Patent application title:

Sso7-polymerase conjugate proteins

Publication number:

-

Publication date:
Application number:

10/280,139

Filed date:

2002-10-23

✅ Patent granted

Patent number:

US 7,666,645 B2

Grant date:

2010-02-23

PCT filing:

-

PCT publication:

-

Examiner:

Richard G Hutson

Adjusted expiration:

2022-10-23

Abstract:

This invention provides Sso7-polymerase conjugates that exhibit improved activity in a polymerase reaction.

Inventors:

Assignee:

Interested in similar patents?

Get notified when new applications in this technology area are published.

Classification:

C12N9/12 IPC

Enzymes; Proenzymes; Compositions thereof ; Processes for preparing, activating, inhibiting, separating or purifying enzymes; Transferases (2.) transferring phosphorus containing groups, e.g. kinases (2.7)

C07K1/00 IPC

General methods for the preparation of peptides, i.e. processes for the organic chemical preparation of peptides or proteins of any length

Description

BACKGROUND OF THE INVENTION

The activity of a polymerase can be improved by joining a sequence-non-specific double-stranded nucleic acid binding domain to the enzyme, or its catalytic domain (see, e.g., WO0192501). Such modified polymerases exhibit increased processivity in comparison to the unmodified enzymes. In some instances, however, it may be useful to additionally modify the processivity of these improved polymerases. For example, when performing polymerase chain reactions (PCR) for long templates, the use of highly processive polymerases often results in lower yields. Therefore, there is a need to modulate polymerase processivity to optimize the enzyme for specific purposes, e.g., long PCR.

Further, polymerase modification with a sequence-non-specific double-stranded nucleic acid binding domain may, in some cases, decrease polymerase discrimination between mismatched primer/templates and properly matched primer/template. Therefore, there can also be a need to increase the specificity of a polymerase for the primer template.

The current invention addresses both of these needs, i.e., the need for modulating processivity and primer/template binding specificity. The invention provides a polymerase conjugate comprising a mutated DNA binding domain such as Sso7d, Sac7d, or related domains joined to the polymerase or catalytic domain of the polymerase. The mutated binding domain comprises one or more amino acid substitutions at a face residue of the DNA binding domain polypeptide sequence. These substituted fusion polymerases exhibit enhanced performance capabilities in polymerase reactions, e.g., a polymerase chain reaction (PCR).

BRIEF SUMMARY OF THE INVENTION

This invention provides polymerase that have modulated processivity. In some embodiments, the polymerase also exhibits enhanced primer/template binding specificity. In particular, the invention provides an Sso7 polymerase conjugate protein comprising an Sso7 domain having at least 60% identity to SEQ ID NO:2 linked to a polymerase domain; wherein an amino acid at a position that is a face residue position as determined with reference to SEQ ID NO:2, is substituted with a different amino acid residue; wherein replacement of the face residue results in a processivity that is less than the processivity of a wildtype Sso7-polymerase fusion and greater than the processivity of the polymerase domain when it is not fused to an Sso7d domain. Often, replacement of the face residue also increases the polymerase primer/template binding specificity in comparison to an Sso7 polymerase fusion protein comprising SEQ ID NO:2.

In some embodiments, the face residue position is selected from the group consisting of a tryptophan residue at position 24, a valine residue at position 26, and a methionine residue at position 29. In particular embodiments, the face residue position is a tryptophan residue at position 24, and the replacement amino acid residue is any amino acid other than Asp, Glu, Arg, Lys, or Pro. Often, the replacement amino acid residue is glycine, valine, or alanine.

In preferred embodiments, the polymerase domain of the conjugates has thermally stable polymerase activity. The polymerase domain may be a family A polymerase domain, e.g., a Thermus polymerase domain or a family B polymerase domain, e.g., a Pyrococcus polymerase domain. Often, the polymerase domain is a ΔTaq polymerase domain.

In other embodiments, the Sso7 domain comprises SEQ ID NO:2 in which an amino acid at a position that is a face residue position is replace by a different amino acid. For example, in some embodiments, the Sso7 domain comprises SEQ ID NO:2 in which a tryptophan residue at position 24 is replaced with an amino acid residue selected from a group consisting of glycine, alanine, and valine.

In another aspect, the invention provides a method of performing a polymerase reaction on a target nucleic acid present in a solution, the method comprising: (a) contacting the target nucleic acid with a an Sso7 polymerase conjugate protein comprising an Sso7d domain having at least 60% identity to SEQ ID NO:2 linked to a polymerase domain; wherein an amino acid at a position that is a face residue position as determined with reference to SEQ ID NO:2, is replaced by an amino acid residue that does not occur at the face residue position in a wildtype Sso7 protein; and wherein replacement of the face residue results in a processivity that is greater than the processivity of the polymerase domain when it is not fused to an Sso7 domain; wherein the solution is of a composition that permits the binding domain to bind to the target nucleic acid and the polymerase domain to extend a primer that is hybridized to the target nucleic acid sequence; and (b) incubating the solution under conditions in which the primer is extended by the polymerase. Often, replacement of the face residue increases the polymerase primer/tem0plate binding specificity in comparison to an Sso7 polymerase fusion protein comprising SEQ ID NO:2.

The invention also provides methods of making and using the polymerase conjugates disclosed herein to modulate a polymerase reaction.

BRIEF DESCRIPTION OF THE DRAWINGS

FIG. 1 depicts the results from a PCR reaction comparing Sso7d(G)-ΔTaq to the wildtype fusion protein, Sso7d-ΔTaq. The final PCR products were analyzed on a 1% agarose gel to assess the relative yields.

FIG. 2 shows an alignment of Sac7e (SEQ ID NO:10) and Sso7d (SEQ ID NO:9). Consensus peptides=SEQ ID NOS:11-14.

DETAILED DESCRIPTION OF THE INVENTION

Definitions

The term “Sso7” or “Sso7 DNA binding domain” or “Sso7-like DNA binding domain” refers to nucleic acid and polypeptide polymorphic variants, alleles, mutants, and interspecies homologs that: (1) have an amino acid sequence that has greater than about 60% amino acid sequence identity, 65%, 70%, 75%, 80%, 85%, 90%, preferably 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or 99% or greater amino acid sequence identity, preferably over a region of at least about 15, 25, 35, 50, or more amino acids, to the Sso7 sequence of SEQ ID NO:2; (2) bind to antibodies, e.g., polyclonal antibodies, raised against an immunogen comprising an amino acid sequence of SEQ ID NO:2 and conservatively modified variants thereof; (3) specifically hybridize under stringent hybridization conditions to an Sso7 nucleic acid sequence of SEQ ID NO:1 and conservatively modified variants thereof; (4) have a nucleic acid sequence that has greater than about 50%, preferably greater than about 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% nucleotide sequence identity, preferably over a region of at least about 50, 100, 150, or more nucleotides, to SEQ ID NO:1; or (5) or are amplified by primers that specifically hybridize under stringent hybridization conditions to the same sequence as a primer set such as 5′ GCAACAGTAAAGT-TGAAGTACAAAGG 3′ (SEQ ID NO:15) (forward) and 5′ CTAACATTTGTAGTAGTTCTTTTGGAGCG 3′ (SEQ ID NO:16), (reverse). The term includes both full-length Sso7 polypeptides and fragments of the polypeptides that have sequence non-specific double-stranded DNA binding activity.

“Domain” refers to a unit of a protein or protein complex, comprising a polypeptide subsequence, a complete polypeptide sequence, or a plurality of polypeptide sequences where that unit has a defined function. The function is understood to be broadly defined and can be ligand binding, catalytic activity or can have a stabilizing effect on the structure of the protein.

The term “identical” in the context of two nucleic acids or polypeptide sequences refers to the residues in the two sequences that are the same when aligned for maximum correspondence, as measured using a “sequence comparison algorithms” described in the section below entitled “Identification of Sso7 domains based on homology”.

A “wildtype Sso7” refers to a naturally occurring Sso7 protein. A “wildtype Sso7 amino acid sequence” refers to the naturally occurring amino acid sequence.

An “Sso7 polymerase conjugate” refers to a modified polymerase comprising at least one Sso7 DNA binding domain joined to a polymerase domain, or a catalytic subunit of the polymerase domain. A “substituted Sso7 polymerase conjugate” refers to a conjugate in which at least one face position amino acid residue is substituted with an amino acid residue that does not occur at that position in a native Sso7 sequence. An “Sso7 polymerase conjugate” may comprises multiple Sso7 binding domains.

“Efficiency” in the context of a nucleic acid modifying enzyme of this invention refers to the ability of the enzyme to perform its catalytic function under specific reaction conditions. Typically, “efficiency” as defined herein is indicated by the amount of product generated under given reaction conditions.

“Enhances” in the context of an enzyme refers to improving the activity of the enzyme, i.e., increasing the amount of product per unit enzyme per unit time.

“Fused” refers to linkage by covalent bonding.

“Heterologous”, when used with reference to portions of a protein, indicates that the protein comprises two or more domains that are not found in the same relationship to each other in nature. Such a protein, e.g., a fusion protein, contains two or more domains from unrelated proteins arranged to make a new functional protein.

“Join” refers to any method known in the art for functionally connecting protein domains, including without limitation recombinant fusion with or without intervening domains, intein-mediated fusion, non-covalent association, and covalent bonding, including disulfide bonding; hydrogen bonding; electrostatic bonding; and conformational bonding, e.g., antibody-antigen, and biotin-avidin associations.

An amino acid residue “having a side chain volume that is less than the side chain volume of tryptophan” refers to an amino acid residue with a side chain that is less bulky than tryptophan. Such a side chain typically has a volume of less than about 170 Å3.

“Polymerase” refers to an enzyme that performs template-directed synthesis of polynucleotides. The term encompasses both the full length polypeptide or a domain that has polymerase activity.

“Processivity” refers to the ability of a polymerase to remain bound to the template or substrate and perform DNA synthesis. Processivity is measured by the number of catalytic events that take place per binding event.

“Thermally stable polymerase” as used herein refers to any enzyme that catalyzes polynucleotide synthesis by addition of nucleotide units to a nucleotide chain using DNA or RNA as a template and has an optimal activity at a temperature above 45° C.

Thermus polymerase” refers to a family A DNA polymerase isolated from any Thermus species, including without limitation Thermus aquaticus, Thermus brockianus, and Thermus thermophilus; any recombinant enzymes deriving from Thermus species, and any functional derivatives thereof, whether derived by genetic modification or chemical modification or other methods known in the art.

The term “amplification reaction” refers to any in vitro means for multiplying the copies of a target sequence of nucleic acid. Such methods include but are not limited to polymerase chain reaction (PCR), DNA ligase chain reaction (see U.S. Pat. Nos. 4,683,195 and 4,683,202; PCR Protocols: A Guide to Methods and Applications (Innis et al., eds, 1990)), (LCR), QBeta RNA replicase, and RNA transcription-based (such as TAS and 3SR) amplification reactions as well as others known to those of skill in the art.

“Amplifying” refers to a step of submitting a solution to conditions sufficient to allow for amplification of a polynucleotide if all of the components of the reaction are intact. Components of an amplification reaction include, e.g., primers, a polynucleotide template, polymerase, nucleotides, and the like. The term “amplifying” typically refers to an “exponential” increase in target nucleic acid. However, “amplifying” as used herein can also refer to linear increases in the numbers of a select target sequence of nucleic acid, such as is obtained with cycle sequencing.

The term “amplification reaction mixture” refers to an aqueous solution comprising the various reagents used to amplify a target nucleic acid. These include enzymes, aqueous buffers, salts, amplification primers, target nucleic acid, and nucleoside triphosphates. Depending upon the context, the mixture can be either a complete or incomplete amplification reaction mixture.

“Polymerase chain reaction” or “PCR” refers to a method whereby a specific segment or subsequence of a target double-stranded DNA, is amplified in a geometric progression. PCR is well known to those of skill in the art; see, e.g., U.S. Pat. Nos. 4,683,195 and 4,683,202; and PCR Protocols: A Guide to Methods and Applications, Innis et al., eds, 1990. Exemplary PCR reaction conditions typically comprise either two or three step cycles. Two step cycles have a denaturation step followed by a hybridization/elongation step. Three step cycles comprise a denaturation step followed by a hybridization step followed by a separate elongation step.

“Long PCR” refers to the amplification of a DNA fragment of 5 kb or longer in length. Long PCR is typically performed using specially-adapted polymerases or polymerase mixtures (see, e.g., U.S. Pat. Nos. 5,436,149 and 5,512,462) that are distinct from the polymerases conventionally used to amplify shorter products. 002310

A “primer” refers to a polynucleotide sequence that hybridizes to a sequence on a target nucleic acid and serves as a point of initiation of nucleic acid synthesis. Primers can be of a variety of lengths and are often less than 50 nucleotides in length, for example 12-30 nucleotides, in length. The length and sequences of primers for use in PCR can be designed based on principles known to those of skill in the art, see, e.g., Innis et al., supra.

A “temperature profile” refers to the temperature and lengths of time of the denaturation, annealing and/or extension steps of a PCR or cycle sequencing reaction. A temperature profile for a PCR or cycle sequencing reaction typically consists of 10 to 60 repetitions of similar or identical shorter temperature profiles; each of these shorter profiles may typically define a two step or three-step cycle. Selection of a temperature profile is based on various considerations known to those of skill in the art, see, e.g., Innis et al., supra. In a long PCR reaction as described herein, the extension time required to obtain an amplification product of 5 kb or greater in length is reduced compared to conventional polymerase mixtures.

PCR “sensitivity” refers to the ability to amplify a target nucleic acid that is present in low concentration. “Low concentration” refers to 104, often 103, 102, 101, or fewer, copies of the target sequence per microliter in the nucleic acid sample to be amplified.

The term “polymerase primer/template binding specificity” as used herein refers to the ability of an Sso7 fusion polymerase to discriminate between correctly matched primer/templates and mismatched primer templates. An “increase in polymerase primer/template binding specificity” in this context refers to an increased ability of an Sso7 variant fusion polymerases of the invention to discriminate between matched primer/template in comparison to a wildtype Sso7 polymerase fusion protein comprising SEQ ID NO:2.

A “template” refers to a double stranded polynucleotide sequence that comprises the polynucleotide to be amplified, flanked by primer hybridization sites. Thus, a “target template” comprises the target polynucleotide sequence flanked by hybridization sites for a 5′ primer and a 3′ primer.

An “improved polymerase” includes a sequence-non-specific double-stranded DNA binding domain joined to the polymerase or polymerase domain. An “unimproved polymerase” or “unmodified polymerase” is a polymerase that does not have a sequence-non-specific double-stranded DNA binding domain.

The terms “polypeptide,” “peptide” and “protein” are used interchangeably herein to refer to a polymer of amino acid residues. The terms apply to amino acid polymers in which one or more amino acid residue is an artificial chemical mimetic of a corresponding naturally occurring amino acid, as well as to naturally occurring amino acid polymers and non-naturally occurring amino acid polymers.

The term “amino acid” refers to naturally occurring and synthetic amino acids, as well as amino acid analogs and amino acid mimetics that function in a manner similar to the naturally occurring amino acids. Naturally occurring amino acids are those encoded by the genetic code, as well as those amino acids that are later modified, e.g., hydroxyproline, γ-carboxyglutamate, and O-phosphoserine. Amino acid analogs refers to compounds that have the same basic chemical structure as a naturally occurring amino acid, i.e., an α carbon that is bound to a hydrogen, a carboxyl group, an amino group, and an R group, e.g., homoserine, norleucine, methionine sulfoxide, methionine methyl sulfonium. Such analogs have modified R groups (e.g., norleucine) or modified peptide backbones, but retain the same basic chemical structure as a naturally occurring amino acid. Amino acid mimetics refers to chemical compounds that have a structure that is different from the general chemical structure of an amino acid, but that functions in a manner similar to a naturally occurring amino acid.

Amino acids may be referred to herein by either their commonly known three letter symbols or by the one-letter symbols recommended by the IUPAC-IUB Biochemical Nomenclature Commission. Nucleotides, likewise, may be referred to by their commonly accepted single-letter codes.

“Conservatively modified variants” applies to both amino acid and nucleic acid sequences. With respect to particular nucleic acid sequences, conservatively modified variants refers to those nucleic acids which encode identical or essentially identical amino acid sequences. Because of the degeneracy of the genetic code, a large number of functionally identical nucleic acids encode any given protein. For instance, the codons GCA, GCC, GCG and GCU all encode the amino acid alanine. Thus, at every position where an alanine is specified by a codon, the codon can be altered to any of the corresponding codons described without altering the encoded polypeptide. Such nucleic acid variations are “silent variations,” which are one species of conservatively modified variations. Every nucleic acid sequence herein which encodes a polypeptide also describes every possible silent variation of the nucleic acid. One of skill will recognize that each codon in a nucleic acid (except AUG, which is ordinarily the only codon for methionine, and TGG, which is ordinarily the only codon for tryptophan) can be modified to yield a functionally identical molecule. Accordingly, each silent variation of a nucleic acid which encodes a polypeptide is implicit in each described sequence.

As to amino acid sequences, one of skill will recognize that individual substitutions, deletions or additions to a nucleic acid, peptide, polypeptide, or protein sequence which alters, adds or deletes a single amino acid or a small percentage of amino acids in the encoded sequence is a “conservatively modified variant” where the alteration results in the substitution of an amino acid with a chemically similar amino acid. Conservative substitution tables providing functionally similar amino acids are well known in the art. Such conservatively modified variants are in addition to and do not exclude polymorphic variants, interspecies homologs, and alleles of the invention.

For example, substitutions may be made wherein an aliphatic amino acid (G, A, I, L, or V) is substituted with another member of the group. Similarly, an aliphatic polar-uncharged group such as C, S, T, M, N, or Q, may be substituted with another member of the group; and basic residues, e.g., K, R, or H, may be substituted for one another. In some embodiments, an amino acid with an acidic side chain, E or D, may be substituted with its uncharged counterpart, Q or N, respectively; or vice versa. Each of the following eight groups contains other exemplary amino acids that are conservative substitutions for one another:

1) Alanine (A), Glycine (G);

2) Aspartic acid (D), Glutamic acid (E);

3) Asparagine (N), Glutamine (Q);

4) Arginine (R), Lysine (K);

5) Isoleucine (I), Leucine (L), Methionine (M), Valine (V);

6) Phenylalanine (F), Tyrosine (Y), Tryptophan (W);

7) Serine (S), Threonine (T); and

8) Cysteine (C), Methionine (M)

(see, e.g., Creighton, Proteins (1984)).

Introduction

The current invention provides variant Sso7 polymerase conjugates that exhibit modulated processivity and/or an increased specificity relative to a wildtype Sso7 fusion polymerase. These polymerase reactions are often more efficient and yield more product compared to unmodified polymerases or wildtype Sso7 fusion polymerases. The variant fusion polymerases comprise a polymerase domain with an Sso7 binding domain joined to it. The Sso7 binding domain comprises an Sso7 in which amino acid residues at face positions are substituted to an amino acid that does not occur at that position in a known, wildtype Sso7.

Those of skill in the art will appreciate that substitutions to modulate processivity may be introduced into the nucleic acid binding domain of a polymerase comprising a heterologous sequence nonspecific double-stranded nucleic acid binding domain other than Sso7. For example, one or more substitutions may be introduced into particular positions (e.g., those that interact with DNA) of the DNA binding domain of a chimeric polymerase that has a sequence nonspecific helix-hairpin-helix (HhH) binding domain fused to the polymerase domain (e.g., Pavlov et al., Proc. Natl. Acad. Sci. USA 99:13510-13515, 2002).

Polymerases

DNA polymerases are well known to those skilled in the art. These include both DNA-dependent polymerases and RNA-dependent polymerases such as reverse transcriptase. At least five families of DNA-dependent DNA polymerases are known, although most fall into families A, B and C. There is little or no structural or sequence similarity among the various families. Most family A polymerases are single chain proteins that can contain multiple enzymatic functions including polymerase, 3′ to 5′ exonuclease activity and 5′ to 3′ exonuclease activity. Family B polymerases typically have a single catalytic domain with polymerase and 3′ to 5′ exonuclease activity, as well as accessory factors. Family C polymerases are typically multi-subunit proteins with polymerizing and 3′ to 5′ exonuclease activity. In E. coli, three types of DNA polymerases have been found, DNA polymerases I (family A), II (family B), and III (family C). In eukaryotic cells, three different family B polymerases, DNA polymerases α, δ, and ε, are implicated in nuclear replication, and a family A polymerase, polymerase γ, is used for mitochondrial DNA replication. Other types of DNA polymerases include phage polymerases.

Similarly, RNA polymerases typically include eukaryotic RNA polymerases I, II, and III, and bacterial RNA polymerases as well as phage and viral polymerases. RNA polymerases can be DNA-dependent and RNA-dependent.

In specific embodiments, Taq polymerase domains are incorporated into the fusion protein. In particular polymerase variants such as ΔTaq, which is a genetically modified version of standard Taq DNA polymerase that lacks the 5′ to 3′-exonuclease activity (Lawyer et al., J Biol Chem 264:6427-6437 (1989)), are often used in constructing the fusion polymerases of the invention. Other family A polymerases that act similarly to Taq, e.g., Thermus brockianus polymerase, which is about 90% similar to Taq polymerase, as well as Thermus flavus polymerase, and Thermus thermophilus polymerase, which has reverse transcriptase activity, may also be used. Additionally, less extremely thermophilic polymerases, such as the family A polymerase from Bacillus stearothermophilus are likely to prove useful, as are mesophilic polymerases such as E. coli Pol I and its deleted derivatives.

Family B polymerases such as Pyrococcus polymerases, e.g., Pfu polymerase, may also be used as a polymerase domain that is fused to a substituted Sso7 domain.

The activity of a polymerase can be measured using assays well known to those of skill in the art. For example, a processive enzymatic activity, such as a polymerase activity, can be measured by determining the amount of nucleic acid synthesized in a reaction, such as a polymerase chain reaction. In determining the relative efficiency of the enzyme, the amount of product obtained with a polymerase containing a sequence-non-specific double-stranded DNA binding domain can then be compared to the amount of product obtained with the normal polymerase enzyme, which will be described in more detail below and in the Examples.

A polymerase domain suitable for use in the invention can be the enzyme itself or the catalytic domain, e.g., Taq polymerase or a domain of Taq with polymerase activity. The catalytic domain may include additional amino acids and/or may be a variant that contains amino acid substitutions, deletions or additions, but still retains enzymatic activity.

Sso7 Proteins

The polymerases of the invention comprise an Sso7 polypeptide sequence that has amino acid substitutions at face residue positions. Sso7d is a small (63 amino acids, about 7,000 kd MW), basic chromosomal protein from the hyperthermophilic archaeabacteria Sulfolobus solfataricus. The protein is lysine-rich and has high thermal, acid and chemical stability. It binds to DNA in a sequence-independent manner and when bound, increase the TM of DNA by up to 40° C. under some conditions (McAfee et al., Biochemistry 34:1006310077, 1995). Sso7d and its homologs are typically believed to be involved in packaging genomic DNA and stabilizing genomic DNA at elevated temperatures. The protein sequence is set forth in SEQ ID NO:2.

There are several known Sso7d-like proteins (also referred to as Sso7 proteins) including, but not limited to, Sac7a, Sac7b, Sac7d, and Sac7e, from the hyperthermophilic archacabacteria S. acidocaldarius; and Ssh7a and Ssh7b, Sulfolobus shibatae. These proteins have an identity with Sso7d that ranges from 78% to 98%. Other Sso7 domains for use in the invention may also be identified as set forth below.

The face residue positions of an Sso7 protein are determined with reference to the Sso7d sequence as set forth in SEQ ID NO:2. Face residues are those residues that are exposed on the surface of the protein that interacts with the bases of a DNA double helix. These residue have been identified through structural studies of Sso7d (see, e.g. Gao et al., Nature Struct. Biol. 5:782-786, 1998). The surface face amino acids Trp24, Val26, Met29, Ser31, Arg43 and Ala45 of SEQ ID NO:2 are face residues that are typically substituted in the fusion polymerases of the invention. It should be understood that such position designations do not indicate the number of amino acids in the claimed molecule per se, but indicate where in the claimed molecule the residue occurs when the claimed molecule sequence is maximally aligned with SEQ ID NO:2. Alignment can be performed either manually or using a sequence comparison algorithm described below. For example, the substituted Sso7 protein at the N-terminus of the fusion polymerase sequence set forth in SEQ ID NO:4 has a glycine substituted for a naturally occurring tryptophan residue. This substitution occurs at the 29th amino acid residue of SEQ ID NO:4. However, with reference to SEQ ID NO:2, the substitution is at the Trp24 position. Based on alignments as described, the following residues are typically present at face positions in wildtype Sso7 proteins: 24-Trp; 26-Val; 29-Met; 31-Ser; 43-Arg; and 45-Ala.

An example of an alignment of an Sso7 protein, Sac7e, to SEQ ID NO:2 and the identification of the face residue positions is shown in FIG. 2. The alignment was obtained using the NCBI BLAST program with default parameters (see, e.g., Altschul et al., Nucl. Acids Res. 25:3389-3402, 1997). Sac7e has 78% identity to SEQ ID NO:2. In FIG. 2, the start methionine of Sso7d (see, SEQ ID NO:2) at position 1 is not shown. Thus, although the Ala residue is the first residue of the Sso7d sequence shown in FIG. 2, it corresponds to position 2 of SEQ ID NO:2. As noted above, the face residues of Sso7d are the Trp at position 24, the Val at position 26, the Met at position 29, the Ser at position 31, the Arg at position 43 and the Ala at position 45. The corresponding face residues of Sac7e are the Trp at position 24 when determined with reference to SEQ ID NO:2 (residue number 23 in the Sac7e sequence); the Val at position 26 (residue number 25 in the Sac 7e sequence); the Met at position 29 (residue number 28 of the Sac7e sequence); the Ser at position 31 (residue number 30 of the Sac7e sequence); the Arg at positions 43 (residue number 41 of the Sac7e sequence); and the Ala at position 45 (residue number 43 of the Sac7e sequence).

As the side chains of these residues interact directly with the bases in the minor groove, changing these residues to residues other than the wildtype amino acids can be used to modify the strength of the interaction with DNA, without destroying the structure of the Sso7 domain, reducing thermostability, or otherwise greatly reducing the ability of the domains to function in the current invention. Furthermore, a subset of the face residues, Trp24, Val26, Met 29, and Ala45, interact with a position where the DNA helix is kinked. Thus, mutation at one of these positions can be used to decrease the affinity of Sso7 domains for DNA containing a mismatch near the kinked position.

A face residue can be substituted with a variety of amino acid residues. Typically the substituted residue is one that does not occur in any other naturally occurring Sso7 protein at that position. Often, the substituted residue occupies less volume than the amino acid residue in the native sequence. For example, the side chain of tryptophan occupies the largest volume of the naturally occurring amino acids. Tryptophan can therefore be substituted with less bulky amino acids, in particular such residues as alanine, glycine, or valine, that occupy less space. Further, a residue that introduces a major structural change into the polypeptide, e.g., proline, or has the capacity to introduce such a change, e.g., cysteine, is typically avoided as a face residue substitution.

Charge and hydrophobicity may also be considered when substituting amino acids. The surface of Sso7d is highly basic, containing 2 arginines and 14 lysines. For example, it may be desirable to select an amino acid residue that has a neutral or weak positive charge. Changing any of the face amino acids to Glu or Asp, which are strongly acidic, is not expected to produce a functional protein.

Thus, face residues are typically substituted with Ala, Gly, His, Iso, Leu, Met, Phe, Ser, Thr, Tyr, Asn, Gin, Cys, or Val. Further, the amino acid selected to be inserted into a fusion polypeptide of the invention to replace the desired face residue is frequently one that is not found in that face residue position in a naturally occurring Sso7 polypeptide.

Identification of Additional Sso7 Domains Based on Homology.

Other suitable Sso7 DNA binding domains for use in the invention can be identified based on their sequence homology to Sso7d. Typically, domains that have about 60% amino acid sequence identity, optionally about 70%, 75, 80, 85, 90, or 95-98% amino acid sequence identity to a known sequence non-specific double-stranded nucleic acid binding protein over a comparison window of about 30 amino acids, optionally about 50-70 amino acids, or the length of the entire protein, can be used in the invention. The sequence can be compared and aligned for maximum correspondence over a comparison window, or designated region as measured using one of the following sequence comparison algorithms or by manual alignment and visual inspection. For purposes of this patent, percent amino acid identity is determined by the default parameters of BLAST.

For sequence comparison, typically one sequence acts as a reference sequence, to which test sequences are compared. When using a sequence comparison algorithm, test and reference sequences are entered into a computer, subsequence coordinates are designated, if necessary, and sequence algorithm program parameters are designated. Default program parameters can be used, or alternative parameters can be designated. The sequence comparison algorithm then calculates the percent sequence identities for the test sequences relative to the reference sequence, based on the program parameters.

The comparison window includes reference to a segment of any one of the number of contiguous positions selected from the group consisting of from 20 to 600, usually about 50 to about 200, more usually about 100 to about 150 in which a sequence may be compared to a reference sequence of the same number of contiguous positions after the two sequences are optimally aligned. Methods of alignment of sequences for comparison are well-known in the art. Optimal alignment of sequences for comparison can be conducted, e.g., by the local homology algorithm of Smith & Waterman, Adv. Appl. Math. 2:482 (1981), by the homology alignment algorithm of Needleman & Wunsch, J. Mol. Biol. 48:443 (1970), by the search for similarity method of Pearson & Lipman, Proc. Nat'l. Acad. Sci. USA 85:2444 (1988), by computerized implementations of these algorithms (GAP, BESTFIT, FASTA, and TFASTA in the Wisconsin Genetics Software Package, Genetics Computer Group, 575 Science Dr., Madison, Wis.), or by manual alignment and visual inspection (see, e.g., Current Protocols in Molecular Biology (Ausubel et al., eds. 1995 supplement)).

An example of an algorithm that is suitable for determining percent sequence identity and sequence similarity are the BLAST and BLAST 2.0 algorithms, which are described in Altschul et al., Nuc. Acids Res. 25:3389-3402 (1977) and Altschul et al., J. Mol. Biol. 215:403-410 (1990), respectively. Software for performing BLAST analyses is publicly available through the National Center for Biotechnology Information (http://www.ncbi.nlm.nih.gov/). This algorithm involves first identifying high scoring sequence pairs (HSPs) by identifying short words of length W in the query sequence, which either match or satisfy some positive-valued threshold score T when aligned with a word of the same length in a database sequence. T is referred to as the neighborhood word score threshold (Altschul et al., supra). These initial neighborhood word hits act as seeds for initiating searches to find longer HSPs containing them. The word hits are extended in both directions along each sequence for as far as the cumulative alignment score can be increased. Cumulative scores are calculated using, for nucleotide sequences, the parameters M (reward score for a pair of matching residues; always >0) and N (penalty score for mismatching residues; always <0). For amino acid sequences, a scoring matrix is used to calculate the cumulative score. Extension of the word hits in each direction are halted when: the cumulative alignment score falls off by the quantity X from its maximum achieved value; the cumulative score goes to zero or below, due to the accumulation of one or more negative-scoring residue alignments; or the end of either sequence is reached. The BLAST algorithm parameters W, T, and X determine the sensitivity and speed of the alignment. The BLASTN program (for nucleotide sequences) uses as defaults a wordlength (W) of 11, an expectation (E) or 10, M=5, N=−4 and a comparison of both strands. For amino acid sequences, the BLASTP program uses as defaults a wordlength of 3, and expectation (E) of 10, and the BLOSUM62 scoring matrix (see Henikoff & Henikoff, Proc. Natl. Acad. Sci. USA 89:10915 (1989)) alignments (B) of 50, expectation (E) of 10, M=5, N=−4, and a comparison of both strands.

The BLAST algorithm also performs a statistical analysis of the similarity between two sequences (see, e.g., Karlin & Altschul, Proc. Nat'l Acad. Sci. USA 90:58735787 (1993)). One measure of similarity provided by the BLAST algorithm is the smallest sum probability (P(N)), which provides an indication of the probability by which a match between two nucleotide or amino acid sequences would occur by chance. For example, a nucleic acid is considered similar to a reference sequence if the smallest sum probability in a comparison of the test nucleic acid to the reference nucleic acid is less than about 0.2, more preferably less than about 0.01, and most preferably less than about 0.001.

Identification of Sso7 Proteins Based on Cross-Reactive Binding to Sso7-Specific Antibodies

Sso7 DNA binding proteins for use in the invention can also be identified by cross-reactivity using antibodies, preferably polyclonal antibodies, that bind to known Sso7 binding domains. Polyclonal antibodies are generated using methods well known to those of ordinary skill in the art (see, e.g., Coligan, Current Protocols in Immunology (1991); Harlow & Lane, Antibodies, A Laboratory Manual (1988)). Those proteins that are immunologically cross-reactive binding proteins can then be detected by a variety of assay methods. For descriptions of various formats and conditions that can be used, see, e.g., Methods in Cell Biology: Antibodies in Cell Biology, volume 37 (Asai, ed. 1993), Coligan, supra, and Harlow & Lane, supra.

Useful immunoassay formats include assays where a sample protein is immobilized to a solid support. For example, a cross-reactive binding protein can be identified using an immunoblot analysis such as a western blot. The western blot technique generally comprises separating sample proteins by gel electrophoresis on the basis of molecular weight, transferring the separated proteins to a suitable solid support, (such as a nitrocellulose filter, a nylon filter, or derivatized nylon filter), and incubating the sample with the antibodies that bind to the sequence non-specific double-stranded nucleic acid binding domain. The antibodies specifically bind to cross-reactive polypeptides on the solid support. The antibodies may be directly labeled or alternatively may be subsequently detected using labeled antibodies (e.g., labeled sheep anti-mouse antibodies) that specifically bind to the anti-binding domain antibodies. Other immunoblot assays, such as analysis of recombinant protein libraries, are also useful for identifying proteins suitable for use in the invention.

Using this methodology under designated immunoassay conditions, immunologically cross-reactive proteins that bind to a particular antibody at least two times the background or more, typically more than 10 times background, and do not substantially bind in a significant amount to other proteins present in the sample can be identified.

Immunoassays in the competitive binding format can also be used for crossreactivity determinations. For example, polyclonal antisera are generated to a known, Sso7 domain, e.g., Sso7d. The target antigen can then be immobilized to a solid support. Non-target antigens having minor crossreactivity (if they exist) can be added to the assay to improve the selectivity of the sera. The ability of the added proteins to compete for binding of the antisera to the immobilized protein is compared to the ability of the Sso7 protein to compete with itself. The percent crossreactivity for the above proteins is calculated, using standard calculations. Those antisera with less than 10% crossreactivity with the added protein are selected and pooled. Cross-reacting antibodies to non-target antigens can also be removed from the pooled antisera by immunoabsorption with the non-target antigens. Antibodies that specifically bind to particular nucleic acid binding domains of the invention can also be made using this methodology.

The immunoabsorbed and pooled antisera are then used in a competitive binding immunoassay as described above to compare a second protein, thought to be perhaps an allele, polymorphic variant or a homolog of the known Sso7 binding domain, for example, a homolog from another species, to the immunogen protein. In order to make this comparison, the two proteins are each assayed at a wide range of concentrations and the amount of each protein required to inhibit 50% of the binding of the antisera to the immobilized protein is determined. If the amount of the second protein required to inhibit 50% of binding is less than 10 times the amount of the nucleic acid binding domain protein that is required to inhibit 50% of binding, then the second protein is said to specifically bind to the polyclonal antibodies generated to the Sso7d immunogen.

The activity of the sequence non-specific double-stranded nucleic acid binding domains can be assessed using a variety of assays as described, e.g., in WO0192501. In the current invention, the Sso7 domain is substituted at least one face residue. The substituted Sso7 domains, when joined to a polymerase, exhibits modified processivity and/or an increase primer/template binding specificity. An Sso7 conjugate polymerase of the invention can be identified using assays well known in the art, which are further described herein.

Joining the Sso7 DNA Binding Domain to the Polymerase.

The Sso7 DNA binding domain and the polymerase domain, e.g., Sso7d and Taq polymerase, of the conjugate proteins of the invention can be joined by methods well known to those of skill in the art. These methods include both chemical and recombinant means.

Chemical means of joining the Sso7 protein to the polymerase are described, e.g., in Bioconjugate Techniques, Hermanson, Ed., Academic Press (1996). These include, for example, derivitization for the purpose of linking the two proteins to each other, either directly or through a linking compound, by methods that are well known in the art of protein chemistry. For example, in one chemical conjugation embodiment, the means of linking the catalytic domain and the nucleic acid binding domain comprises a heterobifunctional-coupling reagent which ultimately contributes to formation of an intermolecular disulfide bond between the two moieties. Other types of coupling reagents that are useful in this capacity for the present invention are described, for example, in U.S. Pat. No. 4,545,985. Alternatively, an intermolecular disulfide may conveniently be formed between cysteines in each moiety, which occur naturally or are inserted by genetic engineering. The means of linking moieties may also use thioether linkages between heterobifunctional crosslinking reagents or specific low pH cleavable crosslinkers or specific protease cleavable linkers or other cleavable or noncleavable chemical linkages.

The means of linking the Sso7 and polymerase domains of the conjugate protein may also comprise a peptidyl bond formed between moieties that are separately synthesized by standard peptide synthesis chemistry or recombinant means. The conjugate protein itself can also be produced using chemical methods to synthesize an amino acid sequence in whole or in part. For example, peptides can be synthesized by solid phase techniques, such as, e.g., the Merrifield solid phase synthesis method, in which amino acids are sequentially added to a growing chain of amino acids (see, Merrifield (1963) J. Am. Chem. Soc., 85:2149-2146). Equipment for automated synthesis of polypeptides is commercially available from suppliers such as PE Corp. (Foster City, Calif.), and may generally be operated according to the manufacturer's instructions. The synthesized peptides can then be cleaved from the resin, and purified, e.g., by preparative high performance liquid chromatography (see Creighton, Proteins Structures and Molecular Principles, 50-60 (1983)). The composition of the synthetic polypeptides or of subfragments of the polypeptide, may be confirmed by amino acid analysis or sequencing (e.g., the Edman degradation procedure; see Creighton, Proteins, Structures and Molecular Principles, pp. 3449 (1983)).

In addition, nonclassical amino acids or chemical amino acid analogs can be introduced as a substitution or addition into the sequence. Non-classical amino acids include, but are not limited to, the D-isomers of the common amino acids, α-amino isobutyric acid, 4-aminobutyric acid, Abu, 2-amino butyric acid, γ-Abu, ε-Ahx, 6-amino hexanoic acid, Aib, 2-amino isobutyric acid, 3-amino propionic acid, ornithine, norleucine, norvaline, hydroxy-proline, sarcosine, citrulline, cysteic acid, t-butylglycine, t-butylalanine, phenylglycine, cyclohexylalanine, β-alanine, fluoro-amino acids, designer amino acids such as β-methyl amino acids, Cα-methyl amino acids, Nα-methyl amino acids, and amino acid analogs in general. Furthermore, the amino acid can be D (dextrorotary) or L (levorotary).

In another embodiment, the Sso7 and polymerase domains are joined via a linking group. The linking group can be a chemical crosslinking agent, including, for example, succinimidyl-(N-maleimidomethyl)-cyclohexane-1-carboxylate (SMCC). The linking group can also be an additional amino acid sequence(s), including, for example, a polyalanine, polyglycine or similarly, linking group.

In a specific embodiment, the coding sequences of each polypeptide in the fusion protein are directly joined at their amino- or carboxy-terminus via a peptide bond in any order. Alternatively, an amino acid linker sequence may be employed to separate the first and second polypeptide components by a distance sufficient to ensure that each polypeptide folds into its secondary and tertiary structures. Such an amino acid linker sequence is incorporated into the fusion protein using standard techniques well known in the art. Suitable peptide linker sequences may be chosen based on the following factors: (1) their ability to adopt a flexible extended conformation; (2) their inability to adopt a secondary structure that could interact with functional epitopes on the first and second polypeptides; and (3) the lack of hydrophobic or charged residues that might react with the polypeptide functional epitopes. Typical peptide linker sequences contain Gly, Ser, Val and Thr residues. Other near neutral amino acids, such as Ala can also be used in the linker sequence. Amino acid sequences which may be usefully employed as linkers include those disclosed in Maratea et al. (1985) Gene 40:39-46; Murphy et al. (1986) Proc. Natl. Acad. Sci. USA 83:8258-8262; U.S. Pat. Nos. 4,935,233 and 4,751,180. The linker sequence may generally be from 1 to about 50 amino acids in length, e.g., 3, 4, 6, or 10 amino acids in length, but can be 100 or 200 amino acids in length. Linker sequences may not be required when the first and second polypeptides have non-essential N-terminal amino acid regions that can be used to separate the functional domains and prevent steric interference.

Other chemical linkers include carbohydrate linkers, lipid linkers, fatty acid linkers, polyether linkers, e.g., PEG, etc. For example, poly(ethylene glycol) linkers are available from Shearwater Polymers, Inc. Huntsville, Ala. These linkers optionally have amide linkages, sulfhydryl linkages, or heterobifunctional linkages.

Other methods of joining the Sso7 and polymerase domains include ionic binding by expressing negative and positive tails and indirect binding through antibodies and streptavidin-biotin interactions. (See, e.g., Bioconjugate Techniques, supra). The domains may also be joined together through an intermediate interacting sequence. For example, an Sso7d-interacting sequence, i.e., a sequence that binds to Sso7d, can be joined to a polymerase. The resulting fusion protein can then be allowed to associate non-covalently with the Sso7d to generate an Sso7d-polymerase conjugate.

Production of Fusion Proteins Using Recombinant Techniques

In a typical embodiment, a conjugate Sso7-polymerase protein of the invention is produced by recombinant expression of a nucleic acid encoding the protein, which technique is standard practice in the art. Such a fusion product can be made by ligating the appropriate nucleic acid sequences encoding the desired amino acid sequences to each other by methods known in the art, in the proper coding frame, and expressing the product by methods known in the art.

Nucleic acids encoding the domains to be incorporated into the fusion proteins of the invention can be obtained using routine techniques in the field of recombinant genetics. Basic texts disclosing the general methods of use in this invention include Sambrook and Russell, Molecular Cloning, A Laboratory Manual (3rd ed. 2001); Kriegler, Gene Transfer and Expression: A Laboratory Manual (1990); and Current Protocols in Molecular Biology (Ausubel et al., eds., 1994-1999).

Nucleic acid sequences that encode the Sso7 and polymerase polypeptides can be obtained using any of a variety of methods. In some embodiments, the nucleic acid sequences encoding the polypeptides are cloned from cDNA and genomic DNA libraries by hybridization with probes, or isolated using amplification techniques with oligonucleotide primers. More commonly, amplification techniques are used to amplify and isolate the Sso7 and polymerase sequences using a DNA or RNA template (see, e.g., Dieffenfach & Dveksler, PCR Primers: A Laboratory Manual (1995)). Alternatively, overlapping oligonucleotides can be produced synthetically and joined to produce one or more of the domains. Nucleic acids encoding catalytic or double-stranded nucleic acid binding domains can also be isolated from expression libraries using antibodies as probes.

In an example of obtaining a nucleic acid encoding an Sso7 or polymerase domain using PCR, the nucleic acid sequence or subsequence is PCR amplified, using a sense primer containing one restriction site and an antisense primer containing another restriction site. This will produce a nucleic acid encoding the desired domain sequence or subsequence and having terminal restriction sites. This nucleic acid can then be easily ligated into a vector containing a nucleic acid encoding the second domain and having the appropriate corresponding restriction sites. The domains can be directly joined or may be separated by a linker, or other, protein sequence. Suitable PCR primers can be determined by one of skill in the art using the sequence information provided in GenBank or other sources. Appropriate restriction sites can also be added to the nucleic acid encoding the protein or protein subsequence by site-directed mutagenesis. The plasmid containing the domain-encoding nucleotide sequence or subsequence is cleaved with the appropriate restriction endonuclease and then ligated into an appropriate vector for amplification and/or expression according to standard methods.

Examples of techniques sufficient to direct persons of skill through in vitro amplification methods are found in Berger, Sambrook, and Ausubel, as well as Mullis et al., (1987) U.S. Pat. No. 4,683,202; PCR Protocols A Guide to Methods and Applications (Innis et al., eds) Academic Press Inc. San Diego, Calif. (1990) (Innis); Arnheim & Levinson (Oct. 1, 1990) C&EN 36-47; The Journal Of NIH Research (1991) 3: 81-94; (Kwoh et al (1989) Proc. Natl. Acad. Sci. USA 86: 1173; Guatelli et al. (1990) Proc. Natl. Acad. Sci. USA 87, 1874; Lomell et al. (1989) J. Clin. Chem., 35: 1826; Landegren et al., (1988) Science 241: 1077-1080; Van Brunt (1990) Biotechnology 8: 291-294; Wu and Wallace (1989) Gene 4: 560; and Barringer et al. (1990) Gene 89: 117.

Other physical properties of a polypeptide expressed from a particular nucleic acid can be compared to properties of an Sso7 polypeptide or polymerase to provide another method of identifying suitable nucleic acids.

One of skill will also recognize that modifications can additionally be made to the Sso7 and polymerase domains without diminishing their biological activity. Some modifications may be made to facilitate the cloning, expression, or incorporation of a domain into a fusion protein. Such modifications are well known to those of skill in the art and include, for example, the addition of codons at either terminus of the polynucleotide that encodes the binding domain to provide, for example, a methionine added at the amino terminus to provide an initiation site, or additional amino acids (e.g., poly His) placed on either terminus to create conveniently located restriction sites or termination codons or purification sequences.

One or more of the domains may also be modified to facilitate the linkage of the two domains to obtain the polynucleotides that encode the fusion polypeptides of the invention. Thus, Sso7 and polymerase domains that are modified by such methods are also part of the invention. For example, a codon for a cysteine residue can be placed at either end of a domain so that the domain can be linked by, for example, a sulfide linkage. The modification can be performed using either recombinant or chemical methods (see, e.g., Pierce Chemical Co. catalog, Rockford Ill.).

The Sso7 and polymerase domains of the recombinant fusion protein are often joined by linker domains, usually polypeptide sequences including Gly, Ser, Ala, and Val such as those described above. In some embodiments, proline residues are incorporated into the linker to prevent the formation of significant secondary structural elements by the linker.

In some embodiments, the recombinant nucleic acids the recombinant nucleic acids encoding the proteins of the invention are modified to provide preferred codons which enhance translation of the nucleic acid in a selected organism (e.g., yeast preferred codons are substituted into a coding nucleic acid for expression in yeast).

Expression Cassettes and Host Cells for Expressing the Fusion Polypeptides

There are many expression systems for producing the fusion polypeptides that are well know to those of ordinary skill in the art. (See, e.g., Gene Expression Systems, Fernandex and Hoeffler, Eds. Academic Press, 1999; Sambrook $ Russell, supra; and Ausubel et al, supra.) Typically, the polynucleotide that encodes the fusion polypeptide is placed under the control of a promoter that is functional in the desired host cell. An extremely wide variety of promoters are available, and can be used in the expression vectors of the invention, depending on the particular application. Ordinarily, the promoter selected depends upon the cell in which the promoter is to be active. Other expression control sequences such as ribosome binding sites, transcription termination sites and the like are also optionally included. Constructs that include one or more of these control sequences are termed “expression cassettes.” Accordingly, the nucleic acids that encode the joined polypeptides are incorporated for high level expression in a desired host cell.

Expression control sequences that are suitable for use in a particular host cell are often obtained by cloning a gene that is expressed in that cell. Commonly used prokaryotic control sequences, which are defined herein to include promoters for transcription initiation, optionally with an operator, along with ribosome binding site sequences, include such commonly used promoters as the beta-lactamase (penicillinase) and lactose (lac) promoter systems (Change et al., Nature (1977) 198: 1056), the tryptophan (trp) promoter system (Goeddel et al., Nucleic Acids Res. (1980) 8: 4057), the tac promoter (DeBoer, et al., Proc. Natl. Acad. Sci. U.S.A. (1983) 80:21-25); and the lambda-derived PL promoter and N-gene ribosome binding site (Shimatake et al., Nature (1981) 292: 128). The particular promoter system is not critical to the invention, any available promoter that functions in prokaryotes can be used. Standard bacterial expression vectors include plasmids such as pBR322-based plasmids, e.g., pBLUESCRIPT™, pSKF, pET23D, λ-phage derived vectors, and fusion expression systems such as GST and LacZ. Epitope tags can also be added to recombinant proteins to provide convenient methods of isolation, e.g., c-myc, HA-tag, 6-His (SEQ ID NO:17) tag, maltose binding protein, VSV-G tag, anti-DYKDDDDK (SEQ ID NO:18) tag, or any such tag, a large number of which are well known to those of skill in the art.

For expression of fusion polypeptides in prokaryotic cells other than E. coli, a promoter that functions in the particular prokaryotic species is required. Such promoters can be obtained from genes that have been cloned from the species, or heterologous promoters can be used. For example, the hybrid trp-lac promoter functions in Bacillus in addition to E. coli. These and other suitable bacterial promoters are well known in the art and are described, e.g., in Sambrook et al. and Ausubel et al. Bacterial expression systems for expressing the proteins of the invention are available in, e.g., E. coli, Bacillus sp., and Salmonella (Palva et al., Gene 22:229-235 (1983); Mosbach et al., Nature 302:543-545 (1983). Kits for such expression systems are commercially available.

Eukaryotic expression systems for mammalian cells, yeast, and insect cells are well known in the art and are also commercially available. In yeast, vectors include Yeast Integrating plasmids (e.g., YIp5) and Yeast Replicating plasmids (the YRp series plasmids) and pGPD-2. Expression vectors containing regulatory elements from eukaryotic viruses are typically used in eukaryotic expression vectors, e.g., SV40 vectors, papilloma virus vectors, and vectors derived from Epstein-Barr virus. Other exemplary eukaryotic vectors include pMSG, pAV009/A+, pMTO10/A+, pMAMneo-5, baculovirus pDSVE, and any other vector allowing expression of proteins under the direction of the CMV promoter, SV40 early promoter, SV40 later promoter, metallothionein promoter, murine mammary tumor virus promoter, Rous sarcoma virus promoter, polyhedrin promoter, or other promoters shown effective for expression in eukaryotic cells.

Either constitutive or regulated promoters can be used in the present invention. Regulated promoters can be advantageous because the host cells can be grown to high densities before expression of the fusion polypeptides is induced. High level expression of heterologous proteins slows cell growth in some situations. An inducible promoter is a promoter that directs expression of a gene where the level of expression is alterable by environmental or developmental factors such as, for example, temperature, pH, anaerobic or aerobic conditions, light, transcription factors and chemicals.

For E. coli and other bacterial host cells, inducible promoters are known to those of skill in the art. These include, for example, the lac promoter, the bacteriophage lambda PL promoter, the hybrid trp-lac promoter (Amann et al. (1983) Gene 25: 167; de Boer et al. (1983) Proc. Nat'l. Acad. Sci. USA 80: 21), and the bacteriophage T7 promoter (Studier et al. (1986) J. Mol. Biol.; Tabor et al. (1985) Proc. Nat'l. Acad. Sci. USA 82: 10748). These promoters and their use are discussed in Sambrook et al., supra.

Inducible promoters for other organisms are also well known to those of skill in the art. These include, for example, the metallothionein promoter, the heat shock promoter, as well as many others.

Translational coupling may be used to enhance expression. The strategy uses a short upstream open reading frame derived from a highly expressed gene native to the translational system, which is placed downstream of the promoter, and a ribosome binding site followed after a few amino acid codons by a termination codon. Just prior to the termination codon is a second ribosome binding site, and following the termination codon is a start codon for the initiation of translation. The system dissolves secondary structure in the RNA, allowing for the efficient initiation of translation. See Squires, et. al. (1988), J. Biol. Chem. 263: 16297-16302.

The construction of polynucleotide constructs generally requires the use of vectors able to replicate in bacteria. Such vectors are commonly used in the art. A plethora of kits are commercially available for the purification of plasmids from bacteria (for example, EasyPrepJ, FlexiPrepJ, from Pharmacia Biotech; StrataCleanJ, from Stratagene; and, QIAexpress Expression System, Qiagen). The isolated and purified plasmids can then be further manipulated to produce other plasmids, and used to transform cells.

The fusion polypeptides can be expressed intracellularly, or can be secreted from the cell. Intracellular expression often results in high yields. If necessary, the amount of soluble, active fusion polypeptide may be increased by performing refolding procedures (see, e.g., Sambrook et al., supra.; Marston et al., Bio/Technology (1984) 2: 800; Schoner et al., Bio/Technology (1985) 3: 151). Fusion polypeptides of the invention can be expressed in a variety of host cells, including E. coli, other bacterial hosts, yeast, and various higher eukaryotic cells such as the COS, CHO and HeLa cells lines and myeloma cell lines. The host cells can be mammalian cells, insect cells, or microorganisms, such as, for example, yeast cells, bacterial cells, or fungal cells.

Once expressed, the recombinant fusion polypeptides can be purified according to standard procedures of the art, including ammonium sulfate precipitation, affinity columns, column chromatography, gel electrophoresis and the like (see, generally, R. Scopes, Protein Purification, Springer-Verlag, N.Y. (1982), Deutscher, Methods in Enzymology Vol. 182: Guide to Protein Purification, Academic Press, Inc. N.Y. (1990)). Substantially pure compositions of at least about 90 to 95% homogeneity are preferred, and 98 to 99% or more homogeneity are most preferred. Once purified, partially or to homogeneity as desired, the polypeptides may then be used (e.g., as immunogens for antibody production).

To facilitate purification of the fusion polypeptides of the invention, the nucleic acids that encode the fusion polypeptides can also include a coding sequence for an epitope or “tag” for which an affinity binding reagent is available. Examples of suitable epitopes include the myc and V-5 reporter genes; expression vectors useful for recombinant production of fusion polypeptides having these epitopes are commercially available (e.g., Invitrogen (Carlsbad Calif.) vectors pcDNA3.1/Myc-His and pcDNA3.1/V5-His are suitable for expression in mammalian cells). Additional expression vectors suitable for attaching a tag to the fusion proteins of the invention, and corresponding detection systems are known to those of skill in the art, and several are commercially available (e.g., FLAG” (Kodak, Rochester N.Y.). Another example of a suitable tag is a polyhistidine sequence, which is capable of binding to metal chelate affinity ligands. Typically, six adjacent histidines are used, although one can use more or less than six. Suitable metal chelate affinity ligands that can serve as the binding moiety for a polyhistidine tag include nitrilo-tri-acetic acid (NTA) (Hochuli, E. (1990) “Purification of recombinant proteins with metal chelating adsorbents” In Genetic Engineering: Principles and Methods, J. K. Setlow, Ed., Plenum Press, NY; commercially available from Qiagen (Santa Clarita, Calif.)).

Introduction of Mutations into Sso7 Sequences

The Sso7 sequences of the invention contain substitutions at face residues. One of skill will recognize that there are many ways of generating these alterations or variants of a given nucleic acid sequence. Such well-known methods include site-directed mutagenesis, PCR amplification using degenerate oligonucleotides, chemical synthesis of a desired oligonucleotide (e.g., in conjunction with ligation and/or cloning to generate large nucleic acids) and other well-known techniques. See, Giliman & Smith, Gene 8:81-97 (1979), Roberts, et al., Nature 328:731-734 (1987) and Sambrook, Innis, and Ausubel (all supra).

In one example of generating an Sso7 sequence of the invention, site directed mutagenesis is used to substitute an amino acid residue for the face residue. The nucleic acid sequence is substituting by synthesizing an oligonucleotide primer that contains the mutation. The primer is hybridized to an Sso7 nucleic acid, e.g., SEQ ID NO:1, and a new sequence amplified. The amplification product with the mutation may then ligated into an expression vector.

Most commonly, polypeptide sequences are altered as above, i.e., by changing the corresponding nucleic acid sequence and expressing the polypeptide. However, polypeptide sequences can also be generated synthetically using commercially available peptide synthesizers to produce a desired polypeptide (see, Merrifield, and Stewart & Young, supra).

Finally, the substituted Sso7 sequences are evaluated by using techniques such as those described below to identify the fusion polymerases that exhibit increased primer/template recognition specificity and/or a processivity that is increased relative to an unmodified polymerase. Typically the processivity of a substituted fusion protein is less than that of a wildtype Sso7 fusion polymerase.

Modulation of Polymerase Activity

The fusion polymerases of the invention exhibit modulated activity that includes both increased processivity relative to an unmodified polymerase and improved primer/template binding specificity. The activities can be measured using techniques that are standard in the art.

A fusion polymerase of the invention often exhibits an increase in primer/template specificity in comparison to a fusion polymerase comprising a wildtype Sso7 sequence, e.g., SEQ ID NO:2. Primer/template specificity is the ability of an enzyme to discriminate between matched primer/template duplexes and mismatched primer/template duplexes. Specificity can be determined, for example, by comparing the relative yield of two reactions, one of which employs a matched primer, and one of which employs a mismatched primer. An enzyme with increased discrimination will have a higher relative yield with the matched primer than with the mismatched primer, i.e., the ratio of the yield in the reaction using the matched primer vs. the reaction using the mismatched primer is about 1 or above. This ratio can then be compared to the yield obtained in a parallel set of reactions employing a fusion polymerase comprising the wildtype Sso7 domain. A fusion protein of the invention typically exhibits at least a 2-fold, often 3-fold or greater increase in the ratio relative to a wildtype fusion polymerase.

Specificity can also be measured, e.g., in a real-time PCR, where the difference in the Ct (threshold cycle) values (ΔCt) between the fully complementary primer/template and the mismatched primer/template can be used to measure primer/template binding specificity of different enzymes. The Ct value represents the number of cycles required to generate a detectable amount of DNA (a “detectable” amount of DNA is typically 2×, usually 5×, 10×, 100× or more above background). A polymerase with enhanced specificity may be able to produce a detectable amount of DNA in a smaller number of cycles by more closely approaching the theoretical maximum amplification efficiency of PCR. Accordingly, a lower Ct value reflects a greater amplification efficiency for the enzyme.

Polymerase processivity can be measured by a variety of methods known to those of ordinary skill in the art. Polymerase processivity is generally defined as the number of nucleotides incorporated during a single binding event of a modifying enzyme to a primed template. For example, a 5′FAM-labeled primer is annealed to circular or linearized ssM13 mp18 DNA to form a primed template. In measuring processivity, the primed template usually is present in significant molar excess to the polymerase so that the chance of any primed template being extended more than once by the polymerase is minimized. The primed template is therefore mixed with the polymerase at a ratio such as approximately 4000:1 (primed DNA:DNA polymerase) in the presence of buffer and dNTPs. MgCl2 is added to initiate DNA synthesis. Samples are quenched at various times after initiation, and analyzed on a sequencing gel. At a polymerase concentration where the median product length does not change with time or polymerase concentration, the length corresponds to the processivity of the enzyme. The processivity of a protein of the invention, i.e., a substituted fusion polymerases that contains a substituted Sso7 nucleic acid binding domain fused to the catalytic domain of a polymerase, is then compared to the processivity of the enzyme without the binding domain (an unmodified polymerase) and the processivity of a fusion polymerase comprising a wildtype Sso7 sequence. The substituted fusion polymerase of the invention exhibits increased processivity relative to the unmodified polymerase and typically, decreased processivity relative to the wildtype Sso7 fusion polymerase.

Enhanced efficiency can also be demonstrated by measuring the increased ability of an enzyme to produce product. Such an analysis measures the stability of the double-stranded nucleic acid duplex indirectly by determining the amount of product obtained in a reaction. For example, a PCR assay can be used to measure the amount of PCR product obtained with a short, e.g., 12 nucleotide in length, primer annealed at an elevated temperature, e.g., 50° C. In this analysis, enhanced efficiency is shown by the ability of a polymerase to produce more product in a PCR reaction using the 12 nucleotide primer annealed at 50° C. when it is joined to a substituted Sso7d sequence in comparison to an unmodified polymerase.

Long PCR may be used as another of demonstrating enhanced efficiency. For example, an enzyme with enhanced efficiency typically allows the amplification of a long amplicon (>5 kb) in a shorter extension time compared to an enzyme with relatively lower efficiency.

Assays such as salt sensitivity can also be used to demonstrate improvement in efficiency of a processive nucleic acid modifying enzyme of the invention. A polymerase, when fused to an Sso7 sequence of the invention exhibits increased tolerance to high salt concentrations, i.e., a processive enzyme with increased processivity can produce more product in higher salt concentrations. For example, a PCR analysis can be performed to determine the amount of product obtained in a reaction using a substituted Sso7 fusion Taq polymerase compared to an unmodified Taq polymerase in reaction conditions with high salt, e.g., 80 mM.

Other methods of assessing enhanced efficiency of the improved polymerases of the invention can be determined by those of ordinary skill in the art using standard assays of the enzymatic activity of a given modification enzyme.

EXAMPLES

Example 1

Construction of Mutant Sso7-ΔTaq Fusions

Sequential PCR was used to introduce the point mutations at the codon encoding W24 in the wild type Sso7d-ΔTaq set forth in SEQ ID NO:2. In the first round of PCR, primer pair M13R (5′ GCGGATAACAATTTCACACAGG 3′; SEQ ID NO:19) and W24T (5′ ATCTCCAAGATCAAGAAAGTAGNGCGTGTGGGCAAGATG 3′; SEQ ID NO:20), and primers pair W24AEVG-B (5′ CTACTTTCTTGATCTTGGAGAT 3′; SEQ ID NO:21) and 1008R (5′ GAGGGCTTTATAAGGCTCG 3′; SEQ ID NO:22) were used to amplify the corresponding regions from pYW1 (see, PCT publication WO 01/92501). The products from the first PCR were purified and combined together with primers M13R and 1008R in a second round of PCR to produce a 400 bp fragment. This fragment was digested with restriction enzymes EcoRI and BstXI and inserted into the corresponding site of pYW1. Primer W24-T contains a degenerate nucleotide at position 23 from the 5′ end, so that the final oligonucleotide will be a mixed population containing 25% each of G, T, A, and C at this position. As the result, the codon GNG encodes one of the following four amino acids, Gly (GGG) (SEQ ID NO:3, bolded and underlined); Val (GTG) (SEQ ID NO:5, bolded and underlined); Glu (GAG) (SEQ ID NO:7, bolded and underlined); or Ala (GCG) in the mutant fusion protein.

Example 2

Mismatch Primer Assay

Based on structural studies (Gao et al., Nature Struct. Biol. 5:782-786, 1998), the W24 residue in wildtype Sso7d is involved in anchoring a base in its unstacked position. This example shows that mutation at this position results in an increase in the primer-template binding specificity of the fusion protein.

Two pairs of primers were used to assess the ability of a PCR enzyme in discriminating matched primers and mismatched primers. The matched primer, 57F (5′ TCCGTTCTTCTTCGTCATAACT 3′; SEQ ID NO:23), is fully complementary to lambda DNA. The mismatched primer, 57F5/6 (5′ TCCGCCCTTCTTCGTCATAACT 3′; SEQ ID NO:24), contains two bases (position 5 and 6 from the 5′ end) that are not complementary to lambda DNA template. The same matched reverse primer, 732R (5′ CCTGACTGTTCGATATATTCACTC 3′; SEQ ID NO:25), is used with 57F or 57F516 to produce a 675 bp amplicon. The cycling program used was: 94° C.-1 mm 20×(94° C.-10 s, 50-74° C.-30 s, 72° C.-1 mm), 72° C.-10 min. The final yield of the PCR products was quantified using a PicoGreen dilution in TE buffer (1:200 PicoGreen:TE) and a fluorescent plate reader. For each enzyme, two PCR amplifications were performed, one using primers 57F and 732R, and the other using primers 57F5/6 and 732R.

The ability of an enzyme to discriminate mismatched and matched primers was determined by comparing the relative yield of the two reactions. The more discriminative enzyme should have a higher relative yield with the matched primer than with the mismatched primer. Table 1 shows the results analyzed at annealing temperature of 64° C. The wild type fusion protein was the least discriminative of matched and mismatched primers. The three mutant proteins showed 2.5-14-fold improvement over the wild type fusion protein.

TABLE 1
Compare match and mismatch discrimination in PCR
Ratio of yield
Enzymes (Match/mismatch) Relative to Sso7d-ΔTaq
Taq 7.7 8.4 x
Sso7d-ΔTaq 0.92   1 x
Sso7d(G)-ΔTaq 3.3 3.6 x
Sso7d(V)-ΔTaq 2.3 2.5 x
Sso7d(E)-ΔTaq 12.8  14 x

Example 3

Processivity Comparison of Wild-Type and Mutant Fusion Proteins

As the binding interaction between Sso7d and dsDNA is important to the enhancement of processivity of the fusion protein, the mutations introduced may abolish the enhancement. The processivity assay (see, PCT publication WO 01/92501) was used to measure the processivity of fusion proteins containing mutations at residue W24 of Sso7d, and the results are summarized in Table 2. Two of the three mutant proteins, W24G and W24V, still maintained a 2-fold higher processivity than the unmodified protein, ΔTaq. The mutant protein containing the W24E change exhibits the same processivity as the unmodified protein. These results suggest that different mutations at this position could have differential effect on the processivity of the fusion protein.

TABLE 2
Processivity comparison
Processivity
Enzymes (in Median product length)
ΔTaq  4-6 nt
Taq 13-18 nt
Sso7d-ΔTaq 31-39 nt
Sso7d(G)-ΔTaq  8-10 nt
Sso7d(V)-ΔTaq  7-11 nt
Sso7d(E)-ΔTaq  4-6 nt

Example 4

Mutant Proteins are More Efficient in Late Cycles of PCR Amplification

The mutant proteins were compared with the wildtype protein in PCR applications. Two criteria were used in the comparison, one was the threshold cycle (Ct) value in qPCR applications, which reflects the efficiency of the enzyme in early cycles of amplification, and the other was the final yield of the PCR product, which reflects the efficiency of the enzyme in late cycles of amplification. SYBR green-based qPCR reactions were used to amplify two beta-actin amplicons, BA481 and BA203, from human genomic DNA. The reactions contained a final concentration of 1×SYBR Green 1 and 2 mM MgCl2. An annealing gradient of 55.8° C. to 72.1° C. was used. The Ct values are summarized in Table 3. Very similar Ct values (<1 cycle difference) were obtained for the wildtype fusion protein and the Sso7d(G) fusion protein, suggesting that there is no significant difference in efficiency between the two enzymes in the early cycles.

The final PCR products were analyzed on 1% agarose gel to assess the relative yields. As shown in FIG. 1, the final yields of both BA481 and BA203 amplicons were significantly higher when the mutant protein, Sso(G)-ΔTaq, was used than when the wildtype fusion protein was used, which is consistent with the mutant protein being more efficient in the late cycles of amplification.

TABLE 3
Comparison of Ct values at 66° C. annealing temperature
Enzyme (10 U/ml) BA481 BA203
Sso7d-ΔTaq 25 24.2
Sso7d(G)-ΔTaq 25.8 23.7

It is understood that the examples and embodiments described herein are for illustrative purposes only and that various modifications or changes in light thereof will be suggested to persons skilled in the art and are to be included within the spirit and purview of this application and scope of the appended claims. All publications, patents, and patent applications cited herein are hereby incorporated by reference in their entirety for all purposes.

TABLE of Sso7d and Sso7d fusion sequences
SEQ ID NO:1
ATGGCAACCGTAAAGTTCAAGTACAAAGGCGAAGAAAAAGAGGTAGACATCTCCAAGATCAAGAAAGT
ATGGCGTGTGGGCAAGATGATCTCCTTCACCTACGACGAGGGCGGTGGCAAGACCGGCCGTGGTGCGG
TAAGCGAAAAGGACGCGCCGAAGGAGCTGCTGCAGATGCTGGAGAAGCAGAAAAAG
SEQ ID NO:2
MATVKFKYKGEEKEVDISKIKKVWRVGKMISFTYDEGGGKTGRGAVSEKDAYKELL
QMLEKQKK
DNA sequence encoding Sso7d(G)-ΔTaq
SEQ ID NO:3
ATGATTACGAATTCGAGCGCAACCGTAAAGTTCAAGTACAAAGGCGAAGAAAAAGAGGTAGACATCTC
CAAGATCAAGAAAGTAGGGCGTGTGGGCAAGATGATCTCCTTCACCTACGACGAGGGCGGTGGCAAGA
CCGGCCGTGGTGCGGTAAGCGAAAAGGACGCGCCGAAGGAGCTGCTGCAGATGCTGGAGAAGCAGAAA
AAGGGCGGCGGTGTCACTAGTCCCAAGGCCCTGGAGGAGGCCCCCTGGCCCCCGCCGGAAGGGGCCTT
CGTGGGCTTTGTGCTTTCCCGCAAGGAGCCCATGTGGGCCGATCTTCTGGCCCTGGCCGCCGCCAGGG
GGGGCCGGGTCCACCGGGCCCCCGAGCCTTATAAAGCCCTCAGGGACCTGAAGGAGGCGCGGGGGCTT
CTCGCCAAAGACCTGAGCGTTCTGGCCCTGAGGGAAGGCCTTGGCCTCCCGCCCGGCGACGACCCCAT
GCTCCTCGCCTACCTCCTGGACCCTTCCAACACCACCCCCGAGGGGGTGGCCCGGCGCTACGGCGGGG
AGTGGACGGAGGAGGCGGGGGAGCGGGCCGCCCTTTCCGAGAGGCTCTTCGCCAACCTGTGGGGGAGG
CTTGAGGGGGAGGAGAGGCTCCTTTGGCTTTACCGGGAGGTGGAGAGGCCCCTTTCCGCTGTCCTGGC
CCACATGGAGGCCACGGGGGTGCGCCTGGACGTGGCCTATCTCAGGGCCTTGTCCCTGGAGGTGGCCG
AGGAGATCGCCCGCCTCGAGGCCGAGGTCTTCCGCCTGGCCGGCCACCCCTTCAACCTCAACTCCCGG
GACCAGCTGGAAAGGGTCCTCTTTGACGAGCTAGGGCTTCCCGCCATCGGCAAGACGGAGAAGACCGG
CAAGCGCTCCACCAGCGCCGCCGTCCTGGAGGCCCTCCGCGAGGCCCACCCCATCGTGGAGAAGATCC
TGCAGTACCGGGAGCTCACCAAGCTGAAGAGCACCTACATTGACCCCTTGCCGGACCTCATCCACCCC
AGGACGGGCCGCCTCCACACCCGCTTCAACCAGACGGCCACGGCCACGGGCAGGCTAAGTAGCTCCGA
TCCCAACCTCCAGAACATCCCCGTCCGCACCCCGCTTGGGCAGAGGATCCGCCGGGCCTTCATCGCCG
AGGAGGGGTGGCTATTGGTGGCCCTGGACTATAGCCAGATAGAGCTCAGGGTGCTGGCCCACCTCTCC
GGCGACGAGAACCTGATCCGGGTCTTCCAGGAGGGGCGGGACATCCACACGGAGACCGCCAGCTGGAT
GTTCGGCGTCCCCCGGGAGGCCGTGGACCCCCTGATGCGCCGGGCGGCCAAGACCATCAACTTCGGGG
TCCTCTACGGCATGTCGGCCCACCGCCTCTCCCAGGAGCTAGCCATCCCTTACGAGGAGGCCCAGGCC
TTCATTGAGCGCTACTTTCAGAGCTTCCCCAAGGTGCGGGCCTGGATTGAGAAGACCCTGGAGGAGGG
CAGGAGGCGGGGGTACGTGGAGACCCTCTTCGGCCGCCGCCGCTACGTGCCAGACCTAGAGGCCCGGG
TGAAGAGCGTGCGGGAGGCGGCCGAGCGCATGGCCTTCAACATGCCCGTCCAGGGCACCGCCGCCGAC
CTCATGAAGCTGGCTATGGTGAAGCTCTTCCCCAGGCTGGAGGAAATGGGGGCCAGGATGCTCCTTCA
GGTCCACGACGAGCTGGTCCTCGAGGCCCCAAAAGAGAGGGCGGAGGCCGTGGCCCGGCTGGCCAAGG
AGGTCATGGAGGGGGTGTATCCCCTGGCCGTGCCCCTGGAGGTGGAGGTGGGGATAGGGGAGGACTGG
CTCTCCGCCAAGGAGGGCATTGATGGCCGCGGCGGAGGCGGGCATCATCATCATCATCATTAATGAGA
TCT
Amino acid sequence of fusion protein Sso7d(G)-ΔTaq
The bolded, underlined residue indicates the amino acid substitution
relative to wildtype Sso7d-ΔTaq.
SEQ ID NO:4
MITNSSATVKFKYKGEEKEVDISKIKKVGRVGKMISFTYDEGGGKTGRGAVSEKDAPKELLQMLEKQK
KGGGVTSPKALEEAPWPPPEGAFVGFVLSRKEPMWADLLALAAARGGRVHRAPEPYKALRDLKEARGL
LAKDLSVLALREGLGLPPGDDPMLLAYLLDPSNTTPEGVARRYGGEWTEEAGERAALSERLFANLWGR
LEGEERLLWLYREVERPLSAVLAHMEATGVRLDVAYLRALSLEVAEEIARLEAEVFRLAGHPFNLNSR
DQLERVLFDELGLPAIGKTEKTGKRSTSAAVLEALREAHPIVEKILQYRELTKLKSTYIDPLPDLIHP
RTGRLHTRFNQTATATGRLSSSDPNLQNIPVRTPLGQRIRRAFIAEEGWLLVALDYSQIELRVLAHLS
GDENLTRVFQEGRDIHTETASWMFGVPREAVDPLMRRAAKTINFGVLYGMSAHRLSQELAIPYEEAQA
FIERYFQSFPKVRAWIEKTLEEGRRRGYVETLFGRRRYVPDLEARVKSVREAAERMAFNMPVQGTAAD
LMKLAMVKLFPRLEEMGARMLLQVHDELVLEAPKERAEAVARLAKEVMEGVYPLAVPLEVEVGIGEDW
LSAKEGIDGRGGGGHHHHHH
DNA sequence encoding Sso7d(V)-ΔTaq
SEQ ID NO:5
ATGATTACGAATTCGAGCGCAACCGTAAAGTTCAAGTACAAAGGCGAAGAAAAAGAGGTAGACATCTC
CAAGATCAAGAAAGTAGTGCGTGTGGGCAAGATGATCTCCTTCACCTACGACGAGGGCGGTGGCAAGA
CCGGCCGTGGTGCGGTAAGCGAAAAGGACGCGCCGAAGGAGCTGCTGCAGATGCTGGAGAAGCAGAAA
AAGGGCGGCGGTGTCACTAGTCCCAAGGCCCTGGAGGAGGCCCCCTGGCCCCCGCCGGAAGGGGCCTT
CGTGGGCTTTGTGCTTTCCCGCAAGGAGCCCATGTGGGCCGATCTTCTGGCCCTGGCCGCCGCCAGGG
GGGGCCGGGTCCACCGGGCCCCCGAGCCTTATAAAGCCCTCAGGGACCTGAAGGAGGCGCGGGGGCTT
CTCGCCAAAGACCTGAGCGTTCTGGCCCTGAGGGAAGGCCTTGGCCTCCCGCCCGGCGACGACCCCAT
GCTCCTCGCCTACCTCCTGGACCCTTCCAACACCACCCCCGAGGGGGTGGCCCGGCGCTACGGCGGGG
AGTGGACGGAGGAGGCGGGGGAGCGGGCCGCCCTTTCCGAGAGGCTCTTCGCCAACCTGTGGGGGAGG
CTTGAGGGGGAGGAGAGGCTCCTTTGGCTTTACCGGGAGGTGGAGAGGCCCCTTTCCGCTGTCCTGGC
CCACATGGAGGCCACGGGGGTGCGCCTGGACGTGGCCTATCTCAGGGCCTTGTCCCTGGAGGTGGCCG
AGGAGATCGCCCGCCTCGAGGCCGAGGTCTTCCGCCTGGCCGGCCACCCCTTCAACCTCAACTCCCGG
GACCAGCTGGAAAGGGTCCTCTTTGACGAGCTAGGGCTTCCCGCCATCGGCAAGACGGAGAAGACCGG
CAAGCGCTCCACCAGCGCCGCCGTCCTGGAGGCCCTCCGCGAGGCCCACCCCATCGTGGAGAAGATCC
TGCAGTACCGGGAGCTCACCAAGCTGAAGAGCACCTACATTGACCCCTTGCCGGACCTCATCCACCCC
AGGACGGGCCGCCTCCACACCCGCTTCAACCAGACGGCCACGGCCACGGGCAGGCTAAGTAGCTCCGA
TCCCAACCTCCAGAACATCCCCGTCCGCACCCCGCTTGGGCAGAGGATCCGCCGGGCCTTCATCGCCG
AGGAGGGGTGGCTATTGGTGGCCCTGGACTATAGCCAGATAGAGCTCAGGGTGCTGGCCCACCTCTCC
GGCGACGAGAACCTGATCCGGGTCTTCCAGGAGGGGCGGGACATCCACACGGAGACCGCCAGCTGGAT
GTTCGGCGTCCCCCGGGAGGCCGTGGACCCCCTGATGCGCCGGGCGGCCAAGACCATCAACTTCGGGG
TCCTCTACGGCATGTCGGCCCACCGCCTCTCCCAGGAGCTAGCCATCCCTTACGAGGAGGCCCAGGCC
TTCATTGAGCGCTACTTTCAGAGCTTCCCCAAGGTGCGGGCCTGGATTGAGAAGACCCTGGAGGAGGG
CAGGAGGCGGGGGTACGTGGAGACCCTCTTCGGCCGCCGCCGCTACGTGCCAGACCTAGAGGCCCGGG
TGAAGAGCGTGCGGGAGGCGGCCGAGCGCATGGCCTTCAACATGCCCGTCCAGGGCACCGCCGCCGAC
CTCATGAAGCTGGCTATGGTGAAGCTCTTCCCCAGGCTGGAGGAAATGGGGGCCAGGATGCTCCTTCA
GGTCCACGACGAGCTGGTCCTCGAGGCCCCAAAAGAGAGGGCGGAGGCCGTGGCCCGGCTGGCCAAGG
AGGTCATGGAGGGGGTGTATCCCCTGGCCGTGCCCCTGGAGGTGGAGGTGGGGATAGGGGAGGACTGG
CTCTCCGCCAAGGAGGGCATTGATGGCCGCGGCGGAGGCGGGCATCATCATCATCATCATTAATGAGA
TCT
Amino acid sequence of fusion protein Sso7d(V)-ΔTaq
The bolded, underlined residue indicates the amino acid substitution
relative to wildtype Sso7d-ΔTaq
SEQ ID NO:6
MITNSSATVKFKYKGEEKEVDTSKIKKVVRVGKMISFTYDEGGGKTGRGAVSEKDAPKELLQMLEKQK
KGGGVTSPKALEEAPWPPPEGAFVGFVLSRKEPMWADLLALAAARGGRVHRAPEPYKALRDLKEARGL
LAKDLSVLALREGLGLPPGDDPMLLAYLLDPSNTTPEGVARRYGGEWTEEAGERAALSERLFANLWGR
LEGEERLLWLYREVERPLSAVLAHMEATGVRLDVAYLRALSLEVAEEIARLEAEVFRLAGHPFNLNSR
DQLERVLFDELGLPAIGKTEKTGKRSTSAAVLEALREAHPIVEKILQYRELTKLKSTYIDPLPDLIHP
RTGRLHTRFNQTATATGRLSSSDPNLQNTPVRTPLGQRIRPAFTAEEGWLLVALDYSQIELRVLAHLS
GDENLIRVFQEGRDIHTETASWMFGVPREAVDPLMRPAAKTINFGVLYGMSAHRLSQELAIPYEEAQA
FIERYFQSFPKVPAWIEKTLEEGRRRGYVETLFGRRRYVPDLEARVKSVREAAERMAFNMPVQGTAAD
LMKLAMVKLFPRLEEMGARMLLQVHDELVLEAPKERAEAVARLAKEVMEGVYPLAVPLEVEVGIGEDW
LSAKEGIDGRGGGGHHHHHH
DNA sequence encoding Sso7d(E)-ΔTaq
SEQ ID NO:7
ATGATTACGAATTCGAGCGCAACCGTAAAGTTCAAGTACAAAGGCGAAGAAAAAGAGGTAGACATCTC
CAAGATCAAGAAAGTAGAGCGTGTGGGCAAGATGATCTCCTTCACCTACGACGAGGGCGGTGGCAAGA
CCGGCCGTGGTGCGGTAAGCGAAAAGGACGCGCCGAAGGAGCTGCTGCAGATGCTGGAGAAGCAGAAA
AAGGGCGGCGGTGTCACTAGTCCCAAGGCCCTGGAGGAGGCCCCCTGGCCCCCGCCGGAAGGGGCCTT
CGTGGGCTTTGTGCTTTCCCGCAAGGAGCCCATGTGGGCCGATCTTCTGGCCCTGGCCGCCGCCAGGG
GGGGCCGGGTCCACCGGGCCCCCGAGCCTTATAAAGCCCTCAGGGACCTGAAGGAGGCGCGGGGGCTT
CTCGCCAAAGACCTGAGCGTTCTGGCCCTGAGGGAAGGCCTTGGCCTCCCGCCCGGCGACGACCCCAT
GCTCCTCGCCTACCTCCTGGACCCTTCCAACACCACCCCCGAGGGGGTGGCCCGGCGCTACGGCGGGG
AGTGGACGGAGGAGGCGGGGGAGCGGGCCGCCCTTTCCGAGAGGCTCTTCGCCAACCTGTGGGGGAGG
CTTGAGGGGGAGGAGAGGCTCCTTTGGCTTTACCGGGAGGTGGAGAGGCCCCTTTCCGCTGTCCTGGC
CCACATGGAGGCCACGGGGGTGCGCCTGGACGTGGCCTATCTCAGGGCCTTGTCCCTGGAGGTGGCCG
AGGAGATCGCCCGCCTCGAGGCCGAGGTCTTCCGCCTGGCCGGCCACCCCTTCAACCTCAACTCCCGG
GACCAGCTGGAAAGGGTCCTCTTTGACGAGCTAGGGCTTCCCGCCATCGGCAAGACGGAGAAGACCGG
CAAGCGCTCCACCAGCGCCGCCGTCCTGGAGGCCCTCCGCGAGGCCCACCCCATCGTGGAGAAGATCC
TGCAGTACCGGGAGCTCACCAAGCTGAAGAGCACCTACATTGACCCCTTGCCGGACCTCATCCACCCC
AGGACGGGCCGCCTCCACACCCGCTTCAACCAGACGGCCACGGCCACGGGCAGGCTAAGTAGCTCCGA
TCCCAACCTCCAGAACATCCCCGTCCGCACCCCGCTTGGGCAGAGGATCCGCCGGGCCTTCATCGCCG
AGGAGGGGTGGCTATTGGTGGCCCTGGACTATAGCCAGATAGAGCTCAGGGTGCTGGCCCACCTCTCC
GGCGACGAGAACCTGATCCGGGTCTTCCAGGAGGGGCGGGACATCCACACGGAGACCGCCAGCTGGAT
GTTCGGCGTCCCCCGGGAGGCCGTGGACCCCCTGATGCGCCGGGCGGCCAAGACCATCAACTTCGGGG
TCCTCTACGGCATGTCGGCCCACCGCCTCTCCCAGGAGCTAGCCATCCCTTACGAGGAGGCCCAGGCC
TTCATTGAGCGCTACTTTCAGAGCTTCCCCAAGGTGCGGGCCTGGATTGAGAAGACCCTGGAGGAGGG
CAGGAGGCGGGGGTACGTGGAGACCCTCTTCGGCCGCCGCCGCTACGTGCCAGACCTAGAGGCCCGGG
TGAAGAGCGTGCGGGAGGCGGCCGAGCGCATGGCCTTCAACATGCCCGTCCAGGGCACCGCCGCCGAC
CTCATGAAGCTGGCTATGGTGAAGCTCTTCCCCAGGCTGGAGGAAATGGGGGCCAGGATGCTCCTTCA
GGTCCACGACGAGCTGGTCCTCGAGGCCCCAAAAGAGAGGGCGGAGGCCGTGGCCCGGCTGGCCAAGG
AGGTCATGGAGGGGGTGTATCCCCTGGCCGTGCCCCTGGAGGTGGAGGTGGGGATAGGGGAGGACTGG
CTCTCCGCCAAGGAGGGCATTGATGGCCGCGGCGGAGGCGGGCATCATCATCATCATCATTAATGAGA
TCT
Amino acid sequence of fusion protein Sso7d(E)-ΔTaq
The bolded, underlined residue indicates the amino acid substitution
relative to wildtype Sso7d-ΔTaq
SEQ ID NO:8
MITNSSATVKFKYKGEEKEVDISKIKKVERVGKMISFTYDEGGGKTGRGAVSEKDAPKELLQMLEKQK
KGGGVTSPKALEEAPWPPPEGAFVGFVLSRKEPMWADLLALAAARGGRVHRAPEPYKALRDLKEARGL
LAKDLSVLALREGLGLPPGDDPMLLAYLLDPSNTTPEGVARRYGGEWTEEAGERAALSERLFANLWGR
LEGEERLLWLYREVERPLSAVLAHMEATGVRLDVAYLRALSLEVAEEIARLEAEVFRLAGHPFNLNSR
DQLERVLFDELGLPATGKTEKTGKRSTSAAVLEALREAHPIVEKILQYRELTKLKSTYIDPLPDLIHP
RTGRLHTRFNQTATATGRLSSSDPNLQNIPVRTPLGQRIRRAFIAEEGWLLVALDYSQIELRVLAHLS
GDENLIRVFQEGRDIHTETASWMFGVPREAVDPLMRRAAKTINFGVLYGMSAHRLSQELAIPYEEAQA
FIERYFQSFPKVRAWIEKTLEEGRRRGYVETLFGRRRYVPDLEARVKSVREAAERMAFNMPVQGTAAD
LMKLAMVKLFPRLEEMGARMLLQVHDELVLEAPKERAEAVARLAKEVMEGVYPLAVPLEVEVGIGEDW
LSAKEGIDGRGGGGHHHHHH

Claims

What is claimed is:

1. An Sso7 polymerase conjugate protein comprising an Sso7 domain linked to a polymerase domain; wherein the Sso7 domain comprises SEQ ID NO:9, and has a glycine, alanine, or valine replacement amino acid at a face residue position that is the tryptophan residue at position 24, as determined with reference to SEQ ID NO:2;

wherein the processivity of the Sso7 polymerase conjugate is greater than the processivity of the polymerase when it is not fused to the Sso7 domain.

2. The Sso7 polymerase conjugate protein of claim 1, wherein the replacement amino acid residue is glycine.

3. The Sso7 polymerase conjugate protein of claim 1, wherein the replacement amino acid residue is valine.

4. The Sso7 polymerase conjugate protein of claim 1, wherein the polymerase domain has thermally stable polymerase activity.

5. The Sso7 polymerase conjugate protein of claim 4, wherein the polymerase domain is a family A polymerase domain.

6. The Sso7 polymerase conjugate protein of claim 5, wherein the polymerase domain is a ΔTaq polymerase domain.

7. The Sso7 polymerase conjugate protein of claim 4, wherein the polymerase domain is a family B polymerase domain.

8. The Sso7 polymerase conjugate protein of claim 7, wherein the polymerase domain is a Pyrococcus polymerase domain.

9. The Sso7 polymerase conjugate protein of claim 1, wherein replacement of the face residue increases the polymerase primer/template binding specificity in comparison to an Sso7 polymerase fusion protein comprising SEQ ID NO:9.

Resources

Images & Drawings included:

Sources:

Similar patent applications:

Recent applications in this class:

Recent applications for this Assignee: