-
2006-11-07
10/013,379
2001-12-10
US 7,133,783 B2
2006-11-07
-
-
John S. Brusca
2023-09-02
5.5 Angstrom resolution x-ray crystallographic structures of 70S ribosome complexes containing messenger RNA and tranfer RNA (tRNA), or tRNA analogs, are provided. The resolution has been enhanced by fitting atomic resolution structures of 30S and 50S subunits onto the 5.5 anstrong electron density map. The enhanced structure reveals regions of structural differences between the 70S complex and the structures of the individual 30S and 50S components. Pharmacophore design to discover novel inhibitors or activators may be carried out using the enhanced 5.5 Angstrom 70S structure.
Get notified when new applications in this technology area are published.
C12Q1/00 IPC
Measuring or testing processes involving enzymes, nucleic acids or microorganisms ; Compositions therefor; Processes of preparing such compositions
This application claims the benefit of U.S. Provisional Application No. 60/254,603, filed Dec. 9, 2000, U.S. Provisional Application No. 60,278,013, filed Mar. 22, 2001, and U.S. Provisional Application No. 60/294,394 filed May 30, 2001, the entire disclosure of each of which is hereby incorporated by reference in its entirety for all purposes.
This invention was made with government support under GM-17129 and GM-59140 awarded by the National Institutes of Health. The government has certain rights in the invention.
Not applicable.
The present invention relates to crystals of 70S ribosome and more particularly to model structures of the 70S ribosome obtained by X-ray diffraction analysis. This invention also relates to methods of using the structure coordinates of the 70S ribosome model to screen and design compounds that bind to sites on the 70S ribosome and that alter ribosome function.
Translation of the RNA-encoded genetic message into the polypeptide chain of a protein links genotype to phenotype. It is carried out by the ribosome, an ancient ribonucleoprotein particle whose structural core and fundamental mechanism of action are conserved among all forms of life (C. R. Woese, et al. Microbiol. Rev. 47, 621 (1983); W. E. Hill, et al. Eds., The Ribosome. Structure, Function and Evolution (American Society for Microbiology, Washington D.C., (1990)). The smallest and best-studied examples are bacterial ribosomes, which have a molecular size of ˜2.5 MD and are made up of a small (30S) and a large (50S) subunit. The 30S subunit is composed of 16S rRNA (˜1500 nucleotides (nt)) and about 20 different proteins, whereas the large subunit contains 23S rRNA (˜2900 nt), 5S rRNA (120 nt), and more than 30 different proteins. This degree of structural complexity is in keeping with that of its biological role.
The substrate of the ribosome is tRNA, which is commonly considered to bind to the ribosome at three different sites: A, P, and E (aminoacyl, peptidyl, and exit, respectively) (Watson 1964; Rheinberger et al. 1981). Each tRNA binding site is partitioned between the two ribosomal subunits, resulting in as many as six different sites of interaction between tRNA and the ribosome. The anticodon ends of the tRNAs bind to the 30S subunit, which also carries messenger RNA (mRNA); the 3′-acceptor, or CCA ends of the tRNAs interact with the 50S subunit, which contains the catalytic site for peptide bond formation, peptidyl transferase (Monro 1967). Thus, the tRNAs span the interface between the 30S and 50S subunits.
The translational elongation cycle depends on three fundamental processes: (i) aminoacyl-tRNA selection, (ii) peptide bond formation, and (iii) translocation of tRNAs from one site to the next within the ribosome. Although in vivo, the steps of tRNA selection and translocation involve the elongation factors EF-Tu and EF-G, respectively, in guanosine triphosphate (GTP)-dependent reactions, both steps can be carried out by the ribosome in a factor-independent manner, under appropriate ionic conditions in vitro (Pestka 1969; Gavrilova et al. 1972). Thus, all three of the fundamental steps of the translation elongation cycle must be based on the properties of the ribosome itself, and most likely on its RNA components (Green et al. 1997). The molecular mechanisms by which the ribosome accomplishes these functional processes remain largely mysterious, as does its molecular structure. While knowledge of ribosome structure may not provide immediate explanations for the complexities of translation, it is clear that deeper mechanistic insights will depend on it.
Structures of ribosomal proteins and rRNA fragments, determined by x-ray crystallography and nuclear magnetic resonance (NMR) spectroscopy, have provided atomic-resolution detail of individual components of the ribosome (Ramakrishnan et al. 1998; Moore et al. 1998; Nikonov et al. 1988; Szewcazk et al. 1995; Dallas et al. 1997; Correll et al. 1997). In recent years, great progress has been made in determining the structures of complete ribosomes, ribosomal subunits, and functional complexes of the ribosome by cryoelectron microscopy (Frank et al. 1995a; Stark et al. 1997a; reviewed in Agrawal et al. 1999a). Two major advances toward x-ray crystallography of the ribosome were the crystallization of 50S subunits (Yonath et al. 1980; von Bohlen et al. 1991) and the recent determination of their crystal structure at 9 Å resolution (Ban et al. 1998). Even more recently, two papers describing the structures of the T. thermophilus 30S ribosomal subunit at 5.5 Å resolution (Clemons et al. 1999) and the Haloarcula marismortui 50S ribosomal subunit at 5 Å resolution (Ban et al. 1999) were published. Although many of the details of the rRNA and ribosomal protein components are more clearly resolved in the subunit structures, some features seen in the 70S ribosome structure, such as protein L1 in the 50S subunit and part of the head of the 30S subunit, appear to be absent in the subunit maps, possibly because of local disorder that is not present in the 70S ribosome crystals. A 2.4 Angstrom structure of the 50S ribosomal subunit from Haloarcula marismortui was recently reported (Ban et at. 2000), as was a 3 Angstrom structure of the 30S ribosome subunit from T. thermophilus (Wimberly et al. 2000). Again, aspects of structure not visible, even in these atomic resolution structures of the subunits (such as L11, see Wimberly et al. 2000) are visible for the first time in the 5.5 Angstrom 70S structure we describe below. In addition, certain features of the 30S subunit, such as the orientation of the head and platform, differ between the isolated subunits and 70S ribosome.
Crystallization of Thermus thermophilus 70S ribosomes and ribosome complexes (Trakhanov et al. 1987; Trakhanov et al. 1989; Hansen et al. 1990; Yusupova et al. 1991; Yusupov et al. 1991) has provided the possibility for solving the structure of the complete ribosome in different functional states. In an earlier work, we reported the crystallization of functional complexes of the complete T. thermophilus 70S ribosome, containing mRNA and tRNA or tRNA analogs, and the solution of their structures by x-ray crystallography at up to 7.8 Å resolution (Cate et al. 1999). Many specific features of the rRNA were identified, and in many instances, elements of protein structure were also recognizable. The interactions of tRNA with the ribosome in the A, P, and E sites were seen in the greatest detail so far obtained, providing new insights into the mechanism of translation.
Despite these improvements in structure determination of 70S ribosome structure, certain details of the molecular interactions such as those in the interface between the 30S and 50S subunits were not clearly resolved in prior art structure determinations of the 70S ribosome. Knowledge of the details of this and other structural features of the 70S ribosome provides deeper insight into the ribosome function, as well as a structural basis for rational design of novel compounds to alter ribosome function. Thus there exists a need in the art for a higher resolution structure of the 70S ribosome. The present invention provides for these and other advantages by extending the resolution of the 70S ribosome structure to 5.5 Angstroms. Using methods described below, the 5.5 Angstrom structure provides a basis for obtaining high-resolution structural details of the 70S ribosome structure, including determination of many features not previously resolved in prior art structure determinations of the 70S ribosome or its subunits.
A three-dimensional structure of the Thermus thermophilus 70S ribosome has been empirically determined at 5.5 Angstroms resolution. The 5.5 Angstrom structure has been used to obtain atomic resolution detail of aspects of the 70S ribosome not previously determined by fitting atomic resolution structures of the 30S ribosome subunit (Wimberly et al. 2000) and the 50S ribosome subunit (Ban et al. 2000) to the observed 5.5 Angstrom electron density map. On the basis of this structural analysis, it now is possible to identify structural parts or specific amino acid residues which from structural or functional considerations appear to be important for ribosome subunit association and function.
Accordingly, in a first aspect the invention relates to a method of identifying molecules which will bind to the 70S ribosome or its subunits. In another aspect, the molecules identified according to the methods of the invention are tested to determine whether they alter 70S ribosome function. Agents that bind to the 70S ribosome or its subunits and that disrupt protein synthesis (i.e. translation) have utility as antibiotic compounds. Agents that bind to the 70S ribosome or its subunits to alter tRNA binding have utility as agents for the creation of variant polypeptides, some of which will have altered functional properties.
The methods of the invention entail identification and/or design of molecules having a particular structure. The methods rely on the use of precise structural information derived from x-ray crystallographic studies of the 70S ribosome, described below.
In yet another aspect, the invention comprises a model structure of a 70S ribosome contained within a computer-readable memory. In a related aspect, the invention includes a computer system comprising a memory comprising X-ray crystallographic structure coordinates defining at least a portion of a bacterial 70S ribosome, said structure coordinates determined from a crystal of a bacterial 70S ribosome that diffracts X-rays to a resolution of at least 5.5 Angstroms and having a space group of 1422 with unit cell dimensions of a=b=507.2 Angstroms, and c=803.7 Angstroms; and a processor in electrical communication with the memory; wherein the processor generates a molecular model having a three dimensional shape representative of at least a portion of said bacterial 70S ribosome.
Another aspect pertains to 70S ribosome variants or subunit variants having altered functional properties. In one preferred embodiment, the variants have altered tRNA binding properties. In another preferred embodiment, the variant comprises a 50S subunit having one or more RNA or polypeptide sequence changes that alter the binding affinity between the 30S and the 50S subunit. Yet another preferred embodiment comprises a 30S subunit having one or more RNA or polypeptide sequence changes that alter the binding affinity between the 30S and the 50S subunit. In an especially preferred embodiment, the sequence changes affect the binding affinity by perturbing the structure of the interface between the 30S and the 50S subunits. Such variant subunits act as dominant negative inhibitors of ribosome function by altering the normal equilibrium between assembled 70S ribosomes and their component 30S and 50S subunits. Also encompassed as another preferred embodiment are polynucleotides encoding a 30S or a 50S variant, wherein said variant alters the binding affinity between the 30S and the 50S subunits.
Another aspect of the invention relates to methods of determining the structure of pharmacophores and candidate compounds having selective binding affinity for bacterial (but not eukaryotic) ribosomes, said method comprising the steps of determining phylogenetically variable regions of primary structure between at least one prokaryotic and at least one eukaryotic ribosomal protein or ribosomal RNA, locating said phylogenetically variable region within the three-dimensional structure of the bacterial 70S ribosome, and providing a pharmacophore that represents the three dimensional arrangement of a pharmacophore binding site comprising said phylogenetically variable region within the three-dimensional structure.
In another aspect, the invention provides for a method of testing candidate compounds for binding activity and or for the ability to affect ribosome function. Said method comprises using the 70S ribosome structure to determine the shape and or charge distribution of a target site, characterizing said site to define a pharmacophore designed to bind the site, obtaining or synthesizing candidate compounds having the a shape and or charge distribution designed to interact with the target site, and contacting the 70S ribosome with one or more of said compounds. In this aspect, the invention encompasses use of the structure- coordinates of the 70S ribosome to design, evaluate computationally, synthesize or otherwise obtain (as e.g., from a library of compounds) and use inhibitors or activators of the 70S ribosome.
Thus, the invention encompasses use of the structure coordinates of a 70S ribosome crystal to define details, including atomic details of regions of the 70S ribosome, such as the subunit interface, the messenger RNA pathway, the tRNA binding sites, and binding sites for initiation or elongation factors, which sites are target sites for inhibitors or activators of protein translation.
The structure coordinates set out in Appendix I may be modified by mathematical manipulation including but not limited to, crystallographic permutations, fractionalizations, or inversions of the structure coordinates, integer additions or subtractions to the set of structure coordinates, and any combination of the above.
The details of the preferred embodiments of the present invention are set forth in the accompanying drawings and the description below. Once the details of the invention are known, numerous additional innovations and changes will become obvious to one skilled in the art. All references, including scientific publications, protein structure files (referenced by PDB and/or MMDB identifiers) patents, and patent applications cited in this document are explicitly incorporated by reference in their entirety for all purposes.
This patent contains at least one drawing executed in color. Copies of this patent with color drawings will be provided by the Patent and Trademark Office upon request and payment of the necessary fee.
FIG. 1. Electron density of tRNAMetf bound to the P site of the 70S ribosome, at 5.5 Å resolution.
FIG. 2. Views of the structure of the Thermus thermophilus 70S ribosome. A, B, C and D are successive 90° rotations about the vertical axis; E is a 90° rotation around the horizontal axis of the view shown in A. (A) view from the back of the 30S subunit. H, head; P, platform; N, neck; B, body. (B) view from the right-hand side, showing the subunit interface cavity, with the 30S subunit on the left and the 50S on the right. The anticodon arm of the A-tRNA (gold) is visible in the interface cavity. (C) View from the back of the 50S subunit. EC, the end of the polypeptide exit channel. (D) View from the left-hand side, with the 50S subunit on the left and the 30S on the right. The anticodon arm of the E-tRNA (red) is partly visible. (E) View from the top, with the 50S subunit above and the 30S below. The E-, P- and A-tRNAs are visible in the interface cavity with their anticodon arms pointed downward into the 30S subunit. (F) Interface view of the 30S subunit (rotated 180° from A), showing the positions of the three tRNAs. (G) Interface view of the 50S subunit. ASF, A-site finger; SRL, sarcin-ricin loop. The different molecular components are colored for identification: cyan, 16S rRNA; grey, 23S rRNA; light blue, 5S rRNA (5S); dark blue, 30S proteins; magenta, 50S proteins. Proteins fitted to the electron density are numbered in orange; 50S proteins whose electron density has been identified but not fitted are numbered in magenta. A, P, E, the A-, P- and E-site tRNAs (gold, orange and red, respectively).
FIG. 3. Secondary and Tertiary Structures of 16S, 23S and 5S rRNAs. (A) Secondary structure of T. thermophilus 16S rRNA (SEQ ID NO: 45) with its 5′, central, 3′-major and 3′-minor domains shaded in blue, magenta, red and yellow, respectively. (B) Secondary structures of T. thermophilus 23S (SEQ ID NO: 23) and 5 S rRNAs (SEQ ID NO: 24), indicating domains I (blue), II (cyan), III (green), IV (yellow), V (red) and VI (magenta) of 23S rRNA. The rRNAs are numbered according to E. ccli (75). (C) Three-dimensional fold of 16S rRNA in 70S ribosornes, with its domains colored as in (A). (D) Three-dimensional folds of 23S and 5S rRNAs, with their domains colored as in (B).
FIG. 4. Conformational differences between rRNAs in 70S ribosomes and 30S and 50S subunits. (A) Differences in 16S rRNA from T. thermophilus 30S subunits (15) and 70S ribosomes. Rmsd differences are colored yellow (>10 Å), orange (5.5 Å>rmsd>10 Å), red (3.5 Å>rmsd>5.5 Å) and blue (rmsd<3.5 Å). H, head; PS, penultimate stem; SP, spur. (B) Stereo diagram showing superimposed structures of 16S rRNA from 30S subunits ((15); red) and 70S ribosomes (blue). (C, D) Front and back views of the 23S rRNA, showing differences between the H. marismortui 50S subunit (14) and the T. thermophilus 70S ribosome. Yellow, features that were disordered in the H. marismortui 50S structure; cyan, features that are specific to the T. thermophilus structure; white, features specific to the H. marismortui structure. Conformational differences in the remaining regions are colored orange (rmsd>5.5 Å) and red (3.5 Å<rmsd<5.5 Å). Nucleotide numbers of Haloarcula -specific features are preceded by H; the remaining numbers are according to E. coli numbering. (E) Conformational differences between the apical stem region of domain III of 23S rRNA in T. thermophilus (light blue) and H. marismortui (red). H1495 indicates the apical nucleotide in the archaeal sequence, (nucleotide 1597, using the archaeal numbering) corresponding to T1495 in T. thermophilus. (F) Stereo view of the 5.5 A electron density map, showing the crystal-packing interaction of protein L9 with the 30S subunit in another ribosome in the crystal. Contact with the C-domain of L9 around position Gly84 (G84) with the 16S rRNA of a separate ribosome around adenosine 55 (A55), and contact between the N-domain of L9 around Lys12 (K12) with the 16S rRNA around guanine 493 (G493) are shown. Shown in yellow are mutations in L9 that stimulate “hopping” of the ribosome on the phage T4 gene 60 mRNA. The backbone of L9 is shown in red, 16S rRNA is shown in magenta, and helix 5 (the main contact with the C-domain of L9) is highlighted in cyan.
FIG. 5. Secondary structures of 16S and 23S rRNAs, showing features involved in intersubunit contacts (red). (B, C) Interface views of the 50S and 30S subunits, with the bridges numbered (Frank et at. 1995a; Cate et al. 1999). RNA—RNA contacts are shown in red (16S rRNA) and magenta (23S rRNA); protein-RNA and protein-protein contacts are shown in yellow and pink. A, P and E indicate the three tRNAs. (D–G) Detailed stereo views of the bridge interactions, viewed as in (D) FIG. 2B, (E) FIG. 2C, (F) FIG. 2D; rotated 90° around the horizontal axis, (G) FIG. 2D.
FIG. 6. tRNA-Ribosome Interactions. (A) Electron density maps of the P-tRNA (left; 5.5 Å) and A-tRNA (right; 7 Å) complexed with their respective mRNA codons in the 70S ribosome. (B) Relative orientations of the A-, P- and E-tRNAs (gold, orange and red, respectively) and mRNA, showing codon-anticodon interactions and the kink between the A and P codons. (C, D) Two views of the P-tRNA anticodon stem-loop bound to the its codon in the 30S subunit P site. (E) Interactions between the D stem, elbow and acceptor arm of P-tRNA with the 50S subunit. (F) Experimental electron density (blue) for the T. thermophilus 70S ribosome complexed with deacylated tRNA Met f, at 5.5 Å, with the H. marismortui CCdAp-Puromycin transition-state analog structure model superimposed. (G) Electron density for the corresponding region of the H. marismortui 50S subunit (3), calculated at 5.5 Å (red). The structures of the analog and surrounding parts of the 23S rRNA (3) are shown. (H, I) Two views of the A-tRNA anticodon stem-loop bound to its codon in the 30S subunit A site. (J) Fourier difference map for the A-tRNA at 7 Å, with the A-tRNA and A-codon superimposed. The positions of bases A1492 and A1493 are shown as they are found in the presence (red) and absence (magenta) of paromomycin (17). A patch of negative density (red) can be seen near the positions of A1492 and A1493, indicating that they may rearrange to interact with the minor groove of the codon-anticodon helix when the A-tRNA is bound, as suggested by Carter et al. (17). (K) Interaction of the D stem, elbow, and acceptor end of A-tRNA with the 50S subunit. (L) Electron density, showing clash between the A-tRNA elbow and unassigned r-protein density that may correspond to part of L16. (M) Interaction of E-tRNA with the ribosome. In all panels, 16S rRNA is shown in cyan, 23S rRNA in grey, and ribosomal proteins in blue, green and magenta. Parts of the ribosome that contact the tRNAs are colored gold (A-tRNA contacts), orange (P-tRNA contacts) or red (E-tRNA contacts). rRNA helices are numbered as in FIGS. 3A, B. Bases in rRNA that are protected from chemical probes by tRNA binding (21, 45, 51) are indicated by spheres. Bases that are protected by direct interaction are colored the same as the contacts; bases that are protected as a result of conformational changes are shown in magenta or, in the case of class III sites (71) grey-blue. The different specific ribosome contacts discussed in the text and listed in Table IV are indicated by lower-case letters. (N) Secondary structures of 16S and 23S rRNA, showing molecular contacts with A-tRNA (gold), P-tRNA (orange) and E-tRNA (red).
FIG. 7. (A) Relative arrangement of the A-, P- and E-tRNAs and mRNA in the ribosome. (B) Schematic representation of an updated version of the hybrid states model (Moazed et al. 1989b) for the translational cycle. (C) A three-dimensional representation of the movements of tRNA through the hybrid states cycle.
FIG. 8. rRNA elements surrounding the A- and P-tRNAs at the subunit interface. The position of ribose 71 of the E-tRNA is shown by a red sphere. See the text for details.
FIG. 9. Nucleotide sequences of the three model mRNAs used in this study, MF36 (SEQ ID NO: 51), MV36 (SEQ ID NO: 50), and MK27 (SEQ ID NO: 52). The Shine-Dalgarno sequence (S/D), and P- and A-site codons are underlined. The self-complementary sequences forming the putative A-site helix in MF36 mRNA are overlined.
FIG. 10. (A) 7 Å Fourier difference map of MK27 mRNA with the mRNA model (yellow) docked, showing the position of the Shine-Dalgamo (S/D) helix (magenta) and the positions of the A- and P-site codons (orange and red, respectively), viewed from the top of the 30S ribosomal subunit. (B) Difference map of the MF36 mRNA, showing a four-base-pair tetraloop helix (A-site helix) fitted to the extra density at the A site. (C) Same as for (B), except that the A-tRNA anticodon stem-loop (green) is shown in the position observed experimentally in the A-tRNA difference map (Yusupov et al. 2001), in place of the A-site mRNA helix. The five-nucleotide (GGAGG/CCUCC) (SEQ. ID NO: XX) core of the Shine Dalgamo interaction is shown in magenta, and the rest of the 16S mRNA tail in cyan.
FIG. 11. (A) Interface and (B) solvent views of the mRNA in the 30S ribosomal subunit. A, P, the A- and P-site codons. 5′, 3′, the 5′ and 3′ correspond to positions −15 and +15 of the mRNA model. The head, platform, shoulder and body of the subunit, and ribosomal proteins S2, S3, S4, S5, S7, S 11, S 12 and S 18 are indicated. The ribosomal proteins are shown in dark blue, 16S rRNA in cyan and the mRNA is colored as in FIG. 2.
FIG. 12. (A) Solvent-side stereo view of the Shine-Dalgamo (S/D) helix bound in its cleft, formed by helices 20, 28 and 37 (h20, h28, h37) and the 723 loop of 16S rRNA and proteins S 11 and S 18, and the path of mRNA nucleotides −1 to −4 through the upstream tunnel. The MV36 Fourier difference map is shown. (B) Interface stereo view of the A- and P-site codons and their flanking nucleotides (530, 790, 791-, 926, 1492, 1493 and 1498) in 16S rRNA. The locations of restrictive mutations in ribosomal protein S12 are shown in yellow (the universal PNSA sequence) and orange. The positions of the bases for G926 and U1498 are modeled from the high-resolution structure of the T. thermophilus 30S subunit (Wimberly et al. 2000). (C) Same as (B), but with the A- and P-tRNAs (orange and red, respectively) docked according to their experimentally observed locations (Yusupov et al. 2001).
FIG. 13. (A) Interface stereo view of the downstream tunnel, showing the features of 16S rRNA layer surrounding mRNA positions +7 to +10. (B) Solvent-side stereo view of the downstream tunnel, showing the formation of the protein layer surrounding positions +11 to +15 of the mRNA by proteins S3, S4 and S5. The double-stranded RNA binding domain of protein S5 is shown in magenta. The MK27 difference map is shown.
FIG. 14. View down the crystallographic four-fold axis of the 70S ribosome-mRNA-tRNA complex (Yusupov et al. 2001), showing the head-to-tail juxtaposition of the model mRNAs (red-orange) between adjacent ribosomes. The molecular components shown are 16S rRNA (cyan), 23S rRNA (grey), 5S rRNA (grey-blue), small subunit proteins (dark blue), large subunit proteins (magenta), the A-, P- and E-tRNAs (yellow, orange and red) and the mRNA (red-orange).
FIG. 15. Chemical footprinting of Fe(II)-derivatized IF3 variants on 16S rRNA. Primer extension showing the kethoxal footprint of IF3-HisTag (wild-type) and Fe(II) BABE-derivatized IF3 variants at positions G700 and G703 on 16S rRNA in the 30S subunit. In both panels, A and G are sequencing lanes. Lanes labeled K and 30S are unmodified 30S subunits and kethoxal-modified 30S subunits, respectively. IF3 is kethoxal-modified 30S-IF3-His6 complex (6×His tag disclosed as SEQ ID NO: 125). In the left panel -cys is kethoxal-modified cysteine-free IF3-30S and all other lanes are kethoxal-modified N-domain Fe(II)-IF3-30S complexes as indicated at the top of each lane. In the right panel, all other lanes are C-domain Fe(II)-IF3-30S complex treated with kethoxal as indicated.
FIG. 16. Hydroxyl radical footprinting of IF3 on 16S rRNA. (A) Primer extension analysis of the hydroxyl radical footprint of IF3 on 16S rRNA in the 30S subunit. Lanes from left to right are as follows: A, G are sequencing lanes; K, unmodified 30S subunit; 30S, 30S subunits exposed to hydroxyl radicals. Subsequent lanes are initiation factor-30S complexes (as labeled) exposed to hydroxyl radicals. Bars at the right of each autoradiogram indicate regions of protection. (B) 1173-dependent protection of 16S rRNA in 30S subunits from free hydroxyl radicals mapped onto the secondary structure of 16S rRNA. Dot sizes indicated the extent of protection.
FIG. 17. Directed hydroxyl radical probing of 16S rRNA from different positions on the surface of IF3. (A) Ribbon diagrams of the crystal structures of the N- and C-domains of IF3 from Bacillus stearothermophilus (Biou et al. 1995). Spheres indicate the Cα positions of engineered cysteine residues used to tether Fe(II), numbered according to the corresponding residue in Escherichia coli. (B) Directed hydroxyl radical cleavage of 16S rRNA in 30S subunits from Fe(II)-IF3 detected by primer extension analysis. A and G are sequencing lanes. All other lanes are 30S-IF3 complexes that were probed with Fe(II) tethered to a different IF3 position, as indicated, including a cysteine-free control reaction (−cys). Labels at the left of each autoradiogram indicate the sequence of 16S rRNA. Bars at the right of each panel indicate regions of cleavage by hydroxyl radicals. (C) Summary of the location of hydroxyl radical cleavages in the central, the 3′-major, and the 3′-minor domains of 16S rRNA (shaded gray, clockwise from left) from Fe(II)-IF3 bound to 30S subunits. Cleavage strengths, assigned as strong, medium, or weak, are proportional to the size of the filled circles.
FIG. 18. Directed hydroxyl radical probing of initiator tRNA from different positions on IF3. (A) Autoradiograph of 5′-end-labeled tRNAMetf showing cleavage by hydroxyl radicals generated from Fe(II) IF3. Lanes are labeled according to the site of attachment of Fe(II)-BABE to IF3. Cleavages are indicated by bars at the right side of the gel.
FIG. 19. Positioning IF3 on the 30S subunit. (A) Hydroxyl radical footprint of IF3 mapped onto a ribbon diagram of the crystal structure of the 30S subunit from Thermus thermophilus. Strongest protections are colored magenta and weaker protections are lighter pink. Base-specific protections are represented as red spheres. (B) Ribbon diagram of IF3 (yellow) docked onto the 30S subunit footprint. The N- and C-domains are labeled N and C, respectively. (C) Model of the interaction of IF3 (black ribbon) with the 30S subunit as determined by directed hydroxyl radical probing and hydroxyl radical footprinting. Nucleotides cleaved by Fe(II)-IF3 are mapped onto a ribbon diagram of 16S rRNA in the 30S subunit from the crystal structure of the T. thermophilus ribosome (Yusupov et al. 2001). Ribosomal proteins S7 and S11 are colored green and 16S rRNA backbone is traced in white except where cleaved by Fe(II) derivatized IF3. Nucleotides cleaved from probing positions 97 and 135 are blue (strong hits) and lighter blue (weaker hits) while nucleotides cleaved from the N-domain probes are colored red (strong hits) and lighter red (weak hits). Cleavages from position 104 are shaded gold. The corresponding probing positions are represented as spheres and are colored to match their respective cleavage targets.
FIG. 20. The position of IF3 relative to initiator tRNA, mRNA, and IF1. (A) Views of the IF3–30S model with initiator tRNA bound to the P site and the location of IF1 as determined by the crystal structure (Carter et al. 2001). 16S rRNA and small subunit proteins are shaded light and dark gray, respectively. IF3 is represented in CPK and colored red. IF1 is shaded blue. Initiator tRNA is traced in yellow, and mRNA is colored purple. (B) A close-up view of IF3 and P site-bound initiator tRNA showing the cleavages from directed probing experiments. Initiator tRNA is colored yellow except where cleaved by Fe-C135(green) and Fe-C76 and Fe-C80 (blue). The corresponding probing positions are colored similarly on IF3 (gray). mRNA is represented in purple.
FIG. 21. The IF3 C-domain occupies the position of helix 69 of 23S rRNA. (A) View of the interaction of helix 69 (yellow) of 23S rRNA with helices 23, 24, and 45 of 16S rRNA (blue). The sites of contact between 23S rRNA and 16S rRNA are colored purple, (B) View showing the overlapping binding site on the 30S subunit of the C domain of IF3 (red) with helix 69 of 23S rRNA (yellow).
The invention is based on the discovery of the 5.5 Å crystal structure of the 70S ribosome from Thermus thermophilus, which is disclosed herein.
Definitions
All scientific terms are to be given their ordinary meanings as understood by those of skill in the art, unless an alternate meaning is set forth below. In case of conflict, the definitions set forth in this specification shall control.
As used herein, the term “binding site” or “binding pocket” refers to a region of a protein or protein/RNA complex or RNA that binds or interacts with a particular compound.
As used herein, the term “interface” refers to the point or surface at which two or more domains of one or more molecules associate.
As used herein, the term “translatable RNA” refers to an RNA which, when incubated with factors necessary for translation can direct the synthesis of protein.
As used herein, the term “decrease” refers to a diminution of at least 10% and preferably by 20% to 50% or more.
As used herein, the term “anti-bacterial” or “antibiotic” refers to the ability of a compound to inhibit growth of bacteria by producing a statistically significant reduction in the proliferation of said bacteria measured according to any means known to one of skill in the art.
As used herein, the terms “associates with” or “interacts with” refers to a condition of proximity between a chemical entity, compound, or portions thereof, with another chemical entity, compound or portion thereof. The association or interaction may be non-covalent—wherein the juxtaposition is energetically favored by hydrogen bonding or van der Waals or electrostatic interactions—or it may be covalent.
As used herein, the term “pharmacophore” refers to an ensemble of steric and electronic features that is necessary to ensure the optimal supramolecular interactions with a specific biological target structure and to trigger or block a biological response. A pharmacophore may be used to design one or more candidate compounds that comprise all or most of the ensemble of steric and electronic features present in the pharmacophore and that are expected to bind to a site and trigger or block a biological response.
As used herein, the term “structure coordinates” refers to mathematical coordinates derived from mathematical equations related to the X-ray diffraction patterns obtained by diffracting X-rays off a crystal. The diffraction data are used to calculate an electron density map of the unit cell comprising the crystal; said maps are used to establish the positions of the atoms (i.e., the structure coordinates) within the unit cell. Those of skill in the art understand that a set of structure coordinates determined by X-ray crystallography contains standard errors. For purposes of this invention, any set of structure coordinates for a 70S ribosome that has a root mean square deviation of backbone atoms of less than 0.75 Angstroms when superimposed on the structure coordinates of Appendix I, shall be considered identical.
The phrase “fidelity of translation” refers to the accuracy with which a sequence encoded by an mRNA molecule is translated to an amino acid sequence according to the genetic code that relates three-nucleotide codons to amino acids encoded thereby.
The phrase “a residue corresponding to a residue” is intended to encompass a residue specifically identified, as by, e.g., reference to a residue along with a SEQ ID NO, as well as residues occupying analogous positions in related proteins or nucleic acids. A related protein or nucleic acid usually refers to a protein or nucleic acid having similar structural or functional properties as a reference protein or nucleic acid molecule, but which is derived from an organism different from the organism from which the reference protein or nucleic acid molecule is derived. In some instances, which will be clear based on context, a related protein or nucleic acid may be a variant protein or nucleic acid molecule derived from the same organism as that from which the reference protein or nucleic acid is derived, but which has similar structural or functional properties as the reference protein or nucleic acid molecule.
Structural similarity may be inferred from, e.g., sequence similarity, which can be determined by one of ordinary skill through visual inspection and comparison of the sequences, or through the use of well-known alignment software programs such as CLUSTAL (Wilbur, W. J. and Lipman, D. J. Proc. Natl. Acad. Sci. USA, 80, 726–730 (1983)) or CLUSTALW (Thompson, J. D., Higgins, D. G. and Gibson, T. J., CLUSTAL W: improving the sensitivity of progressive multiple sequence alignment through sequence weighting, positions-specific gap penalties and weight matrix choice, Nucleic Acids Research, 22:4673–4680 (1994)) or BLAST® (Altschul S F, Gish W, et al., .J Mol. Biol., October 5;215(3):403–10 (1990)), a set of similarity search programs designed to explore all of the available sequence databases regardless of whether the query is protein or DNA. CLUSTAL W is available at http://www.ebi.ac.uk/clustalw/; BLAST is available at http ://www.ncbi.nlm.nih.gov/BLAST/. A residue within a first protein or nucleic acid sequence corresponds to a residue within a second protein or nucleic acid sequence if the two residues occupy the same position when the first and second sequences are aligned. Table I provides illustrative representative alignments that can be used to identify correspondence among residues derived from related proteins and nucleic acids of different organisms. The sequence alignments illustrated in Table I were generated using CLUSTAL.
| TABLE I |
| Representative Sequence Alignments |
| Species | Aligned Sequence | Aligned Sequence |
| A. 16S rRNA Alignments |
| Thermus_thermophilus | 702 | CCGAUG | 707 | 904 | GGGCC | 908 |
| Escherichia coli | 719 | CCGGUG | 724 | 927 | GGGCC | 932 |
| Pseudomonas aerugino | 715 | CCAGUG | 720 | 922 | GGGCC | 926 |
| Neisseria gonorrhoea | 720 | CCGAUG | 725 | 928 | GGACC | 932 |
| Bacillus subtilis | 726 | CCAGUG | 731 | 935 | GGGCC | 939 |
| Haloferax volcanii | 657 | CCGAUG | 662 | 869 | GGGAG | 873 |
| Methanococcus vannie | 651 | CCUAUG | 656 | 863 | GGGAG | 967 |
| Sulfolobus solfatari | 679 | COAGUG | 783 | 890 | GGGAG | 894 |
| Homo sapiens Mit. | 158 | CCACGG | 163 | 369 | UGACA | 363 |
| Caenorhabditis elega | 901 | CCAACA | 906 | 1116 | AAGGG | 1120 |
| Saccharomyces_cerevi | 929 | ACUACU | 934 | 1148 | AAGGG | 1152 |
| Zea_mays | 935 | ACAACU | 940 | 1156 | AAGGG | 1170 |
| Rattus_norvegicus | 991 | ACCAGA | 996 | 1212 | AAGGG | 1216 |
| Thermus_thermophilus | 1370 | CCUUGU | 1375 | 1482 | GGUAG | 1485 |
| Escherichia coli | 1388 | CCUUGU | 1393 | 1505 | GGUAA | 1508 |
| Pseudomonas aerugino | 1383 | CCUUGU | 1388 | 1500 | GGUAG | 1503 |
| Neisseria gonorrhoea | 1388 | UCUUGU | 1393 | 1505 | GGUAG | 1508 |
| Bacillus subtilis | 1393 | CCUUGU | 1398 | 1511 | GGUAG | 1514 |
| Haloferax volcanii | 1335 | CCUUGC | 1340 | 1436 | GGUAG | 1439 |
| Methanococcus varinie | 1325 | CCUUGC | 1330 | 1432 | GGUAG | 1435 |
| Sulfolobus solfatari | 1350 | CCTJUGC | 1355 | 1451 | GGUAG1454 | |
| Homo sapiens Mit. | 825 | GCGCGU | 830 | 923 | GGUAA | 926 |
| Caenorhabditis elega | 1587 | CUUUGU | 1592 | 1728 | GGUAG | 1731 |
| Saccharornyces_cerevi | 1623 | CUUUGU | 1628 | 1766 | GGUUU | 1769 |
| Zea_mays | 1631 | CUUUGU | 1636 | 1773 | GGUTJU | 1776 |
| Rattus_norvegicus | 1694 | CUUUGU | 1699 | 1842 | GGUUU | 1845 |
| Thermus_thermophilus | 1503 | GCUG | 1506 | |||
| Escherichia coli | 1526 | GUUG | 1529 | |||
| Pseudomonas aerugino | 1521 | GCUG | 1524 | |||
| Neisseria gonorrhoea | 1526 | GCUG | 1529 | |||
| Bacillus subtilis | 1532 | GCUG | 1535 | |||
| Haloferax volcanii | 1457 | GCUG | 1460 | |||
| Methanococcus vannie | 1453 | GCUG | 1456 | |||
| Sulfolobus solfatari | 1480 | GCUG | 1483 | |||
| Homo sapiens Mit. | 944 | CUUG | 947 | |||
| Caenorhabditis elega | 1749 | GCUG | 1752 | |||
| Saccharomyces_cerevi | 1787 | GAAG | 1790 | |||
| Zea_mays | 1794 | GAAG | 1797 | |||
| Rattus_norvegicus | 1863 | GAAG | 1866 | |||
| B. S18 Sequence Alignments |
| (SEQ ID NOS: 55–84, |
| respectively, in order of |
| appearance) |
| Species | Aligned Sequence |
| ESCRERICHIA_COLI | 1 --------------------------MAR-----YFRRR-------------------------KFCRF 13 |
| YERSINIA_PESTIS | 1 --------------------------MAR-----YFRRR-------------------------KFCRF 13 |
| SALMONELLA_ | 1 --------------------------MAR-----YFRRR-------------------------KFCRF 13 |
| TYBMIMURI | |
| HAEMOPHILUS_ | 1 --------------------------MAR-----YFRRR-------------------------KFCRF 13 |
| INFLUENZ | |
| THERMOS_ | 1 ---------------------------P-------SRKA-------------------------KVK-A 9 |
| THERMOPHILUS | |
| DEINCOCOOUS_ | 1 ------MTQQCCNSCERSSRCSCPSREEKS----RPRKP-------------------------KVDPF 28 |
| RACICCUR | |
| PSEUDOMONAS_ | 1 --------------------------MAR-----FFRRR-------------------------KFCRF 13 |
| AERUCINO | |
| HOMO_SAPIEN_ | 1 --MAEONPSVOLOTHLSSPRESEESAPKICIRQSYE------------------------KEPLKKCIL 67 |
| MITOCHON | |
| TREPNOMEA_ | 1 -----------MAEHPSVDLDTHLSSPRESEESAPKKNRQFYR--------------------KKVCRF 39 |
| PALLIDUM | |
| BACILLUS_SUBTILIS | 1 ----------------MAGG------RRGG----RAKRR-------------------------KVCYF 18 |
| GEOBACILLUS_ | 1 ----------------MAG-------RRGG----RGKRR-------------------------KVCYF 17 |
| STEAROTH | |
| CHLAMYCOPHILIA_ | 1 ----------------MNK-P-----VHNN----EHRRKRF----------------------NKKCPF 21 |
| PREUM | |
| LISTERIA_INNOCUA | 1 ----------------MAGG------RRGG----R-RRK-------------------------KVCYF 17 |
| CHLAMYDIA_ | 1 ----------------MNR-P-----VHN-----EHRRKRF----------------------AKKCPF 20 |
| TRAONCMATI | |
| STAPHYLCCOCCUS_ | 1 ----------------MAGGP-----RRGG----R-RRK-------------------------KVCYF 18 |
| AUREU | |
| MESORHIZOMBIUM_ | 1 -----------------MVDINQIP-TRRP----FHRRR-------------------------KTCPF 22 |
| LOTI | |
| BACILLUS_ | 1 ----------------MA---------RRG----RPKRR-------------------------KVCYF 15 |
| HALODURANS | |
| AQUIFEX_AEOLICUS | 1 --------------------------MVVR----APKK--------------------------KVCMY 13 |
| THERMATOGA_ | 1 ---------------------------------MAYRR-----------R----------KKKIKKCRL 15 |
| MARITIMA | |
| MYCOPLASMA_ | 1 ------------------MNHNKDKLKK-----KNKRK--------------------------RVSFL 20 |
| PULMONIS | |
| VIBRIO_CHOLERAE | 1 --------------------------MAR----FFRRR--------------------------KFCRF 13 |
| HELIOBACTER_ | 1 --------------------------MERKR---YSKR---------------------------YCKY 13 |
| PYLORI | |
| CYANOPHORA_ | 1 --------------------------MS------VYRR--------------------------RLSPL 11 |
| PARADOXA | |
| ODONTELLA_ | 1 ----------------------MLAQKQ------------------------------------KLSPI 13 |
| SINENSIS_C | |
| OENOTHERA_ELATA | 1 ----------------MDKSKRLFLKSKR-----SFRR--------------------------RLPPI 22 |
| ORYZA_SATIVA | 1 ---------MYTSSQPFHSSKQTSMSSSQ-----TFRKSKQTFRSSSQPSESPSOPSR------RRPRI 49 |
| ZEA_MAYS | 1 ---------MYISSQPSRKSSQPSRKSKC-----TFHKSKQPSRSPSQPSRSSSQPSRKSSQPFRESRI 56 |
| SPINACIA_ | 1 ----------------MDKSKRPFLKFKR-----SFRR--------------------------RLPPI 22 |
| OLERACRA | |
| NIOCTIANA_ | 1 ----------------MDKSKRPFLKFKR-----SFRR--------------------------RLPPI 22 |
| TABACUM | |
| METNANCOCOCUS_ | 1 -------------------MASARRRRIS-----KKKQVIS-----------------------KKIEF 22 |
| JANNAS | |
| ESCHERICHIA_ | 14 TAEGOQEIOYSCIAT--LKNYITE--SGKIV----P--SRITCTEAKYORCLAEA---IK-RARYLSL 67 |
| COLI | |
| YERSINIA_PESTIS | 14 TAECVVEIOYSCIAT--LSNYITE--SGKIV----P--SRITCTEASYCRQLARO---IK-SARYLSL 67 |
| SALMONELLA_ | 14 TAECVOEIDYSCIAT--LSNYITE--SGKIV----P--SRITCTRASYQROLRRA---IK-RARYLSO 67 |
| TYPHIMURI | |
| HAEMOPHILUS_ | 14 TAENVVEIDYKDIAT--LSNYISE--SGKIV----P--SRITCTRAKYQRQLAEA---IK-RARYLAL 67 |
| INFLUENZ | |
| THERMUS_ | 10 TLCSSOLROYENOEO--LSRSLSE--TGKIL----P--RRRTCLSGSEQEILAST---IK-RARILGL 63 |
| THERMOPHILUS | |
| DEINOCOCCUS_ | 29 SICELEITOYSOOSM--LRRFVSD--TGKIL----P--RRETGLSASICRRIACT---IK-VARQLAL 82 |
| RADIODUR | |
| PSEUCOMONAS_ | 14 TAECOSEIOYSDLNT--LKAYVSE--TGSIV----P--SRITGTSASYCRQLATA---IK-RARYLAL 67 |
| AERUGINO | |
| HOMO_SAPIEN_ | 68 CG---KHVDYKNVQL--LSQFVSPF-TGCIY----G--RHITCLOCSKCKEITSA---IK-RAQIMOS 119 |
| MITOCHON | |
| TREPNOMEA_ | 40 CTQKL-LACYSOSOT--LRREITE--RCKIL----P--EEITCTCASHQREVALE---VK-RSRAVAL 92 |
| PALLIDUM | |
| BACILLUS_SUBTILIS | 19 TSNCITMIOYSOODL--LKKFVSE--RGKIL----P--RROTCTNASYORSLTAA---IK-RARQMAL 72 |
| GEOBACILLUS_ | 18 TANNITMIOYSOVOL--LSKPISE--RGKIL----P--RRVTCTSASYCRSLTVA---IK-RAROMAL 71 |
| STEAROTH | |
| CHLAMYCOPHILIA_ | 22 VSACWSTIDYSCVET--LKKFITE--RGKVL----P--RRITCOSSRFQCVLSOA---IK-RARHLGL 75 |
| PNEUM | |
| LISTERIA_INNOCUA | 18 TSNCITHIDYSOVEL--LKKFVSE--RGKIL----P--RRVTCTSASYORSLTOA---IK-RSEQMAL 71 |
| CHLAMYDIA_ | 21 VSAGMSTIOYKDVTT--LKRFITS--RGKIL----P--RRITCVSEEFCALLAQA---VK-RARHVCL 74 |
| TRACHOMATI | |
| STAPHYLOCOCCUS_ | 19 TANCITHIOYROTEL--LSESISE--RGKIL----P--ERVTCTSASYORMLTTA---IK-RSRHMAL 72 |
| AUREU | |
| MESORHIZOMBIUM_ | 23 SGANAPSIOYSOVRL--LQRYISE--RGKIV----P--SRITAOSCSSCRELASA---IK-RARFLGL 76 |
| LOTI | |
| BACILLUS_ | 16 TVNKIESIOYSCODL--LSSSVSE--RGKIL----P--RROTCTEASYCRQLTTA---IK-RARCIAL 69 |
| HALODURANS | |
| AQUIFEX_AEOLICUS | 14 CEQSR-EPDYKNYEE--LRNELTE--RGRIK----D--RKQTCLCASHORRLAOQ---IK-EARQLCL 66 |
| THERMATOGA_ | 16 CEMKLDYVDYKDTRL--LSESLTD--KGKII----P--SELTCNCSSHORMV50A---IK-RARQMOL 69 |
| MARITIMA | |
| MYCOPLASMA_ | 21 DEQCINYIOYROOEL--LSKFINS--HGKIL----P--SKITDVSAKRQRMLTRA---IK-RARNMAL 74 |
| PULMONIS | |
| VIBRIO_CHOLERA | 14 TAECVQEIOYSDOAT--LKNYITE--AGKIV----P--SRITGTSAKYQRQLARA---IK-RARYLAL 67 |
| HELICOBACTER_ | 14 TEASISPIDYSCLDM--LKHTLSE--RYKIM----P--RRLTGNSKKWQERVEVA---IK-RARHMAL 67 |
| PYLORI | |
| CYANOPHORA_ | 12 KPNQV--IDYQDVEL--LRTFITD--QGKIL----P--RRVTGLTAKQQRAVTKA---IK-QARVLAL 63 |
| PARADOXA | |
| ODONTELLA_ | 12 SVNQK--IDYKDIDL--LKLFITE--QGKIL----P--RRATGVTVQQQRQIAKA---IK-RARVLSL 63 |
| SINENSIS_C | |
| OENOTHERA_ELATA | 23 QSGDR--IDYRNISL--ISRFISQ--QGKIL----S--RRVNRLTLKQQRLITIA---IN-QARILSL 74 |
| ORYZA_SATIVA | 50 GPGDR--IDYRNMSL--INRFISE--QGKIL----S--RRINRLTLKQQRLITLA---IK-QARILSF 101 |
| ZEA_MAYS | 57 GPGDR--IDYRNMSL--INRFISE--QGKIL----S--RRINRLTLKQQRLITLA---IK-QARILSF 108 |
| SPINACIA_ | 23 QSGDR--IDYRNMSL--ISRFISE--QGKIL----S--RRVNRLTLKQQRLITSA---IK-QARILSL 74 |
| OLERACEA | |
| NICOTIANA_ | 23 QSGDR--IDYRNMSL--ISRFISE--QGKIL----S--RRVNRLTLKQQRLITLA---IK-QARILSL 74 |
| TABACUM | |
| METHANOCOCCUS_ | 23 RYRGYTLELQQMPLREFAKLLPARQRRTLLRGLTPQQKKLAMKIKKARRLLNKGEPRIIRTHCRDFVI 92 |
| JANNAS | |
| ESCEERICHIA_COLI | 68 LP--------------YTD----------------------------------RHQ-------------- 75 |
| YERSINIA_PESTlS | 68 LP--------------YTD----------------------------------RHQ-------------- 75 |
| SALMONELLA_ | 68 LP--------------YTD----------------------------------RHQ-------------- 75 |
| TYPHIMURI | |
| HAEMOPHILUS_ | 68 LP--------------YTD----------------------------------NHQ-------------- 75 |
| INFLUENZ | |
| THERMUS_ | 64 LP--------------FTEK--------------------------------LVRK-------------- 73 |
| THERMOPHILUS | |
| DEINOCOCCUS_ | 83 LP--------------YTEK--------------------------------LVRK-------------- 92 |
| RADIODUR | |
| PSEUDOMONAS_ | 68 LP--------------YTD----------------------------------SHGR------------- 76 |
| AERUGINO | |
| HOMO_SAPIEN_ | 120 MPVTYKDPA-------YLKD---------------------------------PKVCNIRYRE------- 142 |
| MITOCHON | |
| TREPNOMEA_ | 93 LP--------------FVL----------------------------------TE--------------- 99 |
| PALLIDUM | |
| BACILLUS_SUBTILIS | 73 LP--------------YVS----------------------------------GE--------------- 79 |
| GEOBACILLUS_ | 72 LP--------------YVA----------------------------------DE--------------- 78 |
| STEAROTH | |
| CHLAMYDOPHILIA_ | 76 LP--------------FVG----------------------------------ED--------------- 82 |
| PHEUM | |
| LISTERIA_INNOCUA | 72 LP--------------FVA----------------------------------EEK-------------- 79 |
| CHLAMYDIA_ | 75 LP--------------FVG----------------------------------ED--------------- 81 |
| TRACHOMATI | |
| STAPHYLOCOCCUS_ | 73 LP--------------YVK----------------------------------EEQ-------------- 80 |
| AUREU | |
| MESORHIZOMBIUM_ | 77 LP--------------YVV----------------------------------R---------------- 82 |
| LOTI | |
| BACILLUS_ | 70 LP--------------YVT----------------------------------DNN-------------- 77 |
| HALODURANS | |
| AQUIFEX_AEOLICUS | 67 LP--------------YVV----------------------------------Y---------------- 72 |
| THERMATOGA_ | 70 LP--------------YLK------------------------------------I-------------- 75 |
| MARITIMA | |
| MYCOPLASMA_ | 75 LP--------------FTQ----------------------------------ERVRTQKPL--IVTSNS 94 |
| PULMONIS | |
| VIBRIO_CHOLERAE | 68 LP--------------YTD----------------------------------KHQ-------------- 75 |
| HELICOBACTER_ | 68 IP--------------YIV----------------------------------DRKKVVDSP--FKQH-- 85 |
| PYLORI | |
| CYANOPHORA_ | 64 LP--------------FVN-------------------R---------------ES-------------- 71 |
| PARADOXA | |
| ODONTELLA_ | 64 LP--------------FVA----------------------------------SNSI------------- 72 |
| SINENSIS_C | |
| OENOTHERA_ELATA | 75 LP--------------FRP--KAQRFK-----------R--------------SQSTARTVG--LRTRNK 101 |
| ORYZA_SATIVA | 102 LP--------------FRNYENEKQFQAQSISIITGPRPRREREIPPLTQKPESERELRESEOTLRETER 157 |
| ZEA_MAYS | 109 LP--------------FREYEHEEQPQAQAISIITGPRHRREREIPQLTQKPESHRELRESEQELRNUER 164 |
| SPINACIA_ | 75 LP--------------FLN--NEKQFE-----------R--------------TESTTRTAN--FRTKNK 101 |
| OLERACRA | |
| NICOTIANA_ | 75 LP--------------FLN--NEKQFE-----------R--------------TESTARTTG--FKARNK 101 |
| TABACUM | |
| METHANOCOCCUS_ | 93 TPDHVGLTPOVYEOICEEVEVKVTPEMIGHYLG----------------EFSLTREPVQHDAPGHGATRS 145 |
| JANNAS | |
| ESCHERICHIA_COLI | 75 ----------- 75 |
| YERSINIA_PESTIS | 75 ----------- 75 |
| SALMONELLA_ | 75 ----------- 75 |
| TYPHIMURI | |
| HAEMOPHILUS_ | 75 ----------- 75 |
| INFLUENZ | |
| THERMUS_ | 73 ----------- 73 |
| THERHOPHILUS | |
| DEINOCOCCUS_ | 92 ----------- 92 |
| RADIODUR | |
| PSEUDOMONAS_ | 76 ----------- 76 |
| AERUGINO | |
| HOMO_SAPIEN_ | 142 ----------- 142 |
| MITOCHON | |
| TREPNOMEA_ | 99 ----------- 99 |
| PALLIDUM | |
| BACILLUS_SUBTILIS | 79 ----------- 79 |
| GEOBACILLUS_ | 78 ----------- 78 |
| STEAROTH | |
| CHLAMYDOPHILIA_ | 82 ----------- 82 |
| PNEUM | |
| LISTERIA_INNOCUA | 79 ----------- 79 |
| CHLAMYDIA_ | 81 ----------- 81 |
| TRACHOMATI | |
| STAPHYLOCOCCUS_ | 80 ----------- 80 |
| AUREU | |
| MESORHIZOMBIUM_ | 82 ----------- 82 |
| LOTI | |
| BACILLUS_ | 77 ----------- 77 |
| HALODURANS | |
| AQUIFEX_AEOLICUS | 77 ----------- 77 |
| THERMATOGA_ | 75 ----------- 75 |
| MARITIMA | |
| MYCOPLASMA_ | 95 PKEKEAKPSAQ 105 |
| PULMONIS | |
| VIBRIO_CHOLERAE | 75 ----------- 75 |
| HELICOBACTER_ | 85 ----------- 85 |
| PYLORI | |
| CYANOPHORA_ | 71 ----------- 71 |
| PARADOXA | |
| ODONTELLA_ | 72 ----------- 72 |
| SINENSIS_C | |
| OENOTHERA_ELATA | 101 ----------- 101 |
| ORYZA_SATIVA | 158 NLSSDC----- 163 |
| ZEA_MAYS | 165 NLSSDC----- 170 |
| SPINACIA_ | 101 ----------- 101 |
| OLERACEA | |
| NICOTIANA_ | 101 ----------- 101 |
| TABACUM | |
| METHANOCOCCUS_ | 146 SMFVPIK---- 152 |
| JANNAS | |
| C. S11 Sequence Alignments |
| (SEQ ID NOS: 85–124, |
| respectively, in order of |
| appearance) |
| Species | Aligned Sequence |
| ESCHERICHIA_COLI | 1 -----MAKAPI-----------------------------------RARKRVRKQ----------VSDGV 20 |
| THERMUS_ | 1 ----------------------------------------------------KRQ----------VASGR 8 |
| THERMOPHILUS | |
| CAULOBACTER_ | 1 -----MAKEPA-----------------------------------RVKRRERKN----------ITSOV 20 |
| CRESCENT | |
| MESORHIZOBIUM_ | 1 -----MAKEAA-----------------------------------RVRRRERKN----------ISSGV 20 |
| LOTI | |
| HAEMOPMILUS_ | 1 -----MAKTPV-----------------------------------RARKRVKKQ----------VVDGV 20 |
| INFLUENZ | |
| YERSINIA_PESTIS | 1 -----MAKAPI-----------------------------------RARKRVRKT----------VSDGV 20 |
| GEOBACILLUS_ | 1 ------ARRTN-----------------------------------TRKRRVRKN----------IDTGI 19 |
| STEAROTH | |
| THERMUS_ | 1 -----MAKKPS-------------------------------------KKKVKRQ----------VASGR 18 |
| AQATICUS | |
| DEINOCOCCUS_ | 1 -----MAKPTKG----------------------------------KAPRRSRRN----------ISAGR 21 |
| RADIODUR | |
| STREPTOMYCES_ | 1 -----MPPKGRQGAAK------------------------------KVRRKEKKN----------VAHGH 25 |
| COELICO | |
| CLOSTRIDIUM_ | 1 -----MAVQKNKK---------------------------------TRRRKEKKN----------IEHGC 22 |
| ACETOBUT | |
| TREPONEMA_ | 1 -----MAVTKK--------------------------------------RKEKKN----------VYEGN 17 |
| PALLIDUM | |
| LEPTOSPIRA_ | 1 -----MADDKKSVKKE-----------------------------KKVKKKEKKI----------VPRGK 26 |
| INTERROGA | |
| AQUIFEX_AEOLICUS | 1 -----MAKKK--------------------------------------KKQKRQ-----------VTKAI 16 |
| VIBRIO_CHOLERAE | 1 -----MAKQPT-----------------------------------RARKRVRKQ----------VADGV 20 |
| SALMONELLA_ | 1 -----MAKAPV-----------------------------------CARKRVRKQ----------VSDGV 20 |
| ENTERICA | |
| THERMOTOGA_ | 1 -----MARKRGG----------------------------------SSKKQKKVS----------FDYGV 21 |
| MARITIMA | |
| BACILLUS_ | 1 -----MAKKTN-----------------------------------TRKRRQRKN----------VETGV 20 |
| HALOCURANS | |
| CYANOPHORA_ | 1 -----MARQIKR----------------------------------SGTTKQKKN----------IPVGV 21 |
| PARADOXA | |
| BACILLUS_SUBTILIS | 1 ---MAAARKSN-----------------------------------TRKRRVKKN----------IESGI 22 |
| LISTERIA_INNOCUA | 1 -----MARKTN-----------------------------------TRKRRVKKN----------IESGI 20 |
| STREPTOCOCCUS_ | 1 -----MAKP-------------------------------------TRKRRVKKN----------IESGI 18 |
| PNEUMO | |
| OENOTHERA_ELATA | 1 -----MAKSIPSAGLR--LRLRLRR------------------NARRRSRKSTRK----------IPKGV 35 |
| SPINACIA_ | 1 -----MAKPIP--------KIGSRR------------------NGRISSKKSARK----------IPKGV 29 |
| OLERACEA | |
| ZEA_MAYS | 1 -----MTKAIPKIGSRKKVRIGLRR------------------NARPSLRKSARR----------ITKGI 37 |
| ORYZA_SATIVA | 1 -----MTKAIPKIGSRRKVRIGLRR------------------NARFSLRKSARR----------ITKGV 37 |
| PINUS_ | 1 -----MSKTIK----------------------------------RIGSRRNENR----------VLKGV 21 |
| THUNBERGII_ | |
| CHL | |
| EUGLENOPHYCEAN_ | 1 -------------------------------------------------------------------MAM 3 |
| ALGA | |
| COMMON_TOBACCO | 1 -----MAKAIP--------KISSRR------------------NGRIGSKKGARR----------IPKGV 29 |
| CHLAMYDIA_ | 1 -----MVKNQAQ--K------------------------------KGVKRKQVKN----------IPSGV 23 |
| TRACHOMATI | |
| HOMO_SAPIENS_ | 1 -----MEKRTWSSEVNGSSSGQVEVG-----HWRQSIYPPIPGEESSLRWAGKKF----------EEIPI 50 |
| MITOCHO | |
| HALOARCULA_ | 1 -----MSEE---------------------------------------TEDI---------------WGI 11 |
| MARISMORT | |
| HALOBACTERIUM_ | 1 -----MADD---------------------------------------TK-----------------WGI 9 |
| SALINA | |
| METHANOCOCCUS_ | 1 -----MAEQ---------------------------------------KKEK---------------WGI 11 |
| JANNES | |
| RATTUS_ | 1 -----MQVLT---------------------------------------KRYPKN---------CLLKVM 17 |
| NORVEGICUS_S1 | |
| NEUROSPORA_ | 1 -----MPPKKAAR-----------------------------------PAQEN-ISLGPQIREGELVFGV 29 |
| CRASSA_S1 | |
| MELANOGASTER_ | 1 -----MAPRKAKV-----------------------------------QKEEVQVQLGPQVRDGEIVFGV 30 |
| S14 | |
| CRICETUSLUS_ | 1 -----MAPRKGKE-----------------------------------KKEEQVTSLGPQVAEGENVFGV 30 |
| GRISEUS_ | |
| HOMO_SAPIENS_S14 | 1 -----MAPGKGKE-----------------------------------KKEEQVINLGPQVAEGENVFGV 30 |
| BRUCEI_S14 | 1 -----MS-----------------------------------------KKQE-VKYYGSSAGKOQLVYOV 23 |
| ESCHERICHIA_COLI | 21 AHIHASFNNTIVTITOEQG-NALGNATAOGSGPRGSRKSTPPAAQVAAERCAOAVKE-YGIKNLEVNVKG 95 |
| THERMUS_ | 9 AYINASYNNTIVTITOPCG-NPITWSSGGVIGYKOSEKOTPYAAQLAELCAAKKEMA-YGMQSVOVIVEG 76 |
| THERMOPHILUS | |
| CAULOBACTER_ | 21 AHVNASFNNTMITITDAQG-NTISWSSAGMMGFKGSRKSTPYAAQMAAEDAGKKAAE-HGVKTLEVNVSG 88 |
| CRESCENT | |
| MESORMISOBIUM_ | 21 AHVNSTFNNTMITITDAQG-NSIAWSSAGAQGFKGSRKSTPFAAQMAAEDVAKKAQE-HGMRMLEVEVCG 88 |
| LOTS | |
| HAEMOPHILUS_ | 21 RNIRASFNNTIVTITDEGG-NALEWATAGGSGFROSRESTPPEAQVAAEECAEIVKE-FGLKNLEVMVKG 58 |
| INFLUENZ | |
| YERSINIA_PESTIS | 21 ANIMASPNNTIVTITGKGG-NALGWATAGOSOFRGSRKSTPFAAQVAAERCAEAVKE-YGIKELEVSVKG 55 |
| GEOBACILLUS_ | 20 AHIRSTFNNTIVTITOVNG-NALAWASAOSLGPKGSRKSTPFAAQMEAEAAAKASME-NGNKTVEVNVKG 87 |
| STEAROTH | |
| THERMUS_ | 19 AYTKASYNNTIVTITGPUG-NPITWSSGGVIGYKOSEKOTPYAAQLAALDAAKKANA-YGMQSVUVTVRG 56 |
| AQUATICUS | |
| DEINOCOCCUS_ | 22 AYVHASYNNTIVTITDLDG-NSVAWSSGGTIGYKGSKKGTPYAAQLAAADAVKKAQTSFGMAAVDVIVRG 90 |
| RADIODUR | |
| STREPTOMYCES_ | 26 ANSKSTFNNTIVSITOPTG-NVISNASAGHVGFKGSEKSTPPAAQMAAESAAERAGE-NGMKKVOVFVKG 93 |
| COELICO | |
| CLOSTRIDUM_ | 23 AHIKSTFNNSIVTTTOVNG-NALSSSSAGGLGPKGSEKSTPFAAQMAERTAAKTEME-HGLKSVDVPVKG 90 |
| ACETOBUT | |
| TREPONEMA_ | 15 VYIQATFNNTIITVTULQG-NALSWASSGGLGFNGAKKSTPFAAQTVAEAAVQKAQQ-CGLREVMVFVKG 85 |
| PALLIDUM | |
| LEPTOSPIRA_ | 27 VYITASFNNTIVTITOMAG-NTISWSTSGAMGFRGSKKSTPYAAQIAAGNAAEKAIQSAGLQEVOVNVSG 95 |
| INTERROGA | |
| AQUIFEX_AEOLICUS | 17 VMIMTTFNNTIVNVTOTGG-NTIATSASGOTVGFRGTERSTPYAAQLAQKANKEAKE-HGVQEVEIWVKG 84 |
| VIBRIO_CHOLERA | 21 AHIHASFNNTIVTITOEQG-NALAWATAGGSGPEGSEKSTPPAAQVAAERCAEMAKE-YGLKNLEVMVKG 59 |
| SALMONELLA_ | 21 AHIMASFNNTIVTITOEQG-NALGWATAGGSOFEGSEKSTPFAAQVAAERCAGAVK5-YGOKNLEVMVKG 88 |
| ENTERICA | |
| THERMOTOGA_ | 22 VMIXSTFNNTIITLTOKOG-NTLTWASGOTVGFEGTRKGTPYAAQLAEOKVAREALE-MGIKKVOVLVKG 89 |
| MARITIMA | |
| BACILLUS_ | 21 AHIESTFNNTSVTITOPHG-NAISWASAGALGFKGSEKSTPFAAQMAAETAAKAENE-NOMKSIEVSVRG 88 |
| HALOCURANS | |
| CYANOPHORA_ | 22 AHIQSTFNNTTISITSPTO-EVOAWASAGSSOPKGARKGTPFAAQTAAENSAEQENE-QGMEQIEVITSG 89 |
| PARAGOXA | |
| BACILLUS_SUBTILIS | 23 AHIESTFNNTIVTITOTNG-NEIBWSSAOELGFEGSEKSTPFAAQMAAETAAKGSIE-MGLKTLEVTVKG 90 |
| LISTERIA_INNOCUA | 21 ANTESTFNNTIVMITOTNO-NALAWSSAGSLGFKGSRKSTPFAAQMAAESAAKSAQE-NGLRTLEVTVRG 88 |
| STREPTOCOCCUS_ | 19 ANIMATFNNTSVMITOVMG-NAIAWSSAGALOFKGSRRSTPFAAQMASEAAAKSAQE-NOLKSVEVTVKG 86 |
| PHEUMO | |
| OENOTHERA_ELATA | 36 IHVQASFMNTOVTVTOVEG-RVTSWSSAGTCGPKSTERGTPFAAQTAAGOAIEPVVO-QGMGRAEVEIKG 103 |
| SPINACIA_ | 30 IHVQASPNNTIVTVTOVRG-RVVSWASAGTCGFROTKAGTPFARQTARONAIRTVVE-QOMQRAEVMIRG 97 |
| OLERACEA | |
| ZEA_MAYS | 38 IHVQASFNNTIITVTOPQO-EVVFWSSAGTCOEKESRKASPYAOGRTAVOAORTV----GLQRAEVMVKG 102 |
| ORYZA_SATIVA | 38 IHVQAEFNNTIITVTOPQG-RVVFNSSAGTCGFKSSEKASPYAGQRTAVOAIRTV----GLQRAEVNVKG 102 |
| PINUS_ | 22 IYVQASFMNTIVTATOVRG-QVLSVSSAOACGFRGTERGTPFAAQTAAENVIRALMG-RGMERVEVMISG 89 |
| THUNBERGII_CHL | |
| EUGLENOPHYCEAN_ | 4 VYIKMSPNNTIVTVSOORA-NVLSWCSSGVCKFKGRGKTTAFATRIVITEALKSVLE-EOFNGIOIKVSG 71 |
| ALGA | |
| COMMON_TOBACCO | 30 IHVQASPNNTIVTVTOVRG-RVVSWSSAGTSGFKGTKEGTPFAAGTEAANAIRTVVG-QGMQRAEVMIKG 97 |
| CHLAMYDIA_ | 24 VNVKATPNNTIVTTTOPAG-NVISMASAOXVGYSGSRKSSAFAATVAAQOAAKAENS-SGKLEVEVGKDG 91 |
| TRACHOMATI | |
| HOMO_SAPIENS_ | 51 AHIKASHNNTQTQVVSASN-EPLAFASCGTEGFRNARKGTOIAAQTAGIAAAARAKQ-KGVIMIEVVVKG 118 |
| MITOCHO | |
| HALOARCULA_ | 12 AHVHASFNNTIITITDQTGAETLAKSSGGTVVEQNEOEASPYAENQMAEVVAEKALD-RGVEGVDVRVRG 80 |
| MARISMORT | |
| HALOBACTERIUM_ | 10 AHVMASFNNTIMTVTOGTGAETLAKSSGOSVVRGNEOEASPYAAMQMAEGLAEEVLD-QGIEKVNVRVRG 78 |
| SALINA | |
| METHANOCOCCUS_ | 12 VHIYSSYNNTIIKATOITGAETIARVSGGNVTENGEOEGSPYAEMQAAFRLAEVLKE-RGIENINIRVRA 80 |
| JANNAS | |
| RATTUS_ | 18 DRYSAVVRNNEQVVMSPSLLEDVELMGYGOSVQDGAPOLYTYFTILKSICVEVOMO-LLPREEWQAKVAG 86 |
| NORVEGICUS_S1 | |
| NEUROSPORA_ | 30 ARIFASFNOTPVNVTOLSGRETTORVIGGIRVREGEOESSPYAEMLEAQOVAERCRE-LGITELMOKIEA 98 |
| CRASSA_S1 | |
| MELANOGASTER_ | 31 AHIYASFNOTFVNVTOLSGEETIAEVTGOMRVKEOROEASPYAANLAAGOVAEKCKT-LGOTALMOKLRA 99 |
| S14 | |
| CRICETUSLUS_ | 31 CHIFASFNOTFVMVTOLSOKETICEVTOGMKVKAORGESSPYAAMLAAGOVAGRCKE-LOOTALNIKLRA 99 |
| GRISEUS_ | |
| HOMO_SAPIENS_S14 | 31 CHIFASFNDTFVMVTDLSGKQTICRVTGGMKVKEOEOESSPYAEMLTTQOVAQECKE-LGIIALNIQLRA 99 |
| BRUCEI_S14 | 24 VHIYASFNDTFVHVTDMSGRETFCKVTGGMKVKADRDESSPYAAMMAAQDVVARCKE-CGINALHVKMRA 92 |
| ESCHERICHIA_COLI | 89 PG--------PGRESTI--RALNAAGFRITNITDVTPIPHNGCRPPKKRRV------------- 129 |
| THERMUS_ | 77 TG--------AGREQAI--RALQASGLQVKSIVOOTPVPHNGCRPKKKFRKAS----------- 119 |
| THERMOPHILUS | |
| CAULOBACTER_ | 89 PG--------SGRESAL--RALGAAONTITTIROVTPIPHNOCRPPXRRRV------------- 129 |
| CRESCENT | |
| MESORHIZOBIUM_ | 89 PG--------SGRESAL--RALQAAGFTITSIROVTPIPHNGCRPRKKRRV------------- 129 |
| LOTI | |
| HAEMOPHILUS_ | 89 PG--------PGRESTI--RALNAAOFRITNITOVTPIPHNGCRPPKKRRV------------- 129 |
| INFLUENZ | |
| YERSINIA_PESTIS | 89 PG--------PGRESTI--RALNAAOPRITNXTOVTPIPOIOCRPPKKRRV------------- 129 |
| GEOBACILLUS_ | 88 PG--------AGREAAI--RALQAAGLEITAIKOVTPIPHOCCRPPKRRRV------------- 128 |
| STEAROTH | |
| THERMUS_ | 87 TG--------AGREQAI--BALQASGLQVKSIVOOTPVPMNGCRPKKKFRKAS----------- 129 |
| AQUATICUS | |
| DEINOCOCCUS_ | 91 SG--------SGREQAI--RAICAEOIEVRSIMOOSPvPHNOCRPKXKPRA------------- 131 |
| RADIODUR | |
| STREPTOMYCES_ | 94 PG--------SGRETAI--RSLOATOLEVGSICOVTPTPHNGCRPPKRRRV------------- 134 |
| COELICO | |
| CLOSTRIDIUM_ | 91 PG--------SGREAAI--RSLQAAOLEVTLIKOVTPIPIGGCRPPKRRBV------------- 131 |
| ACETOBUT | |
| TREPONEMA_ | 86 PG--------IGRESAI--RMLGTMGLRVRSIROITPIPHNGCRPRKTRRI------------- 126 |
| PALLIDUM | |
| LEPTOSPIRA_ | 96 PG--------IGRESAI--RSLVARGLNIKMIKOVTPLPHNGCRPRKRRRV------------- 136 |
| INTERROGA | |
| AQUIFEX_AEOLICUS | 69 PG--------AGRESAV--RAVFASGVKVTAIROVTPIPHNOCRPPARRRV------------- 129 |
| VIBRIO_CHOLERAE | 89 PG--------PGRESTV--RALNAAOPRITNIVOATPIPENOCRPPKKRRV------------- 129 |
| SALMONELLA_ | 89 PG--------PGRESTI--RALNAAGFRITNITDVTPIPHNGCRPPRKRRV------------- 129 |
| ENTERICA | |
| THERMOTOGA_ | 90 PG--------PGREPAI--RTLQGAGLEINQIKOVTPIPENOCRPKKRRRV------------- 130 |
| MARITIMA | |
| BACILLUS_ | 89 PG--------AGREAAI--RSLQAVGLEVNMIKDVTPVPHNGCRPPKRRRV------------- 129 |
| HALOCURANS | |
| CYANOPHORA_ | 90 PG--------SGREMAI--KALQATGLEISLIROITPVPHNGCRPPKRRRV------------- 130 |
| PARADOXA | |
| BACILLUS_SUBTILIS | 91 PG--------SGREAAI--RALQAAGLEVTAIROVTPVPIHNCRPPKRRRV------------- 131 |
| LISTERIA_INNOCUA | 89 PG--------SGREAAI--RALQAAOLEVTAIKDVTPVPHNOCRPPKRRRV------------- 129 |
| STREPTOCOCCUS_ | 87 PG--------SGRESAI--RALAAAOLEVTAIROVTPVPHNGARPPXRRRV------------- 127 |
| PHEUMO | |
| OENOTHERA_ELATA | 104 PG--------LGROAAL--RAIRRSGORLSCIROVTPLPHNGCMPPKKRRV------------- 144 |
| SPINACIA_ | 98 PG--------LGRDAAL--RAIRRSGILLSPVROVTPMPHNOCRPPKKRRV------------- 118 |
| OLERACEA | |
| ZEA_MAYS | 103 AG--------SGRDAAL--RAIAKEGVRLSCIROVTPNPHNOCRPPKKRRL------------- 143 |
| ORYZA_SATIVA | 103 AG--------SGRDAAL--RAIAKSGVRLSCIRDVTPMPHNGCRPPKKRRL------------- 143 |
| PINUS_ | 90 PG--------RGRDTAL--RTIRRSOILLSFVROVTPMPHNGCRPPKKRRV------------- 130 |
| THUNBERGII_CHL | |
| EUGLENOPHYCEAN_ | 72 PG--------FGRNVAI--RAIIKMGFKVPSLKOITPLPYNGCRPRKRRRT------------- 112 |
| ALGA | |
| COMMON_TOBACCO | 98 PG--------LGRDAAL--RAIRRSGILLTFVRDVTPMPHNGCRPPKKRRV------------- 138 |
| CHLAMYDIA_ | 92 TG--------AGRESAV--RALISSGLIVSVIRDETPVPMNOCRPRKRRRV------------- 132 |
| TRACHOMATI | |
| HOMO_SAPIENS_ | 119 LG--------PGRLSAM--HGLIMOGLEVIELTOMTPIPHNGCRPRKARKL------------- 169 |
| MITOCHO | |
| HALOARCULA_ | 81 PGGNLQTSPGPGAQATI--RALARAGLEIGRIEDVTPTPHDGTRAPKNSGF------------- 129 |
| MARISMORT | |
| HALOBACTERIUM_ | 79 PGGHLQRSPOPGAQAAI--RALARAGLEIGRIEDVTPIPHDGTRPPKNSGY------------- 127 |
| SALINA | |
| METHANOCOCCUS_ | 81 PGGSGQKNPOPOAQAAI--RALARAOLRIGRIEOVTPVPHOOTTPKXRPKK------------- 129 |
| JANNAS | |
| RATTUS_ | 87 NEGSEAENEAASTEEAEEORLSEELOLEAQFMLHFSSLMMILTNLTQXAQEVTQKYQEMTGQVL 150 |
| NORVEGICUS_S1 | |
| NEUROSPORA_ | 99 TGGNGTRTPGPGAQSAL--RALARSGMKIGRIEOVTPTPSOSTRRKOORRORRL---------- 150 |
| CRASSA_S1 | |
| MELANOGASTER_ | 100 TGGNKTXTPOPOAQSAL--RALARESMKIORIEOVTPIPSOETRRKOGRRORRL---------- 151 |
| S14 | |
| CRICETUSLUS_ | 100 TGONRTKTPOPOAQEAL--NALARBOMXIORIEOVTPIPBOSTRRKOORRORRL---------- 151 |
| GRISEUS_ | |
| HOMO_SAPIENS_S14 | 100 TGGNRTKTLOPGPS---------RP---------SEPLPARV---------------------- 123 |
| BRUCEI_S14 | 93 TGGVGTKSPOPGAQAAL--RALARAGMXIGRIEOVTPVPTOSTRRKOSRRGRRL---------- 144 |
Ribosomes are ubiquitous supramolecular complexes that are responsible for protein synthesis in all living cells. They contain large amounts of ribosomal RNA (rRNA), in addition to more than 50 different proteins. Unlike other cellular polymerases, their mechanism of action appears to be fundamentally based on RNA—i.e., they are ribozymes. A detailed knowledge of the three-dimensional structure of rRNA and proteins in the ribosome thus is essential for a molecular understanding of translation.
Understanding the structural basis for the functional capabilities of ribosomal RNA (rRNA) thus is essential for explaining why these ancient organelles use RNA, instead of protein, for the complex and biologically crucial task of translation. Bacterial and archaeal ribosomes are comprised of small (30S) subunits which contain 16S rRNA and about 20 proteins, and large (50S) subunits, which contain 23S rRNA, 5S rRNA and over 30 proteins. The complete 70S ribosome is formed by binding of the 30S subunit to the 50S subunit via a network of intermolecular bridges. The intersubunit space formed between the two subunits is occupied by the transfer RNAs (tRNAs), whose anticodons base pair to the mRNA codons in the 30S subunit, while their 3′-CCA ends reach into the peptidyl transferase center, the site of peptide bond formation in the 50S subunit.
Uses of the Crystal Structure Coordinates of the 70S Ribosome
The 5.5 Angstrom structure of 70S ribosome we determined from T. thermophilus may be used as a model for rationally designing pharmacophores and/or candidate compounds, either de novo or by modification of known compounds. Pharmacophores and candidate compounds identified through the use of the crystal structure coordinates are useful for altering the rate of bacterial protein synthesis, and so have utility as antimicrobial agents, including antibiotics, and preservatives. Pharmacophores and candidate compounds may be determined according to any method known in the art, including the methods described in U.S. Pat. No. 5,888,738 to Hendry, and the methods described in U.S. Pat. No. 5,856,116 to Wilson et al. the disclosures of which both are incorporated by reference in their entirety for all purposes.
The structure data provided herein may be used in conjunction with computer-modeling techniques to develop models of sites on the 70S ribosome selected by analysis of the crystal structure data. The site models characterize the three-dimensional topography of site surface, as well as factors including van der Waals contacts, electrostatic interactions, and hydrogen-bonding opportunities. Computer simulation techniques are then used to map interaction positions for functional groups including protons, hydroxyl groups, amine groups, divalent cations, aromatic and aliphatic functional groups, amide groups, alcohol groups, etc. that are designed to interact with the model site. These groups may be designed into a pharmacophore or candidate compound with the expectation that the candidate compound will specifically bind to the site. Pharmacophore design thus involves a consideration of the ability of the candidate compounds falling within the pharmacophore to interact with a site through any or all of the available types of chemical interactions, including hydrogen bonding, van der Waals, electrostatic, and covalent interactions, although, in general, and preferably, pharmacophores interact with a site through non-covalent mechanisms.
The ability of a pharmacophore or candidate compound to bind to the 70S ribosome can be analyzed prior to actual synthesis using computer modeling techniques. Only those candidates that are indicated by computer modeling to bind the target with sufficient binding energy (i.e., binding energy corresponding to a dissociation constant with the target on the order of 10−2 M or tighter may be synthesized and tested for their ability to bind to the 70S ribosome and to inhibit ribosome function using binding assays or ribosome function assays known to those of skill in the art. The computational evaluation step thus avoids the unnecessary synthesis of compounds that are unlikely to bind the 70S ribosome with adequate affinity.
A 70S ribosome pharmacophore or candidate compound may be computationally evaluated and designed by means of a series of steps in which chemical entities or fragments are screened and selected for their ability to associate with individual binding target sites on the 70S ribosome. One skilled in the art may use one of several methods to screen chemical entities or fragments for their ability to associate with the 70S ribosome, and more particularly with target sites on the 70S ribosome. The process may begin by visual inspection of, for example a target site on a computer screen, based on the 70S ribosome coordinates, or a subset of those coordinates, as set forth in Appendix I. Selected fragments or chemical entities may then be positioned in a variety of orientations or “docked” within a target site of the 70S ribosome as defined from analysis of the crystal structure data. Docking may be accomplished using software such as Quanta (Molecular Simulations, Inc., San Diego, Calif.) and Sybyl (Tripos, Inc. St. Louis, Mo.) followed by energy minimization and molecular dynamics with standard molecular mechanics forcefields such as CHARMM (Molecular Simulations, Inc., San Diego, Calif.) and AMBER (University of California at San Francisco).
Specialized computer programs may also assist in the process of selecting fragments or chemical entities. These include but are not limited to: GRID (Goodford, P. J., “A Computational Procedure for Determining Energetically Favorable Binding Sites on Biologically Important Macromolecules,” J. Med. Chem., 28, pp. 849–857 (1985)); GRID is available from Oxford University, Oxford, UK; MCSS (Miranker, A. and M. Karplus, “Functionality Maps of Binding Sites: A Multiple Copy Simultaneous Search Method,” Proteins: Structure, Function and Genetics, 11, pp. 29–34 (1991)); MCSS is available from Molecular Simulations, Inc., San Diego, Calif.; AUTODOCK (Goodsell, D. S. and A. J. Olsen, “Automated Docking of Substrates to Proteins by Simulated Annealing,” Proteins: Structure, Function, and Genetics, 8, pp. 195–202 (1990)); AUTODOCK is available from Scripps Research Institute, La Jolla, Calif.; DOCK (Kunts, I. D., et al. “A Geometric Approach to Macromolecule-Ligand Interactions,” J. Mol. Biol., 161, pp. 269–288 (1982)); DOCK is available from University of California, San Francisco, Calif.; CERIUS II (available from Molecular Simulations, Inc., San Diego, Calif.); and Flexx (Raret, et al. J. Mol. Biol. 261, pp. 470–489 (1996)).
After selecting suitable chemical entities or fragments, they can be assembled into a single compound. Assembly may proceed by visual inspection of the relationship of the fragments to each other on a three-dimensional image of the fragments in relation to the 70S ribosome structure or portion thereof displayed on a computer screen. Visual inspection may be followed by manual model building using software such as the Quanta or Sybyl programs described above.
Software programs also may be used to aid one skilled in the art in connecting the individual chemical entities or fragments. These include, but are not limited to CAVEAT (Bartlett, P. A., et al. “CAVEAT: A Program to Facilitate the Structure-Derived Design of Biologically Active Molecules” In “Molecular Recognition in Chemical and Biological Problems,” Special Publ, Royal Chem. Soc., 78, pp. 182–196 (1989)); CAVEAT is available from the University of California, Berkeley, Calif.; 3D Database systems such as MACCS-3D (MDL Information Systems, San Leandro, Calif.); this area is reviewed in Martin, Y. C., “3D Database Searching in Drug Design,” J. Med. Chem., 35:2145–2154 (1992)); and HOOK (available from Molecular Simulations Inc., San Diego, Calif.).
As an alternative to building candidate pharmacophores or candidate compounds up from individual fragments or chemical entities, they may be designed de novo using the structure of a 70S target site, optionally, including information from co-factor(s) or known activators or inhibitor(s) that bind to the target site. De novo design may be included by programs including, but not limited to LUDI (Bohm, H. J., “The Computer Program LUDI: A New Method for the De Novo Design of Enzyme Inhibitors”, J. Comp. Aid. Molec. Design, 6, pp. 61–78 (1992)); LUDI is available from Molecular Simulations, Inc., San Diego, Calif.; LEGEND (Nishibata, Y., and Itai, A., Tetrahedron 47, p. 8985 (1991); LEGEND is available from Molecular Simulations, San Diego, Calif.; and LeapFrog (available from Tripos Associates, St. Louis, Mo.).
The functional effects of known ribosome ligands also may be altered through the use of the molecular modeling and design techniques described herein. This may be carried out by docking the structure of the known ribosome ligand on a bacterial 70S ribosome model structure and modifying the shape and charge distrubution of the ligand to optimize the binding interactions with the 70S ribosome. The modified structure may be synthesized or obtained from a library of compounds and tested for its binding affinity and/or effect on ribosome function. Of course, where the crystal structure of a complex between a 70S ribosome or ribosome subunit and a ligand is known, comparisons between said complex and the 70S ribosome structures of the present invention can be made to gain additional information about alterations in ribosome conformation that occur upon ligand binding. This information can be used in design of optimized ligands. Antibiotics that interfere with ribosome function are especially well suited for the docking, co-crystallization, and optimization applications of the present invention. A list of these types of antibiotics may be found in Spahn and Prescott, J. Mol. Med., 74: 423–439 (1996), which is incorporated by reference in its entirety for all purposes.
Additional molecular modeling techniques also may be employed in accordance with the invention. See, e.g., Cohen, N. C., et al. “Molecular Modeling Software and Methods for Medicinal Chemistry,” J. Med. Chem., 33, pp. 883–894 (1990); Hubbard, Roderick E., “Can drugs be designed?” Curr. Opin. Biotechnol. 8, pp. 696–700 (1997); and Afshar, et al. “Structure-Based and Combinatorial Search for New RNA-Binding Drugs,” Curr. Opin. Biotechnol. 10, pp. 59–63 (1999).
Following pharmacophore or candidate compound design or selection according to any of the above methods or other methods known to one skilled in the art, the efficiency with which a candidate compound falling within the pharmacophore definition binds to the 70S ribosome may be tested and optimized using computational evaluation. A candidate compound may be optimized, e.g., so that in its bound state it would preferably lack repulsive electrostatic interaction with the target site. These repulsive electrostatic interactions include repulsive charge-charge, dipole-dipole, and charge-dipole interactions. It is preferred that the sum of all electrostatic interactions between the candidate compound and the 70S ribosome when the candidate compound is bound to the 70S ribosome make a neutral or favorable contribution to the binding enthalpy.
Specific computer software is available in the art to evaluate compound deformation energy and electrostatic interactions. Examples of programs designed for such uses include, but are not limited to Gaussian 92, revision C (Frisch, M. J., Gaussian, Inc., Pittsburgh, Pa. (1992)); AMBER, version 4.0 (Kollman, P. A., University of California at San Francisco, (1994)); QUANTA/CHARMM (Molecular Simulations, Inc., San Diego, Calif. (1994)); and Insight II/Discover (Biosym Technologies Inc., San Diego, Calif. (1994)). These programs may be run, using, e.g., a Silicon Graphics workstation, Indigo, 02-R10000 or IBM RISC/6000 workstation model 550. Other hardware and software combinations may be used to carry out the above described functions, and are known to those of skill in the art.
Once a pharmacophore or candidate compound has been optimally selected or designed, as described above, substitutions may then be made in some of its atoms or side groups to improve or modify its binding properties. Generally, initial substitutions are conservative in that the replacement group will have approximately the same size, shape, hydrophobicity and charge as the original group. Components known in the art to alter conformation should be avoided in making substitutions. Substituted candidates may be analyzed for efficiency of fit to the 70S ribosome using the same methods described above.
Once a candidate compound has been identified using any of the methods described above, it can be screened for biological activity. Any one of a number of assays of ribosome function known to those of skill in the art may be used. These include, but are not limited to: inhibition of bacterial growth, inhibition of in vitro protein synthesis using messenger RNA as a template, inhibition of the elongation phase of in vitro protein synthesis using polyU as a template, inhibition of GTP hydrolysis mediated by EF-G; activation of GTP hydrolysis mediated by EF-G.
Candidate compound interaction with the 70S ribosome also can be evaluated using direct binding assays including filter binding assays, such as are known to those skilled in the art. Binding assays may be modified to evaluate candidate compounds that competitively inhibit the binding of known ribosome binding compounds such as antibiotics. These and other assays are described in International Publication WO 00/69391, the entire disclosure of which is incorporated by reference in its entirety for all purposes.
Compound Libraries for Screening
Inhibitors and/or activators identified according to the methods of the invention may be provided from libraries of compounds available from a number of sources or may be derived by combinatorial chemistry approaches known in the art. Such libraries include but are not limited to the available Chemical Director, Maybridge, and natural product collections. In one embodiment of the invention libraries of compounds with known or predicted structures may be docked to the 70S ribosome structures of the invention.
The following examples are set forth so that the invention may be understood more fully. The examples are for illustrative purposes only and are not to be construed as limiting this invention in any manner.
The three-dimensional structure of a functional complex of the 70S ribosome was determined at 5.5 Angstrom resolution using X-ray crystallography. Crystals were prepared essentially as described by Cate et al., 1999. Crystal preparation and calculation of the electron density maps and fitting of the maps proceeded as follows.
Crystals of Thermus thermophilus 70S ribosomes in a complex with a synthetic mRNA analogue and, tRNAMetf bound to the P and E sites were grown as described (Cate et al. 1999). Ribosomes were prepared from Thermus thermophilus HB8 lysate as described in Gogia, Z, Yusupov, M, et al., Mol. Biol. (USSR) 20, 519 (1986). A 36-nt phage T4 gene 32 mRNA fragment (SEQ ID NO: 50) with a modified Shine-Dalgarno sequence and two other variant mRNAs (SEQ ID NOS: 51 and 52) were chemically synthesized (Dharmagon). tRNAfMet and tRNALys were isolated from E. coli (Subriden). An anticodon stem loop (“ASL”) of tRNAPhe (19 nucleotides, ASLPhe) was synthesized by in vitro transcription with t7 polymerase. The RNAs were purified on denaturing gels, eluted, and precipitated with ethanol before use. To form a P-site ribosome complex, the shortened gene 32 mRNA and ASLPhe or tRNAfmet were incubated at 37° C. for 30 min in a solution containing 20 mM MgCl2, 100 mM KCl, and 20 mM tric HCl (pH 7.4) before ribosome crystallization (Yusupov, M. M., et al., Dokl. Akad. Nauk. (USSR) 292, 1271 (1987); Yusupova, G. Zh, and Yusupov, M. M., et al., unpublished data. All ligands were present in a 1.1- to 1.5-fold stoichiometric excess over the concentration of ribosomes to form the complexes before crystallization. Crystals of Thermus thermophilus 70S ribosome complexes were grown by the vapor diffusion method in hanging and sitting drops. Crystals grew to maximum dimensions of 0.5 mm by 0.5 mm by 0.25 mm. Heavy atom derivatives were prepared by soaking crystals in solutions containing heavy-atom compound for 1 to five days. To obtain a ribosome complex with ASL in the P site and tRNA in the A site, crystals of the P-site complex (ribosome-mRNA-ASLPhe) were soaked in a solution containing tRNALys (2 μM, Sigma) for 48 hours at room temperature. Crystals having tRNAfMet in the P site diffracted at higher resolution as compared to those having ASL in the P site. As expected, there was variability in the quality of X-ray diffraction obtained from different crystals. 5.0 Angstrom resolution diffraction data could be obtained from tRNAfMet P-site crystals using cryo-crystallographic techniques to minimize radiation damage to the crystal during data collection. The signal to noise properties of the diffraction data were optimized by moving the beam stop close to the crystal to minimize background scatter from air.
Crystals grew in space group 1422 with cell dimensions of a=b=507.2 Å and c=803.7 Å. Data were collected out to 5 Å resolution. Structure factor amplitudes were measured at the Advanced Light Source (ALS), essentially as described (Cate et al. 1999). Phasing began using molecular replacement obtained from an electron microscopy-derived model to provide phases out to 25 Angstroms. These phases were extended to 12 Angstroms using heavy metal clusters. Structure factor phases determined experimentally from a crystal containing an anticodon stem-loop tRNA analogue in the P site (“AS”) (Cate et al. 1999) were used as a starting point for structure factor phasing of diffraction data measured from crystals containing tRNAMetf in the P site. Additional MAD phasing using iridium hexamine was carried out to obtain phases for data to 7.5 Angstroms, and phase extension using solvent flipping produced the current 5.5 Angstrom electron density map. Phase extension to 5.5 Å was carried out by density modification and solvent flipping in CNS (Brunger et al. 1998). The quality of the phases was confirmed by the electron density of the bound P tRNA, which provided an internal standard of known structure (FIG. 1). Using 70S complexes crystallized with and without tRNA bound to the A site, a 7 Å Fourier difference map was obtained that provided the position of the A-site tRNA. Table II summarizes the crystallographic statistics and scaling.
| TABLE II |
| Crystallographic statistics and scaling. |
| Crystal: | ASL | P site | No mRNA | A site |
| High-resolu- | 7.5 | 5 | 6.5 | 6.5 |
| tion limit (Å) | ||||
| Rsym, | 8.9 | 9.4 | 8.9 | 7.2 |
| Mean I/σ (I) | 3.1 | 3.3 | 4.4 | 3 |
| (at 7.8 Å) | (at 5.5 Å) | (at 7.0 Å) | (at 7.0 Å) | |
| Number of | ||||
| reflections | ||||
| Unique | 124,437# | 209,044 | 95,127 | 95,671 |
| Observa- | 4.4 | 2.8 | 3.6 | 2.3 |
| tional | ||||
| redundancy | ||||
| Completeness, | 97.7 | 95.3 | 96.6 | 93.9 |
| % | ||||
| Riso†, % | 23.6 | |||
| χ2, cross- | 36.9 | |||
| crystal‡ | ||||
| Mean figure of | 0.505 | |||
| merit for | ||||
| starting phase | ||||
| set (at 7.5 | ||||
| Å)**: | ||||
| *Rsym = Σ|I − <I> | /ΣI | ||||
| †Riso = Σ|FPH − <Fp> | /Σ FPH, where FPH and FP are the structure factor amplitudes from the ASL-containing ribosome crystal and the P-site tRNA-containing ribosome crystal, respectively. | ||||
| ‡χ2, analysis, from 20 to 7.5 Å, was taken from Scalepack (Otwinoski 1993). | ||||
| **The mean figure of merit, or mean cosine of the phase error, was calculated from experimental phases measured from the ASL-containing crystal (Cate et al. 1999). | ||||
| #Data set taken from the previously reported MAD phasing experiment (Cate et al. 1999). |
At 5.5 Å, the RNA backbones can be traced with high confidence, and proteins of known structure can be fitted readily to the electron density. Three-dimensional model renderings were generated using RIBBONS (M. Carson, Methods Enzymol. 277B, 493–505 (1997)), electron density maps with RIBBONS and with O (Jones, T. A., Zou, J. Y., et al., ACTA Crystallogr. A 47, 110 (1991)), and secondary structure diagrams with XRNA. Although final interpretation of the electron density maps was greatly facilitated by the availability of the high-resolution subunit structures (Ban et al. 2000; Schluenzen et al. 2000; Wimberly et al. 2000), the quality of our maps was sufficient to allow a reasonable initial fit of the 16S rRNA chain (overall rmsd=5.7 Å) guided by biochemical and phylogenetic constraints but independent of any high-resolution structural information.
The 3 Angstrom structure of the 30S ribosomal subunit was docked onto the 70S 5.5 Angstrom resolution map we generated according to the following methods. The phosphate positions known from our 5.5 Angstrom resolution structure were used to align the phosphates of the 16S rRNA contained within the 30S structure determined by Wimberly et al. (2000), using an initial fit by eye which subsequently was refined using an ordinary least squares fitting algorithm. Such docking and fitting can be carried out, e.g., using MIDAS (University of California, San Francisco department of Biochemistry and Molecular Biophysics) running on an SGI O2 or Octane type machine.
Refinement of the docking was carried out by using the 30S structure as a rigid body to obtain the initial alignment. This was followed by successive iterations of breaking down the 30S structure into successively smaller components, eventually using each phosphate in the 16S rRNA as a pseudoatom to obtain the most precise fit between the high resolution structure of the 30S subunit and our 5.5 Angstrom 70S structure.
The Wimberly 30 S structure coordinates were obtained from the PDB (PDB ids 1FJF and 1FJG; MMDB ids 14321 and 14322). Because this 30S structure was determined from T. thermophilus, initial fits for the high resolution 30S structure to our 5.5 Angstrom were qualitatively good. After, fitting the backbone of 16S rRNA in our electron density map, high resolution structures of 30S subunits appeared (Wimberly et al. 2000; Schluenzen et al. 2000). Our model agreed more closely (overall r.m.s.d.=6.9 Å) with the structure of Wimberly et al. than with that of Schluenzen et al.
Small subunit proteins were docked initially as rigid bodies using the coordinates for the individual proteins from the T. thermophilus 30S subunit structure (Wimberly et al. 2000). Structures for most of the T. thermophilus large subunit proteins are not known; therefore, the structures of proteins from the most closely related organisms were modeled, after deleting any extra residues.
Availability of the Haloarcula marismortui 50S subunit structure (containing 23S and 5S rRNAs) (Ban et al. 2000) facilitated fitting the 50S subunit portion of our electron density in regions that are conserved between the bacterial and archaeal structures; initial rigid-body docking of large fragments of the archaeal structure was followed by detailed fitting of smaller fragments and individual phosphates to our map. Representative structures used for docking include PDB id 1FFZ; MMDB id 14060 (with puromycin), PDB id 1FG0; MMDB id 14061 (with 13 bp minihelix puromycin compound, and PDB id 1FFK; MMDB id 14164 (50S alone).
Additional refinements between the high resolution 50S subunit structure and the 50S portion of our 70S model structure, carried out according to the same methods described below, were required because there are conformational differences between the 50S subunit when crystallized without the 30S subunit, but also because of phylogenetic differences between the structures of the 23S rRNAs from Haloarcula marismortui and Thermus thermophilus. Conserved regions of primary and secondary structure were generally observed to fit well as between the 50S and 70S structures. In regions of obvious differences, especially those arising in phylogenetically diverse regions of the two structures, the Haloarcula structure was modeled onto the 70S T. thermophilus structure. Regions of phylogenetic differences among different ribosome structures are well known and are collected, e.g., at the website maintained by the lab of Robin Gutell, located at RNA.icmb.utexas.edu.
Several regions in the 50S structure determined by Ban et al. (2000) were sufficiently disordered as to not be visible, yet could be visualized in the 70S 5.5 Angstrom map. Known secondary structure aspects of the rRNAs contained within the 50S subunit were easily fit into the 5.5 Angstrom electron density map. The 5S primary structure is 60% conserved between Haloarcula and T. thermophilus, and so this region was easily fit. The remaining 40% of the 5S structure was modeled on a fragment of 5S solved from E. coli (PDB id 354D; MMDB id 6741), and this was used to model the Loop E region, containing the most significant differences between Haloarcula and T. thermophilus.
Atomic coordinates for the 70S ribosome 5.5 Angstrom model are contained in the PDB files attached to this specification as Appendix I. The components are identified as follows: File A includes coordinates for the 30S ribosome subunit and associated tRNA and mRNA molecules; File B includes coordinates for the 50S ribosome subunit; File C includes coordinates for the IF3 C-terminal domain docked to the 70S subunit; File D includes coordinates for the IF3 N-terminal domain docked to the 70S subunit; File E includes coordinates for Mk27, a 27 nucleotide synthetic mRNA modeled in the 30S subunit; File F includes coordinates for Mv36, a 36 nucleotide synthetic mRNA in the 30S subunit; and File G includes coordinates for Mf36, a 36 nucleotide synthetic mRNA in the 30S subunit. Where the coordinates have been deposited with the RCSB, a database ID for the file is indicated in Table VI (see Appendix I). Deposited coordinates may be accessed at, e.g., ncbi.nlm.nih.gov.
Overall Structure of the 70s Ribosome
FIG. 2A shows the structure of the 70S ribosome in the “standard view” from the solvent face of the 30S subunit, showing its head (H), body (B), platform (P) and neck (N) features and their corresponding 16S rRNA (cyan) and protein (blue) components. Jutting out at the lower right is the “spur” of the 30S subunit, formed by helix 6 of 16S rRNA, which makes a crystal contact with the P site of another subunit in the recently reported 30S subunit structure (Carter et al. 2000). In this view, the positions of proteins S2, S3, S9, S10 and S14 in the head; S6, S11 and S18 in the platform; and S4, S5, S8 and S16 in the body can be seen. In the background, parts of the 50S subunit are visible in the “crown” view, with its 23S rRNA (gray), 5S rRNA (top; blue) and 50S subunit proteins (magenta). Protein L9 can be seen at the left, extending more than 50 Å beyond the surface of the 50S subunit proper. On the upper left, L1 and its 23S rRNA binding site protrude outside the profile of the 30S subunit, and protein L11 and its RNA and one of the L7 dimers make up the stalk at the upper right.
From the right-hand side (FIG. 2B), the anticodon end of the A-site tRNA (gold) is visible in the near end of the subunit interface cavity, viewed through the large funnel-shaped opening where elongation factors EF-Tu and EF-G interact with the ribosome. One of the ribosomal structures that interacts with the G domains of the elongation factors is the sarcin-ricin loop (SRL) of 23S rRNA, which is visible between the A-tRNA and protein L14. Also evident in the right-hand view are proteins S9, S12, S13, S19, S20, L3, L5, L6, L7, L11, L13, L14, L19, L22, L25 and L30, as well as the positions of proteins L21 and L32 (whose structures are not known), and the positions of electron density labeled LU, LV, and LX that we ascribe to as yet unidentified large subunit ribosomal proteins (which may include the three unassigned known proteins L31, L35 and L36). 5S rRNA (5S) is visible at the top of the 50S subunit, along with two of its binding proteins, L5 and L25.
The view from the back of the 50S subunit (FIG. 2C) reveals the locations of additional 50S subunit proteins L4, L15, L16, L21, L24, L27, L28, L29, L32, L33, L34, the third 5S rRNA-binding protein L18, and unidentified proteins LW and LY. The opening of the polypeptide exit channel (EC) is at the bottom of the back side of the 50S subunit, surrounded by proteins L22, L24 and L29 in addition to elements of domains I and III of 23S rRNA.
In the left-hand view (FIG. 2D), close approach of the two subunits at the interface is much more evident. The platform of the 305 subunit, around proteins S11, S6 and S15, contacts the 50S subunit near protein L2, mainly through RNA—RNA interactions and RNA-protein interactions involving proteins S 15 and L2. The E-site tRNA (red) can be seen at the near side of the interface cavity, partly shielded from view by L1 and its RNA binding site, which appear to block the path for its exit from the ribosome. In the top view (FIG. 2E), the orientations of all three tRNAs (A, gold; P, orange; E, red) in the interface cavity can be seen more clearly. Contact between the A-site finger (ASF) in 23S rRNA and S 13 in the head of the 30S subunit (bridge B1a) is evident, as is the close approach between proteins L5 and S13 (bridge B1b), whose electron densities merge to form the single protein-protein intersubunit bridge (see below).
Viewed from the interface (FIGS. 2F, G), fewer proteins are visible on the 30S and 50S subunits, and they are located mainly around the periphery, leaving large exposed surfaces of ribosomal RNA. The three tRNAs are aligned on the 30S subunit with their anticodon ends bound in the RNA-rich groove between the head, body and platform (FIG. 2F). The rest of all three tRNAs, including their D stems, elbows and acceptor arms, interact with the 50S subunit. The acceptor arms of the A and P tRNAs point downward into the peptidyl transferase cavity, while the E-tRNA acceptor arm is directed into a separate cleft next to the L1 ridge. The tRNA binding site neighborhoods are dominated by rRNA, as are the interface contact surfaces.
Secondary and Tertiary Structural Domains of the rRNAs
The structures of the ribosomal RNAs have been the subjects of intensive investigation for more than twenty years. Their secondary structures (FIGS. 3A, B) were first established by comparative sequence analysis (Woese et al. 1980; Noller et al. 1981a), in which intramolecular base pairing was demonstrated by the existence of phylogenetic covariation of the paired bases, presently supported by 16S-like rRNA sequences from over 8000 different organisms and organelles, and over 1000 different 23 S-like rRNA sequences (http://www.ma.icmb.utexas.edu/). All of the more than 60 phylogenetically predicted helical elements of 16S rRNA are found in the structure. Most of the individual helical elements of 16S rRNA stack coaxially with adjacent helices, as first observed in the structure of tRNA, forming a total of twenty longer, quasi-continuous helical arms.
The secondary structure of 16S rRNA falls into four recognizable domains, called the 5′, central, 3′-major and 3′-minor domains (FIG. 3A; Woese et al. 1980; Gutell 1994). A general sense of the three-dimensional fold of 16S rRNA emerged from early modeling studies (Stem 1988a; Brimacombe et al. 1988) based on chemical footprinting (Noller et al. 1990) and crosslinking (Mueller et al. 1995) experiments, as well as biophysical approaches such as immuno-electron microscopy (Stöffler-Meilecke et al.) and neutron scattering (Capel et al. 1987). Although there were differences in detail between the models deduced by different laboratories, there was general agreement that the 5′ domain is located in the body of the 30S subunit, the central domain in the platform and the 3′ major domain in the head of the particle (Noller et al. 1981a). As observed in the structures of the isolated ribosomal subunits (Wimberly et al. 2000; Schluenzen et al. 2000), the secondary structure domains of 16S rRNA (FIG. 3A) do indeed correspond to three-dimensional domains that are nearly structurally autonomous (FIG. 3C). The 5′ domain makes up the body, the central domain of the platform (anchored to the solvent face of the body by the long, coaxial 620 stem), the 3′-major domain the head and neck of the subunit, and the 3′-minor domain the penultimate stem and adjacent 3′-terminal helix. This organization immediately suggests that the domains are designed to move relative to one another during protein synthesis. In particular, the very minimal interaction between the head and the rest of the subunit is consistent with the proposed movement of the head during translocation (Serdyuk et al. 1992; Frank et al. 2000). The four domains converge near the geometric center of the subunit, next to the sites of its functional interactions with mRNA and tRNA, further suggesting coupling of inter-domain movement with biological function.
More than 130 individual helices predicted from comparative sequence analysis of 23S rRNA (Noller et al. 1981b; Gutell et al. 1993) are found in its X-ray crystal structure, forming forty coaxial arms. No electron density was found for a predicted Thermus-specific helix inserted around position 650 of 23S rRNA, relative to the E. coli secondary structure (http://www.ma.icmb.utexas.edu/). The 23S rRNA and 5S rRNA together form seven secondary structural domains (FIG. 3B). In contrast to the design of the 30S subunit, the domains of 23S rRNA are extensively intertwined with each other, creating the single large, hemispherical domain that forms the body of the 50S subunit (FIG. 3D), as first noted for the H. marismortui 50S subunit (Ban et al. 2000). From the body project a number of molecular stalks, made up of RNA elements from domains II, IV, V and VI, some of which are extended coaxial helical arms and others of which are mushroom-like globular RNA domains tethered to the body of the subunit by helical stems. Some of the stalks form bridges with the 30S subunit, while others interact with the tRNAs and elongation factors; the stalks are likely to be dynamic elements of the 50S subunit, undergoing movement in connection with their various functional interactions, as discussed below.
Differences Between the Conformations of 70S Ribosomes and Isolated Subunits
Comparison of the conformation of 16S rRNA in 70S ribosomes with that of the 30S subunit structure reported by Wimberly et al. (Wimberly et al. 2000) shows a non-uniform distribution of rmsd differences (FIGS. 4A, B). Root-mean-square deviations of the positions of phosphorus atoms were calculated after carrying out least-squares superimpositions of the respective 16S and 23S rRNAs as follows. First, a distance matrix was calculated independently for each RNA coordinate set. Then a set of the 214 atoms whose intramolecular distance values varied the least between the two comparison molecules were used to superimpose the entire molecules by a least-squares fit, using the program MIDAS [T. E. Ferrin, C. C. Huang, L. E. Jarvis, R. Langridge, J. Mol. Graphics 6,13–27 (1988)]. The highest rmsd values (>10 Å) are observed for the spur region (SP) in the lower left of the body; this difference can be explained by a crystal contact in which the spur helix binds to the P site of a symmetry-related subunit in the Wimberly et al. structure. The other major conformational differences (rmsds between 3.5 and 10 Å) are localized to a few regions, including the penultimate stem (PS), the top of the platform and the head of the subunit. All of these features interact with the 50S subunit, as described below, suggesting that the observed differences may include conformational changes that occur upon subunit association.
Differences between the conformations of 23S rRNA in T. thermophilus 70S ribosomes and H. marismortui 50S subunits (Ban et al. 2000) are summarized in FIGS. 4C and 4D. Features of 23S rRNA that were disordered in the 50S structure (yellow) include several of the protruding stalk elements, including the L1 RNA and L11 RNAs, the A-site finger and the 1915 stem-loop. These elements are probably stabilized by interactions with the 30S subunit and with the tRNAs in the 70S ribosome complex. It is also possible that the inherent thermal stability of the Thermus ribosome contributes to the lower degree of disorder.
Many additional conformational differences with the Haloarcula 50S subunit are found (FIGS. 4C, D). Some differences are explained by expected phylogenetic structural variation between corresponding regions of the bacterial and archaeal RNAs. There are examples of RNA helices and other features that are unique to the bacterial structure (FIGS. 4C, D; cyan) and conversely, ones that are uniquely present in the archaeal structure (white). These phylogenetically variable features are located at the bottom and back surfaces of the subunit, remote from the subunit interface and functional sites.
Protein L9 and the Apical Stem of Domain III
A major conformational difference is found in the apical stem region of domain III of 23S rRNA, centered at position 1495 in the bacterial RNA (FIG. 4C) and at 1597 in the archaeal numbering. In the Thermus ribosome, this helix (helix 58) folds back along the lower edge of the subunit, pointing to the left, where it interacts with protein L2; in the Haloarcula 50S structure, it takes a completely different path (FIG. 4E), diverging sharply around position 1478 (Haloarcula marismortui nucleotide 1581) to fold in the opposite direction, up and to the right, on the interface side of the subunit, placing the apical loop next to helix 34 of 23S rRNA, more than 50 Å away from the position of the corresponding loop in the Thermus 70S ribosome.
There is reason to believe that this conformational difference may not be due to phylogenetic variation. First, the bases in the 1495 loop and the amino acids in L2 with which they interact in the Thermus structure are conserved, and identical in Haloarcula, inconsistent with the idea that the 1495 loop makes completely different interactions in the bacterial and archaeal ribosomes. This suggests that helix 58 is rearranged in one of the two structures. Another possibility, that the helix has different conformations in 50S subunits and 70S ribosomes, seems to be ruled out by the results of directed hydroxyl radical probing from protein L9 in E. coli 50S subunits (Lieberman et al. 2000). These results place the loop of helix 58 near helices 10 and 79, and near the internal loop at position 1580 of helix 54, all of which are close neighbors of helix 58 in the Thermus 70S structure, but remote from the position of helix 58 in the Haloarcula 50S structure. A likely explanation is that helix 58 is rearranged in the archaeal 50S subunit crystal structure.
These same probing experiments further suggest that protein L9, whose linker helix and C-terminal domain protrude far into the solvent from the left-hand side of the 50S subunit, is itself rearranged in the Thermus structure. According to calibration studies (Joseph et al. 2000), the strong hydroxyl radical cleavage from position 101 of L9 at nucleotides 165, 1495, 1580, and 2220 of 23 S rRNA place it within 25 Å of these targets; instead, these nucleotides, which are clustered together on the left-hand side of the subunit, are between 70 and 80 Å away from position 101 of L9, a distance at which hydroxyl radical cleavage is virtually undetectable. We infer that the C-terminal domain of L9 must normally be located in the vicinity of the pocket formed between helices 10, 54 and 79 on the left-hand side of the 50S subunit, and that, under our crystallization conditions, it rearranges to form a crystal contact with the 16S rRNA of a neighboring ribosome (FIG. 4F).
Structures of the Intersubunit Bridges
Intersubunit contacts were first visualized as discrete bridges in cryo-EM studies by Frank and co-workers (Frank et al. 1995a). At 5.5 A, all of the molecular components involved in the intersubunit contacts can be identified, including two additional protein-containing bridges. As inferred from earlier chemical probing (Merryman et al. 1999a; Merryman et al. 1999b) and modification-interference (Herr et al. 1979) studies, most of the bridge contacts involve rRNA, as summarized in FIG. 5A. FIG. 5B shows the 30S bridge contacts, viewed from the interface, with the anticodon stem-loops of the A-, P- and E-tRNAs in their respective 30S subunit binding sites. The distribution of RNA—RNA vs. RNA-protein or protein-protein contacts is striking; the RNA—RNA contacts (red) are centrally located on the platform and penultimate stem, directly abutting the tRNA binding sites. In contrast, contacts involving proteins (yellow) are peripherally located, more distal from the functional sites. On the 50S subunit side (FIG. 5C), the RNA—RNA contacts are again central, forming a triangular patch across the front surface of the interface wall that separates the peptidyl transferase and E sites from the interface cavity. Interestingly, the RNA—RNA interactions exclusively involve RNA elements from domain IV of 23S rRNA, except for a small RNA—RNA contact from helix 34 of domain II that makes up most of bridge B4 (Culver et al. 1999). The only other part of 23S rRNA involved in a bridge contact is the tip of helix 38 (the A-site finger), which forms the RNA-protein bridge B 1a. The rest of the bridge interactions from the 50S subunit are made by proteins L2, L5, L14 and L19.
The molecular contacts forming the twelve intersubunit bridges (FIG. 5B, C) are summarized in Table III. Multiple contacts can be seen in the electron density map for many of the bridges, giving a total of more than 30 individual interactions. RNA—RNA contacts are dominated by minor groove-minor groove interactions, although major groove, loop and backbone contacts are also found. The bridge proteins make use of virtually all types of RNA features for recognition, including major groove, minor groove, backbone and loop elements.
Bridges B1a and B1b connect the head of the 30S subunit to the top of 50S subunit, crossing the interface directly above, and parallel to the A- and P-tRNAs (FIG. 2E). B1a, which has been called the ‘A-site finger’ (Frank et al. 1995a) is mostly disordered in the Haloarcula 50S subunit structure (Ban et al. 2000). It consists of a long helical RNA arm (helix 38 of 23S rRNA) reaching from the right side of the central protuberance of the 50S subunit to the middle of the head of the 30S subunit, where its apical 890 loop contacts the conserved basic sequence around position 92 of protein S 13. Bridge B1b is the sole protein-protein contact between the subunits. Helix 84 of 23S rRNA reaches part-way toward the head of the 30S subunit above the P-tRNA; the remaining distance is bridged by protein LS, which contacts the N-terminal tail of S13 from a 20-amino acid loop formed by residues 134–153 of LS (Haloarcula marismortui positions 109–127), which are also disordered in the H. marismortui 50S structure.
Bridges B2a, B3, B5 and B6 (FIG. 5B, C) all involve interactions between the 50S subunit and the penultimate stem (helix 44) of 16S rRNA, the dominant structural component of the 30S subunit interface. FIG. 5D shows the arrangement of the RNA elements forming these four bridges. At the top, bridge B2a is made by the 1914 loop of helix 69 of 23S rRNA, another feature that is disordered in the Haloarcula 50S subunit structure. It contacts the decoding site of 16S rRNA around position 1408, as predicted from cross-linking experiments (Mitchell et al. 1992) in the first of a series of three consecutive minor groove-minor groove interactions. In the next one (B3), helix 71 of 23S rRNA contacts the penultimate stem at its two consecutive non-canonical A–G pairs around position 1418. Just below B3, a major groove contact is made by the minor groove of helix 64 of 23S rRNA, followed by the third minor-minor interaction (B6) formed by contact with helix 62. A further contact with the penultimate stem at bridge B6 is made by protein L19 (FIG. 5E). L14, which interacts with L19 by forming an intermolecular β-sheet, contacts the major groove side of the 345 loop of helix 14 of 16S rRNA to form bridge B8 (FIG. 5E).
Helices 68 and 71 of 23S rRNA form a long, largely non-canonical coaxial arm that lies horizontally along the top of the interface wall of the 50S subunit, containing the 50S components of bridges B2b and B7a, in addition to the aforementioned B3 (FIG. 5C). FIG. 5F shows the complex set of interactions that form B2b and B7a, viewed from the top of the platform. The electron density for bridge B7a suggests that A702, which is strongly protected from diethyl pyrocarbonate modification in 70S ribosomes (Merryman et al. 1999b), makes an ‘A-minor’ contact (Ban et al. 2000) with the minor groove of helix 68 of 23S rRNA. The two remaining protein-RNA bridges are shown in FIG. 5G. Protein L2 makes two distinct contacts with 16S rRNA (B7b), at helices 23 and 24; L2 is also very close to protein S6 (not shown), and may make transient contacts with it during translation. Bridge B4 is primarily an interaction between protein S15 and the 715 loop of helix 34 of 23S rRNA, as shown previously (Culver et al. 1999); the 715 loop also makes a modest RNA—RNA contact with helix 20 of 16S rRNA (FIG. 5G).
| TABLE III |
| Intersubunit Bridges. |
| Bridge | Type | 30S Subunit | 50S Subunit | ||
| B1a | Prot-RNA | S13 | 92–94 | H38-(L) | 886–888 |
| B1b | Prot-Prot | S13 | N-term | L5 | 134–153 |
| B2a | RNA-RNA | H44(m) | 1408–10, 1494–5 | H69(Lm) | 1913–4, 1918 |
| B2b | RNA-RNA | H24(m, LM) | 784–5, 794 | H67(m), H69(M) | 1836–7, 1922 |
| RNA-RNA | H45(LM, Lm) | 1516–9 | H71(M), H69(B) | 1919–20, 1932 | |
| B2c | RNA-RNA | H24(Bm) | 770–1 | H67(B) | 1832–3 |
| RNA-RNA | H27(Bm) | 900–1 | ″ | ″ | |
| B3 | RNA-RNA | H44(m) | 1484–6 | H71(m) | 1947–8, 1960–1 |
| B4 | RNA-RNA | H20(m) | 763–4 | H34(Lm) | 717–8 |
| Prot-RNA | S15 | 40–4, C-term | H34(LB, LM) | 713, 717 | |
| B5 | RNA-RNA | H44(m) | 1418–9 | H64(m) | 1768–9 |
| RNA-Prot | H44(B) | 1420–2 | L14 | 44–9 | |
| RNA-RNA | H44(B) | 1474–6 | H62(Bm) | 1689–90 | |
| RNA-RNA | ″ | ″ | H64(m) | 1989 | |
| B6 | RNA-RNA | H44(m) | 1429–30, 1474–6 | H62(m) | 1689, 90, 1702–5 |
| RNA-prot | H44(B) | 1431 | L19 | (Hm24e:R44) | |
| B7a | RNA-RNA | H23(L, m) | 698, 702 | H68(m) | 1848–9, 1896 |
| B7b | RNA-Prot | H23(M, m) | 712–3 | L2 | 162–4, 172–4, 177–8 |
| RNA-Prot | H24(M, m) | 773–6 | ″ | 177–8, 198–202 | |
| B8 | RNA-Prot | H14(LM) | 345–7 | L14 | 116–9 |
| Bridges are numbered B1a, B1b, etc. as shown in FIGS. 5B and 5C. rRNA contacts are to 16S rRNA for the 30S subunit and to 23S rRNA for the 50S subunit, listed by the number of the proximal helix (H44, etc.), numbered as shown in FIGS. 3A and 3B. rRNA nucleotide numbers are according to E. coli numbering. Molecular contacts are scored in parentheses as: M, major groove; m, minor groove; L, loop; B, backbone; Lm refers to the minor groove side of the loop, LB to the loop backbone, etc. |
Most important for understanding the translational mechanism is how the ribosome interacts with its substrates, the tRNAs. In addition to their well-known interactions with mRNA, via base pairing between the codons and anticodons, tRNAs also interact with the ribosome itself. These interactions not only help to stabilize the binding of tRNA to the ribosome, but are involved directly in functional processes such as discrimination mechanisms that increase the accuracy of aminoacyl-tRNA selection, maintaining the correct translational reading frame, translocational movement of tRNAs within the ribosome, and catalysis of peptide bond formation. Knowledge of the molecular contacts between tRNA and the ribosome thus provides a structural framework for elucidation of mechanisms for these processes. As predicted by many earlier studies (reviewed in Green et al., 1997), the tRNAs are mainly surrounded by elements of rRNA in the ribosome, most of which were identified in footprinting, cross-linking and directed hydroxyl radical probing, studies (Moazed et al. 1986b; Döring et al. 1994; Moazed et al. 1989a). Not surprisingly, we find that the ribosome contacts all three tRNAs at universally conserved parts of their structures, so that all tRNAs can be bound in the precisely same way.
FIG. 6A shows the electron density of the A- and P-tRNAs bound to their respective codons, and FIG. 6B shows the overall relative geometry of the A- P- and E-tRNAs and the mRNA as they are positioned in the 70S ribosome crystals. Their specific contacts with the ribosome indicate that they are in their “classical” (A/A, P/P and E/E), rather than hybrid binding states (Moazed et al. 1989b). All three tRNAs are shared between the two ribosomal subunits in a similar way; their anticodon stem-loops are bound by the 30S subunit, and contacts with the rest of the tRNA—D stem, elbow and acceptor arm—are made by the 50S subunit. The planes of the A- and P-tRNAs form an included angle of 260, and the P- and E-tRNAs an angle of 46°. The closest approach between the backbones of the anticodon stem-loops of the A- and P-tRNAs is about 10 Å, a surprisingly large distance, in view of the fact that these two tRNAs read adjacent codons on the mRNA.
The simultaneous reading of the two codons is accommodated by a kink in the mRNA backbone of about 45° between the A and P codons (FIG. 6B). The A- and P-tRNA backbones are closest at the acceptor stems, which approach within 5 Å of each other. At the elbow, the bases D16 of A-tRNA and U47 of P-tRNA are actually within H-bonding distance of each other, although we are not aware of prior evidence that such an interaction takes place. The CCA tails of the A- and P-tRNAs converge, as expected, at their 3′ ends in the peptidyl transferase site of the 50S subunit. The closest approach of the anticodon stem backbones of the P- and E-tRNAs is about 6 Å, significantly closer than found for the A- and P-tRNAs. However, the elbow and acceptor arm of the E-tRNA are rotated significantly away from the P-tRNA, so that their respective 3′ ends are nearly 50 Å apart. The distances between corresponding positions of the three tRNAs is a measure of the magnitude of the movement of tRNA during translocation. Thus, the anticodon end of tRNA moves about 28 Å between the 30S A and P sites, and 20 Å between the P and E sites. Because of the rotation of the plane of the tRNA, the elbow moves through much larger distances of 40 and 55 Å, as it transits from A to P to E.
As observed previously, the anticodon stem-loop (ASL) and P codon of P-tRNA are positioned by six sets of interactions (a–f) with the 30S subunit (Cate et al. 1999). The structural features involved in these interactions are shown in FIGS. 6C and 6D, and summarized in Table IV. At the present resolution, actual atomic interactions are not resolved. However, known RNA stereochemistry, combined with the docked high-resolution structures, strongly constrains, for example, whether interactions with RNA involve the sugar-phosphate backbone or the bases, and in many instances, allows prediction of the chemical groups most likely involved.
| TABLE IV |
| tRNA - Ribosome Contacts1 |
| tRNA | |||
| interaction | positions | ribosome positions | |
| P-tRNA | |||
| a | a.c. stem-16S (H30) | 28–30 bk | 16S (1229) bk |
| a.c. stem-S13 | — | S13 (116–120) | |
| b | a.c. stem-16S (L29-42) | 40 bk | 16S (1339) bk |
| 40 bs | 16S (1339) bs | ||
| 41 bs | 16S (1338) bs | ||
| c | a.c. loop-16S (790 loop) | 38 bk | 16S (790) bk |
| d | a.c. loop-16S (965 loop) | 34 bk | 16S (m2G966) bs |
| a.c. loop-S9 | 35 bk | 59 (R128) | |
| e | P codon-16S (decoding site) | P codon | 16S (926) bs |
| 1 bk | 16S (1498) bk | ||
| f | a.c. loop-16S (decoding site) | 34 bs | 16S (1400) bs |
| g | D stem-23S (H69) | 12, 13 bk | 23S (1908–9) bk |
| 25, 26 bk | 23S (1922–3) bk | ||
| h | T loop-L5 | 56–7 | L5 (55–66) |
| i | acc. stem-23S (P stem/H80) | 3 bk | 23S (2255–6) bk |
| j | acc. tail-23S (P loop) | 74 bs | 235 (2252) bs |
| k | acc. tail-23S (H93) | 75 | 23S (2602) |
| l | acc. tail-23S (L90-93) | 76 | 23S (2585) |
| A-Trna | |||
| a | codon-anticodon helix - | 34–35 bs | 16S (530) bs |
| 16S (530 loop) | 36 bk | 165 (530) bk | |
| b | ac.-16S (H34) | 34 bk | 16S (1054) bs |
| c | a.c. stem-16S (965 loop) | 40 bk | 16S (955) bk |
| a.c. stem-S13 | 40–41 bk | S13(120–2) | |
| d | a.c. loop-16S (decoding site) | 38 bk | 16S (1493) bk |
| A codon-16S (dec. site) | A codon | 16S (1493) bk | |
| 1 bk | |||
| e | A codon-S 12 | A codon | S12 (46–48) |
| 2, 3 | |||
| f | D stem-238 (1169) | 11, 12 | 23S (1914–5) |
| D stem junction-23S (H69) | 25, 26 | 23S (1913–4) | |
| g | D loop-235 (A finger/H38) | D17 bs | 23S (881–2) bk |
| G19 bs | 23S (882–3) bk | ||
| T loop-238 (A finger/H38) | 56 bk | 23S (898–9) bk | |
| h | T stem-23S (H89) | 50–3 bk | 23S (2470–2) bk |
| 64–5 bk | 23S (2482–4) bk | ||
| i | acc. stem-23S (H71) | 72–3 | 23S (1942–3) |
| j | acc. tail-23S (H89) | 74–6 bk | 23S (2452, 2494) bk |
| k | acc. tail-23S (A loop) I | 75 bs | 23S (2553) bs |
| l | T stem-loop-L16 | 55, 62 | L16 (27, 30) |
| E-tRNA | |||
| a | a.c. loop-16S(H29) | 35, 36 bk | 16S (1339, 1340) bk |
| a.c. stem-16S (L29–42) | 30 bk | bk | |
| b | a.c. loop-16S (H28) | 34 bk | 16S (1382) bk |
| c | ac. loop-16S (L28–29) | 33 bk | 16S (937) bk |
| d | a.c. loop-16S (790 loop) | 37–38 bk | 16S (788–9) bk |
| e | ac. loop-16S (690 loop) | 37 bs | 16 (693) bs |
| 38–39 bk | 16S (694–5) bk | ||
| f | a.c. loop-S7 | 37 | S7 (β-hairpin) |
| 42 | S7 (α-6) | ||
| g | D loop-23S (L76–77) | 19 | 23S (2112–3) |
| h | T loop-23S (L76–77) | 56 | 23S (2116–7) |
| T loop-LI | 56–7 | L1 (124–8) | |
| I | T stem-LI | G53-C61 | L1 (52–4) |
| bp | |||
| T loop-LI | 55 bk | L1 (165–9) | |
| j | acc. Stem-23S (H68) | 2–71 bp | 23S (1852–3) bs |
| 71 bk | 23S (1892) bk | ||
| 3–5 bk | 23S (1850–3) bk | ||
| k | acc. Tail-23S (H75) | 73 bk | 23S (2235) bk |
| l | acc. Tail-23S (H74) | 76 bk | 23S (2433–4) |
| m | acc. Tail-23S (H11) | 76 bs | 23S (199) bs |
| n | acc. Tail-L33 | 73–74 | L33 |
| 1a.c., anticodon; acc., acceptor; D, dihydrouracil; T, thymidine; RNA contacts are indicated as bk, backbone; bs, base; bp, base pair. Where results are inconclusive, the designation is omitted. tRNA positions are numbered according to yeast tRNAPhe, rRNA positions according to E. coil. |
The modes of binding of the anticodon stem-loop and its contacts are very similar to those previously observed for binding of helix 6 to the 30S P site (Carter et al. 2000). All six of the 30S P-site interactions involve direct contacts with 16S rRNA, two of which (a and d) are bolstered by interactions with the extended C-terminal tails of proteins S 13 and S9, respectively. The somewhat phylogenetically variable lysine-rich tail of S 13 interacts with phosphate 36 of the P-tRNA. In contrast, the tail of S9 is precisely conserved, and its C-terminal arginine, which appears to interact with phosphate 35 in the anticodon of P-tRNA, is universally conserved. These same phosphates were identified in phosphorothioate-interference experiments to be important for binding to the 30S P site (Schnitzer et al. 1997). One of the earliest experiments implicating rRNA in ribosome function was the demonstration that kethoxal modification of a limited number of guanines in 16S rRNA caused loss of P-tRNA binding to the 30S subunit, (Noller et al. 1972). Of the five 16S rRNA bases that interact with the P-site mRNA-tRNA complex, G926, 2mG966, G1338, G1339 and C1400, no less than four are guanines, explaining the early findings. Moreover, all five bases were identified as P-site interactions based on chemical footprinting and modification-interference experiments (Moazed et al. 1986b; Ahsen et al. 1995; Moazed et al. 1990).
In addition, a set of interactions appears to stabilize P-site codon-anticodon pairing: the base G966, interacting with the anticodon backbone at position 34 of the tRNA, and the backbone of nucleotide U1498, interacting with the backbone of position 1 of the P codon, appear to clamp the codon and anticodon together. C 1400 appears to stabilize the wobble base pair by stacking on base 34 of tRNA, an arrangement that was predicted by Ofengand and co-workers nearly twenty years ago, from photochemical crosslinking studies (Prince et al. 1982). Again, many of the bases identified by tRNA footprinting experiments (Moazed et al. 1986b; Moazed et al. 1990) are found to make interactions with the tRNA; some, however, including the “class III” bases (Moazed et al. 1987) are protected indirectly, presumably by tRNA-induced conformational changes. Two proteins, S9 and S13, interact with the P-tRNA, both via their extended, basic C-terminal tails, which interact with the anticodon stem-loop in a way that suggests that they function as sophisticated polyamines, bolstering the RNA—RNA interactions.
The minor groove of helix 69 of 23S rRNA, which forms bridge B2a, interacts with the minor groove of the D stem of P-tRNA (FIG. 6E; interaction g), extending into the A site where its conserved loop interacts with almost the same features of the D stem of A-tRNA (FIG. 6K; interaction f), as well as forming the B2a bridge contact with the top of the penultimate stem (FIG. 5D). This complex set of interactions explains chemical footprinting results that showed partial protection of bases in the 1915 loop of helix 69 by the 30S subunit, which became complete upon binding of tRNA (Moazed et al. 1989a). At its elbow, a beta-hairpin loop of protein L5 (positions 54–66) interacts with the T loop of P-tRNA at the minor groove face of C56 (FIG. 6E; h). The CCA tail of the P-tRNA is positioned to allow the predicted C74-G2252 base pair with the 23S rRNA P loop (Samaha et al. 1995), observed in the recent high-resolution structure of the archaeal 50S subunit complexed with substrate analogues (Nissen et al. 2000). In addition, the acceptor end is positioned by a backbone-backbone contact between the acceptor stem and the stem of the 23S rRNA P loop (FIG. 6E; i), and interactions between the CCA tail and nucleotides A2602 and U2585, both of which have been implicated in the peptidyl transferase function of the large subunit (Moazed et al. 1989a; Barta 1984).
Recently, the atomic resolution structure of the Haloarcula 50S subunit has been solved in complex with the compound CCdAp-Puromycin (Nissen et al. 2000), which is believed to be a transition-state analog of the peptidyl transferase reaction (Welch 1995). This structure has led to a proposal for a mechanism for catalysis of peptide bond formation by the ribosome (Nissen et al. 2000). We have docked the peptidyl transferase region of the 50S subunit structure containing CCdAp-Puromycin, on the 70S ribosome structure, guided by superposition of surrounding elements of 23S rRNA. An electron density map, truncated at 5.5 Å resolution, was calculated for the Haloarcula 50S subunit complex, after removing the puromycin moiety, to allow for the fact that deacylated tRNA is bound to the P site in our structure. At 5.5 Å resolution, most of the conformation of the rRNA backbone in the vicinity of the 3′-CCA end of P-site tRNA shows few discernible differences between the two structures. The few apparent differences are localized to the P loop and at or around positions 2451, 2506, 2585 and 2602, which may move in a concerted way. In the 70S ribosome complex, the position of the 3′-CCA end of the P-tRNA, relative to nearby features of 23S rRNA, appears to differ from that of the corresponding part of the transition-state analog, possibly due to the absence of an acyl group. The CCA end of P-tRNA shows a vertical displacement relative to the binding pocket in the two structures (FIG. 6F).
Two possible models could account for the differences seen between the experimental 70S electron density map (FIG. 6F) and the 5.5 Å map calculated from the 50S structure (FIG. 6G). In one model, the CCA end is pulled up slightly in the binding pocket, accounting for the gap in density seen in the experimental map between A76 and the A2451 strand where continuous density is seen in the calculated map. A second model involves a deeper placement of C74 and C75 in the pocket, accompanied by a rotation of A76 towards U2585. The second model is also consistent with the gap in the density described above, but also explains new density appearing adjacent to U2585 in the experimental electron density of the 70S ribosome (FIG. 6F). Chemical protection experiments have shown that U2585 is strongly protected by binding either acylated or deacylated tRNA to the 50S P site but is unprotected when bound with tRNA missing its A76 (Moazed et al. 1989a). Interestingly, while the placement of A76 near U2585 involves a significant rearrangement of the CCA end of the model determined from the 50S subunit structure, the position of the ribose of A76 may not shift much at all in the binding pocket.
Surrounding the A-tRNA anticodon loop in the 30S subunit are G530, A1492 and A1493, the three universally conserved bases originally identified as A-site-specific features by chemical footprinting studies (Moazed et al 1986b; Moazed et al. 1990) and shown to affect A-site binding by mutational and biochemical studies (Powers et al. 1990; Yoshizawa et al. 1999). All three bases are positioned close to the site of codon-anticodon interaction in the 30S A site (FIGS. 6H, I; a,d). The tRNA-protected N1 positions of bases A1492 and 1493 point away from the codon-anticodon base pairs, and are separated from them by the 16S rRNA backbone, when the 30S subunit A site is vacant (Wimberly et al. 2000), consistent with the electron density of the 70S ribosome in the absence of A-tRNA. In the presence of the aminoglycoside antibiotic paromomycin, the conformations of nucleotides 1492 and 1493 have been found to rearrange (Carter et al. 2000), raising the possibility that they may also rearrange in response to binding tRNA to the 30S A site. In the 7 Å Fourier difference map of the A-site tRNA bound to the 70S ribosome (FIG. 6J), a patch of negative electron density is seen at the position of bases 1492–1493, providing support for the possibility that they rearrange to interact with the first and second base pairs in the minor groove of the A-site codon-anticodon helix, as suggested by Carter et al. (Carter et al. 2000). The N1 position of G530 is also protected upon A-tRNA binding (Moazed et al. 1986b; Moazed et al. 1990) and mutations of this base confer a dominant lethal phenotype and defective A-tRNA binding (Powers et al. 1990). G530 is also positioned in the minor groove of the codon-anticodon helix, near the second and third base pairs. The bulged base C1054, mutations in which have been shown to suppress UGA nonsense mutations (Murgola et al. 1988), projects toward the apex of the A-tRNA anticodon loop (FIG. 6I; b).
Lysine 120 of protein S13 and phosphate 955 are both close enough to interact with the tRNA backbone around position 41 (FIG. 6H, I; c). The conserved lobe of S12, which bears the universal PNSA sequence around position 50, projects into the space between the 530 loop and the 1492–1493 strand of the decoding site (FIG. 6H; e), completing the floor of the 30S subunit A site. Mutations on the right-hand side of the lobe, facing the top of the penultimate stem at nucleotides 1492 and 1493 and the switch helix, (Lodmell et al. 1997) at positions 910–912, confer restrictive (hyperaccurate) phenotypes (reviewed in Kurland et al. 1990). These mutations could have the effect of widening the space between the 530 loop and 1492-3 strands, loosening the interactions between the tRNA-mRNA complex and the 30S A site.
The elbow of A-tRNA interacts with bridge B1a (the A-site finger; H3 8) at its D and T loops (FIG. 6K; g), and with protein L16 (Noller et al. 1992). Protein L11 and its associated RNA near position 1067 of 23S rRNA (H43; Ryan et al. 1991) although not directly interacting with the A-tRNA, are close to its T loop and could contact it transiently with only modest movement of either the tRNA or 23S rRNA. Electron density from protein L16 or an as yet unidentified r-protein partially occupies the position of the A-tRNA elbow (FIG. 6L), and so must move upon A-tRNA binding, possibly as part of the “accommodation” step (Pape et al. 1999). Helix 89 of 23S rRNA runs nearly parallel to the acceptor arm of the A-tRNA, making a minor-groove interaction (h) with the T stem at the top, and contacting the backbone of the CCA tail which lies across the major groove of its non-canonical helical extension (j) at the bottom. The CCA tail is also positioned by contact with the conserved 1942 loop, which tucks into the major groove at the end of the acceptor stem (i), and by the previously predicted base pair between C75 and G2553 of 23S rRNA (63), observed in the 50S crystal structure (Nissen et al. 2000).
The E-tRNA anticodon stem-loop is wedged between the head and platform of the 30S subunit, where it is surrounded by a dense system of molecular interactions (FIG. 6M), somewhat unexpected in view of the relatively weak binding of E-tRNA (Lill et al. 1986) and the apparent absence of base protections in 16S rRNA attributable to E-tRNA binding (Moazed et al. 1986b; Moazed et al. 1990). Helices 28 and 29 of 16S rRNA as well its 690 and 790 loops contribute RNA contacts a–e (FIG. 6N). The C-terminal α-helix of protein S7 packs against the backbone of the anticodon stem, while the S7 β-hairpin is positioned at the Watson-Crick face of the E-tRNA anticodon (f). Although normal codon-anticodon interaction is absent, there may be contact between the second base of the E-tRNA anticodon and the mRNA. A possible role of S7 could be to disrupt codon-anticodon interaction in the 30S E site. Recent studies show that deletion of either the β-hairpin or C-terminal helix of S7 influences the efficiency and accuracy of EF-G-dependent translocation (K. Fredrick, unpubl.)
Protein L1 and its binding region (H76–77) on 23 S rRNA interact with the elbow of E-tRNA (contacts g-i). The E-tRNA-protected bases G2112 and G2116 may stack on the tertiary G19-C56 base pair at the top of the tRNA elbow. The acceptor stem makes a minor-groove interaction with helix 68 of 23S rRNA, which includes the backbone contacts with ribose 71 that have been shown by Joseph and co-workers to be essential for EF-G-dependent translocation (Feinberg et al. 2001). In addition, the conserved A1853 may make an A-minor interaction with the 2–71 base pair. The CCA tail is buried in a deep pocket of the 50S subunit that is separate from the peptidyl transferase cleft, making contacts with helices 11, 74 and 75 of 23S rRNA and protein L33, and the E-tRNA-protected C2394 (Moazed et al. 1989a).
Implications for the Mechanism of Translation
The structure of a complete ribosome provides the basis for understanding the mechanism of protein synthesis at the molecular level. As a molecular machine, the ribosome must have moving parts that enable its function (Spirin 1969). The translocation step of protein synthesis inescapably requires movements of 20 A or more by the tRNAs, as they move from the A to P to E sites. It seems unlikely that such movements would not be matched by corresponding structural rearrangements of the ribosome (Wilson et al. 1998). The hybrid states model, in which the tRNAs move independently with respect to the 30S and 50S subunits in two separate steps, carries the implication that the mechanism of translocation may involve relative movement of the 30S and 50S subunits, or of particular structural domains or substructures of the two subunits (Moazed et al. 1989b).
FIG. 7A shows the overall relative geometry of the A-, P- and E-tRNAs and the mRNA as they are positioned in the 70S ribosome crystals. Their specific contacts with the ribosome indicate that they are in their “classical” (A/A, P/P and E/E), rather than hybrid binding states (Moazed et al. 1989b). The planes of the A- and P-tRNAs form an included angle of 26°, and the P- and E-tRNAs an angle of 46°. Simultaneous reading of the adjacent A and P codons is accommodated by a kink in the mRNA backbone of about 45° between the A and P codons (FIG. 7A). The distances between corresponding positions of the three tRNAs is a measure of the magnitude of the movement of tRNA during translocation. Thus, the anticodon end of tRNA moves about 28 Å between the 30S A and P sites, and 20 A between the P and E sites. Because of the rotation of the plane of the tRNA, the elbow moves through much larger distances of 40 and 55 Å, as it transits from A to P to E.
Our current understanding of the hybrid-states model (Moazed et al. 1989b) is shown schematically in FIG. 7B. Experimental evidence from several laboratories over the past decade have led to the introduction of some modifications to the minimal model. First, the afore-mentioned crystallographic evidence necessitates participation of a 30S E site in the mechanism. Second, evidence for an “accommodation” step following release of EF-Tu (Pape et al. 1999) raises the possibility that proof-reading of the incoming aminoacyl-tRNA could take place during this step; possibly, the accommodation process could involve regulation of peptidyl transferase activity, permitting only the cognate aminoacyl-tRNA to participate in peptide bond formation. Third, several lines of evidence (Green et al. 1998; M. Rodnina and S. Joseph, unpublished) have convincingly demonstrated that movement from the A/A to A/P and P/P to P/E states occurs sequentially, rather than concertedly, with peptide bond formation. Therefore, a separate state in which the peptidyl-tRNA occupies the A/A state has been introduced (FIG. 7B).
Extensive evidence has by now accumulated in support of the essential feature of the hybrid-states model, that the tRNAs move independently with respect to the two ribosomal subunits, first on the 50S subunit and then, on the 30S subunit (coupled to mRNA movement). Direct structural observation of the A/P and P/E states have been observed directly in cryo-EM reconstructions (Agrawal et al. 2000). The A/T state, in which the incoming aminoacyl-tRNA is still bound to EF-Tu, has also been observed by cryo-EM studies (Stark et al. 1997a).
FIG. 7C shows a three-dimensional interpretation of the hybrid-states translocational cycle. Here, the orientations of the classical-states tRNAs (A/A, P/P and E/E) are represented by those that we have directly observed crystallographically. The positions of the A/P and P/E hybrid-states tRNAs were modeled starting with the classical-state tRNAs, fixing the positions of their anticodon ends, and rotating them as rigid bodies to dock their respective acceptor ends in the 50S subunit. The resulting models bear close resemblance to the low-resolution structures observed experimentally by cryo-EM (Agrawal et al. 2000). The A/T tRNA was modeled in two steps: First, the structure of EF-G (Czworkowski et al. 1994) was docked on the 70S ribosome structure using constraints from footprinting and directed hydroxyl radical probing. Second, the structure of the EF-Tu-tRNA-GTP ternary complex (Nissen et al. 1995) was docked on EF-G by virtue of their homologous G domains. The result is again in good agreement with the position of the ternary complex determined by cryo-EM (Stark et al. 1997a). A striking observation is that the distance traversed by the acceptor end of the aminoacyl-tRNA in going from the A/T to the A/A states is on the order of 70 A, roughly the overall dimensions of the tRNA itself.
Thus far, most of the evidence for movement has pointed mainly to the 30S subunit. Neutron scattering experiments, in which changes in the radius of gyration of the ribosome were observed between the pre-and post-translocation states, suggested movement of the head of the small subunit (Serdyuk et al. 1992). Cryo-EM comparison of ribosomes bearing mutations in the “switch helix” (helix 27) of 16S rRNA indicate conformational differences in the head, shoulder, platform and penultimate stem of the 30S subunit between the ram and restrictive forms (Gabashvili et al. 2000). Comparison of the conformation of 16S rRNA in the 70S ribosome with that of the separate 30S subunit (FIG. 3A, B) again shows differences that suggest mobility of the head, platform and penultimate stem regions of the small subunit. Recent cryo-EM studies (Agrawal et al. 1999b; Frank et al. 2000) indicate rotation of the entire 30S subunit by about 6° upon binding of EFG-GTP.
The hybrid-states implication that tRNA translocation may involve relative movement at the subunit interface was reinforced by the observation that many of the nucleotides implicated in tRNA-ribosome interactions by biochemical and genetic experiments are adjacent to nucleotides involved in subunit association (Merryman et al. 1999a, b). The crystal structure provides direct evidence for close proximity of the tRNA binding sites to interface contacts, and even shows that some of the bridges interact directly with the tRNAs. Moreover, there is evidence that some of these tRNA-bridge interactions are dynamic.
Knowledge of the 70S three-dimensional ribosome structure provides important clues to the mechanism of tRNA movement. The hybrid states model notion that the mechanism of translocation involves relative movement of the 30S and 50S subunits, or of particular structural domains or substructures of the two subunits (Moazed et al. 1989b) is reinforced by the observation that many of the nucleotides implicated in tRNA-ribosome interactions by biochemical and genetic experiments are adjacent to nucleotides involved in subunit association (Merryman et al. 1999a; Merryman et al. 1999b). The crystal structure in fact shows that the tRNAs directly contact intersubunit bridges, at least some of which are believed to be dynamic elements of the ribosome. For example, among the structural elements that are disordered in the high-resolution 50S subunit structure are the bridges B1a, B1b and B2a. Disorder is informative in that it identifies specific molecular features of the ribosome that are capable of independent motion, at least under conditions prevailing in the crystal, and so are candidates for participation in ribosomal dynamics. FIG. 8 shows the features directly surrounding the A- and P-tRNAs at the subunit interface, viewed from the two opposite interface sides. The two tRNAs are sandwiched between bridges B1b and B1b at the top, and B2a at the bottom. The intersubunit contacts for all three of these bridges are disordered in the 50S crystal structure (Ban et al. 2000), suggesting that all three are dynamic elements. On the 30S side (FIG. 5B), the tRNAs are sandwiched between the head and the tops of the penultimate stem and platform, all of which show conformational differences between the free 30S subunits and 70S ribosomes (Yusupov et al. 2001), again suggesting that they are capable of movement during translation. Moreover, the fact that these potentially dynamic elements all interact with each other across the subunit interface points to the likelihood that their respective movements are coordinated. Thus, movement of bridges B1a and B1b would be coupled to rotation of the head, and movement of bridge B 2 a to movement of the penultimate stem and platform. In fact, low-resolution cryo-EM images of the pre- and post-translocation states of E. coli ribosomes (Agrawal et al. 1999b) are consistent with such a coordinated movement.
A potentially important clue to the mechanism of translocation comes from tRNA modification-interference studies by Feinberg and Joseph (Feinberg et al. 2001). Their studies show that introduction of a single 2′-O-methyl group at position 71 of P-tRNA abolishes EF-G-dependent translocation. Interestingly, the sole interaction between the ribosome and position 71 of tRNA occurs in the SOS E site, indicating that the effect of the methyl group must be on the P/E state. This finding is consistent with a kinetic analysis that has shown the importance of hybrid states formation for EF-G-dependent translocation (Semenkov et al. 2000). The mechanism by which ribose 71 methylation inhibits translocation must be indirect, since the nearest approach of EF-G is about 70 A away, and its catalytic center is over 100 A away. One possibility is that the effect is mediated through 23S rRNA. Ribose 71 contacts helix 68 of 23S rRNA, which is at the far left end of the lateral arm of domain IV that lies horizontally across the top of the subunit interface surface of the 50S subunit (FIG. 8A). The lateral arm is a continuously coaxially stacked system of canonical and non-canonical helices that traverse the interface. Its far right-hand end terminates in a hairpin loop that makes an A-minor interaction with the stem of the A loop.
The single-stranded loop at the base of the A loop in turn interacts with the minor groove of the sarcin/ricin loop, which has been directly implicated in the GTPase function of EF-G (Hausner et al. 1987). In addition, helix 69, which directly contacts both the A- and P-tRNAs in their respective D stems, is connected to the conserved, non-canonical helix in the middle of the lateral arm of domain IV (FIG. 8A). These structural clues present a circumstantial case for the involvement of specific elements of ribosomal RNA in the mechanism of translocation.
Among the structural elements that are disordered in the 50S subunit structure are the bridges B1a, B1b and B2a. The disorder is informative in that it identifies specific molecular features of the ribosome that are capable of independent motion, at least under conditions prevailing in the crystal, and so are candidates for participation in ribosomal dynamics. B1a and B1b connect the central protuberance of the 50S subunit to the head of the 30S subunit (FIGS. 2E, 5B, 5C; Table III), an independent structural domain which has repeatedly been implicated in ribosomal dynamics, as discussed above. The 50S contacts for the two bridges are the 890 loop of helix 38, and the 134–153 loop of protein L5, both of which are disordered in the SOS subunit electron density map (Ban et al. 2000), and are thus flexible. Bridges B1a and B1b contact the conserved elbow regions of the A-and P-tRNAs, respectively, which undergo the largest movement (˜40–50 Å) during translocation. Helix 38 of 23S rRNA, around its conserved internal loop at positions 882/898, interacts with the D and T loops of A-TRNA, and protein L5 interacts with the T loop of P-tRNA via the conserved β-hairpin centered on residue 80. Interestingly, B1a and B1b are also the bridges most strongly affected by the EF-G-dependent intersubunit rotation observed in the above-mentioned cryo-EM studies (Frank et al. 2000). Near their junctions with the body of the 50S subunit, these two bridges are straddled by 5S rRNA, which might in some way help to coordinate their movement.
The most intriguing of the flexible bridge elements is the centrally located B2a, formed by interaction of the universally conserved 1915 loop of helix 69 of 23S rRNA with the top of the penultimate stem (helix 44) of 16S rRNA at the base of the decoding site, where codon-anticodon interactions take place. The helix 69 stem-loop also contacts the A- and P-tRNAs, its loop interacting simultaneously with the penultimate stem of 16S rRNA and with the minor groove of the D stem of A-tRNA, while the minor groove of its stem contacts the minor groove surface of the D stem of the adjacent P-tRNA. The disorder of helix 69 in the 50S subunit structure can be explained by the absence of any direct stacking or other packing interactions with the SOS subunit, and its connection to the rest of 23S rRNA by only a single-stranded loop, to the conserved lateral arm of domain IV of 23S rRNA (which, in turn, embodies bridges B2b, B3 and B7a; FIG. 5C).
Continuous coaxial stacking of the lateral arm includes a non-canonical helix that occupies nearly a whole helical turn in the highly conserved region separating the Watson-Crick helices 68 and 71 (bridges B2b and 133) just below and directly parallel to helix 69. In this crucial central region of the interface, it is not difficult to see how the movement of tRNA could be coupled to perturbation of the interface contacts at bridges B2a, B2b and B3, and potentially to conformational rearrangement of the non-canonical helical segment of the lateral arm. In the post-translocation state, directed hydroxyl radical probing has placed helix 69 in proximity to the tip of the functionally dynamic domain IV of elongation factor EF-G (Wilson et al. 1998), which is believed to mimic tRNA and has been implicated in the mechanism of EF-G-catalyzed tRNA movement (Nissen et al. 1995).
Interaction of the 1915 loop of helix 69 with the minor groove of the D stem of A-site tRNA suggests a possible explanation for the mechanism of action of the Hirsch suppressor (Hirsch 1971), one of the more puzzling tRNA nonsense suppressor mutations, consisting of an A to G mutation at position 24 in the D stem of tryptophan tRNA. A24 is base paired to U11, which is nearly always a pyrimidine, whose 02 position projects into the minor groove of the D stem where it is within contact range of the 1915 loop. Creation of a G24-U11 wobble pair could thus hinder the accessibility of the pyrimidine 02 from the minor groove side. Dahlberg and co-workers have discovered that mutation of the nearby Cl 914 to U confers a nonsense- suppressor phenotype (O'Connor et al. 1995). Thus, this unanticipated bridge B2a-tRNA interaction may play an important role in translational fidelity.
The other bridges implicated in ribosomal function involve the penultimate stem (helix 44), switch helix (helix 27) and the platform (helices 23 and 24) of 16S rRNA. These three features contain five of the six class III sites, whose interesting behavior was identified in earlier chemical probing experiments (Moazed et al. 1987). These bases are all protected independently by tRNA, 50S subunits or certain antibiotics. The observation that all three kinds of ligand were independently able to protect these bases, led to the conclusion that their protection must be caused by ligand-induced conformational changes rather than direct contact between the bases and ligands. Indeed, the structural results show that none of these bases make direct contact with the 50S subunit, tRNA or antibiotics (Carter et al. 2000; Fourary et al. 1996) . Three class III sites (A909, A1413, G1487) are found at the contact surface between the internal loop of the switch helix with the minor groove of the penultimate stem, where A909 makes an A-minor interaction with the non-canonical A1413–G1487 base pair (Wimberly et al. 2000).
The reactivities of the N1 positions of all three purine bases in vacant 30S subunits indicates that interaction with tRNA, 50S subunits or streptomycin or the neomycin-related antibiotics induces formation of this interhelical base-triple interaction. Protection by subunit association can be explained by the bridge interactions B2a and B3, which directly flank the 1413–1487 pair, and B2c which involves the 900 loop of the switch helix. Protection by tRNA and antibiotics is consistent with binding of the A- and P-tRNAs and drugs to the decoding site at the top of the penultimate stem. The two class III bases in the 790 loop are protected by their interactions with the 16S rRNA backbone in the decoding site at positions 1497–1498, next to the P-site codon-anticodon interaction. This interaction appears to be stabilized upon subunit association by contact of helix 24 of 16S rRNA with the 50S subunit in the adjacent bridge B2b, and as a result of tRNA binding by backbone-backbone interactions between positions 790- 1 and nucleotides 38–9 in the P-tRNA anticodon stem-loop. The sixth class III base is A1394, in the neck of the subunit (helix 28), in which a hydrogen bond is formed between the N1 position of A1394 and the 2′-hydroxyl of the decoding site nucleotide A1500 (Wimberly et al. 2000). The global result of the class III conformational changes appears to be an overall tightening of the base of the decoding site, in the channel where the mRNA is bound, and where the A- and P-site codon-anticodon interactions take place, which could help to explain the miscoding effects of streptomycin and the aminoglycoside antibiotics.
Intramolecular movement in 16S rRNA, embodied in the class III conformational changes, can be linked to at least one mobile element of 23S rRNA, the conserved 1915 stem-loop (helix 69), and the potentially mobile non-canonical helix in the middle of the lateral arm of domain IV, which is flanked by bridges B2a, B2b, B2c and B3. As just discussed, all four of these bridges are implicated in 50S-induced conformational changes in 16S rRNA that are manifested by the class III protections. It would not be surprising to find that these same conformational changes, which are also induced in 16S rRNA by tRNA and mRNA interactions in the decoding site of the 30S subunit, could reciprocally affect the conformation of this interface region of 23S rRNA, via the same set of bridge interactions. This could have interesting implications for the mechanism of translation, since the lateral arm of domain IV packs directly against the 2600 stem-loop (helix 93) and the A loop (helix 92) of 23S rRNA, both of which are directly involved in interactions in the peptidyl transferase center (Nissen et al. 2000; Moazed et al. 1989a; Kim et al. 1999; Moazed et al. 1998). Furthermore, the 2563–4 loop at the base of helix 92 interacts directly with the base of helix 95, the sarcin-ricin loop, which is directly implicated in the activities of elongation factors EF-Tu and EF-G. Finally, the far left-hand end of the lateral arm of domain IV, near bridge B7a, makes interactions with the acceptor end of the E-tRNA that have been shown to be crucial for EF-G-dependent translocation (Feinberg, J. S. and Joseph, S., personal communication). Knowledge of the complete structure of the ribosome complexed with mRNA and tRNA now provides the possibility to test these and other specific molecular models for the mechanism of translation.
Introduction
The path of the mRNA in the ribosome was mapped for the first time, by X-ray crystallography. Using diffraction data from crystals of 70S ribosomal complexes containing bound tRNAs and either a model mRNA fragment or no mRNA at all (Belitsina et al. 1981), we calculated Fourier difference maps of the bound mRNA. Together with the positions of the A- and P-site codons bound to their respective mRNAs in 70S complexes described above, we were able to describe the complete path of the mRNA through the ribosome, at 7 Å resolution. The mRNA is threaded through a channel that wraps around the neck of the 30S subunit, confirming the general features of the previous models (Frank et al. 1995b; Shatsky et al. 1991). The locations in the ribosome of the Shine-Dalgamo and downstream regions of the mRNA flanking the A and P sites have implications for translational initiation, frame-shifting and other functional interactions of mRNA. Unexpectedly, a model mRNA, based on gene 32 mRNA forms an electron-dense mass, most likely resulting from formation of a small hairpin loop by intramolecular base pairing of the mRNA, that appears to mimic binding of the anticodon loop of tRNA to the A site. Finally, the arrangement of ribosomes around the crystallographic four-fold axis permits direct threading of the mRNA from one ribosome to the next, suggesting how ribosomes may pack in polysomes to make efficient use of shared mRNA and tRNAs.
Experimental
Model mRNA Constructs
Model mRNAs were based initially on the phage T4 gene 32 mRNA. For all three mRNAs (FIG. 9), the Shine-Dalgarno pairing was increased to allow eight potential base pairs with 16S rRNA, and a GGC sequence added to the 5′ end to facilitate transcription by T7 RNA polymerase. The mRNA samples used in these studies were made by solid-phase synthesis (Dharmacon, Inc., Boulder, Colo.), and gel-purified prior to use in crystallization.
Crystallization, Data Collection and Model Fitting
Thermus thermophilus 70S ribosomes were prepared and co-crystallized with purified E. coli initiator tRNA (Subriden, Rollingbay, Wash.) and MK27 (SEQ ID NO: 52), MF36 (SEQ ID NO: 51) or MV36 (SEQ ID NO: 50) mRNAs (Dharmacon), or without mRNA, using the same conditions reported previously (Cate et al. 1999; Yusupov et al. 2001). Diffraction data were collected using synchrotron radiation, as previously described (Cate et al. 1999), and processed using Scalepack and Denzo (Otwinowski, 1993). Fourier difference maps were calculated from measured native amplitudes (Table V) and previously calculated structure factor phases (Cate et al. 1999; Yusupov et al. 2001) using the CCP4 suite of programs (1994). mRNA models were fitted using O (Jones et al. 1997), and molecular structure figures were rendered using Ribbons (Carson 1997).
| TABLE V |
| Crystallographic Dataa |
| Data set | ||||
| (model mRNA) | no mRNA | MK27 | MF36 | MV36 |
| High-resolution limit | 6.5 | 5.6 | 5.0 | 7.0 |
| (Å) | ||||
| Rsym* | 8.9 | 12.4 | 9.4 | 8.8 |
| Mean I/σ(I) | 2.6 at 6.5 Å | 2.1 at 5.6 | 3.3 at 5.5 | 2.3 at 7.0 |
| Number of reflections | ||||
| Unique | 95,127 | 153,627 | 209,044 | 73,146 |
| Observational | 3.6 | 3.0 | 2.8 | 3.6 |
| redundancy | ||||
| Completeness (%) | 96.7 | 97.7 | 95.3 | 89.5 |
| aCrystals of ribosomal complexes were prepared as described in Methods, using the model mRNAs MK27, MF36 and MV36 (FIG. 1). All data were collected at beamline 5.0.2, at the Berkeley Center for Structural Biology, Lawrence Berkeley National Laboratory. | ||||
| *Rsym = Σ|I − <I> I|ΣI |
The model mRNA MF36 was based on phage T4 gene 32 mRNA (FIG. 9), except that the potential for pairing of its Shine-Dalgamo sequence was increased to eight base pairs by extending its complementarity to the 3′ tail of 16S rRNA. For the MV36 (SEQ ID NO: 50) and MK27 (SEQ ID NO: 52) mRNAs different coding and downstream regions were also introduced (FIG. 9). Complexes containing Thermus thermophilus 70S ribosomes, mRNA fragments and either full-length tRNA or an anticodon stem-loop (ASL) bound to the ribosomal P site were co-crystallized as described (Cate et al. 1999; Yusupov et al. 2001). Similar co-crystals containing 70S ribosomes and initiator tRNA, but lacking mRNA (Belitsina et al. 1981) were prepared under the same conditions. Data were collected using synchrotron radiation, and previously derived structure factor phases (Cate et al. 1999; Yusupov et al. 2001)) were used to compute Fourier difference maps (Table V).
FIG. 10A shows the 7 Å Fourier difference map computed for the MK27 mRNA fragment (SEQ ID NO: 52) using data collected from crystals containing two types of ribosomal constructs. In one construct, 70S ribosomes were bound with the MK27 mRNA (SEQ ID NO: 52) and initiator tRNA; the other construct was identical, except that mRNA was omitted. Pseudoatom models for the mRNA 27mer and the 3′-terminus of 16S rRNA, as well as the previously—determined models for the A and P codons (Yusupov et al. 2001), are shown superimposed on the difference map. The positions of the A- and P-codons provide a close check on the register of the central part of the mRNA model, while the resolution of the difference map itself allows fitting the rest of the mRNA with a precision of about +/−1 nucleotide.
A pronounced cylinder of electron density is seen at the 5′ end of the mRNA, whose dimensions are in good agreement with the predicted eight base-pair Shine-Dalgarno helix. A gap of about four nucleotides in the electron density is seen at the position of the P codon and its 5′ flanking nucleotide (mRNA positions −1 to +3). This can be explained by the folding back of the 3′ tail of 16S rRNA in the absence of mRNA, as found in the high-resolution structure for the T. thermophilus 30S subunit (Wimberly et al. 2000); binding of the tail of 16S rRNA to the P codon position of the ribosome results in subtraction of the P codon from the mRNA difference map. An additional small gap is found at position −4 of the mRNA, which may be due to local disorder. The location of the A codon is close to that found in the presence of A-tRNA, even though A-tRNA was absent in these complexes. At its 3′ end, the MK27 (SEQ ID NO: 52) difference density terminates in good agreement with the predicted position of the 3′ end (position +12) of the mRNA model.
The difference map for the MK36 mRNA (SEQ ID NO: 50) resembles that of the MK27 mRNA (SEQ ID NO: 52), except at its 3′ tail and in the A codon region, where a cylinder of density overlapping with the position normally occupied by the A-tRNA (Cate et al. 1999; Ogle et al 2001; Yusupov et al. 2001) appears (FIG. 10B). This unexpected feature can be explained by intramolecular base pairing of-complementary sequences in-the gene 32 mRNA (positions +4 to +7 and +12 to +15 of the MF36 mRNA (SEQ ID NO: 51)(FIG. 9). This feature is absent in the difference map for MK-27 (SEQ ID NO: 52)(FIG. 10A), in which the self-complementary sequences were replaced by poly(A). A four base-pair stem modeled from a tetraloop-containing helix (13) can be accommodated in the extra difference density (FIG. 10B). Modeled in this way, the 3′ end of the MF36 mRNA (SEQ ID NO: 51) terminates close to the end of the strongest part of the electron density (FIG. 10B). Weaker density can be seen extending about six nucleotides further, suggesting that the unfolded form of the MF36 mRNA (SEQ ID NO: 51) is also present, but at lower occupancy. The weaker density extends to about position +17, implying that the very 3′ end of the mRNA chain (nucleotides +18 through +21) is disordered in the unfolded mRNA conformer. The mRNA hairpin feature occupies the position of the anticodon stem-loop (ASL) of the A-site tRNA (Cate et al. 1999; Yusupov et al. 2001), as shown in FIG. 10C. The striking coincidence of these two structures suggests that the mRNA hairpin may be designed to mimic the A-site ASL, possibly playing a role in initiation of translation of gene 32 mRNA.
FIG. 11A shows the path of the mRNA in the context of the complete 30S ribosomal subunit of the 70S ribosome, as viewed from the subunit interface. The mRNA passes through upstream and downstream tunnels to access the interface, where only about eight nucleotides (−1 to +7), centered on the junction between the A and P codons, are exposed. Binding of mRNA to the 30S subunit during translational initiation requires opening one or both of the tunnels, (which are closed non-covalently), depending on the length of the upstream leader, since it has been shown by Bretscher (Bretscher, 1968) that the ribosome is able to initiate translation on a circular message. The contact point between the head and body has been described as a potential “latch”, the closing of which was proposed to provide a geometry that guarantees processivity, provide directionality and prevent dissociation (Schluenzen et al. 2000). The boundaries of the ribosomal contacts with the mRNA (−15 to +16) are within experimental error of those predicted (−16 to +16) by Steitz (Steitz, 1969). The features of 16mRNA structure that surround the message agree well (P-P distances from 8 to 28 Å) with all but one (60 Å between mRNA position −1 to −8 with 16S rRNA position 1360) of the site-directed crosslinking results (Bhangu et al. 1994; Bhangu and Wollenzien, 1992; Brimacombe, 1995; Dokudovskaya et al. 1993; Dontsova et al. 1992; Greuer et al. 1999; Juzumiene et al. 1995; Rinke-Appel et al. 1993; Rinke-Appel et al. 1994; Sergiev et al. 1997).
The 5′ end of the mRNA originates at the back of the platform (FIG. 11B), where it enters the groove between the head and platform, wrapping around the neck of the subunit and exiting on the opposite side between the head and shoulder. Although the ribosome-bound portion of the mRNA contains about 30 nucleotides, stretching from about position −15 to +15, the region most closely wrapped around the neck extends from around positions −3 to +10, centering on the junction between the A and P codons. The immediate molecular environment of the mRNA contains mainly 16S rRNA (SEQ ID NO: 45)(FIG. 11A), except at the extremities of its binding site, around the upstream Shine-Dalgamo interaction and in the downstream region around position +12, as well as in the A codon, where it is close to ribosomal proteins.
Upstream Interactions
The Shine-Dalgarno helix fits into a large cleft between the back of the platform and the head of the subunit (FIG. 12A). In the solvent-side view, The Shine-Dalgamo cleft is formed by helix 20 on the bottom, the 723 bulge loop and proteins S11 (SEQ ID NO: 34) and S18 (SEQ ID NO: 41) on the left, and the neck helix (helix 28) and helix 37 on the right. The N-terminal end of protein S18 (SEQ ID NO: 41), which is rich in basic and aromatic side-chains, is directed toward the major groove of the Shine-Dalgamo helix, at the 5′ end of the mRNA (position −15). Extra density under the upstream end of the Shine-Dalgamo helix may come from the N-terminal 15 amino acids of S18 (SEQ ID NO: 41), which were disordered in the high-resolution structure of the 30S subunit (Wimberly et al. 2000). Both the N-terminal tail and the loop of S11 (SEQ ID NO: 34) that contains Arg 54 are near enough to make specific interactions with the Shine-Dalgamo helix. At the downstream end of the Shine-Dalgarno helix, the C-terminal tail of protein S11 (SEQ ID NO: 34) interacts with the backbone of the mRNA around positions −4 to −6.
Directly downstream of the Shine-Dalgarno helix, the 5′ leader (positions −1 to −4) of the mRNA passes through a short tunnel between the head and the platform of the subunit to the interface side, where it is surrounded by the tip of the β-hairpin of protein S7 (SEQ ID NO: 30), the apex of the 690 loop, the minor groove side of the 790 loop, the base of helix 45 around position 1505 and the 925 region of helix 28. This region of the mRNA contains the E codon (position −1 to −3), whose fall access to the interface is hindered by its location in the tunnel.
The P and A Codons
After a sharp turn in the mRNA around position −1, the P and A codons are presented to their respective tRNAs in the middle of the interface surface of the cleft, with an approximately 45° kink between the adjacent codons that allows simultaneous pairing of the A- and P-tRNA anticodons (as described above). The two codons are centered above the axis of the penultimate stem of 16S rRNA (SEQ ID NO: 45), where they occupy the major groove of the non-canonical helical structure formed by the 1400 and 1500 strands of 16S rRNA (SEQ ID NO: 45) often referred to as the “decoding site” (FIG. 12B). As noted above, the P codon follows a path very similar to that described for the folded-back tail of 16S rRNA (SEQ ID NO: 45), which appears to mimic this region of the mRNA in the high-resolution crystal structure of the 30S subunit (Wimberly et al. 2000).
Some details of the interactions between the ribosome and the P codon can therefore be inferred from the 30S structure. Interestingly, the N1 position of G926, which was protected from kethoxal by P-tRNA binding, even in the absence of mRNA (Moazed et al., 1990; Moazed et al. 1986b), is positioned to interact with the phosphate of nucleotide +1 of the P codon. The observed tRNA-dependent protection may be due to re-positioning of the mRNA chain (or the 16S tail, in the absence of mRNA) in response to tRNA binding, since the mRNA backbone begins to diverge from the path of the 3′-tail of 16S rRNA near position −1 of the mRNA. Modification-interference experiments also indicated the importance for G926 in mRNA-independent binding of tRNAPhe to the 30S P site (von Ahsen and Noller, 1995); since the 3′ tail does not contain a Phe codon, this result suggests that the apparent mRNA mimicry by the 16S rRNA tail, stabilized by the 926 interaction, may be important in inducing the active conformation of the 30S P site, and could help to explain the fact that initiator tRNA can bind to the 30S subunit independently of mRNA during translational initiation (Gualerzi et al. 1977).
The 1500 strand of 16S rRNA crosses at right angles to the mRNA chain, where nucleotide 1498 lies directly under nucleotide +1 of the P codon (FIG. 12B). In the high-resolution structure (Wimberly et al. 2000) the phosphate of nucleotide 1498 packs against ribose +1 and its base (m 3U 1498 in E. coli) against ribose +2. These interactions are evidently stabilized by interaction of the N6-amino group of A790 and the N1 of the universally conserved G791 with the non-bridging phosphate oxygens of nucleotide 1498. Both A790 and G791 were earlier identified as “class III” bases (Moazed et al. 1987), whose protection from attack by chemical probes at their N1 positions was predicted to result from a conformational change in 16S rRNA (SEQ ID NO: 45), because the same protections were conferred by P-tRNA, 50S subunits or certain antibiotics. These class III protections can now be explained by movement of the 790 stem-loop (helix 24) toward the penultimate stem in response to binding of P-tRNA or the other ligands, simultaneously resulting in interaction of the backbone of the 790 loop with the bottom of the anticodon stem of P-tRNA and packing of nucleotide 1498 against the P codon. Such a movement would be consistent with the counter-clockwise rotation of the platform of the 30 S subunit when it joins with the 50S subunit, observed in cryo-EM studies (Lata et al. 1996).
At the junction between the P and A codons, the mRNA is blocked from continuing its A-RNA-like trajectory by the phosphate of nucleotide 1401, which lies directly in its path (FIG. 12B). This redirects the mRNA, resulting in the observed kink in the mRNA between the A and P codons.
In the A site, the bases G530, A1492 and A1493 interact intimately with the minor groove of the A-site codon-anticodon helix, in a possible discriminatory mechanism for A-site tRNA selection, as shown recently by Ramakrishnan and co-workers (Ogle et al. 2001). A further interaction is made by the β-hairpin loop of protein S12 (SEQ ID NO: 35) around the conserved PNSA sequence at positions 48–51, which is directly beneath riboses +5 and +6 (Ogle et al. 2001). This part of S12 (SEQ ID NO: 35) contains-most of the mutations that confer restrictive (hyper-accurate) phenotypes.
Downstream Interactions
Immediately downstream of the A codon, the mRNA passes through a second tunnel, about 20 Å in diameter, between the head and shoulder of the subunit, leading to the solvent side of the 30S subunit, first observed in cryo-EM reconstructions (Frank et al. 1995b). It has been suggested that closing of this tunnel around the mRNA ensures processivity and directionality of mRNA movement (Schluenzen et al. 2000). From the interface side, the mRNA (positions ca. +7 to +10) passes first through a layer of RNA, where it is surrounded by helix 34 at the top, the base of the neck at nucleotide 1397 (helix 28) on the right, the 5′ hairpin loop (at nucleotide 16 of 16S rRNA (SEQ ID NO: 45)) at the bottom and the 530 loop on the left (FIG. 13A). In the RNA layer, bases C 1397 and U1196 (Wimberly et al. 2000) are oriented toward the mRNA around positions +7 and +9, respectively, and may help to position the mRNA immediately downstream from the A codon.
Finally, the mRNA (positions ca. +11 to +15) passes through a layer of protein into the solvent at the back of the subunit. Viewed from the solvent side (FIG. 13B), the mRNA is encircled by protein S3 (SEQ ID NO: 26) at the top, S4 (SEQ ID NO: 27) on the right and S5 (SEQ ID NO: 28) on the lower left. These three proteins project a dense array of basic side chains into the downstream tunnel, including Arg131, Arg132, Lys135 and Arg164 from S3 (SEQ ID NO: 26), Arg47, Arg49 and Arg5O from S4, and Arg15 and Arg24 from S5 (SEQ ID NO: 28), which appear to position the downstream region of the mRNA via interactions with its backbone phosphates.
mRNA Helices, Pseudoknots and Frame-shifting
All mRNA chains have the ability to form hairpins and other intramolecularly base-paired structures, yet the codons must be read in single-stranded form. The ribosome is therefore able to unwind mRNA secondary structure, by some as-yet unknown mechanism. An mRNA hairpin would approach the ribosome surface at the back of the 30S subunit, from the view shown in FIG. 13B. Since an RNA helix is too large to pass through the narrow downstream tunnel, unwinding of mRNA structure is likely to occur at or near the entrance to the tunnel, around positions +13 to +15. Unfolding of a downstream (+11 to +17, +25 to +31) hairpin of λ cro mRNA, dependent on binding of initiator tRNA, may result from its threading through the downstream tunnel (Balakin et al. 1990).
A possible mechanistic basis for a mRNA helicase is suggested by the fact that proteins S4 (SEQ ID NO: 27) and S5 (SEQ ID NO: 28) are integral to the body of the 30S subunit, whereas S3 (SEQ ID NO: 26) is part of the head. If one strand of the incoming helix were bound to S4 (SEQ ID NO: 27) and/or S5 (SEQ ID NO: 28) and the other strand to S3 (SEQ ID NO: 26), the rotational movement of the head that is believed to occur during translocation (Agrawal et al. 1999b) could result in physical disruption of the helix, at the rate of about three base pairs (i.e., one codon) at a time, simultaneously advancing the mRNA through the ribosome.
Interestingly, the part of protein S5 (SEQ ID NO: 28) that faces the mRNA near its entry point to the downstream tunnel has the same three-dimensional fold as the double-stranded RNA binding domain (dsRBD) (Brunger et al. 1998). However, its relatively low sequence homology with the dsRBD consensus does not provide support for its potential binding to double-stranded RNA (dsRNA), at least in the way that has been observed for complexes containing the Xenopus XIrbpa protein and dsRNA (Brunger et al. 1998).
One type of structure that has been shown to perturb translation are mRNA pseudoknots. Most extensively documented is the finding that certain downstream pseudoknots promote a −1 shift of the translational reading frame when a “shifty” sequence is positioned in the decoding site, a mechanism that is exploited for translational regulation by many viruses (Alam et al. 1999; Brierley et al. 1989). The optimum position for the pseudoknot is between positions +11 and +15, which corresponds closely to the region where mRNA enters the downstream tunnel (+13 to +15), at the position of the proposed mRNA helicase. A simple explanation for the frameshifting event is that the structure of the pseudoknot is poorly matched to the geometry of the helicase, blocking entry of the mRNA into the downstream tunnel. Upon EF-G-catalyzed translocation, forward movement of the mRNA would be retarded, resulting in backlash of the mRNA and favoring slippage into the −1 reading frame.
Path of the rnRNA in the Crystal Lattice
In our crystals, the Thermus thermophilus 70S ribosomes pack in the 1422 tetragonal space group (Cate et al. 1999), in which adjacent ribosomes are organized symmetrically in layers of tetramers that are centered around a four-fold axis. FIG. 14 shows the arrangement of ribosomes around the four-fold axis in the crystal lattice. A striking feature of this arrangement is that it juxtaposes the 3′ end of the mRNA in one 70S monomer with the 5′ end of the mRNA of the adjacent 70S monomer, in principle permitting direct threading of a single continuous mRNA through all four ribosomes in the tetramer.
The crystal packing might reflect one of the ways in which ribosomes interact with each other in polysomes in vivo. An interesting consequence is that the E site of one ribosome is directly adjacent to the A site of its neighboring ribosome, so that a tRNA exiting one ribosome would immediately be positioned to enter the next ribosome, after charging by its synthetase. Thus, a given tRNA could, in effect, follow its own codon through the polysome.
Conclusion
Our 7 difference maps clearly reveal the path of the mRNA through the ribosome and identify the molecular features of the ribosome that surround each position along the length of the mRNA. The path taken by mRNA through the T. thermophilus 70S ribosome is likely to be generalizable to all bacterial and archaeal ribosomes, which share all of the structural features making up the mRNA binding channel. In fact, with the exception of the Shine-Dalgarno interaction, which is absent in eukaryotic ribosomes, we would expect mRNAs to follow a very similar path in all ribosomes. A major unanswered question is how the movement of mRNA is coupled to tRNA movement during the translocation step of protein synthesis, to prevent disruption of the weak codon-anticodon interactions and loss of the translational reading frame. A possible answer is that some of the ribosomal features that contact the mRNA are themselves mobile, and that the ribosome is able to coordinate their movement with that of tRNA during translocation. A possible example, mentioned above, is the head of the 30S subunit. Another obvious candidate is the decoding site itself, a non-canonical helix that links the penultimate stem with the head of the small subunit.
The A and P codons are threaded through the major groove of this unusual helix (FIG. 12B), which is formed from the universally conserved 1400 and 1500 strands of 16S rRNA (SEQ ID NO: 45). The decoding site helix is, in turn, connected via bridge B2a to another non-canonical helix formed by the universally conserved 1935 and 1965 strands of 23S rRNA (SEQ ID NO: 23) in the lateral arm of domain IV, that has been proposed to play a role in tRNA movement and intersubunit signaling as described above. Intriguingly, the connection between the two non-canonical helices is made by helix 69 of 23S rRNA (SEQ ID NO: 23), which not only interacts via its hairpin loop to the decoding site of 16S rRNA (SEQ ID NO: 45), but simultaneously interacts with the D stems of both the A- and P- tRNAs (FIG. 12C), suggesting a possible structural basis for coupling mRNA and tRNA translocation.
In this example, we demonstrate how biochemical footprinting and structural information about the ribosome may be used to facilitate the docking of functionally significant molecules on the ribosome structure to identify and characterize a ribosome target site. While the example describes the docking of translation initiation factor 3 (IF3), the results may be generalized to any molecule that can be bound by the ribosome. The information derived from the docking can be used to identify one or more target sites for disrupting the interaction between the ribosome and a ligand such as IF3. Identification and characterization of a ribosome target site structure, informed by the docked structure to provide information as to the three-dimensional shape and charge distribution of the site, allows one of ordinary skill to design other molecules that can occupy the target site. If binding of the ligand is necessary for proper ribosome function, a molecule designed to disrupt or prevent the ribosome-ligand binding interaction can inhibit protein translation. Such molecules have utility as antibiotics, preservatives, and as agents to further define the biochemical mechanisms of ribosome function.
In this example we show how to use hydroxyl radical footprinting and directed probing from Fe(II) derivatized IF3 to map the interaction of IF3 (SEQ ID NOS: 53 and 54) relative to 16S rRNA (SEQ ID NO: 45) and tRNAMetf in the 30S ribosomal subunit. Our results place the two domains of IF3 (SEQ ID NOS: 53 and 54) on opposite sides of the initiator tRNA with the C-domain at the platform interface, and the N-domain at the E site. The C-domain coincides with the location of helix 69 of 23S rRNA (SEQ ID NO: 23), explaining the ability of IF3 (SEQ ID NOS: 53 and 54) to block subunit association. The N-domain neighbors proteins S7 (SEQ ID NO: 30) and S 11 (SEQ ID NO: 34) and may interfere with E-site tRNA binding. Our model suggests that IF3 influences initiator tRNA selection indirectly.
Introduction
During initiation, the ribosome must select the correct reading frame for translation of messenger RNA. The triplet codon start signal of the message must be identified and aligned in the P site of the 30S subunit so that it basepairs with the anticodon of initiator tRNA. A complex is formed between the small ribosomal subunit, the initiator tRNA in the P site and the mRNA before the large subunit can bind and protein synthesis can begin (Gualerzi and Pon, 1990; Gualerzi et al. 2000). Both prokaryotes and eukaryotes require multiple protein factors in order to form the intermediates in this pathway although there are significant differences in the factors involved and the intermediates formed. Initiation is the rate-limiting step of translation and is the stage where translational regulation most often occurs (Sonenberg et al. 2000).
Three protein factors, IF1, IF2, and IF3, in addition to GTP co-factor are required for proper initiation in bacteria (Gualerzi and Pon, 1990). IF2, a GTPase, stimulates the binding of initiator tRNA to the P site of the 30S subunit (Canonaco et al. 1986). Chemical footprinting studies showed that IF1 protects nucleotides that are protected by tRNA bound to the A site of the 30S subunit, leading to the hypothesis that IF1 blocks binding of tRNA to the A site during initiation (Moazed et al. 1995). A recent crystal structure of IF1 bound to the 30S subunit reveals that IF1 does occupy the 30S A site (Carter et al. 2001).
Several activities have been ascribed to IF3 during initiation. IF3 dissociates 70S ribosomes by binding preferentially to 30S subunits, making them available for initiation (Subramanian and Davis, 1970; Grunberg-Manago et al. 1975). IF3 also increases the accuracy of initiator tRNA selection both in vivo and in vitro (Risuleo et al. 1976; Hartz et al. 1989; Sussman et al. 1996; Meinnel et al. 1999; Sacerdot et al. 1999). Recently, a role for IF3 in the recycling of subunits was proposed since IF3 was observed to enhance the dissociation of deacylated tRNAs from post-termination complexes (Karimi et al. 1999). T he mechanisms by which IF3 accomplishes these functions are not well understood.
IF3 is a two-domain, 20 kD protein, whose N-terminal and C-terminal domain structures have been determined by both x-ray crystallography and NMR (Biou et al. 1995; Garcia et al. 1995a; Garcia et al. 1995b). The N-domain has an α/β-fold and is connected to the C-domain by an extended α-helical element rich in basic and aromatic residues. This linker helix is partially disordered in both the crystal and the NMR structures but to different extents. Dynamics studies of the intact, full-length protein by NMR support the notion that the linker is flexible in solution (Moreau et al. 1997). The C-domain of IF3 folds into a classical RNA binding domain consisting of a four-stranded (β-sheet backed by two α-helices.
The site of interaction of IF3 with the 30S subunit has been studied using many approaches, sometimes yielding conflicting results. Immunoelectron microscopy located IF3 at the cleft of the 30S subunit (Stöffler and Stöffler-Meilicke, 1984). IF3 has been crosslinked to small subunit proteins S7 (SEQ ID NO: 30), S11 (SEQ ID NO: 34), S12 (SEQ ID NO: 35), S13 (SEQ ID NO: 36), S18 (SEQ ID NO: 41), S19 (SEQ ID NO: 42), and S21 (SEQ ID NO: XX), a set of proteins that is distributed over a broad area of the 30S subunit (Cooperman et al. 1977; MacKeen et al. 1980; Cooperman et al. 1981; Boileau et al. 1983). IF3 has also been crosslinked to helices 26 and 45 of 16S rRNA (SEQ ID NO: 45) in the central and 3′-minor domains of the 30S subunit, respectively (Ehresmann et al. 1986). Chemical footprints using kethoxal, DMS, and CMCT were found in helices 23 and 24 of the central domain of 16S rRNA (Muralikrishna et al. 1989; Moazed et al. 1995). An NMR study indicated that IF3 interacts with a fragment of the 3′-end of 16S rRNA containing residues 1495–1542 (Wickstrom et al. 1986). Cryo-electron microscopy (cryo-EM) reconstruction localized the C-terminal domain of IF3 at the interface side of the small subunit (McCutcheon et al. 1999). In contrast, a recent crystallographic analysis of the C-domain of IF3 soaked into crystals of the Thermus thermophilus (Tth) 30S subunit revealed a binding site for the C-terminal domain on the opposite face of the 30S subunit (Pioletti et al. 2001).
Here we describe an independent approach to localize the binding site of IF3 (SEQ ID NOS: 53 and 54) on the 30S ribosomal subunit with respect to 16S rRNA (SEQ ID NO: 45), using a combination of hydroxyl radical footprinting and directed hydroxyl radical probing. Directed probing was carried out from Fe(II) tethered to 14 different positions on the surface of IF3. Sites of directed cleavage of 16S rRNA and the initiator tRNA, together with the footprinting data provided sufficient constraints to model the positions of the N- and C-domains of IF3 in the crystallographically-determined structure of the 30S subunit (Schluenzen et al. 2000; Wimberly et al 2000; Yusupov et al. 2001). Our findings explain the subunit dissociation activity of IF3, and provide clues to its other biological roles.
Experimental Procedures
Preparation of Mutant Derivatives of IF3
The gene encoding IF3 was amplified from MRE600 genomic DNA by PCR using primers that contained restriction sites for convenient cloning and that also changed the non-canonical, unique AUU start codon of IF3 to AUG to promote efficient overexpression. The PCR product was subcloned into pET-24b (Novagen) resulting in recombinant IF3 containing a C-terminal His6-Tag (SEQ ID NO: 125) for rapid purification. A cysteine-free variant of IF3 for a use as a control in probing experiments was produced by site-directed mutagenesis (Kunkel et al. 1987) where the single occurring natural cysteine residue at position 65 was mutated to alanine, a substitution tolerated in phylogenetic alignments of IF3s from various species. Single cysteine residues were introduced by site-directed mutagenesis at fifteen different positions on the surface of IF3 at sites that were not absolutely conserved and were located on the surface of the protein (R11, Q22, E44, A49, E76, K79, S80, S81, K97, E104, K123, M135, Q138, M142, and Q180). Wild-type and mutant constructs were over-expressed in E. coli BL21 (DE3) after inducing mid-log cells to over-express for 3 hours after addition of 1 mM IPTG.
Cells were resuspended in buffer containing 100 mM NaCl, 100 mM Tris-Cl, pH 7.5 and lysed by freezing and thawing in the presence of lysozyme. The cell lysate was centrifuged for 15 minutes at 10,000 rpm in a JA-20 rotor, and the supernatant transferred to Ni-NTA agarose resin (Qiagen) that had been pre-equilibrated with resuspension buffer. The resin was then extensively washed with high-salt buffer containing 1 M NaCl, 100 mM Tris-Cl, 10% glycerol, and 6 mM β-ME. IF3 was then eluted with 500 mM imidazole and dialyzed against three changes of storage buffer containing 122 mM NH4Cl, 80 mM K+ Cacodylate, 10 mM MgCl2, 1 mM DTT, pH 7.2. The protein concentration was estimated by Bradford assay. The purified proteins were flash-frozen and stored in aliquots at −80° C. IF3 derivatives purified in this manner were judged greater than 95% pure by Coomassie blue-stained SDS-PAGE.
mRNA and tRNA
A synthetic 36-nucleotide T4 gene32 mRNA derivative was purchased from Dharmacon, with sequence 5 ′-GGCAAGGAGGUAAAAAUGUUUAAACGUAAAUCUACU-3′ SEQ ID NO:50). E. coli tRNAMecf was purchased from Sigma. mRNA and tRNA were purified on 18% and 10% polyacrylamide denaturing gels, respectively. tRNA was treated with calf-intestinal alkaline phosphatase (Boehringer-Mannheim) and subsequently 5′-end-labeled with [32P]-y,-ATP (ICN). tRNA was gel-purified again and renatured in buffer containing 10 mM MgC12 and 75 mM Tris-Cl, pH 7.5 at 55° C. for 3 minutes, followed by slow cooling to room temperature.
Initiation Complex Formation
Complexes of IF3 bound to 30 subunits were prepared as described (Moazed et al. 1995). Typically, 30S subunits (prepared as described in Moazed et al. (1986a) at a concentration of 0.4 μM were heat activated in buffer containing 122 mM NH4Cl, 80 mM K+ Cacodylate, 10 mM MgCl2, and 1 mM DTT, pH 7.2 at 42° C. for 15 minutes. Purified IF3 was added to a final concentration of 4 μM and incubated for 5 minutes at 37° C. followed by 30 minutes at room temperature.
Kethoxal and Solution Fe(II)-EFTA Footprinting of IF3
Complexes of IF3 bound to 30S subunits were probed with kethoxal as follows. 40 pmol of 30S subunits were incubated with a ten-fold molar excess of IF3 in a 100 μL reaction volume. Control samples of 30S subunits alone were treated identically to those containing IF3. Kethoxal modification was performed as described (Moazed et al. 1986a), where 4 μL of 37 mg/mL kethoxal was added to each sample and incubated at 37° C. for 8 minutes. Samples were then adjusted to 25 mM potassium borate and precipitated with ethanol. Hydroxyl radical footprinting experiments were performed as described (Powers and Noller, 1995) except that the final concentrations of probing reagents added to each reaction were as follows: 1 mM Fe(NH4)(SO4)2–6H2O, 2 mM EDTA, 5 mM ascorbic acid, and 0.05% H2O2. Reactions were incubated for 10 minutes on ice, quenched with an equal volume of 7.6 mg/mL thiourea, and ethanol precipitated. In both the kethoxal and hydroxyl radical footprinting experiments, the rRNA was extracted and the sites of protection from modification were identified by primer extension as described (Stem et al. 1988b).
Preparation of Fe(II)-BABE-derivatized IF3
Conjugation of Fe(I)-BABE to cysteine-containing mutants of IF3 was performed essentially as described (Culver and Noller, 2000). 2–6 mnol of each IF3 derivative were incubated with 100 nmol Fe(II) BABE in 100 μL buffer containing 122 mM NH4Cl, 80 mM K+ Cacodylate, 10 mM MgCl2, 1 mM DTT, pH 7.2 at 37° C. for 30 minutes. Free Fe(II)-BABE was separated from derivatized protein on Microcon-10 microconcentrators using multiple washes with the incubation buffer. A mock modification reaction was also performed on the cysteine-free IF3 mutant as a control.
Directed Hydroxyl Radical Probing
IF3–30S complexes containing Fe(II) conjugated IF3 were formed as described above. Free, excess IF3 was removed by centrifuging the complex in a microcon-100 microconcentrator and washed by spinning through an additional 500 microliters of buffer. The isolated IF3–30S complexes were brought to 100 microliters and probed by initiating hydroxyl radical formation with 0.025% H2O2 and 5 mM ascorbic acid. The reactions were incubated on ice for 10 minutes and quenched with 20 mM thiourea. 16S rRNA was extracted and analyzed by primer extension as described (Stem et al. 1988b). Cleavage intensities were assigned as strong, medium, or weak according to the intensity of each band relative to control sequencing bands as described (Joseph et al. 1997).
For directed probing of initiator tRNA, 10 pmol of heat-activated 30S subunits were coincubated in 25 microliters with 20 pmol mRNA, 1 pmol 5′ end-labeled initiator tRNA, and Fe(II) derivatized IF3 for 10 minutes at 37° C. followed by incubation at room temperature for 30 minutes. Unbound mRNA, tRNA and IF3 were removed by spinning in a microcon-100. The complexes were brought up to 25 microliters volume and probed as above. The reactions were ethanol precipitated, and electrophoresed on 15% denaturing PAGE.
Results
Hydroxyl Radical Footprinting
We tested the binding of recombinant wild-type IF3 to the 30S subunit by reproducing its previously determined kethoxal footprint on 16S rRNA (SEQ ID NO: 45) (Moazed et al. 1995). Lanes 3–5 in FIG. 15 (left panel) show that purified, recombinant IF3 protects nucleotides G700 and G703 from modification at N1IN2 by kethoxal. Recombinant IF3 was also able to dissociate tight-couple 70S ribosomes into subunits, by sedimentation analysis (data not shown).
To further define the IF3 binding site, we monitored the protection of the 16S rRNA (SEQ ID NO: 45) sugar-phosphate backbone from hydroxyl radicals generated in solution with free Fe(II)-EDTA in the presence of bound IF3. Since susceptibility of the RNA backbone to hydroxyl radical attack is independent of secondary structure, these data are complementary to protection from chemical probes that specifically modify unpaired base moieties of the RNA. Protection was monitored by primer extension and classified by visual inspection of the autoradiograms (FIGS. 16A and 16B).
Protected nucleotides are clustered in helices 23 and 24 of the central domain of 16S rRNA, which are located at the subunit interface as described above. In helix 23, nucleotides 685–688 and 693–703 are protected (FIG. 16B); in addition, an extensive footprint is observed in helix 24 at positions 774–776, 783–793, 799–802, and 807–810 (FIG. 16A). These nucleotides surround the bases G700, U701, G703, G791, and U793, which are protected by IF3 from attack by kethoxal and CMCT (Muralikrishna et al. 1989; Moazed et al. 1995). The protected nucleotides in helix 24 are staggered in the 3′-direction, suggesting that IF3 interacts with the minor groove of the RNA helix at these positions. The IF3-dependent protection pattern is unchanged when IF1 and IF2 are also present in the 30S complex, except that some of the nucleotides around position 775 appear more strongly protected, indicating that the binding of IF3 is similar in the presence or absence of the other initiation factors (FIG. 16A).
Directed Hydroxyl Radical Probing Experiments of IF3–30S Complexes
After over-expressing, purifying, and Fe(II) BABE-derivatizing cysteine-free and single-cysteine-containing IF3 variants, we tested the ability of these derivatized proteins to bind normally to 30S subunits and to promote dissociation of ribosomes. FIG. 15 shows that all of the proteins were able to protect nucleotides G700 and G703 from kethoxal modification with the exception of the Fe-C79 construct. Likewise, all except Fe-C79 were able to dissociate ribosomes into subunits as judged by sedimentation analysis (data not shown). Therefore, Fe-C79 was excluded from subsequent probing experiments. The positions of derivatization of IF3 with Fe(II)-BABE are shown in FIG. 17A.
Directed hydroxyl radical probing of Fe(II)-IF3–30S complexes was performed and scored as described in the Experimental Procedures. While the footprint is tightly localized to the 690 and 790 stem-loops in the platform, hydroxyl radicals generated from Fe(II) tethered to six of the 15 positions tested cleave three of the four domains of 16S rRNA (FIGS. 17B and 17C). Although the cleavage targets are widely distributed in the secondary structure, they are localized to an area that lines the cleft, including elements of the platform, penultimate stem, and head of the 30S subunit.
When hydroxyl radicals are generated from Fe(II) tethered to the C-terminal half of IF3, the most intense cleavages occur in the 790 loop and in the top of the penultimate stem at the subunit interface. Hydroxyl radicals generated from Fe(II) tethered to position 97, in the first (β-strand of the C-domain, and to a lesser extent position 135, in the loop connecting (β-strand 2 and α-helix 2, cleave 16S rRNA in the 690 and 790 loops and nucleotides in the 925, 1228, 1338, and 1400 regions. These features of 16S rRNA surround the P site (Moazed et al. 1990; Yusupov et al. 2001; see above). These two probing positions also cleave nucleotides at the top of the penultimate stem near the decoding site. Fe(II) tethered to position 104, at the beginning of the helix 1 of the C-domain, weakly cleaves residues 1482–1487 in the penultimate stem (FIGS. 17B and 17C).
The 690 and 790 stem-loops are also cleaved by Fe(II) tethered to positions 76 and 80 in the helical linker. The patterns of cleavage from these two probing sites are almost identical, producing their strongest hits at nucleotides 699–705 (FIG. 17B). In the globular portion of the N-domain, only the probe tethered to position 11 cleaved 16S rRNA, at the apex of the 690 loop (FIG. 17B). In the crystal structure of the N-domain of IF3 from Bacillus stearothermophilus, the residue that corresponds to E. coli position 11 resides in an extended loop that runs parallel to the linker region between the N- and C-domains. Thus, this residue, while at the N-terminus of IF3, is actually directed toward the C-domain (FIG. 17A). Probes at positions 22, 44, 49, and 65 fail to cleave 16S rRNA.
Directed Hydroxyl Radical Probing of Initiator tRNA Bound to the 30S P Site
To constrain the orientation of IF3 with respect to P site-bound initiator tRNA, cleavage of the tRNA backbone was examined by directed probing of 30S subunit complexes containing 32P-end-labeled initiator tRNA, mRNA, and Fe(II)-IF3. Three of the tethered Fe(II)-IF3 probes cleave the backbone of initiator tRNA bound to the 30S subunit P site, at characteristically different positions (FIG. 18). The probe at position 135 cleaves nucleotides 26–29 and 35–37 at the junction between the anticodon stem and the D stem and the anticodon of the initiator tRNA, respectively. The probes at positions 76 and 80 cleave the tRNAMetf at nucleotides 3–5 and 13–24 in the D loop. The C-domain probe (135) and the linker probes (76 and 80) cleave nucleotides on opposite faces of the tRNA, indicating that the two domains of IF3 are positioned on opposite sides of the tRNA.
Modeling the IF3–30S Subunit Interaction
We modeled the position and orientation of IF3 to maximally satisfy the biochemical constraints from directed hydroxyl probing and footprinting in the context of the three-dimensional structure of the 30S subunit. While the probing and footprinting experiments were performed with full-length IF3, each domain of IF3 was modeled individually, since the structures of the N- and C-domains were solved separately.
The strongest cleavages using Fe-BABE-derivatized IF3 are from Fe-C97 at the top of the 790 loop and the top of the penultimate stem, clearly indicating the proximity of the C-domain to this region of 16S rRNA and to the interface side of the 30S subunit. Accordingly, we have modeled the C-domain bound directly to the interface surface of the platform of the 30S subunit, effectively covering the hydroxyl radical footprint of IF3 on 16S rRNA (FIG. 19). This interpretation is supported by analysis of the recent crystal structures of the ribosome (Wimberly et al. 2000; Yusupov et al. 2001; see above), which show that the overwhelming majority of hydroxyl radical footprints of the small subunit proteins on 16S rRNA (Powers et al. 1995) reflect direct protein-rRNA interaction rather than indirect protection induced by conformational changes.
The Fe-C97 and Fe-Cl 35 probes cleave nucleotides in the head of the 30S subunit with medium to weak intensity, and so we have oriented these residues in the C-domain to face across the cleft toward the head in the direction of the 30S A site (FIG. 19C). The orientation and position of the C-domain of IF3 were further constrained by avoidance of steric clash with the P-site-bound tRNA that is present in the 5.5A ribosome structure. In this orientation, α-helix 1 of the C-domain interacts with the minor groove of 16S rRNA helix 24. Mutation of lysine-110 to leucine in a-helix 1 virtually abolishes binding of IF3 to 30S subunits, consistent with our placement (De Bellis et al. 1992).
A consequence of this orientation of the C-domain is that residue M135 of the C-domain faces the anticodon loop of P site-bound tRNA, consistent with the observed cleavage of the initiator tRNA anticodon by Fe-C 135. Although this orientation of the C-domain of IF3 maximizes agreement with the cleavage data, the distances between some of the probing positions and their targets in the 3′ major domain are nevertheless, farther than predicted from their cleavage intensities, as discussed below.
The N-terminal half of IF3 contains the highly conserved linker region that is rich in basic and aromatic residues. Since the cleavage data from this half of the factor are dominated by hits coming from the linker region, our first step in docking the N-terminal half of IF3 was to position the linker. Probes in the linker region cleave the middle and lower portions of the 690- and 790-stems, and so it was modeled as spanning this region of the platform (FIG. 19C).
Placement of the globular portion of the N-domain is less certain since most of the probes from that domain failed to cleave 16S rRNA. The position shown in FIG. 19C, largely constrained by the position of the linker, is consistent with the cleavages that were obtained from position 11, the lone N-terminal probing site that cleaved 16S rRNA. This arrangement wedges the globular portion of the N-domain between ribosomal proteins S7 (SEQ ID NO: 30) and S11 (SEQ ID NO: 34), both of which have been crosslinked to IF3 (MacKeen et al. 1980; Boileau et al. 1983). Placement of the N-domain in a protein-rich environment accounts for the absence of hits from the N-terminal probes at positions 22, 44, 49, and 65, although this was not explicitly used as a modeling constraint.
Whereas IF1 overlaps the A site of the 30S subunit during initiation, in our model the N- and C-domains of IF3 lie on opposite faces of the initiator tRNA (FIGS. 20A and 20B), placing the N-domain at the E site. Additional support for this arrangement comes from cleavage of the D loop of initiator tRNA from Fe(II) tethered to position 76 in the linker region of IF3 (FIG. 20B). Solution scattering studies indicate that the two domains of IF3 do not interact with one another (Kycia et al. 1995), in agreement with our findings, which also support an extended conformation for IF3. A caveat is that we cannot say how our model would be affected by conformational changes that may occur in IF3 or in the 30S subunit when they interact, such as the ones observed in a cryo-EM study (McCutcheon et al. 1999).
Discussion
In our model, the C-domain of IF3 interacts with helices 23, 24, and 45 at the interface surface of the platform, a placement that is supported by extensive biochemical and biophysical studies. Immunoelectron microscopy localized IF3 on the interface surface of the 30S subunit (Stöffler and Stöffler-Meilicke, 1984). Nucleotides G700, U701, G703, G791, and U793, which are located at the interface of the small subunit, are protected from kethoxal and CMCT modification (Muralikrishna and Wickstrom, 1989; Moazed et al. 1995). Additionally, mutation of G791 to A reduces the binding affinity of IF3 for the 30S subunit by ten-fold (Tapprich et al. 1989). A crosslink between helix 45 and IF3 is also in agreement with contact between helix 45 and the C-domain in our model (Ehresmann et al. 1986). In another study, binding of IF3 to the 30S subunit interrupted an intramolecular crosslink between U793 (in helix 24) and G1517 (in helix 45) (Shapkina et al. 2000). A recent cryo-EM study of IF3 with the 30S subunit identified electron density of the same dimensions as the C-domain at the interface side of the platform (McCutcheon et al. 1999). In addition, a deletion mutant of IF3 that contains only the C-domain produces a hydroxyl radical footprint on helices 23 and 24 that is identical to that of full-length IF3 (A. D. and HEN., unpublished results).
While our positioning of the C-domain agrees with the 27 Å cryo-EM study (McCutcheon et al. 1999), positioning of the N-domain differs. In the cryo-EM study, three regions of positive difference density and one region of negative difference density were identified. The N-domain was fit into the positive difference density that spanned from the platform to the neck of the 30S subunit, while the remaining difference density was attributed to conformational changes that occurred upon IF3 binding. Our data more closely fit location of the N-domain at the unassigned region of positive density that is contiguous with the platform. We would then ascribe the remaining lobes of positive and negative difference density to a conformational change in the 30S subunit in which the head of the 30S subunit pivots from the direction of the A site toward the P site. This movement would bring some of the nucleotides cleaved in the head closer to the C-domain, helping to reconcile the discrepancy between the observed intensities of the cleavages and the probe-target distances from positions Fe-C97 and Fe-C135.
While our model for IF3 is in agreement with the cryo-EM data, our position for the C-domain of IF3 differs substantially from a recently reported analysis of crystals of 30S subunits that were soaked with the C-domain of IF3 (Pioletti et al. 2001). Pioletti et al. place the C-domain on the opposite surface of the 30S subunit, interacting with the solvent face of helix 23 as well as helix 26. Neither our footprinting data nor our directed probing data can be reconciled with this placement of the C-domain. This discrepancy can be explained by the fact that the interface surface of the platform, which we propose is the binding site for the C-domain, coincides with crystal contacts in the Tth 30S crystals (Schluenzen et al. 2000; Wimberly et al. 2000). In fact, this is the same region where the “spur” helix from the body of a neighboring 30S subunit binds to the P site, mimicking a tRNA anticodon stem-loop (Carter et al. 2000). Thus, we would expect that the C-domain of IF3 would be unable to bind to the location that we have proposed without disrupting the crystal packing. Given the documented propensity of IF3 for non specific binding (Sabol and Ochoa, 1974; Wickstrom, 1981) and in light of the abundant biochemical and biophysical evidence that IF3 interacts at the interface of the 30S subunit, it is possible that what was observed in the crystallographic study represents a secondary binding site.
Our model offers an explanation for the dissociation activity of IF3 in translation initiation. There is significant overlap between nucleotides protected by IF3 and those that are protected upon formation of the 70S ribosome (Merryman et al. 1999). Although the mass of IF3 is less than two percent of the mass of the 50S subunit, it would prevent access of 50S subunits to an extensive area comprising the intersubunit bridges B2b, B2c, and B7a (Cate et al. 1999; Yusupov et al. 2001; see above), consistent with proposals by McCutcheon et al. (1999) and Gualerzi et al. (2000). The position of the C-domain of IF3 coincides with that of helix 69 of 23S rRNA (SEQ ID NO: 23), the main large subunit component of bridge B2b (Yusupov et al. 2001; see above)(FIG. 20). Thus, IF3 may prevent subunit association by mimicking this 23S rRNA helix. That the isolated C-domain is itself capable of promoting subunit dissociation (Garcia et al. 1995b) and footprints the contact site of helix 69 supports this scheme. This mechanism contrasts with that of Pioletti et al, who propose that IF3 indirectly affects subunit interaction, despite the fact that they do not report any structural changes in the 16S rRNA regions involved in inter-subunit contact (Pioletti et al. 2001).
Our model also constrains the possible ways in which IF3 may promote initiator tRNA selection (Risuleo et al. 1976; Hartz et al 1989). It has been shown that the main discriminatory feature of the initiator tRNA is a series of three conserved G-C base pairs (nucleotides 29–31 and 39–41) adjacent to the anticodon loop, reviewed in (Mangroo et al. 1995). According to our model, IF3 would be out of reach of this feature of tRNA, suggesting that its role in promoting tRNA discrimination is indirect. In the co-crystal structure of the 70S ribosome bound with initiator tRNA, nucleotides G1338 and A1339 in the head of the 30S subunit are juxtaposed with the minor groove surface of exactly this region of the anticodon stem of initiator tRNA (Yusupov et al. 2001; see above). A possible mechanism is that the proposed IF3-dependent tilting of the head toward the platform inferred from the cryo-EM study moves these two bases of 16S rRNA into intimate contact with the minor groove of the anticodon stem of tRNAM″f, where they may perform a steric check of the tRNA identity. Such a scheme would be analogous to the mechanism proposed by Ogle and colleagues for aminoacyl-tRNA discrimination, which involves minor groove recognition (Ogle et al. 2001).
Several studies have suggested that the mRNA rearranges on the 30S subunit when initiation factors are present (Canonaco et al. 1989; La Teana et al. 1995). Interestingly, the position of the 3′-end of 16S rRNA differs between the crystal structure of the isolated 30S subunit and that of the 70S ribosome with P site tRNA and mRNA bound (Carter et al. 2000; Wimberly et al. 2000; Yusupov et al. 2001; see above). Interaction of IF3 with the 3′ terminal stem-loop of 16S rRNA could promote movement of the 3′ end of 16S rRNA out of the P and E sites as observed in the 30S crystal structure to make it available for binding the Shine-Dalgamo sequence of the mRNA.
Finally, there is steric clash between the position of the N-domain of IF3 and that of E-tRNA. Thus, an additional role of IF3 could be to exclude tRNA from the 30S E site during initiation. Since IF3 has been crosslinked to IF2 (Boileau et al. 1983) and IF2 also promotes the selection of initiator tRNA, it is possible that the N-domain of IF3 might interact with IF2 prior to joining with the 50S subunit. The availability of extensive structural information for the ribosome and its ligands now makes it possible to directly test these and other proposals for the mechanisms of IF3 activity during initiation.
The structure coordinates of the 70S ribosome, or portions thereof are useful for designing structural features of the 70S ribosome that can be targeted to inhibit or activate ribosome function. The following regions of the 70S ribosome, defined by the structure coordinates, represent particularly useful targets for the development of inhibitory or activating compounds.
One approach to developing inhibitors or activators specific to prokaryotic ribosome target sites is to select target regions based on phylogenetically diverse regions found in the primary structures of prokaryotic and eukaryotic ribosome components and to determine, by way of mapping these regions onto the instant 5.5A 70S structure, which phylogenetically diverse regions are contained in parts of the ribosome likely to disrupt ribosome function when perturbed. Phylogenetically diverse regions can be located in the primary structures of these components by going to a protein or a nucleic acid sequence database and carrying out sequence comparisons between related sequences from different organisms using well-known sequence alignment tools such as BLAST. Carl Woese of the University of Illinois has compiled such sequence comparisons as part of a ribosomal database project (www.cme.msu.edu/RDP/html/index.html). Such databases are useful to locate nonconserved regions of 23S, L2, L5, L14, and L19, 16S,S13, and S15. Representative alignments are set forth in Table I.
Of course, there are instances in which prokaryotic or eukaryotic specificity is not needed. In such instances, a phylogenetically diverse region need not be identified.
Interface interactions provide structure regions useful for pharmacophore or candidate compound design of agents that disrupt or enhance the strength of interaction between the 30S and 50S subunits. By comparing the Ban et al. 2000 2.4 Angstrom 50S structure to the instant 50S structure, differences between the two are readily determined that provide clues as to the conformational changes occurring in the 50S structure upon binding to the 70S subunit. These conformational differences are described above. Several approaches for target selection may be used.
One approach is to target interface or bridge regions while the subunits are apart. The other is to target regions accessible to small molecules when the subunits are together. Ribosomes exist within an organism as dissociated 30S and 50S subunits that come together during protein translation and then again separate at the end of the translation process. Any and all bridge regions are good targets for disrupting the association between 30S and 50S. Especially good targets are those found in the aforementioned phylogenetically different regions of 50S ribosome structure as between host and pathogen. These regions can be readily deduced by sequence comparisons among different rRNAS contained within 50S (interface components of 50S contain parts of 23S rRNA and parts of ribosomal proteins L2, L5, L14, and L19). 30S bridge component are comprised of 16S rRNA and parts of proteins S13 and S15. The regions of the structure involved in making bridge contacts between the subunits are set forth in Table III.
Regions of the 70S ribosome involved in binding the A site, P site, and E site tRNAs, as set forth in Table IV also may be used in target site selection.
Regions of the 70S ribosome that contact the mRNA also provide potential target sites for developing pharmacophores and candidate compounds to affect protein translation. These include those elements of the structure containing protein S3 residues 156–163; 127–132; protein S4 residues 47–52; protein S5 residues 9–30 and 46–56; 16S rRNA residues 13–17; 528–532; 1194–1198; and 1054–1056.
The Shine-Dalgamo helix (formed between the −10 region of mRNA and the 3′-terminus of 16S rRNA during initiation of translation), is absent in both cytoplasmic and mitochondrial human ribosomes, but is present in all pathogens (such as bacteria). The portion of the 16S rRNA that forms the Shine Dalgamo helix portion, as described above, therefore provides a good target site. Upon binding of mRNA a conformational shift occurs in the 30S portion of the ribosome structure. The tail of the 16S rRNA base pairs with the Shine Dalgamo sequence of the mRNA, and that helix then binds to a Shine Dalgarno binding pocket on the solvent side of the “platform” of the 30S ribosome subunit. We compared our 70S structure to the isolated 30S structure (Wimberly, et al. 2000; PDB id 1FJF) to locate the Shine Dalgarno binding pocket. The pocket also provides a target site, and is defined by regions of the structure containing the following elements: protein S11, residues 85–90; 112–129; 22–27; protein S18, residues 1–24; 16S helix 20, helix 28, helix 37, helix 45 and bulge loop 723 (including 16S residues 927–931; 1388–1393; 1526–1529; 1505–1508; and 719–724).
Additional target sites include binding sites for ribosome binding factors such as IF3, the docking of which is described above, the binding sites of EF-Tu and EF-G, and regions of the 50S subunit implicated in the GTPase and factor-related functions. These include the SRL (sarcin ricin loop, see FIG. 2 and L11). These two sites interact with EF-Tu and EF-G. Structures of EF-Tu are reported by Kjeldgaard, et al. Structure 15, 35 (1993) (PDB 1EFT, 847, ITTT; 5401, ITUI; 6200, IEFC; 9879) and by Czworkowski et al. EMBO J 13, 3661 (PDB IEFG; 845, IDAR; 4586, IELO; 4920, 2EFG; 12085, IFNM; 14532, and by Liljas (al-Karadaghi, et al. Structure 4, 555 (PDB 2EFG; 12085, 1FNM; 14532. )
We have docked these structures, using the techniques described above to the 70S structure based on the following criteria: (1) steric fit of EF-G to 70S; (2) footprinting of these factors onto 23S RNA (Moazed et al. 1988); and directed hydroxyl radical probing (Wilson et al., ‘Mapping the position of translational elongation factor EF-G in the ribosome by directed hydroxyl radical probing.’ Cell (1998) 92(l):131–9). Based on the novel 70S structure and known high resolution structures of the elongation factors and the additional information detailed above EF-Tu and EF-G can be accurately docked into the 70S structure to provide a template for designing small molecules that will interfere with the ribosomal GTPase activity and consequently protein synthesis.
Our docking studies indicate the EF-Tu contacts to be on 23S rRNA residues 2651–2665, 16S rRNA residues 54–57, and 357–361, and L11 residues 20–36. The EF-G contacts are found at 23S rRNA residues 1065–1069, 1094–1097, and 2651–2665, 16S rRNA residues 54–57, 340–345 and 357–361 and at L11 residues 20–36.
Accurate docking of EF-Tu and EF-G was not possible with prior art ribosome structures such as the 50S Ban et al. (2000) structure which resolves the SRL loop but not L11, which is disordered in the 50S structure. L11 density is observable in the instant 5.5 Å structure and high resolution geometry can be deduced according to the fitting methods using high resolution structure of L11 and L11 RNA (Conn G L, Draper D E, Lattman E E, Gittis A G. Science. May 14, 1999;284(5417): 1171–4. (1QA6; 10294) and Wimberly B T, Guymon R, McCutcheon J P, White S W, Ramakrishnan V. Cell. May 14, 1999;97(4):491–502. (1EG0; 12626, IMMS; 13236, 487D; 13285) complex fit into the density as described above, and is modeled in the instant structure.
In practice we used the Ramakrishnan L11 structure referenced above to carry out the docking of L11 into the 5.5 Angstrom 70 S structure. Given this newly identified or solved aspect of the 70S ribosome structure and the docking algorithms described above, one of ordinary skill may readily deduce target sites and pharmacophores enabling the preparation of small molecules and other agents that can interfere with the binding of EF-Tu and or EF-G to the ribosome. Such agents are expected to inhibit protein synthesis by inhibiting the ribosome-associated GTPase activity. Antibiotics such as thiostrepton, and micrococcin act at the L11 protein to inhibit protein synthesis. Porse B T, Cundliffe E, Garrett R A. ‘The antibiotic micrococcin acts on protein L11 at the ribosomal GTPase centre.’J Mol Biol. March 19;287(1):33–45 (1999); Biochimie. July-August;73(7–8):1131–5 (1991). These antibiotics can be used as templates to dock onto the 70S structure we have determined, to provide additional information from which other pharmacophores or candidate compounds can be designed to target the L11 region and inhibit the GTPase activity. In this way novel agents can be discovered that will prevent binding of factor(s) to the site.
In addition there are compounds that bind to the elongation factors (as fusidic acid that binds to EF-G) that do not inhibit GTPase but prevents release of EF-G and so it remains bound and block translation by preventing extension of the nascent polypeptide chain. Laurberg M, Kristensen O, Martemyanov K, Gudkov A T, Nagaev I, Hughes D, Liljas A. Structure of a mutant EF-G reveals domain III and possibly the fusidic acid binding site. J Mol Biol. November 3;303(4):593–603 (2000) (1FNM; 14532) These compounds also can be docked into the 70S 5.5 Angstrom structure to design other molecules that will act in a similar manner as fusidic acid to inhibit EF-G release.
Yet other classes of agents can be docked into the 70S 5.5 Angstrom structure for pharmacophore or candidate compound design. For example the GTPase related drug “kirromycin” binds to EF-Tu and prevents conformational change that allows EF-Tu to release from the ribosome and release tRNA.
Agrawal, R. K., et al., (1996) Science 271: 1000–1002.
Agrawal, R. K., et al., (1999a) Curr. Opin. Struct. Biol. 9: 215.
Agrawal, R. K., et al., (1999b) EF-G-dependent GTP hydrolysis induces translocation accompanied by large conformational changes in the 70S ribosome. Nat. Struct. Biol. 6: 643–7.
Agrawal, R. K., et al., (2000) Visualization of tRNA movements on the Escherichia coli 70S ribosome during the elongation cycle. J. Cell Biol. 150: 447–60.
Ahsen, U. v., et al., (1995) Science 267: 234–237.
Alam, S. L., et al., (1999) Programmed ribosomal frameshifting: much ado about knotting! Proc. Natl. Acad. Sci. USA 96: 14177–9.
Balakin, A., et al., (1990) Transition of the mRNA sequence downstream from the initiation codon into a single-stranded conformation is strongly promoted by binding of the initiator tRNA, Biochim. Biophys. Acta. 1050: 119–23.
Ban, N., et al., (1998) Cell 93: 1105–1115.
Ban, N., et al., (1999) Nature 400: 841–847.
Ban, N., et al., (2000) The complete atomic structure of the large ribosomal subunit at 2.4 A resolution, Science 289: 905–20.
Barta, A., (1984) Proc. Natl. Acad. Sci. USA 81: 3607–3611.
Belitsina, N. V., et al., (1981) Template-free ribosomal synthesis of polylysine from lysyl-tRNA, FEBS Lett. 131: 289–92.
Bhangu, R., et al., (1994) Arrangement of messenger RNA on Escherichia coli ribosomes with respect to 10 16S rRNA cross-linking sites, Biochemistry 33: 3063–3070.
Bhangu, R., et al., (1992) The mRNA binding track in the Escherichia coli ribosome for mRNAs of different sequences, Biochemistry 31: 5937–5944.
Biou, V., et al., (1995). X-ray crystallography shows that translational initiation factor IF3 consists of two compact alpha/beta domains linked by an alpha-helix, Embo J 14,4056–64.
Boileau, G. et al., (1983). Direct cross-links between initiation factors 1, 2, and 3 and ribosomal proteins promoted by 2-iminothiolane, Biochemistry 22, 3162–70.
Bretscher, M. S. (1968) Direct translation of a circular messenger DNA, Nature 220: 1088–91.
Brierley, I., et al., (1989) Characterization of an efficient coronavirus ribosomal frameshifting signal: requirement for an RNA pseudoknot, Cell, 57:537–47.
Brimacombe, R., et al., (1988) J. Mol. Biol. 199:115–36.
Brimacombe, R. (1995) The structure of ribosomal mRNA: a three-dimensional jigsaw puzzle, European JouRNAl of Biochem. 230: 365–383.
Brosius, J., et al., (1980) Proc. Natl. Acad. Sci. USA 77: 201–4.
Brunger, A. T., et al., (1998) Crystallography & NMR system: A new software suite for macromolecular structure determination, Acta. Crystallogr. D. Biol. Crystallogr. 54: 905–21.
Canonaco, M. A., et al., (1986). Mechanism of translational initiation in prokaryotes. Evidence for a direct effect of IF2 on the activity of the 30 S ribosomal subunit, FEBS Lett 207:198–204.
Canonaco, M. A., et al, (1989). Alternative occupancy of a dual ribosomal binding site by mRNA affected by translation initiation factors, Eur J Biochem 182: 501–6.
Capel, M. S., et al., (1987) Science 238: 1403–6.
Carson, M. (1997) Ribbons, Methods Enzymol. 277B: 493–505.
Carter, A. P., et al., (2001). Crystal structure of an initiation factor bound to the 30S ribosomal subunit, Science 291, 498–501.
Carter, A. P., et al., (2000). Functional insights from the structure of the 30S ribosomal subunit and its interactions with antibiotics, Nature 407, 340–8.
Cate, J. H., et al., (1999). X-ray crystal structures of 70S ribosome functional complexes, Science 285, 2095–104.
Clemons, W. M., et al., (1999) Nature 400: 833–840.
Cooperman, B. S., et al., (1977). Photosensitized cross-linking of IF-3 to Escherichia coli 30 S subunits, FEBS Lett 76: 59–63.
Cooperman, B. S., et al., (1981). IF-3 crosslinking to Escherichia coli ribosomal 30 S subunits by three different light-dependent procedures: identification of 30 S proteins crosslinked to IF-3-utilization of a new two-stage crosslinking reagent, p-nitrobenzylmaleimide, FEBS Lett 208: 554–62
Correll, C. C., et al., (1997) Cell 91, 705.
Crick, F. H. (1968) The origin of the genetic code, J. Mol. Biol. 38: 367–79.
Culver, G. M., et al., (1999) Science 285: 2133–6.
Culver, G. M., et al., (2000). Directed hydroxyl radical probing of RNA from iron(II) tethered to proteins in ribonucleoprotein complexes, Methods Enzymol 318: 461–75.
Czworkowski, J., et al., (1994) The crystal structure of elongation factor G complexed with GDP, at 2.7 A resolution. Embo. J. 13: 36618.
Dallas, A., et al., (1997) Structure 5: 1639.
De Bellis, D., et al., (1992) Structure-function analysis of Escherichia coli translation initiation factor IF3: tyrosine 107 and lysine 110 are required for ribosome binding, Biochemistry 31: 11984–90.
Dokudovskaya, S. S., et al., (1993) mRNA-ribosome interactions, Biotechnol. Appl. Biochem. 18: 149–55.
Dontsova, O., et al., (1992) Three widely separated positions in the 16S RNA lie in or close to the ribosomal decoding region; a site-directed cross-linking study with mRNA analogues, EMBO J 11: 3105–3116.
Döring, T. et al., (1994) EMBO J 13: 2677–2685.
Ehresmann. C., et al., (1986). Cross-linking of initiation factor IF3 to Escherichia coli 30S ribosomal subunit by trans-diamminedichloro latinum(II): characterization of two cross linking sites in 16S rRNA: a possible wave of functioning for IF3. Nucleic Acids Research 14: 4803–4821.
Feinberg, J., et al., (2001) Identification of molecular interactions between P site tRNA and the ribosome essential for translocation, Proc. Nat. Acad. Sci. 20: 11120–5.
Fourmy, D., (1996) Science 274: 1367–71.
Frank, J., et al., (1995a) A model of protein synthesis based on cryo-electron microscopy of the E. coli ribosome, Nature 376: 441–444.
Frank, J., et al., (1995b) A model of the translational apparatus based on a three-dimensional reconstruction of the Escherichia coli ribosome, Biochem. Cell. Biol. 73: 757–65.
Frank, J., et al., (2000) Nature 406: 318–22.
Gabashvili, I. S., et al., (2000) Solution structure of the E. coli 70S ribosome at 11.5 A resolution, Cell 100: 537–49.
Gabashvili, I. S., et al., (1999) Embo. J. 18: 6501–7.
Garcia, C., et al., (1995a). 1H and 15N resonance assignments and structure of the N-terminal domain of Escherichia coli initiation factor 3, Eur J Biochem 228, 395–402.
Garcia, C., et al., (1995b). Solution structure of the ribosome-binding domain of E. coli translation initiation factor IF3: homology with the UIA protein of the eukaryotic spliceosome, J Mol Biol 254, 247–59.
Gavnlova, L. P., et al., (1976) Factor-free (“non-enzymic”) and factor-dependent systems of translation of polyuridylic acid by Escherichia coli ribosomes, J. Mol. Biol. 101: 537–52.
Gomez-Lorenzo, M. G., et al., (2000) Three-dimensional cryo-electron microscopy localization of EF2 in the Saccharomyces cerevisiae 80S ribosome at 17.5 A resolution, Embo. J. 19: 2710–8.
Gorini, L., (1971) Ribosomal discrimination of tRNAs. Nature 234: 261–264.
Green, R., et al., (1997) Ribosomes and Translation, Annu. Rev. Biochem. 66: 679–716.
Green, R., et al., (1998) Ribosome-catalyzed peptide-bond formation with an A-site substrate covalently linked to 23S ribosomal RNA, Science 280: 286–9.
Greuer, B., et al., (1999) The cross-link from the upstream region of mRNA to ribosomal protein S7 is located in the C-terminal peptide: experimental verification of a prediction from modeling studies. RNA 5: 1521–5.
Grunberg-Manago, M., et al., (1975). Light-scattering studies showing the effect of initiation factors on the reversible dissociation of Escherichia coli ribosomes, J Mol Biol 94, 461–78.
Gualerzi, C., et al., (1977) Initial rate kinetic analysis of the mechanism of initiation complex formation and the role of initiation factor IF-3, Biochemistry 16:1684–9.
Gualerzi, C. O., et al., (1990). Initiation of mRNA translation in prokaryotes, Biochemistry 29, 5881–9.
Gualerzi, C., et al., (2000). in The Ribosome: Structure, Function, Antibiotics, and Cellular Interactions; R. A. Garrett, et al., eds. (Washington D.C., ASM Press).
Guerrier-Takada, C., et al., (1983) The RNA moiety of ribonuclease P is the catalytic subunit of the enzyme, Cell 35: 849–857.
Gutell, R. R., et al., (1993) Nucleic Acids Res. 21: 3055–74.
Gutell, R. R., (1994) Nucleic Acids Res. 22: 3 502–7.
Hansen, H. A., et al., (1990) Biochim. Biophys. Acta. 1050: 1.
Hartz, D., et al., (1989). Selection of the initiator tRNA by Escherichia coli initiation factors, Genes Dev 3, 1899–912.
Hausner, T. P., et al., (1987) Evidence that the G2661 region of 23S rRNA is located at the ribosomal binding sites of both elongation factors, Biochimie 69: 911–23.
Herr, W., et al., (1979) Mechanism of ribosomal subunit association: discrimination of specific sites in 16 S RNA essential for association activity. J. Mo. Biol. 130: 433–49.
Hill, W. E. et al., Eds., (1990) The Ribosome: Structure, Function and Evolution, 123–33, American Society for Microbiology, Washington, D.C., .
Hirsh, D., (1971) J. Mol. Biol. 58: 439–58.
Huttenhofer, A., et al., (1994) Footprinting mRNA-ribosome complexes with chemical probes, EMBO. J. 13: 3892–3901.
Jones, T. A., et al., (1997) Electron-density map interpretation, Methods Enzymol. 277B: 173–208.
Joseph, S., et al., (1996) EMBO. J. 15: 910–16.
Joseph, S., et al., (1997). Mapping the inside of the ribosome with an RNA helical ruler, Science 278,1093–8.
Joseph, S., et al., (2000) Methods Enzymol 318: 175–90.
Juzumiene, D. I., et al., (1995) Distribution of cross-links between mRNA analogues and 16S rRNA in Escherichia coli 70S ribosomes made under equilibrium conditions and their response to tRNA binding, J. Biol. Chem. 270: 12794–12800.
Karimi, R., et al., (1999). Novel roles for classical factors at the interface between translation termination and initiation, Mol Cell 3, 601–9.
Kim, D. F., et al., (1999) Mol. Cell 4: 859–64.
Kruger, K., et al., (1982) Self-splicing RNA: Autoexcision and autocyclization of the ribosomal RNA intervening sequence of Tetrahymena, Cell 31: 147–157.
Kunkel, T. A., et al., (1987). Rapid and efficient site-specific mutagenesis without phenotypic selection, Methods Enzymol 154, 367–82.
Kurland, C. G., et al., (1990) in The Ribosome: structure, function, and evolution, W. E. Hill, Ed. American Society of Microbiology, Washington, D.C. 513–526.
Kycia, J. H., et al., (1995). Prokaryotic translation initiation factor IF3 is an elongated protein consisting of two crystallizable domains, Biochemistry 34, 6183–7.
Lake, J. A., ibid., 180–193.
Lata, K. R., et al., (1996) Three-dimensional reconstruction of the Escherichia coli 30S ribosomal subunit in ice. J. Mol. Biol. 262: 43–52.
La Teana, A., et al., (1995). From stand-by to decoding site. Adjustment of the mRNA on the 30S ribosomal subunit under the influence of the initiation factors, RNA 1, 772–82.
Lieberman, K. R., et al., (2000) J. Mol. Biol. 297: 1129–43.
Lill, R. et al., (1986) Biochemistry 25: 3245–55.
Lodmell, J. S., et al., (1997) Science 277:1262–1267.
MacKeen, L. A., et al., (1980). Photochemical crosslinking of initiation factor-3 to Escherichia coli 30 S ribosomal subunits, J Biol Chem 255, 10526–31.
Makowski, I., et al., (1987) J. Mol. Biol. 193: 819–22.
Malhotra, A., et al., (1998) J. Mol. Biol. 280.
Mandal, N., et al., (1996) Role of the three consecutive G.:C base pairs conserved in the anticodon stem of initiator tRNAs in initiation of protein synthesis in Escherichia coli, RNA 2: 47382.
Mangroo, D., et al., (1995). Escherichia coli initiator tRNA: structure-function relationships and interactions with the translational machinery, Biochem. Cell Biol. 73, 1023–31.
Matheson, A. T., et al., (1995) Biochem. Cell Biol. 73.
McCutcheon, J. P., et al., (1999). Location of translational initiation factor IF3 on the small ribosomal subunit, Proc Natl Acad Sci 96, 430–16.
Meinnel, T., et al., (1999). Discrimination by Escherichia coli initiation factor IF3 against initiation on noncanonical codons relies on complementarity rules, J Mol Biol 290, 825–37.
Merryman, C., et al., (1999a) Nucleotides in 23S rRNA protected by the association of 30S and 50S ribosomal subunts, J. Mol. Biol. 285: 107–13.
Merryman, C., et al., (1999b) Nucleotides in 16S rRNA protected by the association of 30S and 50S ribosomal subunits, J. Mol. Biol. 285: 97–105.
Mitchell, P. et al., (1992) Biochemistry 31: 3004–3011.
Moazed, D., et al., (1986a). Rapid chemical probing of conformation in 16 S ribosomal RNA and 30 S ribosomal subunits using primer extension, J Mol Biol 187,399–416.
Moazed, D., et al., (1986b) Transfer RNA shields specific nucleotides in 16S ribosomal RNA from attack by chemical probes, Cell 47: 985–994.
Moazed, D., et al., (1987) Interaction of antibiotics with functional sites in 16S ribosomal RNA, Nature 327: 389–394.
Moazed, D., et al, (1989a) Cell 57: 585–597.
Moazed, D., et al., (1989b) Nature 342: 142–148.
Moazed, D., et al., (1990). Binding of tRNA to the ribosomal A and P sites protects two distinct sets of nucleotides in 16 S rRNA, J Mol Biol 211, 135–45.
Moazed, D., et al., (1991) Proc. Natl. Acad. Sci. USA 88: 3725–3728.
Moazed, D., et al., (1995). Specific protection of 16 S rRNA by translational initiation factors, J Mol Biol 248, 207–10.
Monro, R. E., (1967) J. Mol. Biol. 26,147.
Moore, P. B., et al., (1998) Annu. Rev. Biophys. Biomol. Struct. 27, 35.
Moreau, M., et al., (1997). Heteronuclear NMR studies of E. coli translation initiation factor IF3. Evidence that the inter-domain region is disordered in solution, J Mol Biol 266,15–22.
Mougel, M., et al., (1987) J. Mol. Biol. 198: 91–107.
Mueller, F., et al., (1995) Biochem. Cell Biochem. 73: 767–773.
Muralikrishna, P., et al., (1989). Escherichia coli initiation factor 3 protein binding to 30S ribosomal subunits alters the accessibility of nucleotides within the conserved central region of 16S rRNA, Biochemistry 28, 7505–10.
Murgola, E. J., et al, (1988) Mutant 16S ribosomal RNA: a codon-specific translational suppressor, Proc. Natl. Acad. Sci. USA 85: 4162–5.
Nikonov, S. V., et al., (1988) Biol. Chem. 379, 795.
Nissen, P., et al., (1995) Crystal structure of the teRNAry complex of Phe-tRNAPhet EF-Tu, and a GTP analog, Science 270: 1464–1472.
Nissen, P., et al., (2000) The structural basis of ribosome activity in peptide bond synthesis, Science 289: 920–30.
Noller, H. F., et al., (1972) Functional modification of 16S ribosomal RNA by kethoxal, Proc. Natl. Acad. Sci. 69: 3113–8.
Noller, H. F., et al, (1981a) Nucleic Acids Res. 9: 6167–89.
Noller, H. F., et al., (1981b) Science 212: 403–11.
Noller, H. F., et al., (1992) Science 256: 1416–1419.
Noller. H. F., et al., (1990) The Ribosome: Structure, Function, and Evolution W. E. Hill et al., Eds. American Society of Microbiology, Washington, D.C. 73–92.
O'Connor, M., et al., (1995) J. Mol. Biol. 254: 838–47.
Ogle, J. M., et al., (2001). Recognition of cognate transfer RNA by the 30S ribosomal subunit, Science 292, 897–902.
Otwinowski, Z. (1993) In Data Collection and Processing, L. Sawyer, et al., Eds. (Warrington, UK: SERC Daresbury Laboratory), pp. 52–62.
Pape, T., et al., (1999) Induced fit in initial selection and proofreading of aminoacyl-tRNA on the ribosome. Embo. J. 18: 3800–7.
Pestka, S., (1967) Studies on the formation of transfer ribonucleic acid-ribosome complexes. II. A possible site on the 50S subunit protecting aminoacyl transfer ribonucleic acid from deacylation. J. Biol. Chem. 242: 4939–47.
Pioletti, M., et al., (2001). Crystal structures of complexes of the small ribosomal subunit with tetracycline, edeine and IF3, Embo J 20, 1829–1839.
Powers, T., et al., (1995). Hydroxyl radical footprinting of ribosomal proteins on 16S rRNA, RNA 1, 194–209.
Powers, T., et al., (1990) Dominant lethal mutations in a conserved loop in 16S rRNA, Proc. Natl. Acad. Sci. 87: 1042–1046.
Prince, J. B., et al., (1982) Covalent crosslinking of tRNA1Val to 16S RNA at the ribosomal P site: identification of crosslinked residues. Proc. Natl. Acad. Sci. USA 79: 5450–4.
Ramakrishnan, V., et al., (1998) Trends Biochem. Sci. 23, 208.
Rheinberger, H., et al., Proc. Natl. Acad. Sci. 78, 5310 (1981).
Rinke-Appel, J., et al., (1993) Site-directed cross-linking of mRNA analogues to 16S ribosomal RNA; a complete scan of cross-links from all positions between ‘+1’ and ‘+16’ on the mRNA, downstream from the decoding site, Nucl. Acids Res. 21: 2853–2859.
Rinke-Appel, J., et al., (1994) Contacts between 16S ribosomal RNA and mRNA, within the spacer region separating the AUG initiator codon and the Shine-Dalgarno sequence; a site-directed cross-linking study, Nucl. Acids Res. 22: 3018–3025.
Risuleo, G., et al., (1976). Specificity and properties of the destabilization, induced by initiation factor IF3 , of ternary complexes of the 30S ribosomal subunit, aminoacyl-tRNA and polynucleotides, European Journal of Biochemistry 67, 603–613.
Ryan, P. C., et al., (1991) J. Mol. Biol. 221: 1257–1268.
Sabol, S., et al., (1974). Preparation of Radioactive Initiation Factor 3, Methods Enzymol 30, 39–44.
Sacerdot, C., et al., (1999). Mutations that alter initiation codon discrimination by Escherichia coli initiation factor IF3, J Mol Biol 288, 803–10.
Samaha, R. R. et al., (1995) Nature 377: 309–14.
Schilling-Bartetzko, S., et al., (1992) J. Biol. Chem. 267: 4693–702.
Schluenzen, F., et al., (2000). Structure of functionally activated small ribosomal subunit at 3.3 angstroms resolution, Cell 102, 615–23.
Schnitzer, W., et a., (1997) Proc. Natl. Acad. Sci. 94: 12823–8.
Semenkov, Y. P., et al., (2000) Energetic contribution of tRNA hybrid state formation to translocation catalysis on the ribosome, Nat. Struct. Biol. 7: 1027–31.
Serdyukl., I., et al., (1992) Biochimie 74: 299–306.
Sergiev, P. V., et al., (1997) The path of mRNA through the bacterial ribosome: a site-directed crosslinking study using new photoreactive derivatives of guanosine and uridine. RNA 3: 464–75.
Shapkina, T. G., et al., (2000). Initiation factor 3-induced structural changes in the 30 S ribosomal subunit and in complexes containing tRNA(f)(Met) and mRNA, J Mol Biol 299, 615–28.
Shatsky, I. N., et al., (1991) How does the mRNA pass through the ribosome? Biochimie 73: 937–45.
Shine, J., et al., (1974) The 3′-terminal sequence of E coli 16S ribosomal RNA complementarity to nonsense triplets and ribosome binding sites. Proc. Nat. Acad. Sci. USA 71: 1342–1346.
Sonenberg, N., et al., (2000). Translational Control of Gene Expression (Cold Spring Harbor, N.Y., CSH Lab Press).
Spirin, A. S. (1969) A model of the functioning ribosome: locking and unlocking of the ribosome subparticles, Cold Spring Harb. Symp. Quant. Biol. 34: 197–207.
Stark, H., et al., (1997a) Visualization of elongation factor Tu on the Escherichia coli ribosome, Nature 389: 403–406.
Steitz, J. A. (1969) Polypeptide chain initiation: nucleotide sequences of the three ribosomal binding sites in bacteriophage R17 RNA, Nature 224: 957–64.
Steitz, J. A., et al., (1975) How ribosomes select initiator regions in mRNA: base pair formation between the 3′ term inns of 16S rRNA and the mRNA during initiation of protein synthesis in Escherichia coli, Proc. Nat. Acad. Sci. USA 72: 4734–8.
Stern, S., (1988a) J. Mol. Biol. 204: 447–481.
Stern, S., et al., (1988b). Structural analysis of RNA using chemical and enzymatic probing monitored by primer extension, Methods Enzymol 164, 481–9.
Stöffler-Meilecke, et al., The Ribosome. Structure, Function and Evolution
Stöffler, G., et al., (1984). Immunoelectron Microscopy of Ribosomes, Annu Rev Biophys Bioeng 13, 303–330.
Subramanian, A. R., et al., (1970). Activity of initiation factor F3 in dissociating Escherichia coli ribosomes, Nature 228, 1273–5.
Sussman, J. K., Simons, E. L., and Simons, R. W. (1996). Escherichia coli translation initiation factor 3 discriminates the initiation codon in vivo, Mol Microbiol 21, 347–60.
Szewczak, A. A., et al., (1995) J. Mol. Biol. 247, 81.
Tapprich, W. E., Goss, D. J., and Dahlberg, A. E. (1989). Mutation at position 791 in Escherichia coli 16S ribosomal RNA affects processes involved in the initiation of protein synthesis, Proc. Natl. Acad. Sci. 86, 4927–31.
Tissieres, A., et al., (1958) Ribunucleoprotein particles from E. coli, Nature 182: 778–780.
Tocilj, A., et al., (1999) Proc. Natl. Acad. Sci. USA 96: 14252–7.
Trakhanov, S., et al., (1987) FEBS Lett. 220: 319.
Trakhanov, S., et al., (1989) J. Mol. Biol. 209: 327–8.
von Ahsen, U., et al., (1995) Identification of bases in 16S rRNA essential for tRNA binding at the 30S ribosomal P site, Science 267: 234–7.
von Bohlen, K., et al., (1991) J. Mol. Biol. 222:11–5.
Watson, J. D., et al., (1964) Bull. Soc. Chim. Biol. 46, 1399.
Welch, M., (1995) Biochem. 34: 385–90.
Wickstrom, E. (1981). Physical parameters of Escherichia coli translational initiation factor 3 binding to poly(A), FEBS Lett 128, 154–6.
Wickstrom, E., et al., (1986). Circular dichroism and 500-MHz proton magnetic resonance studies of the interaction of Escherichia coli translational initiation factor 3 protein with the 16S ribosomal RNA 3′ cloacin fragment, Biochemistry 25, 2770–7.
Wilson, K., et al., (1998) Molecular movement inside the translational engine, Cell 92: 337–349.
Wimberly, B. T., et al., (1999) Cell 97: 491–502.
Wimberly, B. T., et al., (2000). Structure of the 30S ribosomal subunit, Nature 407, 327–39.
Woese, C. R., et al., (1980) Nucleic Acids Res 8: 2275–93.
Yarus, M., et al., (1995) tRNA: Structure, biosynthesis and function, D. Söll, et al., Eds. American Society for Microbiology, Washington, D.C. 20005, pp. 443–469.
Yonath, A., et al., (1980) Biochem. Int. 1: 428.
Yoshizawa, S., et al., (1999) Recognition of the codon-anticodon helix by ribosomal RNA, Science 285: 1722–5.
Yusupov, M. M., et al., (1987) Interaction of antibiotics with functional sites in 16S ribosomal RNA, Nature 327: 389–394.
Yusupov, M. M., et al., (1989) Intermediate states in the movement of transfer RNA in the ribosome, Nature 342: 142–148.
Yusupov, M. M., et al., (1990) Binding of tRNA to the ribosomal A and P sites protects two distinct sets of nucleotides in 16S rRNA, J. Mol. Biol. 211: 135–145.
Yusupov, M. M., et al., (1991) Biochimie 73: 887–97.
Yusupov, M. M., et al., (1994) Collaborative Computing Project Number 4, Acta Crystallogr. D50: 760–763.
Yusupov, M. M., et al., (2001) Crystal Structure of the Ribosome at 5.5 A Resolution, Science 292, 883–896.
Yusupova, G. Z., et al., (1991) FEBS Lett. 290: 69.
Yusupova, G. Z., et al., (2001) The Path of Messenger RNA Through the Ribosome. Cell 106: 233–241.
1. A method of identifying a compound that binds to a bacterial 70S ribosome or portion thereof, comprising: designing a compound based upon a three-dimensional structure of the bacterial 70S ribosome said three-dimensional structure defined by structure coordinates within Appendix I; providing said compound; contacting said compound with the bacterial 70S ribosome or portion thereof; and determining whether said compound binds to the bacterial 70S ribosome or portion thereof.
2. The method of claim 1, wherein a subset of the structure coordinates within Appendix 1 is used for said designing step.
3. The method of claim 1, wherein said portion is a bacterial ribosome 30S subunit.
4. The method of claim 1, wherein said portion is a bacterial ribosorne 50S subunit.
5. The method of claim 1, wherein said compound is designed de novo.
6. The method of claim 1, wherein said compound is designed from a known compound.
7. The method of claim 6 wherein said known compound is selected from the group consisting of antibiotics, initiation factors, and elongation factors.
8. The method of claim 7, wherein said antibiotics are selected from die group consisting of paromoniycin, puromycin, streptomycin, neomycin, thiostrepton, micrococcin, fusidic acid, kirromycin, chloramphenicol, clindamycin, erythromycin, clarithromycin, and roxithromycin.
9. The method of claim 7, wherein said initiation factors are selected from the group consisting of IF1, IF2, and IF3.
10. The method of claim 7, wherein said elongation factors are selected from the group consisting of EF-Tu, and EF-G.
11. The method of claim 1, thrther comprising the step of determining whether the designed compound inhibits protein translation.
12. The method of claim 1, further comprising the step of detennining whether the designed compound alters protein translation fidelity.
13. The method of claim 1, further comprising the step of determining whether the designed compound affects association between a 30S and a 50S ribosome subunit.
14. The method of claim 1, further comprising the step of determining whether the designed compound affects binding of a tRNA to a ribosomal tRNA binding site.
15. The method of claim 1, further comprising the step of determining whether the designed compound affects binding of an mRNA to a ribosomal mRNA binding site.
16. The method of claim 1, further comprising the step of determining whether the designed compound affects binding of IF3 to a ribosomal IF3 binding site.
17. The method of claim 1, further comprising the step of determining whether the designed compound affects binding of EF-Tu to a ribosomal EF-Tu ribosomal binding site.
18. The method of claim 1, further comprising the step of determining whether the designed compound affects binding of EF-G to a ribosomal EF-G ribosomal binding site.
19. A method of identifying a compound that binds to a bacterial 70S ribosome or portion thereof, comprising: obtaining a set of structure coordinates defining the three-dimensional structure of a crystal of a bacterial 70S ribosome that diffracts X-rays for the determination of the structure coordinates of the bacterial 70S ribosome to a resolution of at least 5.5 Angstroms, wherein said bacterial 70S ribosome comprises a 23S rRNA having residues 1–2916 of SEQ ID NO: 23, a 5S rRNA having residues 1–123 of SEQ ID NO: 24, and a 16S rRNA having residues 1–1522 of SEQ ID NO: 45, and wherein said crystal has a space group of I422 with unit cell dimensions of a=b=507.2 Angstroms, and c=803.7 Angstroms; designing a compound based upon the structure coordinates obtained from said crystal; providing said compound; contacting said compound with the 70S ribosome or portion thereof; and determining whether said compound binds to the bacterial 70S ribosome or portion thereof.
20. The method of claim 19, wherein a subset of the structure coordinates obtained from said crystal is used for said designing step.
21. The method of claim 19, wherein said portion is a bacterial ribosome 30S subunit.
22. The method of claim 19, wherein said portion is a bacterial ribosome 50S subunit.
23. The method of claim 19, wherein said compound is designed de novo.
24. The method of claim 19, wherein said compound is designed from a known compound.
25. The method of claim 24 wherein said known compound is selected from the group consisting of antibiotics, initiation factors, and elongation factors.
26. The method of claim 25, wherein said antibiotics are selected from the group consisting of paromomycin, puromycin, streptomycin, neomycin, thiostrepton, micrococoin, fusidic acid, kirromycin, chloramphenicol, clindamycin, erythromycin, clarithromycin, and roxithromycin.
27. The method of claim 25, wherein said initiation factors are selected from the group consisting of IF1, IF2, and IF3.
28. The method of claim 25, wherein said elongation factors are selected from the group consisting of EF-Tu and EF-G.
29. The method of claim 19, further comprising the step of determining whether the designed compound inhibits protein translation.
30. The method of claim 19, further comprising the step of determining whether the designed compound alters protein translation fidelity.
31. The method of claim 19, further comprising the step of determining whether the designed compound affects association between a 30S and a 50S ribosome subunit.
32. The method of claim 19, further comprising the step of determining whether the designed compound affects binding of a tRNA to a ribosomal tRNA binding site.
33. The method of claim 19, further comprising the step of determining whether the designed compound affects binding of an mRNA to a ribosomal mRNA binding site.
34. The method of claim 19, further comprising the step of determining whether the designed compound affects binding of IF3 to a ribosomal IF3 binding site.
35. The method of claim 19, further comprising the step of determining whether the designed compound affects binding of EF-Tu to a ribosomal EF-Tu ribosomal binding site.
36. The method of claim 19, further comprising the step of determining whether the designed compound affects binding of EF-G to a ribosomal EF-G ribosomal binding site.
37. The method of claim 1, wherein said compound is designed to form a non-covalent bond with a residue corresponding to a residue within the ranges of residues selected from the group consisting of
S13 (SEQ ID NO: 36) 92–94, 2–11,
S15 (SEQ ID NO: 38) 40–44, 85–89,
L2 (SEQ ID NO: 2) 162–164, 172–174, 177–178, 198–202,
L5 (SEQ ID NO: 5) 134–153,
L14 (SEQ ID NO: 12) 116–119,
L19 (SEQ ID NO: 16) 44,
16S tRNA (SEQ ID NO: 45) 1408–1410, 1494, 1495, 784, 785, 794, 1516–1519, 770, 771, 900, 901, 763, 764, 698, 702, 712, 713, 773–776, 345–347,
23S rRNA (SEQ ID NO: 23) 886–888, 1913–1914, 1918, 1836–1836, 1919, 1920, 1922, 1932, 1832–1833, 1947–1948, 1960–1961, 1768–1769,44–49, 1689–1690, 1989, 1689, 1690, 1702–1705, 1848–1849, and 1896.
wherein said 16S tRNA and 23S rRNA residue numbers are according to E. coli numbering.
38. The method of claim 37, wherein said residue, is within the ranges of residues selected from the group consisting of
S13 (SEQ ID NO: 36) 92–94, 2–11,
L5 (SEQ ID NO: 5) 134–153,
16S rRNA (SEQ ID NO: 45) 1408–1410, 1494, 1495,
23S rRNA (SEQ ID NO: 23) 886–888, 1913–1914, and 1918,
wherein said 16S rRNA and 23S rRNA residue numbers are according to E. coli numbering.
39. The method of claim 1, wherein said compound is designed to form a non-covalent bond with a residue corresponding to a residue within the ranges of residues selected from the group consisting of
16S rRNA (SEQ ID NO: 45) 1229, 1338, 1339, 790, 966, 926, 1498, 1400, 530, 1045, 955, 1493, 1339–1340, 1382, 937, 788–789, 693–695,
S9 (SEQ ID NO: 32) 128,
L5 (SEQ ID NO: 5) 55–66, S13 (SEQ ID NO: 36) 120–122,
S12 (SEQ ID NO: 35) 46–48,
L16 (SEQ ID NO: 14) 27, 30, S7 (SEQ ID NO: 30) 76–87, 140–152,
L1 (SEQ ID NO: 1) 124–128, 52–54, 165–169,
23S rRNA (SEQ ID NO: 23) 1908, 1909, 1922, 1923, 2255–2256, 2252, 2602, 2585, 1913–1915, 881–883, 898, 899, 2470–2472,2482–2484, 1942, 1943, 2452, 2494,2553,2112–2113,2116, 2117, 1850–1353, 1892, 2235, 2433, 2434, and 199, wherein said 16S rRNA and 23S rRNA residue numbers are according to E. coli numbering.
40. The method of claim 1, wherein said compound is designed to form a non-covalent bond with a residue corresponding to a residue within the ranges of residues selected from the group consisting of
S3 (SEQ ID NO: 26) 127–132, 156–163,
S4 (SEQ ID NO: 27) 47–52,
S5 (SEQ ID NO: 28) 9–30, 46–56,
16S rRNA (SEQ ID NO: 45), 13–17, 528–532, 1054–1056, 1194–1197, and 1198,
wherein said 16S rRNA residue numbers are according to E. coli numbering.
41. The method of claim 1, wherein said compound is designed to form a non-covalent bond with a residue corresponding to a residue within the ranges of residues selected from the group consisting of
16S rRNA (SEQ ID NO: 45) 685–705, 783–795, 799–802, and 803,
wherein said 16S rRNA residue numbers are according to E. coli numbering.
42. The method of claim 1, wherein said compound is designed to fbrin a non-covalent bond with a residue corresponding to a residue within the ranges of residues selected from the group consisting of
L1 (SEQ ID NO: 10) 20–36,
16S rRNA (SEQ ID NO: 45) 54–57, 357–361, and
23S rRNA (SEQ ID NO: 23) 2651–2664, and 2665,
wherein said 16S rRNA and said 23S rRNA residue numbers are according to E. coli numbering.
43. The method of claim 1, wherein said compound is designed to form a non-covalent bond with a residue corresponding to a residue within the ranges of residues selected from the group consisting of
L11 (SEQ ID NO: 10)20–36,
16S rRNA (SEQ ID NO: 45) 54–57, 340–345, 357–361, and
23S rRNA (SEQ ID NO: 23)1065–1069, 1094–1097, 2651–2664, and 2665,
wherein said 16S rRNA and said 23S rRNA residue numbers are according to E. coli numbering.
44. The method of claim 1, wherein said compound is designed to form a non-covalent bond with a residue lining a Shine Dalgarno helix binding pocket, said residue corresponding to a residue within the ranges of residues selected from the group consisting of
S11 (SEQ ID NO: 34) 85–90, 112–129, 22–27,
N8 (SEQ ID NO: 41) 1–24, and
16S rRNA (SEQ ID NO: 45) 927–93 1, 1388–1393, 1526–1529, 1505–1508, 719–723, and 724,
wherein said 165 rRNA and residue numbers are according to E. coli numbering.