Patent application title:

OsK1 derivatives

Publication number:

-

Publication date:
Application number:

11/571,005

Filed date:

2005-06-27

✅ Patent granted

Patent number:

US 7,745,575 B1

Grant date:

2010-06-29

PCT filing:

WO; PCT/EP2005/006897; 20050627

PCT publication:

WO; WO2006/002850; 20060112

Examiner:

David Lukton

Adjusted expiration:

2025-07-25

Abstract:

OsK1 is a 38-residue peptide with 3 disulphide bridges and is found in the venom of the scorpion Orthochirus scrobiculosus. It is potently active on voltage-gated K+ channels Kv1.1, Kv1.2 and Kv1.3, and moderately active on the type 1 intermediate-conductance Cat2+-activated channel KCa3.1. Derivatives of OsK1, particularly involving truncation or point mutations, have been developed to enhance the activity against and selectivity for the Kv1.3 channel. This renders the derivatives likely candidates for the treatment of autoimmune diseases, including multiple sclerosis. Such use may be alone or in combination therapy with maurotoxin, another scorpion toxin.

Inventors:

Assignee:

Interested in similar patents?

Get notified when new applications in this technology area are published.

Classification:

C07K14/00 IPC

Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof

Description

CROSS REFERENCE TO PRIOR APPLICATIONS

This application is the U.S. national phase of International Application No. PCT/EP2005/006897 filed Jun. 27, 2005, which claims priority from Great Britain Application Serial No. 0414272.5 filed Jun. 25, 2004.

REFERENCE TO SEQUENCE LISTING

A Sequence Listing is provided in this patent document as a .txt file entitled, “50538018001_Sequence_Listing,” modified Jan. 12, 2010 (size: 21.7 KB).

The content of this file is herein incorporated by reference.

The invention relates to derivatives of OsK1 and to pharmaceutical compositions containing them. The derivatives are useful in the treatment of neurological disorders including multiple sclerosis.

BACKGROUND

OsK1 is a 38-residue peptide with 3 disulphide bridges and is found in the venom of the scorpion Orthochirus scrobiculosus. It is one of a number of short chain scorpion toxins which contain between 29 and 39 amino acid residues, are crosslinked by 3 or 4 disulphide bridges and are active on several potassium channel subtypes, both voltage gated and calcium activated. These short chain scorpion toxins have been classified by Tytgat et al., Trends Pharmacol. Sci., 20(11), 444-447, 1999. OsK1 is a group 3 toxin and is shown below in Table 1 along with the other group 3 toxins and one group 6 toxin, Maurotoxin (MTx).

TABLE 1
3.1 KTx GVEINVKCSGSPQCLKPCKDA-GMR-FGKCMNR-KCHCTPK
3.2 AgTx2 GVPINVSCTGSPQCIKPCKDA-GMR-FGKCMNR-KCHCTPK
3.3 AgTx3 GVPINVPCTGSPQCIKPCKDA-GMR-FGKCMNR-KCHCTPK
3.4 AgTx1 GVPINVKCTGSPQCLKPCKDA-GMR-FGKCING-KCHCTPK
3.5 KTx2 VRIPVSCKHSGQCLKPCKDA-GMR-FGKCMNR-KCDCTPK
3.6 BmKTx VGINVKCKHSGQCLKPCKDA-GMR-FGKCING-KCDCTPK
3.7 OsK1 GVIINVKCKISRQCLEPCKKA-GMR-FGKCMNG-KCHCTPK
3.8 Bs6 GVPINVKCRGSPQCIQPCRDA-GMR-FGKCMNG-KCHCTPQ
6.2 MTx VSCTGSKDCYAPCRKQTGCPNA-KCINK-SCKCYGC

Both the mammalian voltage-gated K+ channel Kv1.3 and the type 1 intermediate-conductance Ca2+-activated channel KCa3.1 (also referred to as IK1) are expressed in immune T-cells. Their relative abundance at the T-cell surface depends on the state of lymphocyte activation and differentiation. The potassium channel phenotype varies during the progression from the resting to the activated T-cell state, and from naive to effector memory T-cells. Therefore, blockers of these channel types possess potent immunomodulatory properties that could be beneficial in the treatment of human diseases, such as multiple sclerosis. Multiple sclerosis is a chronic inflammatory autoimmune disease of the central nervous system, characterised by progressive demyelination and axonal damage caused by reactive autoimmune lymphocytes. Activation and proliferation of these cells (effector memory T-cells) relies upon Kv1.3 channels (and possibly IK1 channels), and can be blocked by Kv1.3 channel blockers. Demyelination also involves unmasking of the Kv1.1 and Kv1.2 subtypes, which provokes leak currents and a decrease in nervous transmission (by altering the action potential).

We have found that OsK1, alone amongst the short chain scorpion toxins, is potently active on Kv1.1, Kv1.2 and Kv1.3 channels, and moderately active on IK1. It would be desirable to find synthetic peptides which retain or enhance this property- or part of this property- and/or block more potently the IK1 subtype.

Such derivatives may also be useful against other human disorders, such as graft rejection, rheumatoid arthritis, bone degradation, and cancer (abnormal cell proliferation).

BRIEF DESCRIPTION OF THE DRAWINGS

FIG. 1 is a series of HPLC profiles of Osk1 derivatives.

THE INVENTION

The invention provides an OsK1 derivative in which up to seven N-terminal amino acid residues have been omitted and/or in which up to four amino acid residues have been point mutated. Preferably, the replacement amino acid residue(s) are in positions 8 to 38 and occur in the corresponding position in another group 3 short chain scorpion toxin or in maurotoxin.

Table 2 lists the OsK1 derivatives which the inventors have studied. Not all of them are within the scope of the invention. Differences from OsK1 are shown in bold. It will be understood that Δn indicates that the peptide present in position n in OsK1 has been omitted and that r indicates that the peptide present in position n in OsK1 has been replaced with a peptide X. Ac stands for acetyl and Val for valeryl.

A preferred peptide is [K16,D20]-OsK1 and this has been abbreviated as AOsK1. The substitution of lysine for glutamic acid at position 16 in OsK1 and of aspartic acid for lysine at position 20 in OsK1 follow the norms in those positions in kaliotoxins 1 and 2, agitoxins 1, 2 and 3 and Buthus martensi kaliotoxin. AOsK1 is about five times more potent on the Kv1.3 channel than OsK1 itself and is the most potent Kv1.3 channel blocker characterized so far. Since AOsK1 also shares the same activity on IK1, it makes this derivative a better lead compound than OsK1.

TABLE 2
OsK1     GVIINVKCKISRQCLEPCKKAGMRFGKCMNGKCHCTPK-OH
OsK1-NH2     GVIINVKCKISRQCLEPCKKAGMRFGKCMNGKCHCTPK-NH2
Ac-OsK1-NH2 Ac-GVIINVKCKISRQCLEPCKKAGMRFGKCMNGKCHCTPK-NH2
1]-OsK1-NH2     -VIINVKCKISRQCLEPCKKAGMRFGKCMNGKCHCTPK-NH2
[A34]-OsK1     GVIINVKCKISRQCLEPCKKAGMRFGKCMNGKCACTPK-OH
[K16]-OsK1     GVIINVKCKISRQCLKPCKKAGMRFGKCMNGKCHCTPK-OH
[D20]-OsK1     GVIINVKCKISRQCLEPCKDAGMRFGKCMNGKCHCTPK-OH
AOsK1     GVIINVKCKISRQCLKPCKDAGMRFGKCMNGKCHCTPK-OH
Val-AOsK1 Val-GVIINVKCKISRQCLKPCKDAGMRFGKCMNGKCHCTPK-OH
AOsK1-NH2     GVIINVKCKISRQCLKPCKDAGMRFGKCMNGKCHCTPK-NH2
1]-AOsK1     -VIINVKCKISRQCLKPCKDAGMRFGKCMNGKCHCTPK-OH
1]-AOsK1-NH2     -VIINVKCKISRQCLKPCKDAGMRFGKCMNGKCHCTPK-NH2
1,T2]-AOsK1     -TIINVKCKISRQCLKPCKDAGMRFGKCMNGKCHCTPK-OH
1-4]-AOsK1     ----NVKCKISRQCLKPCKDAGMRFGKCMNGKCHCTPK-OH
1-6]-AOsK1     ------KCKISRQCLKPCKDAGMRFGKCMNGKCHCTPK-OH
1-7]-AOsK1     -------CKISRQCLKPCKDAGMRFGKCMNGKCHCTPK-OH
36-38]-AOsK1     GVIINVKCKISRQCLKPCKDAGMRFGKCMNGKCHC----OH
[K3]-AOsK1-NH2     GVKINVKCKISRQCLKPCKDAGMRFGKCMNGKCHCTPK-NH2
[P12]-AOsK1     GVIINVKCKISPQCLKPCKDAGMRFGKCMNGKCHCTPK-OH
[N25]-AOsK1     GVIINVKCKISRQCLKPCKDAGMRNGKCMNGKCHCTPK-OH
[R31]-AOsK1     GVIINVKCKISRQCLKPCKDAGMRFGKCMNRKCHCTPK-OH
[Y36]-AOsK1     GVIINVKCKISRQCLKPCKDAGMRFGKCMNGKCHCYPK-OH
Ac-[K12,R19]-AOsK1 Ac-GVIINVKCKISKQCLKPCRDAGMRFGKCMNGKCHCTPK-OH

Truncating the N-terminal of OsK1 or its derivatives reduces the activity of the resultant peptide against the Kv1.2 channel and, to a lesser extent, against the Kv1.1 channel, and therefore enhances the selectivity of the resultant peptide for the Kv1.3 channel. Further, truncating the N-terminal of OsK1 or its derivatives reduces the toxicity of the resultant peptide, possibly due to the decreased affinity towards the Kv1.1 and Kv1.2 channels. By contrast, truncating the C-terminal caused significant loss of activity against all channels measured.

A point mutation at position 2 of AOsK1, coupled with the omission of the peptide at position 1, gave a peptide [Δ1,T2]-AOsK1 possessing an N-terminal domain (i.e. TIINVK) that is identical to those of margatoxin and noxiustoxin, two scorpion toxins potently active on Kv1.3 channel. The peptides truncated at the N-terminal, whether or not mutated at position 2, showed good activity against the Kv3.2 channel.

Docking studies have indicated that His in position 34 of OsK1 appeared to be involved in Kv1.2 and Kv1.3 docking, so replacement of this peptide, e.g. by Ala, is desirable, leading to higher selectivity for Kv1.3. Such studies have also suggested the inclusion of Lys at position 3 in place of Ile.

Asparagine at position 25 has been reported as important in the affinity of toxins with the Kv1.3 channel and arginine at position 31 is homologous with other toxins active on the Kv1.3 channel. In fact R at position 31 provides an AOsK1 derivative which has strong affinity to all of the Kv1.1, Kv1.2 and Kv1.3 channels.

OsK1 derivatives according to the invention may be acetylated at the N-terminal or may be amidated at the C-terminal in conventional manner. Another approach is to terminate the OsK1 derivative with a fatty acid having from 4 to 10 carbon atoms and from 0 to 2 carbon-carbon double bonds, or a derivative thereof such as an co-amino-fatty acid. Either the N-terminal or the C-terminal may be so terminated. This should result in increased water solubility for the derivative, and enhanced bioavailability. The preferred fatty acid is valeric acid (or, for the C-terminal, ω-amino-valeric acid).

The invention further provides a pharmaceutical composition comprising an OsK1 derivative as described above in admixture with a pharmaceutically acceptable diluent or carrier.

Furthermore, the invention also provides the use of OsK1 or of an OsK1 derivative as described above for the preparation of a medicament for the treatment of autoimmume diseases, including but not limited to multiple sclerosis.

Maurotoxin is the most potent inhibitor amongst the short chain scorpion toxins of the calcium activated potassium channel subtype IK1. Replacing amino acid residue(s) occurring in the corresponding position(s) in maurotoxin may lead to the derivative having an enhanced activity against IK1 although the replacement is tyrosine for threonine at position 36 has not been shown to achieve this. In the absence of a single compound combining high activity on Kv1.3 with improved activity on IK1, we have investigated the possibility of combination therapy using an OsK1 derivative according to the invention with MTx. As shown below, the use of AOsK1 and MTx together does appear to be better than the use of either alone. Such combination therapy is thus included within the invention.

EXPERIMENTAL

OsK1 and the OsK1 derivatives listed in Table 2 were prepared by chemical synthesis using a peptide synthesizer (Model 433A, Applied Biosystems Inc.). Peptide chains were assembled stepwise on 0.25 mmol of HMP resin (1% cross-linked; 0.65 mmol of amino group/g) using 1 mmol of Nα-(9-fluorenyl)methyloxycarbonyl (Fmoc) L-amino acid derivatives. Side chain-protecting groups for trifunctional residues were: trityl for cysteine, asparagine, histidine and glutamine; t-butyl for serine, threonine, tyrosine, aspartate and glutamate; 2,2,4,6,7-pentamethyldihydrobenzofuran-5-sulfonyl for arginine; and t-butyloxycarbonyl for lysine. Nα-amino groups were deprotected by successively treating with 18 and 20% (v/v) piperidine/N-methylpyrrolidone for 3 and 8 min, respectively. After three washes with N-methylpyrrolidone, the Fmoc-amino acid derivatives were coupled (20 min) as their hydroxybenzotriazole active esters in N-methylpyrrolidone (4-fold excess). After peptides were assembled, and removal of N-terminal Fmoc groups, the peptide resins (ca. 1.5 g) were treated under stirring for 3 h at 25° C. with mixtures of trifluoroacetic acid/H2O/thioanisole/ethanedithiol (73:11:11:5, v/v) in the presence of crystalline phenol (2.1 g) in final volumes of 30 ml per gram of peptide resins. The peptide mixtures were filtered, precipitated and washed twice with cold diethyloxide. The crude peptides were pelleted by centrifugation (3,200×g; 8 min). The crude peptides were then dissolved in H2O and freeze dried. Reduced AOsK1 analogues were solubilized at a concentration of ca. 0.6 mM in 0.2 M Tris-HCl buffer (pH 8.3) for oxidative folding (40 to 120 h depending on the peptide, 20° C.). The folded/oxidized peptides were purified to homogeneity by reversed-phase high pressure liquid chromatography (HPLC) (C18 Aquapore ODS, 20 μm, 250×10 mm; PerkinElmer Life Sciences) by means of a 60-min linear gradient of 0.08% (v/v) trifluoroacetic acid/H2O (buffer A) with 0 to 40% of 0.1% (v/v) trifluoroacetic acid/acetonitrile (buffer B), at a flow rate of 6 ml/min (λ=230 nm). The purity and identity of each peptide were assessed by: (i) analytical C18 reversed-phase HPLC (C18 Lichrospher 5 μm, 4×200 mm; Merck) using a 60 min linear gradient of buffer A with 0-60% of buffer B, at a flow rate of 1 ml/min; (ii) amino acid analysis after peptide acidolysis [6 M HCl/2% (w/v) phenol, 20 h, 120° C., N2 atmosphere]; and (iii) molecular mass determination by matrix-assisted laser desorption ionization-time of flight (MALDI-TOF) spectrometry. Some of the MS results are shown in Table 3 below and some of the HPLC profiles are shown in FIG. 1.

TABLE 3
Mass spectra of OsK1 and its derivatives
Peptide Theoretical Experimental
OsK1 4205.24 4205.57
[K16]-OsK1 4204.3 4204.64
[D20]-OsK1 4192.15 4189.94
AOsK1 4191.21 4192.02
[P12]-AOsK1 4132.09 4132.00
[Y36]-AOsK1 4253.28 4253.70
Val-AOsK1 4290.26 4280.68

Electrophysiological experiments were carried out at 22-24° C. using the patch-clamp whole-cell recording mode. Cells were bathed with mammalian Ringer's solution (in mM): 160 NaCl, 4.5 KCl, 2 CaCl2, 1 MgCl2, and 10 HEPES (pH 7.4 with NaOH), with an osmolarity of 290-320 mOsm. When AOsK1 derivatives were applied, 0.1% bovine serum albumin was added to the Ringer's solution. A syringe-driven perfusion device was used to exchange the external recording bath solution. Two internal pipette solutions were used, one for measuring voltage-gated K+ currents that contained (in mM): 155 KF, 2 MgCl2, 10 HEPES, and 10 EGTA (pH 7.2 with KOH), with an osmolarity of 290-320 mOsm and another for measuring Ca2+-activated K+ currents that contained (in mM): 135 K-aspartate, 8.7 CaCl2, 2 MgCl2, 10 EGTA, 10 HEPES (pH 7.2 with KOH), with an osmolarity of 290-320 mOsm. A free [Ca2+]i of 1 μM was calculated. All currents through voltage-gated K+ channels were elicited by 200 ms depolarising voltage steps from −80 to +40 mV. Potassium currents through KCa1.1, KCa2.1 and KCa3.1 were elicited by 1 μM internal [Ca2+]i and 400 ms voltage ramps from −120 to 0 mV (for KCa3.1 channel and KCa1.1 channel) and from −120 to +40 mV (for KCa2.1 channel). Electrodes were pulled from glass capillaries (Science Products, Germany), and fire-polished to resistances of 2.5-5 MΩ. Membrane currents were measured with an EPC-9 or EPC-10 patch-clamp amplifier (HEKA Elektronik, Lambrecht, Germany) interfaced to a Macintosh computer running acquisition and analysis software (Pulse and PulseFit). When voltage-gated K+ currents were measured, the capacitive and leak currents were subtracted using a P/10 procedure. Series resistance compensation (>80%) was used for currents above 2 nA. The holding potential was −80 mV in all experiments. Data analyses were performed with Igor Pro (WaveMetrics, Oregon, USA), and IC50 values were deduced by fitting a modified Hill equation to the data (Itoxin/Icontrol=1/[1+([AOsK1 analogue]/IC50)], where I is the peak current (for voltage-gated K+ channels), or the slope of the ramp current, i.e. the conductance measured between −100 and −60 mV (for Ca2+-activated K+ channels) to the normalized data points obtained with four different AOsK1 analogue concentrations. The results are shown in Table 4.

TABLE 4
ID50 ID50 ID50 ID50 ID50
mKv1.1 hKv1.2 mKv1.3 hKv3.2 hIK1
Peptide (nM) (nM) (nM) (nM) (nM)
OsK1  0.6 ± 0.04  5.4 ± 1.89 0.014 ± 0.001 >1 μM 225 ± 10
OsK1-NH2  0.3 ± 0.03 26 ± 6 0.019 ± 0.003 >1 μM >1 μM
Ac-OsK1-NH2 1.33 ± 0.1 ~1.3 μM 0.075 ± 0.005 >1 μM >1 μM
1]-OsK1-NH2 2.06 ± 0.2  85 ± 11 0.038 ± 0.003 >1 μM 620 ± 50
[A34]-OsK1 15.8 ± 2.8 65 ± 3 0.034 ± 0.008 >1 μM >1 μM
[K16]-OsK1  0.63 ± 0.05  5.23 ± 0.22 0.067 ± 0.006 n/a 151 ± 21
[D20]-OsK1  2.95 ± 0.24 77.8 ± 9.2 0.037 ± 0.007 n/a 716 ± 1 
AOsK1  0.4 ± 0.01  2.96 ± 0.01 0.003 ± 0.001 >1 μM 228 ± 92
Val-AOsK1 14.2 ± 1.3 >1 μM 0.328 ± 0.032 n/a >1 μM
AOsK1-NH2  0.36 ± 0.04 19 ± 3 0.075 ± 0.006   1 ± 0.2 μM >1 μM
1]-AOsK1  0.19 ± 0.01 30 ± 7 0.025 ± 0.002 95 ± 10 425 ± 25
1]-AOsK1-NH2  0.37 ± 0.02 41 ± ? 0.067 ± 0.007 >1 μM >1 μM
1, T2]-AOsK1  0.36 ± 0.04 100 ± 5  0.021 ± 0.004 65 ± 10 >1 μM
1-4]-AOsK1 2.67 ± 0.5 245 ± 77 0.038 ± 0.001 >1 μM >1 μM
1-6]-AOsK1 2.18 ± 0.3 634 ± 5  0.045 ± 0.002 >1 μM >1 μM
1-7]-AOsK1  7.9 ± 1.2 >1 μM 0.114 ± 0.005 >1 μM >1 μM
36-38]-AOsK1 366 ± 63 >1 μM 1.85 ± 0.7  >1 μM >1 μM
[K3]-AOsK1-NH2  0.2 ± 0.02 22 ± 4 0.100 ± 0.015 >1 μM >1 μM
[P12]-AOsK1  3.18 ± 0.11 196 ± 13 0.059 ± 0.003 n/a 2600 ± 400
[N25]-AOsK1  791 ± 121 212 ± 3  5.4 ± 0.9 >1 μM >1 μM
[R31]-AOsK1  0.28 ± 0.02  0.43 ± 0.03 0.045 ± 0.006 220 ± 20  >1 μM
[Y36]-AOsK1 34.4 ± 0.3 231.8 ± 0.1  0.122 ± 0.007 n/a 885 ± 18
Ac-[K12, R19]-AOsK1 2.76 ± 0.4 101 ± 3  0.090 ± 0.004 1.5 ± 0.2 μM >1 μM

No activity was detected at micromolar concentrations for any of the synthesized peptides on voltage-gated channels hKv1.4, Kv1.5, hKv1.6, mKv1.7, mKv3.1 and hKv11.x (also referred to as HERG, human ether-a-go-go related gene) or on Ca2+-activated K+ channels hKCa1.1 (also referred to as BK) and hKCa2.1 (also referred to as SK1).

The peptides were evaluated for toxicity in vivo by determining the 50% lethal dose (LD50) after intracerebroventricular injection into 20 g C57/BL6 mice. Groups of six to eight mice per dose were injected with 5 μl peptide solution containing 0.1% (w/v) bovine serum albumin and 0.9% (w/v) NaCl. The LD50 values are set out in Table 5.

TABLE 5
Peptide LD50 (μg/kg)
OsK1 2
OsK1-NH2 3.5
Ac-OsK1-NH2 11
1]-OsK1-NH2 7
34]-OsK1 10
[K16]-OsK1 3
[D20]-OsK1 4.5
AOsK1 2.5
Val-AOsK1 16
AOsK1-NH2 2.25
1]-AOsK1 3
1]-AOsK1-NH2 4.5
1, T2]-AOsK1 3
1-4]-AOsK1 5
1-6]-AOsK1 6.5
1-7]-AOsK1 15
36-38]-AOsK1 800
[K3]-AOsK1 -NH2 2.25
[P12]-AOsK1 7.5
[N25]-AOsK1 11.5
[R31]-AOsK1 5
[Y36]-AOsK1 9
Ac-[K12, R19]-AOsK1 17.5

The effect of co-administering AOsK1 and MTx has been tested on Lewis rats immunized with spinal cord homogenate emulsified with complete Freund adjuvant. Each rat received 200 μl of emulsion sc, divided in the rear footpads, on day 0. Eight days later, as their body weight decreased, a precursor sign for clinical EAE, an osmotic pump was implanted IP. The pump delivered drugs at 1 μl/h for 8 days. They were filled with the peptide blockers, dissolved in Na Cl 0.15 M containing 2% Lewis serum, as vehicle.

Two additional groups of rats non-immunized were treated with the blockers in the same conditions. Blood samples were collected after 4 days of continuous administration in order to measure the blocker concentration in serum, using the patch-clamp technique.

Clinical evaluation. The severity of the disease was scored on a scale of 0 to 6, with 0.5 points for intermediate clinical findings (0: no clinical signs; 1.0: limp tail; 2.0: mild paraparesis and ataxia; 3.0: moderate paraparesis; 4.0: complete hind limb paralysis; 5.0: paralysis+incontinence; 5.5: tetraplegia; 6.0: moribund or death). Rats were weighed every day. Rats showing no clinical signs of EAE and no weight loss were excluded from the studies. The beneficial effects of K+ blockers on EAE were evaluated by a reduction in clinical severity and in duration of the disease and in number of relapses compared with those of rats treated with the vehicle only, 0.15 M NaCl.

Data analysis. Statistical analysis was conducted using the Mann-Whitney U test. Mean differences between groups were considered significant at values of P<0.05.

Results are shown in Table 6. The combination of 50 nM of MTx and 50 nM of AOsK1 proved more effective than 50 nM of MT alone.

TABLE 6
MTX and AOsK1 treatment of chronic relapsing EAE
First episode of EAE
Groups Onset Duration Incid
of rats (day)a (days)b Max Clin Sc (%)
Vehicle
1 d9  10 4
2 d7  13 4
3 d7  chronic 5
0 d11 10 5
5 d8  13 5
Mean ± SD 4.6 ± 0.5  100
MTx
50 nM
1 d11 chronic 4
2 d8  11 1
3 d7  chronic 1
0 (d) d7  chronic 3
Mean ± SD 2.2 ± 1.5* 100
MTX 50 nM
AOsK1 50 nM
1 d11  4 1
2 d12  4 1
3 d11  3 0.5
Mean ± SD 0.83 ± 0.2* 100
MTx 6.2 nM
AOsK1 50 nM
1 d10 10 5
2 d12  7 5
3d d13  2 0.5
Mean ± SD 3.5 ± 2.5 100
aday when first clinical signs (even scored 0.5) appear.
bnumber of days until clinical signs reverse to minimal score (0.5).
caggravation
d2 sd relapse
*Mean differences between groups were considered significant at values of P < 0.05 (Mann-Whitney U test).

Claims

The invention claimed is:

1. An OsK1 derivative selected from the group consisting of the following OsK1 derivatives:

1]-OsK1,

[A34]-OsK1,

[K16]-OsK1,

[D20]-OsK1,

[K16,D20]-OsK1,

1,K16,D20]-OsK1,

1,T2,K16,D20]-OsK1,

1-4,K16,D20]-OsK1,

1-6,K16,D20]-OsK1,

1-7,K16,D20]-OsK1,

[K3,K16,D20]-OsK1,

[P12,K16,D20]-OsK1,

[K16,D20,N25]-OsK1,

[K16,D20,R31]-OsK1,

[K16,D20,Y36]-OsK1, and

[K12, K16,R19,D20]-OsK1.

2. An OsK1 derivative according to claim 1, which is terminated at the N-terminal with an acetyl group or which is amidated at the C-terminal.

3. An OsK1 derivative according to claim 1, which is terminated with an ω-amino-fatty acid having from 4 to 10 carbon atoms and from 0 to 2 carbon-carbon double bonds.

4. A pharmaceutical composition comprising an OsK1 derivative according to claim 1 in admixture with a pharmaceutically acceptable diluent or carrier.

5. An OsK1 derivative according to claim 1, wherein said derivative is [Δ1-7,K16,D20]-OsK1 (SEQ ID NO: 19).

6. An OsK1 derivative according to claim 1, wherein said derivative is [K16,D20]-OsK1 (SEQ ID NO: 14).

Resources

Images & Drawings included:

Sources:

Recent applications in this class: