marked difference in chronic and autoimmune disease severity.
In a first aspect the present invention provides a genetically edited non-human animal comprising a genetic modification which alters the expression or activity of the RELA protein.
RELA protein is a predominant component of the NFkappaB heterodimeric transcription factor. As such, genetic editing which reduces the levels or activity of RELA will directly affect NFkappaB dependent cell activities, in particular transcription from NFkappaB induced genes. NFkappaB is a key effector of animal responses to various stresses, including infection. Genetically edited animals with altered RELA expression or activity will therefore react differently to their non-edited counterparts in response to biological stresses or insults, such as infection, chronic and/or autoimmune diseases.
The cDNA sequence of Sus scrofa RELA is shown in FIG. 1 (SEQ ID NO 1), and the amino acid sequence is shown in FIG. 2 (SEQ ID NO 2). The RELA sequences in other animals are available on GenBank, e.g. cow (NM_001080242.2) (SEQ ID NO.: 38) and chicken (NM_205129.1) (SEQ ID NO.: 39).
Preferably the expression or function of the RELA protein in the genetically edited animal is reduced when compared to a corresponding non-genetically edited animal, i.e. in which the RELA protein is homozygous âwild-typeâ (e.g. in pigs homozygous âEurasian wild typeâ). Overall activity of RELA in an animal can be reduced by reducing the amount of RELA which is present, by reducing the activity of RELA, or a combination of both. The present invention contemplates all of these options. For example, one could reduce RELA levels by knocking out one allele of the wild-type allele, while the other is left unaltered; in such an animal there would be approximately a 50% reduction in RELA levels, but the activity of the remaining RELA would be unchanged. Alternatively, alterations to one or both of the RELA alleles could be introduced which reduce, but which do not eliminate RELA activity. In such an animal the levels of RELA may be substantially unchanged, but RELA activity is reduced because the RELA protein present is less active. The third option is that both the level of RELA and its activity can be reduced, and this can be achieved through a single edit, or through multiple edits to the gene and/or regulatory sequences. If RELA activity in an animal is completely abolished then the animal is typically non-viable, and therefore that is not a preferred option
In a preferred embodiment of the invention the genetically edited animal is a pig. Preferably the animal is of the species Sus scrofa or Sus scrofa domesticus. However, the genetically edited animal can be a cow, sheep, goat or chicken, amongst others.
In general, the discussions below will focus on RELA in pigs. However, it should be noted that RELA is highly conserved across animal species and thus equivalent editing events could be applied to the genome of other domestic animal species.
Preferably all cells of the non-human animal contain the genetic edit. This can be achieved, for example, by modifying the single-cell zygote. A genetic editing event is often referred to as an âindelâ, and that term will be used at various instances below. An âindelâ can be an insertion, a deletion or a substitution.
In a preferred embodiment the modification is a modification to the genome of the animal, especially a modification of the sequence of the RELA gene. The modification could also be to one or more control sequences which modulate the expression of the RELA gene. Preferably the modification disrupts or alters the RELA gene sequence such that there is an overall reduction of RELA activity in the animal's cells.
Alternatively, the modification could be separate from the RELA gene and result in the expression of a modulator of RELA expression, e.g. by interfering with normal transcription or translation of the gene. Such a modulator could be a siRNA or antisense polynucleotide which is adapted to reduce expression of RELA. However, this is generally a less preferred embodiment of the present invention.
It is generally preferred that the modification involves an alteration to the coding regions of the RELA gene, i.e. corresponding to the cDNA set out in SEQ ID NO 1. The modification may result in a change of one or more amino acids relative to the wild type Eurasian RELA sequence shown in SEQ ID NO 2. The modification could, however, be to non-coding sequences such as introns or splice sites.
In one embodiment of the invention, the genetically edited animal comprises a modification that substantially or completely knocks out the expression or activity of the RELA protein. In such an embodiment it is highly preferred that the modification is mono-allelic, i.e. the animal is heterozygous and retains one functional copy of the wild-type allele (RELAâ/RELA+). Where both alleles are abrogated (i.e. a RELA null, homozygous RELAâ/RELAâ), and no functioning RELA is produced, the animal is generally non-viable and typically dies in utero. In one embodiment of the invention one RELA allele is abrogated and the other allele is not edited, i.e. it is wild type RELA. In such an animal there would be approximately 50% of normal levels of wild type RELA. Alternatively, one RELA allele could be abrogated and the other could be modified in a manner which does not completely eliminate RELA expression or activity. An abrogating modification could prevent transcription of the RELA protein, it could result in production of a non-functional mRNA, or it could result in translation of an mRNA to form a non-functional protein. There are a wide variety of modifications which could be carried out to substantially abrogate expression or function of RELA, and they would be readily apparent to the person skilled in the art. For example, such a modification could delete at least a portion of the RELA gene or it could cause a frame-shift in the open reading frame (ORF).
Alternatively, the modification alters, e.g. reduces, the expression or activity of the edited RELA gene or protein from the edited allele. Such a modification does not completely abrogate the expression or activity of the edited gene or protein from the allele, but, rather, reduces the level of RELA expressed in the cell and/or the ability of RELA to induce NFkappaB dependent induced gene expression.
For example, a modification could be made to disrupt regulatory sequences of the RELA gene, and thus reduce RELA expression from that allele. Alternatively, the RELA gene could be modified such that the RELA protein expressed from it is less active.
In a preferred embodiment the modification reduces the activity of the RELA protein, e.g. by reducing its ability to be activated by protein modification (e.g. phosphorylation) or protein/protein interaction. In a particularly preferred embodiment of the invention the modification results in a change in a transactivation domain of the RELA protein. Suitably, the modification can alter an activation site on the RELA protein, e.g. by removing or modifying a phosphorylation site.
Where a modification to a RELA allele reduces, but does not abrogate expression or activity of the RELA gene or protein expressed from that allele, then it is possible, and indeed may be desirable, that the genetic modification is bi-allelic.
Editing of the RELA gene sequence can suitably be achieved by any one or more of:
As mentioned above, it can be preferred that the modification is located in a region of the RELA gene which encodes the transactivation domain of RELA. In pigs such domains extend from amino acid 431 to 553 of the wild type RELA protein sequence (unless otherwise stated, nucleic acid and amino acid numbering is with reference to the wild type Sus scrofa RELA cDNA or protein sequences shown in FIGS. 1 and 2). Transactivation domain 2 extends from amino acid 431 to 521 and transactivation domain 1 extends from amino acid no 522 to the C-terminus of the protein at amino acid 553. More preferably the modification is located in a region extending from amino acid 448 to 531 of RELA.
In a preferred embodiment the modification causes a change in the amino acid located at one or more of the following sites of RELA:
Suitably the amino acids at two or more of these sites are altered, and optionally the amino acids at all three of the sites are altered.
The modifications may suitably result in the following changes in the amino acids of RELA:T448A, S485P, and/or S531P. These alterations correspond to polymorphisms which have been observed between domestic pigs and warthogs. These polymorphisms correlate with tolerance to ASFV infection in warthogs. Warthogs contain several other polymorphism but they do not affect the expressed amino acid sequence.
In a particularly preferred embodiment the genetically edited animal has a modification which results in a change in the amino acid at position 531 of RELA. Experimental data indicates that, of the three polymorphic sites observed in warhogs versus domestic pigs, the change at position S531 have the most significant role in modulating RELA activity. Thus modifications to this site are of principal interest. S531 is a phosphorylation site on RELA, and it is highly likely that phosphorylation of this site has a role to play in the activation of RELA, and hence NFkappaB.
Thus, in a particularly preferred embodiment of the present invention, the genetically edited animal comprises a modification which inactivates or destroys the phosphorylation site at amino acid position S531 in RELA, or a corresponding phosphorylation site in RELA of other species. The modification could alter a single amino acid, e.g. changing the serine to another amino acid which is not amenable to phosphorylation, or it could involve deleting or replacing a larger portion of the protein or making distal changes to the protein which cause a conformational change which inactivates the phosphorylation site.
The present invention provides a genetically edited pig wherein the RELA gene has been edited such that it comprises a sequence which encodes a RELA protein with a sequence as set out in any one of the following (the amino acids at sites 448, 485 and 531 are shown in bold):
One Amino Acid Change Present
| LLQLQFDADEDLGALLGNNTDPTVFTDLASVDNSEFQQLLNQGVSMPPHTA |
| EPMLMEYPEAITRLVTGSQRPPDPAPTPLGASGLTNGLLSDGEDFSSIADM |
| (changeâT448Aâ-âSEQâIDâNOâ3) |
| LLQLQFDTDEDLGALLGNNTDPTVFTDLASVDNSEFQQLLNQGVPMPPHTA |
| EPMLMEYPEAITRLVTGSQRPPDPAPTPLGASGLTNGLLSDGEDFSSIADM |
| (changeâS485Pâ-âSEQâIDâNOâ4) |
| LLQLQFDTDEDLGALLGNNTDPTVFTDLASVDNSEFQQLLNQGVSMPPHTA |
| EPMLMEYPEAITRLVTGSQRPPDPAPTPLGASGLTNGLLPDGEDFSSIADM |
| (changeâS531Pâ-âSEQâIDâNOâ5) |
Two Amino Acid Changes Present
| LLQLQFDADEDLGALLGNNTDPTVFTDLASVDNSEFQQLLNQGVPMPPHTA |
| EPMLMEYPEAITRLVTGSQRPPDPAPTPLGASGLTNGLLSDGEDFSSIADM |
| (changesâT448AâandâS485Pâ-âSEQâIDâNOâ6) |
| LLQLQFDTDEDLGALLGNNTDPTVFTDLASVDNSEFQQLLNQGVSMPPHTA |
| EPMLMEYPEAITRLVTGSQRPPDPAPTPLGASGLTNGLLPDGEDFSSIADM |
| (changesâT448AâandâS531Pâ-âSEQâIDâNOâ7) |
| LLQLQFDTDEDLGALLGNNTDPTVFTDLASVDNSEFQQLLNQGVPMPPHTA |
| EPMLMEYPEAITRLVTGSQRPPDPAPTPLGASGLTNGLLPDGEDFSSIADM |
| (changesâS485PâandâS531Pâ-âSEQâIDâNOâ8) |
Three Amino Acid Changes Present
| LLQLQFDADEDLGALLGNNTDPTVFTDLASVDNSEFQQLLNQGVPMPPHTA |
| EPMLMEYPEAITRLVTGSQRPPDPAPTPLGASGLTNGLLPDGEDFSSIADM |
| (changesâT449A,âS485PâandâS531Pâ-âSEQâIDâNOâ9) |
The present invention also provides a domestic pig which has been edited such that at least a portion of the autologous RELA sequence has been replaced with a sequence which encodes the corresponding warthog (Phacochoerus sp.) RELA protein sequence. The inserted nucleic acid sequence can be identical to the warthog sequence or can be an equivalent artificial sequence with synonymous base changes. Preferably the portion which is replaced in such an introgression includes the sequences encoding S531, and optionally includes the sequences encoding T449 and/or S485.
For example, in one preferred embodiment a portion of the autologous RELA gene has been removed and the following corresponding sequence has been inserted.
| (SEQâIDâNOâ10) |
| GAACCAGGGTGTAcCcATGCCtCCtCACACAGCcGAGCCCATGCTGATGGA |
| aTAtCCTGAGGCcATAACcCGCTTGGTcACAGGcTCgCAGAGACCtCCcGA |
| CCCtGCTCCtACTCCtCTGGGGGCCTCgGGGCTgACCAAtGGTCTCCTCcC |
| cGGGGACGAgGACTTC |
Such an introgression causes amino acid changes at sites S485 and S531P. This sequence codes for the warthog RELA protein sequence, but it has been slightly altered to introduce some synonymous nucleic acid changes to the warthog DNA sequence. The synonymous changes were made so that preferred ZFN and TALEN pairs, which can be used during the introgression process, are unlikely to bind. The synonymous changes are shown in lower case, while the changes which cause the S485P and S531P alterations are shown in bold.
In another preferred embodiment a portion of the autologous RELA gene has been removed and the following sequence has been inserted:
| (SEQâIDâNOâ11) |
| GTTTGATgCTGATGAGGACCTGGGGGCCCTGCTCGGCAATAACACTGACCC |
| GACCGTGTTCACGGACCTGGCATCCGTCGACAACTCTGAGTTTCAGCAGCT |
| GCTGAACCAGGGTGTAcCcATGCCtCCtCACACAGCcGAGCCCATGCTGAT |
| GGAaTAtCCTGAGGCcATAACcCGCTTGGTcACAGGcTCgCAGAGACCtCC |
| cGACCCtGCTCCtACTCCtCTGGGGGCCTCgGGGCTgACCAAtGGTCTCCT |
| CcCcGGGGACGAgGACTTC |
Such an introgression causes amino acid changes at sites T448A, S485 and S531P. The lower case and emboldened bases have the same meaning as in SEQ ID NO 10.
Expression levels of RELA can be determined by directly measuring the amount of protein or by measuring the amount of RELA mRNA in a cell or tissue of the non-human animal. There are a number of well-established quantitative assays for measuring protein levels, e.g. ELISA. Quantitative measurement of RELA mRNA levels can be measured using quantitative real-time reverse transcription polymerase chain reaction (qRT-PCR). Techniques for performing suitable ELISA and qRT-PCR techniques are well known to the person skilled in the art, and suitable antibodies and PCR primers can be readily obtained or generated. In preferred embodiments of the invention where the expression levels of RELA are reduced, but the remaining RELA is fully functional wild-type Sus scrofa RELA, suitably the amount of RELA protein or RELA mRNA is between 30% and 70% of normal levels. Preferably the amount of RELA protein or RELA mRNA is between 40% and 60% of normal levels, and most preferably around 50% of normal levels. âNormal levelsâ are defined as the levels measured in a control cell, i.e. the same cell type as the cell being tested, under identical conditions, but wherein the control cell has not been genetically edited.
Such assays can be performed on tissue (e.g. skin) or cells (e.g. primary fibroblasts isolated from skin biopsy or PBMCs isolated from blood) isolated from the genetically edited animal. A preferred cell type for assaying is the macrophage.
In terms of RELA activity, because RELA is a predominant component of the NFkappaB transcription factor, changes to the activity of RELA following genetic modification can therefore be determined using a test which assesses the levels of activity of the NFkappaB pathway in a cell. This can be assessed by measuring the level of proteins or mRNAs which are induced by NFkappaB, e.g. by qRT-PCR or ELISA. The cells or tissues to be tested can suitably be subjected to a challenge which stimulates the NFkappaB pathway, e.g. stress, lipopolysaccharide (LPS), phorbol-12-myristate-13-acetate, hydrogen peroxide, viral infection, cytokines, irradiation or the like. Suitable tissues and cells can include pig tissue (e.g. skin) or cells (e.g. primary fibroblasts isolated from skin biopsy, PBMCs isolated from blood) isolated from edited pigs, with or without stimulation, e.g. by LPS, TNFalpha, CSF1. A list of genes targeted by NFkappaB can be found in Pahl H L, âActivators and target genes of Rel/NFkappaB transcription factorsâ, Oncogene 1999 November 22; 18(49):6853-66 and in Li X, Stark G R; âNFkappaB-dependent signalling pathwaysâ, Exp Hematol. 2002 April; 30(4):285-96. The person skilled in the art can select suitable markers from these or other genes known to be activated by NFkappaB. Exemplary indicator genes which could be profiled include TNFalpha, SOD2, CSF1, and HMOX1.
Genetically edited animals according to the present invention preferably demonstrate one or more of the following phenotypes:
More particularly, beneficial effects of the genetic modification may include improved tolerance to:
In a particularly preferred aspect of the present invention the genetically edited animal is a pig which has improved tolerance to ASFV infection.
An animal can be said to be more tolerant to infection when the morality rate, morbidity rate, the proportion of animals showing significant morbidity (e.g. weight loss or decreased growth rate), the level of morbidity or the duration of morbidity is reduced. In the case of ASFV in domesticated pigs, the morbidity rate approaches 100% in naive herds. The mortality rate depends on the virulence of the isolate, and can range from 0% to 100%. Highly virulent isolates can cause almost 100% mortality in pigs of all ages. Less virulent isolates are more likely to be fatal in pigs with a concurrent disease, pregnant animals and young animals. In sub-acute disease, the mortality rate may be as high as 70-80% in young pigs, but less than 20% in older animals. Any statistically significant reduction (e.g. 95% confidence, or 99% confidence using an appropriate test) in the mortality or morbidity between a population of genetically edited pigs and a population of equivalent non-edited pigs when exposed to ASFV of the same virulence level (ideally the same isolate) demonstrates improved tolerance.
According to a second aspect of the invention there is provided a cell nucleus, germ cell, stem cell, gamete, blastocyst, embryo, foetus and/or donor cell of a non-human animal comprising a genetic modification which alters the expression or function of RELA protein.
Suitably the cell nucleus, germ cell, stem cell, gamete, blastocyst, embryo, foetus and/or donor cell is derived from a non-human animal as set out above. Alternatively, it can be created de novousing the methods described herein, or by other methods known to the skilled person, which allow editing of the genome of an animal cell.
According to a third aspect the invention provides a method of producing a genetically edited non-human animal comprising the steps of:
The editing step suitably comprises:
The non-human animal cell can be a somatic cell, a gamete, a germ cell, a gametocyte, a stem cell (e.g. a totipotent stem cell or pluripotent stem cell) or a zygote.
The method can optionally involve cloning, e.g. somatic cell nuclear transfer (SCNT). In such an embodiment the genetic editing event is carried out on a somatic cell, after which the edited nucleus is transferred to an enucleated egg cell. Typically a population of somatic cells will be edited and cells in which a desired editing event has occurred will be used to provide donor nuclei for SCNT. Processes for SCNT have been well described in the art and would be known to the skilled person.
However, it is an advantage of the present invention that editing can be performed without the need for cloning.
Preferably the method is performed on a zygote. The term âzygoteâ can be used in a strict sense to refer to the single cell formed by the fusion of gametes. However, it can also be used more broadly to refer to the cell bundle resulting from the first few divisions of the true zygoteâthis is more properly known as the morula.
It is preferred that the present method is at least initiated, and preferably completed, in the zygote at the single cell stage. This should result in all cells of the animal containing the same edit. It is, however, possible that the zygote may divide while the editing process is occurring. Depending on when the cell division occurs relative to the stage of the editing process, it is possible that one of the following will occur:
Editing can also be conducted at after the first cell division, and the results may be of interest. However, this is generally not preferred where the desired result is a non-mosaic animal.
Accordingly, in a preferred embodiment the method comprises the steps of:
It should be noted that the site specific nuclease can be introduced to a cell in any suitable form. For example, the nuclease can be provided directly into the cell as a functional protein. Alternatively, the nuclease can be provided into the cell in the form of a precursor or template from which the active nuclease is produced by the cell. In a preferred embodiment an mRNA encoding the nuclease is introduced into the cell, e.g. by injection. The mRNA is then expressed by the cell to form the functioning protein. Using mRNA in this way allows rapid but transient expression of the nuclease within the cell, which is ideal for the purposes of genetic editing.
It should also be noted that the term ânucleaseâ is intended to cover any biological enzyme which creates a single or double stranded cut of a target nucleic acid. Accordingly, the term includes nickases and recombinases, as well as more conventional nucleases which cause single or double stranded breaks.
The method may comprise inserting a heterologous sequence in the RELA gene at the target site. Such a heterologous DNA sequence can replace and/or disrupt the endogenous DNA sequence. This can be achieved by introducing a suitable template DNA molecule to the cell, such as single or double-stranded DNA molecule, which will be inserted by the cell's DNA repair mechanisms or an exogenous recombinase. Exemplary DNA sequences for insertion are described above, but many others could of course be used.
The genetically edited zygote can be grown to become an embryo and eventually an adult animal. As discussed above, if the editing event occurs in the single-cell zygote then all cells of this animal will therefore comprise the modified RELA gene as all cells of the animal are derived from a single genetically edited cell. If the editing event occurs after one or more cell divisions then the resultant animal will likely be a mosaic for the editing event, in that it will have some cells derived from the edited cell and some cells derived from unedited cells.
The method may involve characterising the genetic modification which has occurred. Suitable methods to achieve this are set out below.
The method can be performed on a plurality of zygotes and the method may involve selecting zygotes in which the desired genetic modification has been achieved.
Where the modification to the zygote is intended to knock out the expression or activity of the RELA gene or the RELA protein, the method may suitably comprise selecting for zygotes in which the modification is mono-allelic. Given that bi-allelic edited zygotes are typically non-viable, the method of selection may simply be selecting for zygotes which have been edited, but which do survive to birth.
Preferably the nuclease comprises a pair of transcription activator-like effector nucleases (TALENs) or zinc finger nucleases (ZFNs). Such nucleases are well known in the art and comprise a nuclease moiety fused to a sequence-specific DNA binding moiety. The nuclease activity requires a pair of the nuclease moieties to form the active nuclease dimer. Such nucleases are well adapted to site-specific cleaving of DNA molecules, and techniques to target said nucleases to any desired sequences are known to the skilled person and described below. The TALENs or ZFNs can be tailored to target suitable sequences to achieve the desired DNA cut. By inducing a cut in the DNA the cell repairs the cut by NHEJ or HDR. The former is an error prone system and therefore can be used to introduce edits as a result of errors. The latter can be used to introduce a heterologous sequence into the cell.
Alternatively, the nuclease may comprise a nickase. Nickases are like TALENs or ZFNs in many ways, but they cause only a single strand break. This can be an advantage in inducing accurate homology-directed repair, which is particularly useful in the present invention to create a desired introgression. Nickases are described in Ramirez et al. âEngineered zinc finger nickases induce homology-directed repair with reduced mutagenic effectsâ Nucleic Acids Research, 2012, 1-9 doi:10.1093/nar/gks179.
Another option is that the nuclease comprises a recombinase. Recombinases are a group of enzymes which allow very precise manipulation and editing of DNA. Although they are not currently as versatile as TALENs, ZFNs and nickases, they have significant potential to allow very tightly controlled editing events. Recombination controlled by recombinases can be used to accurately paste a sequence of interest into the RELA gene.
Another option is that the nuclease comprises an RNA-guided site-specific nuclease, such as the CRISPR/Cas system described in Cong et al. âMultiplex Genome Engineering Using CRISPR/Cas Systemsâ, Science, 15 Feb. 2013: Vol. 339 no. 6121 pp. 819-823. Such systems use an RNA molecule to target a specific sequence in to be cleaved by the nuclease, in the case of the CRISPR/Cas system âspacerâ sequences are used to target the nuclease. Suitable spacers can be created and used to target the Cas nuclease to the desired location in the RELA gene and thus cause double-stranded breaks in the DNA whereupon NHEJ would result in the introductions of indels.
Of course, in this rapidly developing field, other techniques for genetic editing are likely to become available. Such techniques could in many cases be readily adapted for use in the present invention.
Preferably the nuclease is adapted to target sequences in the region of the RELA gene which encodes the transactivation domain of the RELA protein. The regions of particular interest are discussed in more detail above.
The site specific nuclease can be adapted to target a sequence proximal to the sequences encoding one or more of amino acids T448, S485, and S531. For example the nuclease can be targeted such that they make a single or double stranded cut within 100 bases, preferably within 50 bases, more preferably within 20, yet more preferably within 10 bases, and most preferably within 5 bases bases of the sequence encoding these amino acids. Non-homologous end joining and/or homology-directed repair can then be utilised to edit any one of amino acids T448, S485, and S531, any two of amino acids T448, S485, and S531, or all three amino acids.
Two or more pairs of TALENs, ZFNs or other such nucleases can be adapted to excise a region of DNA which encodes any one of amino acids T448, S485, and S531, any two of amino acids T448, S485, and S531, or all three amino acids.
In preferred embodiments the site specific nucleases are TALENs or ZFNs and are adapted to target the sequences shown in FIGS. 4 and 5, i.e. for TALENs GCCCCCCCACACAGCTG (SEQ ID NO 12) and AGTACCCTGAGGCTAT (SEQ ID NO 13), and for ZFNs CTGAGGCTATAACTC (SEQ ID NO 14) and GACAGGGTCCCAGAG (SEQ ID NO 15). However, site specific nucleases adapted to target other suitable target sequences could of course be used.
The method may suitably comprise delivering a single or double-stranded DNA molecule comprising or consisting of a sequence as set out in SEQ ID NOs10 or 11. As mentioned above, this sequence corresponds to a portion of the warthog RELA gene which includes polymorphisms at sites encoding amino acids T448, S485, and S531.
The method may comprise one or more of the step of testing the ability of the animal to tolerate challenge with a pathogen, e.g. a virus. For example, where the animal is a pig, the method may involve testing the ability of the genetically edited animal to survive infection with a highly virulent ASFV.
According to a fifth aspect of the present invention there is provided a method of screening the efficacy of a pharmaceutical agent or the virulence of a pathogen including the steps of:
The invention will be further described by way of the following examples, which are in no way intended to limit the scope of the invention. The examples refer to the accompanying drawings, in which:
FIG. 1 shows the Sus scrofa RELA cDNA sequence, GenBank accession number NM_001114281 (SEQ ID NO 1).
FIG. 2 shows the Sus scrofa RELA amino acids sequence, GenBank accession number NP_001107753 (SEQ ID NO 2).
FIG. 3 shows the Sus scrofa RELA primary amino acid sequence showing allelic variation in transactivation domains and Rel homology domain (see also Palgrave et al, 2011). Domestic pig sequence EMBL deposited number FN999988. Warthog pig sequence EMBL deposited number FN999989. The full domestic pig (Sus scrofa) sequence is provided and underneath, positions where the warthog sequences differs are indicated, i.e. T448A, S485P and S531P (SEQ ID NO 18).
FIG. 4 shows the Sus scrofa genomic sequence showing the editor binding sites in bold. Sequence locations marked refer to porcine RELA cDNA, Accession number NM_001114281; fully genomic Sus scrofa sequence accession number NC_010444, specifically between 5699452 and 5707267 of Assembly 10.2 (SEQ ID NOS 19 and 29).
FIG. 5 shows a diagram of the Sus scrofa RELA genomic sequence (SEQ ID NO 37) with TALEN (boxes; TALEN11-1L and TALEN11-1R) and ZFN (boxes ZFN1 and ZFN2) binding sites identified; relative positioning of PCR primers also shown (boxes ss p65NJF1 and ssp65NJR1).
FIG. 6 shows gel electrophoresis identification of editing events by Cell assay. Amplified products were digested with Cell and assessed by gel electrophoresis. Minor bands lower down the gel below dominant band indicate mismatch and editing event. The first 2 gels identify heterozygous (one allele) editing events; third gel identifies homozygous (bi-allelic events) through sample mixing assay.
FIG. 7 shows exemplar sequence of RELA edited site (indel). Sequencing trace and sequence interpretation of indels at porcine RELA in two individual pigs (#16 and #26) are shown (SEQ ID NOS 32 to 36, relative to order shown in Fig).
FIG. 8 shows the location of TALEN, ZFN and PCR primers for sequencing amplicon; porcine RELA sequence 769417-769110 accession number NW_003609513.1 (SEQ ID NO 37).
FIG. 9 shows an example Cell Assay; lanes A2, A12, B6, B14 and B20 were identified as having cleavage products consistent with editing events at the target site. Direct sequencing of the same PCR products confirmed this interpretation and identified B12, B16, B17 and B18 as having only wild-type sequence.
FIG. 10 shows specific indels identified in several piglets (SEQ ID NOS 19 to 31).
Two types of editor were used: TALEN and ZFN. Both were designed to target the same region of porcine RELA gene.
TALEN: All TALENs were designed using the TALE-NT software and assembled using methods described in Cermak et al. (2011)âNucl. Acids Res. (2011) 39 (12): e82. Briefly, intermediary arrays were produced for each TALEN pair that were compatible for Golden Gate cloning into pC-+63-TAL modified vector (although other vectors such as pC-+231-TAL, RCIscript-+231-TAL, pC-GoldyTALEN or RCIscript-GoldyTALENetc. could be used). Arrays were joined in the above vectors as follows; 150 ng each pFUS_A, pFUS_B, pLR-X and the desired backbone were mixed in a 20 Îźl digestion/ligation reaction including 50 units T4 DNA ligase (New England Biolabs) and 10 units Esp3I (Fermentas) in 1ĂT4 ligase buffer (New England Biolabs). The reaction was incubated in a thermocycler for 10 cycles of 5 min at 37° C. and 10 min at 16° C., then heated to 50° C. for 5 min and then 80° C. for 5 min. Two microliters of each reaction was transformed into E. coli and plated on LB-carbenicillin plates. Plasmid DNA was purified and mRNA synthesized from SacI linearized RCIscript vectors using the mMessage Machine T3 Kit (Ambion).
The target sequences for the TALENs used in this work are shown in FIGS. 4 and 5. It is of course possible that TALENs targeting other sequences within the RELA gene, or indeed elsewhere in the pig genome, could be used in the present invention. The person skilled in the art could readily construct TALENs adapted to target essentially any other desired sequence using the same techniques described above.
ZFN: ZFNs targeted to porcine RELA were purchased from Sigma who use Sangamo algorithm to assist design of modules from the Sangamo archive to assemble the zinc finger proteins and attach the FokI nuclease domain to create the ZFN. The ZFN was supplied by Sigma as mRNA.
ZFNs targeted at other sequences of interest can also be commercially sourced.
A useful summary of gene editing using site specific nucleases can be found in the recent review by Moira A McMahon, Meghdad Randar & Matthew Porteus, âGene editing: not just for translation anymoreâ, Nature Methods, Vol. 9, No. 1, January 2012.
Target sites for the designed TALENs and ZFNs (FIGS. 4 and 5) are shown with reference to the nucleic acid numbering system of the RELA cDNA (as shown in FIG. 1), GenBank accession number NM_001114281 (SEQ ID NO.: 1); the TALEN target site is located between bases 1458 to 1505; the ZFN target site is located between bases 1496 to 1432. The full genomic Sus scofa genomic sequence NCBI Reference Sequence accession number is NC_010444 Assembly 10.2.
To establish the frequency of gene editing in pig embryos an in vitro embryo culture experiment was performed.
Pig ovaries were collected, washed with pre-warmed phosphate buffered saline at 38.5° C. and follicles aspirated. Oocytes were washed in TL HEPES PVA before culturing in maturation medium for 44 hours (22 hours plus hormones and 22 hours minus hormones; 38.5° C., 5% CO2), followed by gentle pipetting to remove cumulus cells and incubation with prepared sperm for 6 hours (38.5° C. in 5% CO2). Zygotes were transferred to NCSU-23 HEPES base medium and subjected to a single 2-10 Οl cytoplasmic injection of mRNA at 2, 10 or 25 ng/Οl. The 25 ng/Οl mRNA sample consisted of 20 ng/Οl of either a TALEN or ZFN pair mRNA and 5 ng/Οl EGFP mRNA. The 10 and 2 ng/Οl mRNA samples were dilutions of the 25 ng/Οl sample. Zygotes were cultured in batches for 66 hours (embryo culture medium; 5% CO2, 38.5° C.), following which they were placed individually into micro-droplets of medium under oil for visual inspection or harvested for genotyping.
The results of these experiments are shown in Table 1 below.
| TABLE 1 |
| Frequency of editing events |
| TALEN injections | |||
| Embryos | No edited | % edited/analysed | % edited/born |
| No. embryos analysed | |||
| 120 | 25 | 21% | â |
| No. pigs analysed | |||
| â46 | 8 | â | 17% |
| ZFN injections | |||
| No. pigs analysed | |||
| â9 | 1 | â | 11% |
Gene editing events in porcine embryos were identified by direct sequencing of amplified, isolated DNA and through a gel electrophoresis assay. The latter identified mismatch between the two alleles through digestion by the Cell enzyme.
DNA was amplified from harvested embryos using the REPLI-gÂŽ mini kit, QiagenÂŽ. The REPLI-gÂŽ DNA sample was then used as a template for High fidelity PCR (AccuPrime⢠Taq DNA Polymerase High Fidelity, Invitrogenâ˘) using single-stranded oligonucleotidep65NJF1 (GCAATAACACTGACCCGACCGTG) (SEQ ID NO 16) and single-stranded oligonucleotidep65NJR1 (GCAGGTGTCAGCCCTTTAGGAGCT) (SEQ ID NO 17) as primers designed to amplify a 308 base pair region (see FIG. 5) of the wild-type porcine RELA gene that overlapped the TALEN and ZFN cut sites. The PCR product was then sent for sequence analysis to allow identification of editing events. Alternatively, the PCR products were cloned into a plasmid and individual plasmids sequenced allowing heterozygous and mosaic editing events to be analysed separately. From 56 of the EGFP positive embryos, 16 were confirmed to harbour RELA editing events (often termed an indel). Of these edited embryos, 10 harboured a heterozygous mutation in one allele, while the remaining 6 carried a mutation on both alleles.
The presence of mutations in the RELA gene were additionally identified using a Cell assay (SURVEYORÂŽ mutation detection kit, TRANSGENOMICÂŽ). The high fidelity PCR product was denatured/re-annealed before being subjected to SURVEYORÂŽ nuclease activity which cuts at base mismatches highlighting insertions, deletions and substitutions. The resulting fragments were subsequently separated by gel electrophoresis for analysis with size differences identifying edited indel events.
Gene edited pigs were produced through injection of the TALEN or ZFN mRNA into the cytoplasm of porcine zygotes.
Embryos were produced from Large-White gilts that were approximately 9 months of age and weighed at least 120 kg at time of use. Super-ovulation was achieved by feeding, between day 11 and 15 following an observed oestrus, 20 mg altrenogest (Regumate, Hoechst Roussel Vet Ltd) once daily for 4 days and 20 mg altrenogest twice on the 5th day. On the 6th day, 1500 IU of eCG (PMSG, Intervet UK Ltd) was injected at 20:00 hrs. Eighty three hours later 750 IU hCG (Chorulon, Intervet UK Ltd) was injected.
Donor gilts were inseminated twice 6 hours apart after exhibiting heat generated following super-ovulation. Embryos were surgically recovered from mated donors by mid-line laparotomy under general anaesthesia on day 1 following oestrus into NCSU-23 HEPES base medium. Embryos were subjected to a single 2-5 Îźl cytoplasmic injection of either ZFN or TALEN pair mRNA at 2 ng/Îźl. Recipient females were treated identically to donor gilts but remained un-mated. Following TALEN or ZFN injection, fertilized embryos were transferred to recipient gilts following a mid-line laparotomy under general anaesthesia. During surgery, the reproductive tract was exposed and embryos were transferred into the oviduct of recipients using a 3.5 French gauge tomcat catheter.
Gene editing events in born piglets were identified by direct sequencing of amplified, isolated DNA and through gel electrophoresis assay. The latter identified mismatch between the two alleles through digestion by the Cell enzyme.
The DNA was extracted from tissue samples (e.g. ear skin biopsy) using the DNeasy Blood and Tissue kit, QIAGEN. A sample of purified DNA was then used as a template for High fidelity PCR (AccuPrime⢠Taq DNA Polymerase High Fidelity, Invitrogenâ˘) using single-stranded oligonucleotide p65NJF1 (GCAATAACACTGACCCGACCGTGâSEQ ID NO 16) and single-stranded oligonucleotide p65NJR1 (GCAGGTGTCAGCCCTTTAGGAGCTâSEQ ID NO 17) as primers designed to amplify a 308 base pair region (FIG. 5) of the wild-type porcine RELA gene that overlapped the TALEN and ZFN cut sites. The PCR product was then sent for sequence analysis to allow identification of editing events. Alternatively, the PCR products were cloned into a plasmid and individual clones sequenced allowing heterozygous and mosaic editing events to be analysed separately.
The presence of mutations in the RELA gene were additionally identified using a Cell assay (SURVEYORÂŽ mutation detection kit, TRANSGENOMICÂŽ). The high fidelity PCR product was denatured/re-annealed before being subjected to SURVEYORÂŽ nuclease activity which cuts at base mismatches highlighting insertions, deletions and substitutions. The resulting fragments were subsequently separated by gel electrophoresis for analysis with size differences identifying edited indel events.
From 46 born piglets analysed following TALEN pair zygotic injection, 8 were identified as being genome edited (Table 1). See FIG. 7 for exemplars of direct sequence analysis from 2 of the TALEN genome edited piglets. From 9 born piglets analysed following ZFN pair zygotic injection 1 was identified as being genome edited (Table 1).
The following examples relate to methodology to create pigs with sequences inserted into the RELA gene and to analyse the phenotype of genetically edited pigs.
To establish the frequency of gene editing in pig embryos in vitro embryo culture experiment is performed.
Pig ovaries are collected, washed with pre-warmed phosphate buffered saline at 38° C. and follicles aspirated. Oocytes are washed in TL HEPES PVA before culturing in maturation medium for 44 hours (22 hours plus hormones and 22 hours minus hormones; 39° C., 5% CO2), followed by gentle pipetting to remove cumulus cells and IVF for 6 hours (38.5° C. in 5% CO2). Zygotes are transferred to NCSU-23 HEPES base medium and subjected to a single 2-5 Οl cytoplasmic or pronuclear injection of either ZFN or TALEN pair mRNA between 2 to 10 ng/Οl mixed with from 1 to 10 ng/Οl (optimum concentrations can be determined by experimenter) single-stranded or double-stranded DNA fragment or plasmid. Zygotes are cultured in batches for 66 hours (embryo culture medium; 5% CO2, 38.5° C.), following which they are placed individually into micro-droplets of medium under oil for visual inspection or harvested for genotyping.
Gene introgression events in porcine embryos are identified by direct sequencing of amplified, isolated DNA.
DNA is amplified from harvested embryos using the REPLI-gÂŽ mini kit, QiagenÂŽ. The REPLI-gÂŽ DNA sample is then used as a template for High fidelity PCR (AccuPrime⢠Taq DNA Polymerase High Fidelity, Invitrogenâ˘) using single-stranded primers designed to amplify replicon containing the target region. The PCR product is then sent for sequence analysis to allow identification of editing events. Alternatively, the PCR products are cloned into a plasmid and individual plasmids sequenced allowing heterozygous and mosaic editing events to be analysed separately.
Gene introgression edited pigs are produced through injection of the TALEN or ZFN mRNA in combination with a single-stranded DNA oligo or double-stranded DNA fragment into the cytoplasm or nucleus of porcine zygotes.
Embryos are produced from Large-White gilts that are approximately 9 months of age and which weigh at least 120 kg at time of use. Super-ovulation is achieved by feeding, between day 11 and 15 following an observed oestrus, 20 mg altrenogest (Regumate, Hoechst Roussel Vet Ltd) once daily for 4 days and 20 mg altrenogest twice on the 5th day. On the 6th day, 1500 IU of eCG (PMSG, Intervet UK Ltd) is injected at 20:00 hrs. Eighty three hours later 750 IU hCG (Chorulon, Intervet UK Ltd) is injected.
Donor gilts are inseminated twice 6 hours apart after exhibiting heat generated following super-ovulation. Embryos are surgically recovered from mated donors by mid-line laparotomy under general anaesthesia on day 1 following oestrus into NCSU-23 HEPES base medium. Embryos are subjected to a single 2-5 Îźl cytoplasmic or pronuclear injection of either ZFN or TALEN pair mRNA at 2 to 10 ng/Îźl mixed from 1 to 10 ng/Îźl (optimum concentrations can be determined by experimenter) single-stranded or double-stranded DNA fragment or plasmid.
Suitable sequences are:
| (SEQâIDâNOâ10) |
| GAACCAGGGTGTAcCcATGCCtCCtCACACAGCcGAGCCCATGCTGATGGA |
| aTAtCCTGAGGCcATAACcCGCTTGGTcACAGGcTCgCAGAGACCtCCcGA |
| CCCtGCTCCtACTCCtCTGGGGGCCTCgGGGCTgACCAAtGGTCTCCTCcC |
| cGGGGACGAgGACTTC |
| (SEQâIDâNOâ11) |
| GTTTGATgCTGATGAGGACCTGGGGGCCCTGCTCGGCAATAACACTGACCC |
| GACCGTGTTCACGGACCTGGCATCCGTCGACAACTCTGAGTTTCAGCAGCT |
| GCTGAACCAGGGTGTAcCcATGCCtCCtCACACAGCcGAGCCCATGCTGAT |
| GGAaTAtCCTGAGGCcATAACcCGCTTGGTcACAGGcTCgCAGAGACCtCC |
| cGACCCtGCTCCtACTCCtCTGGGGGCCTCgGGGCTgACCAAtGGTCTCCT |
| CcCcGGGGACGAgGACTTC |
Recipient females are treated identically to donor gilts but remain un-mated. Following TALEN or ZFN plus DNA injection, fertilized embryos are transferred to recipient gilts following a mid-line laparotomy under general anaesthesia. During surgery, the reproductive tract is exposed and embryos are transferred into the oviduct of recipients using a 3.5 French gauge tomcat catheter.
Gene introgression events in born piglets are identified by direct sequencing of amplified, isolated DNA.
The DNA is extracted from tissue samples (e.g. ear skin biopsy) using the DNeasy Blood and Tissue kit, QIAGEN. A sample of purified DNA is then used as a template for High fidelity PCR (AccuPrime⢠Taq DNA Polymerase High Fidelity, Invitrogenâ˘) using single-stranded oligonucleotides p65NJF1 (GCAATAACACTGACCCGACCGTGâSEQ ID NO 16) and single-stranded oligonucleotide p65NJR1 (GCAGGTGTCAGCCCTTTAGGAGCTâSEQ ID NO 17) designed to amplify a 308 base pair region (FIG. 5) of the wild-type porcine RELA gene that overlapped the TALEN and ZFN cut sites. The PCR product was then sent for sequence analysis to allow identification of editing events. Alternatively, the PCR products were cloned into a plasmid and individual clones sequenced allowing heterozygous and mosaic editing events to be analysed separately.
To assess the effect of editing of the RELA locus on RELA levels one can utilise qRT-PCR and RELA protein levels by Western blot and ELISA in pig tissue (e.g. skin) or cells (e.g. primary fibroblasts isolated from skin biopsy, PBMCs isolated from blood) isolated from edited pigs. Suitable primers and probes for qRT-PCR can readily be determined by the person skilled in the art.
RELA is a predominant component of the NFkappaB transcription factor. To assess the effect of editing of the RELA locus on NFkappaB signalling one can perform qRT-PCR for genes known to be activated by NFkappaB on pig tissue (e.g. skin) or cells (e.g. primary fibroblasts isolated from skin biopsy, PBMCs isolated from blood) isolated from edited pigs with or without stimulation, e.g. by LPS, TNFalpha, CSF1.
To assess the effect of editing of the RELA locus on the cellular response to virus challenge PBMCs from blood are isolated. Cultured PBMCs, either with or without CSF1, are exposed to virus challenge (e.g. influenza virus, PRRSV). The signalling response to virus challenge is assessed by expression profiling.
There have been described a number of methodologies to modify (edit) the genome of pigs. These methodologies can readily be adapted to modify the genetics of other animals, such as cows, sheep, goats and chickens.
In pigs the modification of RELA can provide increased tolerance against ASFV. This provides a novel mechanism by which tolerance to this extremely significant pathogen can be created. The commercial and ecological importance of this is great. Domestic pig production in Africa is severely restricted because of the effects of ASFV. Outside of Africa, ASFV is endemic in feral pigs in Sardinia, Italy. In 2007 it was introduced into the Caucasus, and has apparently become endemic among wild boars in the region. There have been outbreaks of the virus in domesticated swine in the Republic of Georgia, Russia, Armenia, Azerbaijan and other countries in the region. There is thus a great need to protect against the spread of this disease and also to mitigate the risk should controlling prove impossible. The present invention has the potential to significantly mitigate the problems should ASFV infection become more widespread and raises the possibility of increasing pig production in Africa.
Additional work was conducted to further demonstrate the power of the above mentioned gene editing techniques. In this work it is demonstrated that both TALEN and ZFN technology can be efficiently applied to engineer pig zygotes that result in gene edited live births, both mono- and bi-allelic (Table 2), significantly broadening the use of editor technology in livestock.
We performed cytoplasmic editor injection into porcine zygotes, given the difficulty associated with visualization of the pronucleus in porcine zygotes. Oocytes were harvested from slaughterhouse material for in vitro studies and superovulated artificially inseminated sows for embryos destined for transfer into recipients. Initially 208 zygotes were subjected to a single cytoplasmic injection of 10 Îźl of a solution composed 20 ng/Îźl RELA TALEN mRNA with 5 ng/Îźl EGFP mRNA (to enable visual identification and isolation of embryos that functionally translated the injected mRNA). After approximately 3 days of in vitro development, GFP fluorescence was detected in 36% of embryos. Thus mRNA injected into the cytoplasm of pig zygotes translates to functional protein in the embryo. GFP positive embryos were screened for editing events by Cell surveyor assay (FIG. 9) and sequencing of PCR amplified fragments (shown below and in FIG. 10). We detected 16 editing events in 46 GFP-positive embryos analysed (35%). In a second experiment we tested 34 embryos injected with 2 Îźl of 20 ng/Îźl RELA TALEN mRNA but without selection for GFP activity, and detected 2 editing events (6%). In two further experiments where 2 Îźl of 10 ng/Îźl or 2 Îźg/Îźl RELA TALEN mRNA was injected, 0% and 18% editing frequency, respectively, was observed. Thus, in total we identified 21 editing events in porcine embryos in vitro (21% of tested embryos), and a high frequency of these editing events were biallelic in nature (29% of editing events). Calculating this as a frequency of tested embryos, we achieved a biallelic editing frequency of 6%.
Since both the highest and lowest tested concentrations of RELA TALEN mRNA produced edited embryos in vitro we elected to transfer zygotes injected with each tested TALEN amount into recipient sows and allow pregnancies to develop to term. Pregnancy rates for the higher concentrations of RELA TALEN mRNA were poor; 1 out of 2 transfers and 0 out of 2 transfer for embryos injected with 10 ng/Îźl or 20 ng/Îźl, respectively. This poor pregnancy rate reflect the visual observation that 2 ng/Îźl RELA TALEN mRNA injected embryos developed better in vitro than those injected with higher concentrations of TALEN mRNA. The one pregnancy from 10 ng/Îźl delivered 7 piglets, none of which harboured RELA editing events by direct sequencing of PCR amplified products. We did not pursue transfers of embryos with these higher TALEN mRNA concentrations any further.
In contrast, transfer of embryos injected with 2 ng/Îźl RELA TALEN RNA resulted in 5 pregnancies from 7 recipients. One subsequently aborted at 15 weeks of pregnancy just prior to parturition; analysis of the 9 foetuses carried revealed 3 to have editing events. In total from the remaining 4 farrowings, 39 piglets were produced of which 8 carried editing events (21%). Of the 8 editing events, 2 animals were stillborn and a further 1 died neonatally due to being crushed by the mother; 5 are still alive.
In parallel we tested a ZFN with a target location of 1496 to 1532 bp relative to the translational start site in porcine RELA cDNA sequence (NM_001114281) (SEQ ID NO.: 1). Again the one transfer of embryos injected with RELA ZFN mRNA at 10 ng/Îźl failed to generate a pregnancy while the two transfers of embryos injected with RELA ZFN mRNA at 2 ng/Îźl both became pregnant resulting in the birth of 9 piglets. Of these 9 piglets, one carried an editing event at the ZFN target site (11%); although low numbers, this is a comparable frequency in comparison to our observed TALEN editing efficiency.
Direct sequencing of PCR products revealed a variety of editing events in piglets derived from TALEN and ZFN injected embryos. Analysis of ear biopsy isolated genomic DNA identified both deletions and insertions at the target sites. Sequence data from 2 animals constituted multiple overlapping traces indicating two or more editing events; this was subsequently confirmed by sequencing of multiple cloned PCR products. Presuming that in these cases of multiple editing the frequency of events detected in ear biopsy reflects frequency in the early embryo, designer nuclease editing can remain active beyond the 2-cell stage (i.e. some events display low representation in the PCR pool and are therefore only present in a subset of cells). In total, 5 biallelic events where identified from 9 edited piglets (56%; 9% of piglets born); 4 from TALEN and 1 from ZFN mRNA injections. Of these bialleleic events 2 were homozygous with 3 displaying different indels on each allele. While both piglets carrying homozygous biallelic event survived farrowing (milk in stomach post mortem), they both died within the first 24 hours of life: the ZFN-derived piglet with an 18 bp biallelic homozygous deletion was bitten by its mother while the TALEN-derived piglet with a 6 bp biallelic homozygous deletion was crushed by its mother.
In summary, we observed an overall editing frequency of 2% of transferred embryos or 16% of piglets born. These figures compare favourably with that reported for zygote injection of ZFNs in rats where 2% of transferred embryos and 12% of founder animals harboured editing events (Guerts, A. M. et al. Science 325, 433 (2009)). Our editing frequencies also compare favourably with the production of monoallelic (0.1% of transferred embryos) and biallelic (1% of transferred embryos; the greater frequency over monoallelic due to incorporation of a FACS enrichment stage prior to somatic cell nuclear transfer (Hauschild, J. et al. Proc. Natl. Acad. Sci. USA 108, 12013-12017 (2011)) pigs using somatic cell nuclear transfer methodology.
In conclusion, we demonstrate that editor technology, both TALEN and ZFN, can be successfully applied to pig zygotes to produce live gene edited pigs and contrary to predictions the delivery of editors by the direct injection into the zygote is both efficient and able to generate biallelic mutations. This novel achievement paves the way for precise genome engineering of livestock independent of somatic cell nuclear transfer (cloning) technology.
Materials and Methods for Additional Exemplification
Editor Design and Construction
Two types of editor were used: TALEN and ZFN. Both were designed to target the same region of porcine RELA gene.
TALEN: TALENs were designed using the TALE-NT software and assembled using methods described previously (Carlson, D. F. et al. Proc. Natl. Acad. Sci. USA 109, 17382-17387 (2012)). Briefly, intermediary arrays were produced for the porcine RELA TALEN pair for Golden Gate cloning as follows; 150 ng each pFUS_A, pFUS_B, pLR-X and pC-+63-TAL modified vector were incubated for 10 cycles of 5 min at 37° C. and 10 min at 16° C., then heated to 50° C. for 5 min and then 80° C. for 5 min in the presence of 50 units T4 DNA ligase (New England Biolabs), 10 units Esp3l (Fermentas), lx T4 ligase buffer (New England Biolabs). Plasmid DNA was purified from ligated vector transformed E. coli and mRNA synthesized from SacI linearized RCIscript vectors using the mMessage Machine T3 Kit (Ambion).
ZFN: ZFNs targeted to porcine RELA were purchased from Sigma. The ZFN displayed 84.7% cutting in MEL1 assay (Sigma data sheet) and was supplied as mRNA.
Zygote Injections
To establish the frequency of gene editing in pig embryos an in vitro embryo culture experiment was performed. Pig ovaries were collected, washed with pre-warmed phosphate buffered saline at 38° C. and follicles aspirated. Oocytes were washed in TL HEPES PVA before culturing in maturation medium for 44 hours (22 hours plus hormones and 22 hours minus hormones; 39° C., 5% CO2), followed by gentle pipetting to remove cumulus cells and IVF for 6 hours (38.5° C. in 5% CO2). Zygotes were transferred to NCSU-23 HEPES base medium and subjected to a single 2-10 Οl cytoplasmic injection of mRNA at 2, 10 or 20 ng/Οl+1-5 ng/Οl EGFP mRNA. The 10 and 2 ng/Οl mRNA samples were dilutions of the 20 ng/Οl sample. Zygotes were cultured in batches for 66 hours (embryo culture medium; 5% CO2, 38.5° C.), following which they were placed individually into micro-droplets of medium under oil for visual inspection or harvested for genotyping either as a total group or after manual selection of GFP fluorescing embryos.
Embryo Transfers
Embryos were produced from Large-White gilts that were approximately 9 months of age and weighed at least 120 kg at time of use. Super-ovulation was achieved by feeding, between day 11 and 15 following an observed oestrus, 20 mg altrenogest (Regumate, Hoechst Roussel Vet Ltd) once daily for 4 days and 20 mg altrenogest twice on the 5th day. On the 6th day, 1500 IU of eCG (PMSG, Intervet UK Ltd) was injected at 20:00 hrs. Eighty three hours later 750 IU hCG (Chorulon, Intervet UK Ltd) was injected.
Donor gilts were inseminated twice 6 hours apart after exhibiting heat generated following super-ovulation. Embryos were surgically recovered from mated donors by mid-line laparotomy under general anaesthesia on day 1 following oestrus into NCSU-23 HEPES base medium. Embryos were subjected to a single 2p1 cytoplasmic injection of either ZFN or TALEN pair mRNA at 10 ng/Îźl or 2 ng/Îźl.
Recipient females were treated identically to donor gilts but remained un-mated. Following TALEN or ZFN injection, fertilized embryos were transferred to recipient gilts following a mid-line laparotomy under general anaesthesia. During surgery, the reproductive tract was exposed and embryos were transferred into the oviduct of recipients using a 3.5 French gauge tomcat catheter. Litter sizes ranged from 3-17 piglets.
Genotyping
Gene editing events in porcine embryos were identified by direct sequencing of amplified, isolated DNA and through a gel electrophoresis assay. The latter identified mismatch between the two alleles through digestion by the Cell enzyme.
Sequencing: DNA was amplified from harvested embryos using the REPLI-gÂŽ mini kit, QiagenÂŽ. The REPLI-gÂŽ DNA sample was then used as a template for High fidelity PCR (AccuPrime⢠Taq DNA Polymerase High Fidelity, Invitrogenâ˘) using p65NJF1 5â˛-GCAATAACACTGACCCGACCGTG-3Ⲡ(SEQ ID NO 16) and p65NJR1 5â˛-GCAGGTGTCAGCCCTTTAGGAGCT-3Ⲡ(SEQ ID NO 17) as primers designed to amplify a 308 base pair region of the wild-type porcine RELA gene that overlapped the TALEN and ZFN cut sites. The PCR product was purified then sent for sequence analysis to allow identification of editing events. Alternatively, the PCR products were cloned into a plasmid and individual plasmids sequenced allowing heterozygous and mosaic editing events to be analysed separately.
The following sequences were determined (TALEN/ZFN target sites are shown in bold, insertions are double underlined, and deletions are shown with symbol 1:
| TALENâbindingâsites | |
| (SEQâIDâNOâ19) | |
| GGTGTATCCATGCCCCCCCACACAGCTGAGCCCATGCTGATGGAGTACCCT | |
| GAGGCTATAACTCâWT | |
| Pigletâ8770-I | |
| (SEQâIDâNOâ19) | |
| GGTGTATCCATGCCCCCCCACACAGCTGAGCCCATGCTGATGGAGTACCCT | |
| GAGGCTATAACTCâWT | |
| (SEQâIDâNOâ20) | |
| GGTGTATCCATGCCCCCCCACACAGCTGAGCCCA~GCTGATGGAGTACCCT | |
| GAGGCTATAACTCâÎ1 | |
| Pigletâ8770-J | |
| (SEQâIDâNOâ19) | |
| GGTGTATCCATGCCCCCCCACACAGCTGAGCCCATGCTGATGGAGTACCCT | |
| GAGGCTATAACTCâWT | |
| (SEQâIDâNOâ21) | |
| GGTGTATCCATGCCCCCCCACACAGCTGAGCCCATTGCTGATGGAGTACCC | |
| TGAGGCTATAACTâ+1 | |
| Pigletâ8770-26 | |
| (SEQâIDâNOâ19) | |
| GGTGTATCCATGCCCCCCCACACAGCTGAGCCCATGCTGATGGAGTACCCT | |
| GAGGCTATAACTCâWT | |
| (SEQâIDâNOâ20) | |
| GGTGTATCCATGCCCCCCCACACAGCTGAGCCCA~GCTGATGGAGTACCCT | |
| GAGGCTATAACTCâÎ1 | |
| Pigletâ8130-satâon | |
| (SEQâIDâNOâ22) | |
| GGTGTATCCATGCCCCCCCACACAGCTGA~~~~~~GCTGATGGAGTACCCT | |
| GAGGCTATAACTCâÎ6 | |
| Pigletâ8130-16 | |
| (SEQâIDâNOâ19) | |
| GGTGTATCCATGCCCCCCCACACAGCTGAGCCCATGCTGATGGAGTACCCT | |
| GAGGCTATAACTCâWT | |
| (SEQâIDâNOâ23) | |
| GGTGTATCCATGCCCCCCCACACAGCTGAGCCCTCCATCAGCTGATGGAGT | |
| ACCCTGAGGCTATâ+5 | |
| (SEQâIDâNOâ24) | |
| GGTGTATCCATGCCCCCCCACACAGCTGAG~~~~~~~~~~~~~~~~~CCCT | |
| GAGGCTATAACTCâÎ17 | |
| Insertedâsequenceâ(doubleâunderlined)âisâduplica- | |
| tion/inversionâofâunderlinedâsequence | |
| Pigletâ8784-30 | |
| (SEQâIDâNOâ25) | |
| GGTGTATCCATGCCCCCCCACACAGCTGAGC~~~~~~~~~~~~~~~~~~~~ | |
| ~~~~~~~~~~~~~ Î111 | |
| (SEQâIDâNOâ26) | |
| GGTGTATCCATGCCCCCCCACACAGCTGAGCC~~~~CTGATGGAGTACCCT | |
| GAGGCTATAACTCâÎ4 | |
| Pigletâ8784-33 | |
| (SEQâIDâNOâ27) | |
| GGTGTATCCATGCCCCCCCACACAGCTGAGC~~~~~CTGATGGAGTACCCT | |
| GAGGCTATAACTCâÎ5 | |
| (SEQâIDâNOâ22) | |
| GGTGTATCCATGCCCCCCCACACAGCTGAG~~~~~~CTGATGGAGTACCCT | |
| GAGGCTATAACTCâÎ6 | |
| (SEQâIDâNOâ28) | |
| GGTGTATCCATGCCCCCCCACACAGCTGAGCC~~~~CTGATGGAGTACCCT | |
| GAGGCTATAACTCâÎ4 | |
| Pigletâ8784-34 | |
| (SEQâIDâNOâ20) | |
| GGTGTATCCATGCCCCCCCACACAGCTGAGCCCA~GCTGATGGAGTACCCT | |
| GAGGCTATAACTCâÎ1 | |
| (SEQâIDâNOâ29) | |
| GGTGTATCCATGCCCCCCCACACAGCTGAGCCC+TGAGTACCCTGAGGAGTACCCTGA | |
| GGCTATAâÎ8â+ 12 | |
| Doubleâunderlinedâportionâofâinsertedâsequenceâis | |
| inversionâofâunderlinedâsequenceâinâWT. | |
| ZENâbindingâsite | |
| (SEQâIDâNOâ30) | |
| TGCTGATGGAGTACCCTGAGGCTATAACTCGCTTGGTGACAGGGTCCCAGA | |
| GACCCCCTGACCâWT | |
| Pigletâ8142-C | |
| (SEQâIDâNOâ31) | |
| TGCTGATGGAGTACCCTGAGGCTATAACTC~~~~~~~~~TCTGGGA~~~~~ | |
| ~~~~CCCTGACCâÎ25â+ 7 | |
| Insertedâsequenceâ(doubleâunderlined)âisâinversion | |
| ofâunderlinedâsequenceâinâWT. |
Cel1 assay: The presence of mutations in the RELA gene were additionally identified using a Cell assay (SURVEYORÂŽ mutation detection kit, TRANSGENOMICÂŽ). The high fidelity PCR product was denatured/re-annealed before being subjected to SURVEYORÂŽ nuclease activity which cuts at base mismatches highlighting insertions, deletions and substitutions. The resulting fragments were subsequently separated by gel electrophoresis for analysis with size differences identifying edited events.
Comparison of In Vitro Embryo and Piglet Editing Frequency
For RELA TALEN mRNA injected zygotes we transferred 393 embryos into 11 recipient sows, resulting in 6 pregnancies and 5 farrowings with litter sizes ranging from 3 to 17. One female aborted within last two weeks of pregnancy. Of the 46 piglets born, 5 were stillborn while of the live born 13 were savaged, sat on by the sow or culled on veterinary advice. Post mortem investigation failed to detect any common pathology associated with the dead piglets.
In comparison to previous studies describing the combination of editor technology and somatic cell nuclear transfer, zygote injection represents an efficient technology. In our 32 donor/recipient animals were used to produce 9 edited piglets. In contrast the generation of genome edited pigs by somatic cell nuclear transfer used, for example, approximately 75 donor/recipients to produce 2 edited animals (Yang, D. et al. Cell Res. 21, 979-982 (2011)). while approximately 84 donor/recipient animals to produce 11 edited piglets in a report of biallelic genome editing (Hauschild, J. et al. Proc. Natl. Acad. Sci. USA 108, 12013-12017 (2011)); assuming 20 oocytes per donor animal.
Table 2 summarises the TALEN-mediated editing events in embryos and piglets.
| TABLE 2 |
| Numbers for TALEN edited indels in porcine embryos in vitro and piglets. |
| Embryos in vitro |
| GFP | PCR | |||||
| Injected | fluorescence | amplified | Edited* | Biallelic | ||
| TALEN | zygotes | (visual) | (tested) | (% of tested) | (% of tested) | |
| 20 ng/Îźl | 208 | 75 | 46 | 16 | (35%) | 5 | (11%) | |
| 20 ng/Îźl | 68 | ND | 34 | 2 | (6%) | 1 | (3%) | |
| 10 ng/Îźl | 38 | ND | 3 | 0 | (0%) | 0 | (0%) | |
| 2 ng/Îźl | 53 | ND | 17 | 3 | (18%) | 1 | (6%) | |
| total | 367 | NA | 100 | 21 | (21%) | 6 | (6%) | |
| Piglets |
| Transferred | Edited* | Biallelic | ||||
| Editor | embryos | Recipients | Pregnancies | Piglets born | (% of born) | (% of born) |
| 20 ng/Îźl | 60 | 2 | 0 | NA | NA | NA |
| TALEN |
| 10 ng/Îźl | 67 | 2 | 1 | â7 | 0 | (0%) | 0 | (0%) |
| TALEN | ||||||||
| 2 ng/Îźl | 266 | 7 | 5 | 39 | 8 | (21%) | 4 | (10%)** |
| TALEN |
| 10 ng/Îźl | 29 | 1 | 0 | NA | NA | NA |
| ZFN |
| 2 ng/Îźl | 80 | 2 | 2 | â9 | 1 | (11%) | 1 | (11%)*** |
| ZFN | ||||||||
| Total | 502 | 14 | 8 | 55 | 9 | (16%) | 5 | (9%) |
| *Edited confirmed by sequencing PCR product | ||||||||
| **Of the 4 biallelic TALEN mediated editing events, only 1 was as homozygous event. | ||||||||
| ***The 1 biallelic ZFN mediated event was homozygous. | ||||||||
| NDânot determined | ||||||||
| NAânot appropriate |
1. A genetically edited pig comprising a genetic modification to the sequence of the RELA gene which alters the expression or activity of the RELA protein, wherein the modification results in the following changes in the amino acids of the RELA protein: T448A, S485P and S531P.
2-3. (canceled)
4. The pig of claim 1 in which all cells of the pig contain the genetic modification.
5-10. (canceled)
11. The pig of claim 1 in which the modification is bi-allelic.
12-18. (canceled)
19. The pig of claim 1 wherein the RELA gene has been edited such that it comprises a sequence which encodes a RELA protein with a sequence as follows:
| (SEQâIDâNOâ9) |
| LLQLQFDADEDLGALLGNNTDPTVFTDLASVDNSEFQQLLNQGVPMPPHT |
| AEPMLMEYPEAITRLVTGSQRPPDPAPTPLGASGLTNGLLPDGEDFSSIA |
| DM. |
20. The pig of claim 1 wherein at least a portion of the autologous RELA sequence has been replaced with a sequence which encodes the corresponding warthog (Phacochoerus sp.) RELA protein sequence.
21. The pig of claim 1 in which a portion of the autologous RELA gene has been removed and the following corresponding sequence, or a variant thereof which encodes the same polypeptide, has been inserted:
| (SEQâIDâNOâ11) |
| GTTTGATgCTGATGAGGACCTGGGGGCCCTGCTCGGCAATAACACTGACCC |
| GACCGTGTTCACGGACCTGGCATCCGTCGACAACTCTGAGTTTCAGCAGCT |
| GCTGAACCAGGGTGTAcCcATGCCtCCtCACACAGCcGAGCCCATGCTGAT |
| GGAaTAtCCTGAGGCcATAACcCGCTTGGTcACAGGcTCgCAGAGACCtCC |
| CtGCTCCtACTCCtCTGGGGGCCTCgGGGCTgACCAAtGGTcGACC |
| CTCCTCcCcGGGGACGAâgGACTTC |
22. The pig of claim 1 which demonstrates one or more of the following phenotypes: an altered NFkappaB signalling capacity; an altered disease resilience or tolerance; an altered immune response; and an altered stress response.
23. The pig of claim 1 which demonstrates improved tolerance to one or more of:
virus infection;
pathogen infection, other than viral infection; and
general or specific stressors.
24. The pig of claim 1 which has improved tolerance to ASFV infection.
25-45. (canceled)