Patent application title:

Coronavirus neutralizing humanized antibodies and uses thereof

Publication number:

-

Publication date:
Application number:

17/191,764

Filed date:

2021-03-04

✅ Patent granted

Patent number:

US 12,024,551 B1

Grant date:

2024-07-02

PCT filing:

-

PCT publication:

-

Examiner:

Michael Szperka | Lia E Taylor

Agent:

Fish & Richardson | Madelynne J. Farber | Samantha Updegraff

Adjusted expiration:

2041-11-08

Abstract:

The present disclosure relates to an isolated or purified antibody, or a fragment thereof, having a binding domain that binds to a coronavirus (e.g., SARS-COV-2) or a portion thereof. In other embodiments, the antibody includes a binding domain that competes with binding to angiotensin converting enzyme 2 (ACE2) or a portion thereof. Methods of using such antibodies are also described herein, such as methods of treating or delaying the progression of a disease associated with a coronavirus.

Inventors:

Assignee:

Applicant:

Interested in similar patents?

Get notified when new applications in this technology area are published.

Classification:

C07K16/10 »  CPC main

Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from viruses from RNA viruses, e.g. hepatitis E virus

A61K39/42 »  CPC further

Medicinal preparations containing antigens or antibodies; Antibodies ; Immunoglobulins; Immune serum, e.g. antilymphocytic serum viral

A61K47/6841 »  CPC further

Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment the modifying agent being an antibody or an immunoglobulin bearing at least one antigen-binding site the antibody targeting material from viruses the antibody targeting a RNA virus

A61P31/14 »  CPC further

Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics; Antivirals for RNA viruses

C07K2317/24 »  CPC further

Immunoglobulins specific features characterized by taxonomic origin containing regions, domains or residues from different species, e.g. chimeric, humanized or veneered

C07K2317/31 »  CPC further

Immunoglobulins specific features characterized by aspects of specificity or valency multispecific

C07K2317/567 »  CPC further

Immunoglobulins specific features characterized by immunoglobulin fragments variable (Fv) region, i.e. VH and/or VL Framework region [FR]

C07K2317/569 »  CPC further

Immunoglobulins specific features characterized by immunoglobulin fragments variable (Fv) region, i.e. VH and/or VL Single domain, e.g. dAb, sdAb, VHH, VNAR or nanobodyÂŽ

C07K2317/76 »  CPC further

Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen Antagonist effect on antigen, e.g. neutralization or inhibition of binding

A61K47/68 IPC

Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment

Description

STATEMENT OF GOVERNMENT INTEREST

This invention was made with Government support under Contract No. DE-NA0003525 awarded by the United States Department of Energy/National Nuclear Security Administration. The U.S. Government has certain rights in the invention

REFERENCE TO A SEQUENCE LISTING APPENDIX

A sequence listing appendix including an ASCII formatted file accompanies this application. The appendix includes a file named “SANDP010_ST25.txt,” created on Feb. 19, 2021 (size of 256 kilobytes), which is hereby incorporated by reference in its entirety.

FIELD OF THE INVENTION

The present disclosure relates to an isolated or purified antibody, or a fragment thereof, having a binding domain that binds to a coronavirus (e.g., SARS-COV-2 or a portion thereof). In other embodiments, the antibody includes a binding domain that competes with binding to angiotensin converting enzyme 2 (ACE2) or a portion thereof. Methods of using such antibodies are also described herein, such as methods of treating, prophylactically treating, or delaying the progression of a disease associated with a coronavirus.

BACKGROUND OF THE INVENTION

Severe acute respiratory syndrome coronavirus 2 (SARS-COV-2) remains a challenging public health issue. There is a need for further strategies and efforts to control disease associated with this virus.

SUMMARY OF THE INVENTION

The present invention relates to use of an isolated or purified antibody, or a fragment thereof, that binds to SARS-COV-2 or a portion thereof (e.g., the spike protein or receptor-binding domain (RBD) of the spike protein). Such antibodies, in some instances, can also be characterized as competing (e.g., with SARS-COV-2) for binding with angiotensin converting enzyme 2 (ACE2). In particular, provided herein are complementarity determining regions (CDRs) that provide such binding. The antibody can have any useful form, such as a single variable domain (VHH) or nanobody, a single-chain variable-fragment (scFv) antibody, a monoclonal antibody (mAb), an antigen-binding fragment (Fab), a heavy-chain only antibody (HcAb), an Immunoglobulin G (IgG) antibody, as well as bivalent, biparatropic, bispecific, chimeric, and humanized forms thereof. Additional details follow.

Accordingly, in a first aspect the present disclosure features an isolated or purified antibody or fragment thereof, including a first binding domain, wherein the first binding domain includes: a first complementarity determining region including a polypeptide sequence having at least 90% sequence identity to any one of SEQ ID NOs: 150-155; a second complementarity determining region including a polypeptide sequence having at least 90% sequence identity to any one of SEQ ID NOs: 160-167; and/or a third complementarity determining region including a polypeptide sequence having at least 90% sequence identity to any one of SEQ ID NOs: 170-175.

In some embodiments, the first complementarity determining region includes a polypeptide sequence having at least 90% sequence identity to any one of SEQ ID NOs:40-73. In other embodiments, the second complementarity determining region includes a polypeptide sequence having at least 90% sequence identity to any one of SEQ ID NOs:74-107. In yet other embodiments, the third complementarity determining region includes a polypeptide sequence having at least 90% sequence identity to any one of SEQ ID NOs: 108-141.

In some embodiments, the antibody or fragment thereof further includes: a first framework region attached to an N-terminus of the first complementarity determining region; a second framework region disposed between the first and second complementarity determining regions; a third framework region disposed between the second and third complementarity determining regions; and a fourth framework region attached to a C-terminus of the third complementarity determining region.

In some embodiments, the antibody or fragment thereof includes a polypeptide sequence having at least 90% sequence identity to any one of SEQ ID NOs: 1-34 or a fragment thereof.

In some embodiments, the antibody or fragment thereof includes a polypeptide sequence having at least 90% sequence identity to any one of SEQ ID NOs: 180-186, wherein CDR1 includes the first complementarity determining region, wherein CDR2 includes the second complementarity determining region, and wherein CDR3 includes the third complementarity determining region.

In other embodiments, the first framework region includes a polypeptide sequence having at least 90% sequence identity to any one of SEQ ID NOs:213-217. In yet other embodiments, the second framework region includes a polypeptide sequence having at least 90% sequence identity to any one of SEQ ID NOs:244-248. In other embodiments, the third framework region includes a polypeptide sequence having at least 90% sequence identity to any one of SEQ ID NOs:285-289. In yet other embodiments, the fourth framework region includes a polypeptide sequence having at least 90% sequence identity to any one of SEQ ID NOs:302-307.

In some embodiments, the first framework region includes a polypeptide sequence having at least 90% sequence identity to any one of SEQ ID NOs: 190-212. In other embodiments, the second framework region includes a polypeptide sequence having at least 90% sequence identity to any one of SEQ ID NOs:220-243. In yet other embodiments, the third framework region includes a polypeptide sequence having at least 90% sequence identity to any one of SEQ ID NOs:250-284. In some embodiments, the fourth framework region includes a polypeptide sequence having at least 90% sequence identity to any one of SEQ ID NOs:290-301.

In some embodiments, the first complementarity determining region includes a polypeptide sequence having at least 90% sequence identity to any one of SEQ ID NOs:40-73; and/or the second complementarity determining region includes a polypeptide sequence having at least 90% sequence identity to any one of SEQ ID NOs:74-107; and/or the third complementarity determining region includes a polypeptide sequence having at least 90% sequence identity to any one of SEQ ID NOs: 108-141.

In any embodiment herein, the antibody or fragment thereof includes a nanobody.

In any embodiment herein, a binding domain of the antibody or fragment thereof (e.g., the first binding domain and/or the second binding domain) binds to a spike protein of a coronavirus or a receptor-binding domain of a coronavirus. In some embodiments, the coronavirus is SARS-CoV-2. In other embodiments, the spike protein includes a polypeptide sequence having at least 90% sequence identity to any one of SEQ ID NOs:320-327 or a fragment thereof. In yet other embodiments, the receptor-binding domain includes a polypeptide sequence having at least 90% sequence identity to any one of SEQ ID NOs:328-336 or a fragment thereof.

In any embodiment herein, the antibody or fragment thereof further includes a second binding domain that binds to a coronavirus or a portion thereof. In some embodiments, the second binding domain includes: a first complementarity determining region including a polypeptide sequence having at least 90% sequence identity to any one of SEQ ID NOs: 150-155; and/or a second complementarity determining region including a polypeptide sequence having at least 90% sequence identity to any one of SEQ ID NOs: 160-167; and/or a third complementarity determining region including a polypeptide sequence having at least 90% sequence identity to any one of SEQ ID NOs:170-175.

In some embodiments, the antibody or fragment thereof further includes a linker disposed between the first and second binding domains. Non-limiting linkers include any described herein, such as SEQ ID NOs:310-319.

In any embodiment herein, the antibody or fragment thereof further includes a therapeutic agent or a diagnostic agent attached directly or indirectly to the first binding domain.

In a second aspect, the present disclosure features a method of treating or prophylactically treating a viral infection. In some embodiments, the method includes: administering an isolated or purified antibody or fragment thereof (e.g., any described herein) to a subject in need thereof. In other embodiments, the isolated or purified antibody or fragment thereof is provided as a pharmaceutical composition having a pharmaceutically acceptable carrier (e.g., as described herein). Such a composition can be provided as a medication (e.g., a vaccine optionally including any useful adjuvant).

In some embodiments, the viral infection includes an infection from a coronavirus. In other embodiments, the coronavirus is SARS-COV-2 or a variant or a mutant thereof.

In some embodiments, the isolated or purified antibody or fragment thereof includes a first complementarity determining region including a polypeptide sequence having at least 90% sequence identity to any one of SEQ ID NOs:40-73; and/or a second complementarity determining region including a polypeptide sequence having at least 90% sequence identity to any one of SEQ ID NOs:74-107; and/or a third complementarity determining region including a polypeptide sequence having at least 90% sequence identity to any one of SEQ ID NOs: 108-141. Additional details follow.

Definitions

As used herein, the term “about” means+/−10% of any recited value. As used herein, this term modifies any recited value, range of values, or endpoints of one or more ranges.

The terms “polynucleotide” and “nucleic acid,” used interchangeably herein, refer to a polymeric form of nucleotides of any length, either ribonucleotides or deoxyribonucleotides. Thus, this term includes, but is not limited to, single-stranded (e.g., sense or antisense), double-stranded, or multi-stranded ribonucleic acids (RNAs), deoxyribonucleic acids (DNAs), threose nucleic acids (TNAs), glycol nucleic acids (GNAs), peptide nucleic acids (PNAs), locked nucleic acids (LNAs), or hybrids thereof, genomic DNA, cDNA, DNA-RNA hybrids, or a polymer comprising purine and pyrimidine bases or other natural, chemically or biochemically modified, non-natural, or derivatized nucleotide bases. Polynucleotides can have any useful two-dimensional or three-dimensional structure or motif, such as regions including one or more duplex, triplex, quadruplex, hairpin, and/or pseudoknot structures or motifs.

The term “modified,” as used in reference to nucleic acids, means a nucleic acid sequence including one or more modifications to the nucleobase, nucleoside, nucleotide, phosphate group, sugar group, and/or internucleoside linkage (e.g., phosphodiester backbone, linking phosphate, or a phosphodiester linkage).

The term “modified,” as used in reference to amino acids, means an amino acid including one or more modifications, such as a post-translation modification (e.g., acetylation, methylation, phosphorylation, ubiquitination, sumoylation, ribosylation, glycosylation, acylation, or isomerization), or including a non-natural amino acid.

The term “modified,” as used in reference to a protein, means a polypeptide sequence including one or more amino acid substitution, as compared to the reference sequence for the protein.

“Complementarity” or “complementary” or “complement” refers to the ability of a nucleic acid to form hydrogen bond(s) with another nucleic acid sequence by either traditional Watson-Crick or other non-traditional types, e.g., form Watson-Crick base pairs and/or G/U base pairs, “anneal”, or “hybridize,” to another nucleic acid in a sequence-specific, antiparallel, manner (i.e., a nucleic acid specifically binds to a complementary nucleic acid) under the appropriate in vitro and/or in vivo conditions of temperature and solution ionic strength. As is known in the art, standard Watson-Crick base-pairing includes: adenine (A) pairing with thymidine (T), adenine (A) pairing with uracil (U), and guanine (G) pairing with cytosine (C). In addition, it is also known in the art that for hybridization between two RNA molecules (e.g., dsRNA), guanine (G) base pairs with uracil (U). A percent complementarity indicates the percentage of residues in a nucleic acid molecule which can form hydrogen bonds (e.g., Watson-Crick base pairing) with a second nucleic acid sequence (e.g., 5, 6, 7, 8, 9, 10 out of 10 being 50%, 60%, 70%, 80%, 90%, and 100% complementary). “Perfectly complementary” means that all the contiguous residues of a nucleic acid sequence will hydrogen bond with the same number of contiguous residues in a second nucleic acid sequence. “Substantially complementary” or “sufficient complementarity” as used herein refers to a degree of complementarity that is at least 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 97%, 98%, 99%, or 100% over a region of 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 30, 35, 40, 45, 50, or more nucleotides, or refers to two nucleic acids that hybridize under stringent conditions.

As used herein, “stringent conditions” for hybridization refer to conditions under which a nucleic acid having complementarity to a target sequence predominantly hybridizes with the target sequence, and substantially does not hybridize to non-target sequences. Stringent conditions are generally sequence-dependent, and vary depending on a number of factors. In general, the longer the sequence, the higher the temperature at which the sequence specifically hybridizes to its target sequence. Non-limiting examples of stringent conditions are described in detail in Tijssen (1993), Laboratory Techniques In Biochemistry And Molecular Biology-Hybridization With Nucleic Acid Probes Part 1, Second Chapter “Overview of principles of hybridization and the strategy of nucleic acid probe assay”, Elsevier, N.Y.

“Hybridization” refers to a reaction in which one or more polynucleotides react to form a complex that is stabilized via hydrogen bonding between the bases of the nucleotide residues. The hydrogen bonding may occur by Watson Crick base pairing, Hoogstein binding, or in any other sequence specific manner. The complex may comprise two strands forming a duplex structure, three or more strands forming a multi stranded complex, a single self-hybridizing strand, or any combination of these. A hybridization reaction may constitute a step in a more extensive process, such as the initiation of PCR, or the cleavage of a polynucleotide by an enzyme. A sequence capable of hybridizing with a given sequence is referred to as the “complement” of the given sequence. Hybridization and washing conditions are well known and exemplified in Sambrook J, Fritsch E F, and Maniatis T, “Molecular Cloning: A Laboratory Manual,” Second Edition, Cold Spring Harbor Laboratory Press, Cold Spring Harbor (1989), particularly Chapter 11 and Table 11.1 therein; and Sambrook J and Russell W, “Molecular Cloning: A Laboratory Manual,” Third Edition, Cold Spring Harbor Laboratory Press, Cold Spring Harbor (2001). The conditions of temperature and ionic strength determine the “stringency” of the hybridization.

Hybridization requires that the two nucleic acids contain complementary sequences, although mismatches between bases are possible. The conditions appropriate for hybridization between two nucleic acids depend on the length of the nucleic acids and the degree of complementation, variables well known in the art. The greater the degree of complementation between two nucleotide sequences, the greater the value of the melting temperature (Tm) for hybrids of nucleic acids having those sequences. For hybridizations between nucleic acids with short stretches of complementarity (e.g., complementarity over 35 or less, 30 or less, 25 or less, 22 or less, 20 or less, or 18 or less nucleotides) the position of mismatches becomes important (see Sambrook et al., supra, 11.7-11.8). Typically, the length for a hybridizable nucleic acid is at least about 10 nucleotides. Illustrative minimum lengths for a hybridizable nucleic acid are: at least about 15 nucleotides; at least about 20 nucleotides; at least about 22 nucleotides; at least about 25 nucleotides; and at least about 30 nucleotides. Furthermore, the skilled artisan will recognize that the temperature and wash solution salt concentration may be adjusted as necessary according to factors such as length of the region of complementation and the degree of complementation.

It is understood in the art that the sequence of polynucleotide need not be 100% complementary to that of its target nucleic acid to be specifically hybridizable or hybridizable. Moreover, a polynucleotide may hybridize over one or more segments such that intervening or adjacent segments are not involved in the hybridization event (e.g., a loop structure or hairpin structure). A polynucleotide can comprise at least 70%, at least 80%, at least 90%, at least 95%, at least 99%, or 100% sequence complementarity to a target region within the target nucleic acid sequence to which they are targeted. For example, an antisense nucleic acid in which 18 of 20 nucleotides of the antisense compound are complementary to a target region, and would therefore specifically hybridize, would represent 90 percent complementarity. In this example, the remaining noncomplementary nucleotides may be clustered or interspersed with complementary nucleotides and need not be contiguous to each other or to complementary nucleotides. Percent complementarity between particular stretches of nucleic acid sequences within nucleic acids can be determined routinely using BLAST programs (basic local alignment search tools) and PowerBLAST programs known in the art (Altschul S F et al., J. Mol. Biol. 1990; 215:403-10; Zhang J et al., Genome Res. 1997; 7:649-56) or by using the Gap program (Wisconsin Sequence Analysis Package, Version 8 for Unix, Genetics Computer Group, University Research Park, Madison Wis.), using default settings, which uses the algorithm of Smith T F et al., Adv. Appl. Math. 1981; 2(4):482-9.

By “protein,” “peptide,” or “polypeptide,” as used interchangeably, is meant any chain of more than two amino acids, regardless of post-translational modification (e.g., glycosylation or phosphorylation), constituting all or part of a naturally occurring polypeptide or peptide, or constituting a non-naturally occurring polypeptide or peptide, which can include coded amino acids, non-coded amino acids, modified amino acids (e.g., chemically and/or biologically modified amino acids), and/or modified backbones. Non-limiting amino acids include glycine (Gly, G), alanine (Ala, A), valine (Val, V), isoleucine (Ile, I), leucine (Leu, L), cysteine (Cys, C), methionine (Met, M), aspartic acid (Asp, D), glutamic acid (Glu, E), arginine (Arg, R), histidine (His, H), lysine (Lys, K), asparagine (Asn, N), glutamine (Gln, Q), serine (Ser, S), threonine (Thr, T), proline (Pro, P), phenylalanine (Phe, F), tyrosine (Tyr, Y), tryptophan (Trp, W), selenocysteine (Sec, U), and pyrrolysine (Pyl, O).

The term “fragment” is meant a portion of a nucleic acid or a polypeptide that is at least one nucleotide or one amino acid shorter than the reference sequence. This portion contains, preferably, at least about 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, or 90% of the entire length of the reference nucleic acid molecule or polypeptide. A fragment may contain 10, 20, 30, 40, 50, 60, 70, 80, 90, or 100, 200, 300, 400, 500, 600, 700, 800, 900, 1000, 1250, 1500, 1750, 1800 or more nucleotides; or 10, 20, 30, 40, 50, 60, 70, 80, 90, 100, 150, 200, 250, 300, 350, 400, 450, 500, 550, 600, 640 amino acids or more. In another example, any polypeptide fragment can include a stretch of at least about 5 (e.g., about 10, about 20, about 30, about 40, about 50, or about 100) amino acids that are at least about 40% (e.g., about 50%, about 60%, about 70%, about 80%, about 90%, about 95%, about 87%, about 98%, about 99%, or about 100%) identical to any of the sequences described herein can be utilized in accordance with the invention. In certain embodiments, a polypeptide to be utilized in accordance with the invention includes 2, 3, 4, 5, 6, 7, 8, 9, 10, or more mutations (e.g., one or more conservative amino acid substitutions, as described herein). In yet another example, any nucleic acid fragment can include a stretch of at least about 5 (e.g., about 7, about 8, about 10, about 12, about 14, about 18, about 20, about 24, about 28, about 30, or more) nucleotides that are at least about 40% (about 50%, about 60%, about 70%, about 80%, about 90%, about 95%, about 87%, about 98%, about 99%, or about 100%) identical to any of the sequences described herein can be utilized in accordance with the invention.

The term “conservative amino acid substitution” refers to the interchangeability in proteins of amino acid residues having similar side chains (e.g., of similar size, charge, and/or polarity). For example, a group of amino acids having aliphatic side chains consists of glycine (Gly, G), alanine (Ala, A), valine (Val, V), leucine (Leu, L), and isoleucine (Ile, I); a group of amino acids having aliphatic-hydroxyl side chains consists of serine (Ser, S) and threonine (Thr, T); a group of amino acids having amide containing side chains consisting of asparagine (Asn, N) and glutamine (Gln, Q); a group of amino acids having aromatic side chains consists of phenylalanine (Phe, F), tyrosine (Tyr, Y), and tryptophan (Trp, W); a group of amino acids having basic side chains consists of lysine (Lys, K), arginine (Arg, R), and histidine (His, H); a group of amino acids having acidic side chains consists of glutamic acid (Glu, E) and aspartic acid (Asp, D); and a group of amino acids having sulfur containing side chains consists of cysteine (Cys, C) and methionine (Met, M). Exemplary conservative amino acid substitution groups are valine-leucine-isoleucine, phenylalanine-tyrosine, lysine-arginine, alanine-valine, glycine-serine, glutamate-aspartate, and asparagine-glutamine. The present disclosure encompasses any sequence having a conservative amino acid sequence of any polypeptide sequence described herein.

As used herein, when a polypeptide or nucleic acid sequence is referred to as having “at least X % sequence identity” to a reference sequence, it is meant that at least X percent of the amino acids or nucleotides in the polypeptide or nucleic acid are identical to those of the reference sequence when the sequences are optimally aligned. An optimal alignment of sequences can be determined in various ways that are within the skill in the art, for instance, the Smith Waterman alignment algorithm (Smith T F et al., J. Mol. Biol. 1981; 147:195-7) and BLAST (Basic Local Alignment Search Tool; Altschul S F et al., J. Mol. Biol. 1990; 215:403-10). These and other alignment algorithms are accessible using publicly available computer software such as “Best Fit” (Smith T F et al., Adv. Appl. Math. 1981; 2(4):482-9) as incorporated into GeneMatcher Plus.™. (Schwarz and Dayhof, “Atlas of Protein Sequence and Structure,” ed. Dayhoff, M. O., pp. 353-358, 1979), BLAST, BLAST-2, BLAST-P, BLAST-N, BLAST-X, WU-BLAST-2, ALIGN, ALIGN-2, CLUSTAL, T-COFFEE, MUSCLE, MAFFT, or Megalign (DNASTAR). In addition, those skilled in the art can determine appropriate parameters for measuring alignment, including any algorithms needed to achieve optimal alignment over the length of the sequences being compared. In general, for polypeptides, the length of comparison sequences can be at least five amino acids, preferably 10, 20, 30, 40, 50, 60, 70, 80, 90, 100, 125, 150, 175, 200, 250, 300, 400, 500, 600, 700, or more amino acids, up to the entire length of the polypeptide. For nucleic acids, the length of comparison sequences can generally be at least 10, 20, 30, 40, 50, 60, 70, 80, 90, 100, 125, 150, 175, 200, 250, 300, 400, 500, 600, 700, 800, 900, 1000, 1100, 1200, 1300, 1400, 1500, 1600, 1700, 1800, 1900, 2000, 2100, or more nucleotides, up to the entire length of the nucleic acid molecule. It is understood that for the purposes of determining sequence identity when comparing a DNA sequence to an RNA sequence, a thymine nucleotide is equivalent to an uracil nucleotide.

By “substantial identity” or “substantially identical” is meant a polypeptide or nucleic acid sequence that has the same polypeptide or nucleic acid sequence, respectively, as a reference sequence, or has a specified percentage of amino acid residues or nucleotides, respectively, that are the same at the corresponding location within a reference sequence when the two sequences are optimally aligned. For example, an amino acid sequence that is “substantially identical” to a reference sequence has at least about 50%, 60%, 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the reference amino acid sequence. For polypeptides, the length of comparison sequences will generally be at least 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 25, 50, 75, 90, 100, 150, 200, 250, 300, or 350 contiguous amino acids (e.g., a full-length sequence). For nucleic acids, the length of comparison sequences will generally be at least 5, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, or 25 contiguous nucleotides (e.g., the full-length nucleotide sequence). Sequence identity may be measured using sequence analysis software on the default setting (e.g., Sequence Analysis Software Package of the Genetics Computer Group, University of Wisconsin Biotechnology Center, 1710 University Avenue, Madison, Wis., 53705). Such software may match similar sequences by assigning degrees of homology to various substitutions, deletions, and other modifications.

A “vector” or “expression vector” is a replicon, such as plasmid, phage, virus, or cosmid, to which another nucleic acid segment, i.e., an “insert”, may be attached so as to bring about the replication of the attached segment in a cell.

An “expression cassette” comprises a nucleic acid coding sequence operably linked, as defined herein, to a promoter sequence, as defined herein.

“Operably linked” or “operatively linked” or “operatively associated with,” as used interchangeably, refers to a juxtaposition wherein the components so described are in a relationship permitting them to function in their intended manner. For instance, a promoter is operably linked to a coding sequence if the promoter affects its transcription or expression. A nucleic acid molecule is operatively linked or operably linked to, or operably associated with, an expression control sequence when the expression control sequence controls and regulates the transcription and translation of nucleic acid sequence. The term “operatively linked” includes having an appropriate start signal (e.g., ATG) in front of the nucleic acid sequence to be expressed and maintaining the correct reading frame to permit expression of the nucleic acid sequence under the control of the expression control sequence and production of the desired product encoded by the nucleic acid sequence. If a gene that one desires to insert into a recombinant DNA molecule does not contain an appropriate start signal, such a start signal can be inserted in front of the gene.

By an “effective amount” or a “sufficient amount” of an agent, as used herein, is that amount sufficient to effect beneficial or desired results, such as clinical results, and, as such, an “effective amount” depends upon the context in which it is being applied. For example, in the context of administering an agent that is an antiviral agent, an effective amount of an agent is, for example, an amount sufficient to achieve a reduction in viral load or a mitigation of a symptom related to a viral infection or a delay in a symptom related to a viral infection, as compared to the response obtained without administration of the agent.

By “subject” is meant a human or non-human animal (e.g., a mammal).

By “treating” a disease, disorder, or condition in a subject is meant reducing at least one symptom of the disease, disorder, or condition by administrating a therapeutic agent to the subject. By “treating prophylactically” a disease, disorder, or condition in a subject is meant reducing the frequency of occurrence of or reducing the severity of a disease, disorder or condition by administering a therapeutic agent to the subject prior to the onset of disease symptoms. Beneficial or desired results can include, but are not limited to, alleviation or amelioration of one or more symptoms or conditions; diminishment of extent of disease, disorder, or condition; stabilized (i.e., not worsening) state of disease, disorder, or condition; preventing spread of disease, disorder, or condition; delay or slowing the progress of the disease, disorder, or condition; amelioration or palliation of the disease, disorder, or condition; and/or remission (whether partial or total), whether detectable or undetectable.

By “attached,” “attaching,” “attachment,” or related word forms is meant any covalent or non-covalent bonding interaction between two components. Non-covalent bonding interactions include, without limitation, hydrogen bonding, ionic interactions, halogen bonding, electrostatic interactions, π bond interactions, hydrophobic interactions, inclusion complexes, clathration, van der Waals interactions, and combinations thereof.

As used herein, the terms “top,” “bottom,” “upper,” “lower,” “above,” and “below” are used to provide a relative relationship between structures. The use of these terms does not indicate or require that a particular structure must be located at a particular location in the apparatus.

Other features and advantages of the invention will be apparent from the following description and the claims.

BRIEF DESCRIPTION OF THE DRAWINGS

FIG. 1 shows a schematic of a non-limiting method for providing illustrative antibodies.

FIGS. 2A-2C provide non-limiting sequences for nanobodies, in which complementarity determining regions (CDRs) are underlined. Provided are (A) sequences for SEQ ID NOs: 1-14, (B) sequences for SEQ ID NOs: 15-28, and (C) sequences for SEQ ID NOs:29-34.

FIG. 3 provides a non-limiting sequence logo for nanobody sequences provided as SEQ ID NOs: 1-34. The sequence logo was generated with WebLogo.

FIG. 4 provides non-limiting sequences for CDRs, including sequences for complementarity determining region 1 (CDR1, SEQ ID NOs:40-73), complementarity determining region 2 (CDR2, SEQ ID NOs:74-107), and complementarity determining region 3 (CDR3, SEQ ID NOs:108-141).

FIGS. 5A-5B provide (A) a non-limiting phylogenetic tree constructed from CDR1 sequences (SEQ ID NOs:40-73) and (B) a sequence alignment of non-limiting CDR1 sequences (SEQ ID NOs:40-58 and 68) and non-limiting consensus sequences (SEQ ID NOs:150-155).

FIGS. 6A-6B provide (A) a non-limiting phylogenetic tree constructed from CDR2 sequences (SEQ ID NOs:74-107) and (B) a sequence alignment of non-limiting CDR2 sequences (SEQ ID NOs:74-92 and 95) and non-limiting consensus sequences (SEQ ID NOs: 160-167).

FIGS. 7A-7B provide (A) a non-limiting phylogenetic tree constructed from CDR3 sequences (SEQ ID NOs: 108-141) and (B) a sequence alignment of non-limiting CDR3 sequences (SEQ ID NOs: 108-126) and non-limiting consensus sequences (SEQ ID NOs: 170-175).

FIGS. 8A-8B provide (A) a non-limiting schematic of an antibody having framework regions (FRs) interspersed with complementarity determining regions (CDRs), in which a nanobody can include framework regions 1-4 (FR1, FR2, FR3, and FR4) with interspersed CDR1, CDR2, and CDR3; and (B) non-limiting sequences (SEQ ID NOs: 180-186) for framework regions with interspersed CDR1, CDR2, and CDR3 sequences (e.g., any described herein, such as SEQ ID NOs:40-141, 150-155, 160-167, and 170-175).

FIGS. 9A-9D provide (A) a sequence alignment of non-limiting FR1 sequences (SEQ ID NOs: 190-212) and non-limiting consensus sequences (SEQ ID NOs:213-217); (B) a sequence alignment of non-limiting FR2 sequences (SEQ ID NOs:220-243) and non-limiting consensus sequences (SEQ ID NOs:244-248); (C) a sequence alignment of non-limiting FR3 sequences (SEQ ID NOs:250-284) and non-limiting consensus sequences (SEQ ID NOs:285-289); and (D) a sequence alignment of non-limiting FR4 sequences (SEQ ID NOs:290-301) and non-limiting consensus sequences (SEQ ID NOs:302-307).

FIGS. 10A-10C show mechanism of inhibition of viral infections with non-limiting nanobodies. Provided are results from (A) a competition ELISA with human ACE2 and full length SARS-COV-2 spike protein with particular nanobodies (SP1D9, SP3A5, SP3H4, and SP1B4); (B) a neutralization assay showing relative infection of green monkey kidney cells (vero) with VSV-SARS-COV-2 virus in the presence of particular nanobodies (SPID9, SP3A5, SP3H4, and SP1B4) and MM57; and (C) a neutralization assay showing relative infection with wild-type SARS-COV-2 in the presence of particular nanobodies (SP1D9, SP3A5, SP3H4, and SP1B4) and MM57. Experiments were performed in triplicate, two times, with similar results.

FIGS. 11A-11C show results of neutralization assays with non-limiting nanobodies. Provided are results for (A) SP3D11, SPIE1, SPIE4, SPIF6, SP3D6, SP3F9, MM57, and anti-VSV; (B) SP4B5, SPID8, SP1F2, SP1G7, SP2A7, SP2D8, and MM57; and (C) SP1A11, SP1A2, SP3H10, SP4A5, and MM57-2. Experiments were performed in triplicate, two times, with similar results.

FIGS. 12A-12E show (A-D) a sequence alignment of non-limiting sequences for spike glycoproteins (SEQ ID NOs:320-326) and a non-limiting consensus sequence (SEQ ID NOs:327) and (E) a sequence alignment of non-limiting sequences for RBDs of spike glycoproteins (SEQ ID NOs:328-334) and non-limiting consensus sequences (SEQ ID NOs:335-336).

DETAILED DESCRIPTION OF THE INVENTION

The present invention relates to an isolated or purified antibody or fragment thereof, that binds to SARS-COV-2 or a portion thereof (e.g., the spike protein or receptor-binding domain (RBD) of the spike protein). We have identified CDRs that provide enhanced efficacy, as determined by reducing infectivity of a coronavirus and/or exhibiting binding to the coronavirus. Such CDRs can be provided in an antibody having any useful format, such as a nanobody or other forms described herein.

CDRs can be identified by using a phage library (FIG. 1). Such a library can be constructed by generating 101 a DNA library of CDRs with high diversity, cloning 102 the DNA into a phage vector to express nanobodies as fusion proteins with the phage coat protein, optimizing 103 the transformation to obtain phages having sufficient diversity, and profiling 104 the phage library by sequencing. Diversity can include distribution in both the amino acid content and the length of the CDRs.

The selections from the phage library can be screened. Such screening can include testing by various assays, including a competition enzyme-linked immunosorbent assay (ELISA), a binding assay with the coronavirus or a portion thereof (e.g., SARS-COV-2, the spike protein of SARS-COV-2, or the RBD of SARS-COV-2), a competition assay including the coronavirus (or a portion thereof) and a target of the coronavirus (e.g., human ACE2 or another receptor that binds to SARS-COV-2), and/or a neutralization assay including coronavirus-expressing cells.

The antibody can have any useful form, such as one or more of the following domains: a single variable domain (VHH) or nanobody, a variable heavy domain (VH), a variable light domain (VL), a single-chain variable-fragment (scFv) antibody, a monoclonal antibody (mAb), an antigen-binding fragment (Fab), a fragment crystallizable region (Fc region), a heavy-chain only antibody (HcAb), an Immunoglobulin G (IgG) antibody, as well as bivalent, trivalent, tetravalent, multivalent, biparatropic, bispecific, multispecific chimeric, and humanized forms thereof. Any of the forms can include a linker between a first amino acid sequence (any domain herein, e.g., such as VH) and a second amino acid sequence (any domain herein, e.g. such as VL).

The constructs herein can be employed as a nanobody, preferably human or humanized. In some embodiments, the nanobody has a molecular weight of about 12-15 kDa. In some embodiments, the nanobody can include a single VHH domain. In other embodiments, the nanobody can include a plurality of VHH domains, in which each VHH domain can be the same or different. Furthermore, each VHH domain can bind to the same target, the same portion of the same target, different targets, or different portions of the same target. Non-limiting targets are described herein.

One or more VHH domains can be fused to any useful amino acid sequence, such as a Fc domain or a humanized Fc domain. The VHH domains can be fused to other humanized forms of constant domains, such as Fc, CH1, CH2, CH3, and CL domains. Such VHH domains can be sued to other forms, such as IgG1, IgG3, IgA, or IgM.

Yet other forms can include an Fc region and a Fab; or an Fc region and a VHH. The Fc region can include heavy chains present in any useful isotype (A, E, G, or M), such as Immunoglobulin G (e.g., IgG1, IgG2a, or IgG3). The Fab region can include domains from the heavy and light chains, including the variable heavy (VH) and variable light (VL) domains. Within the VH and VL domains, CDRs can be configured to bind to a target of interest. The VHH domain can include a single variable domain having CDRs configured to bind to a target of interest.

The Fc region of the constructs herein can include a native immunoglobulin, i.e., as formed by the dimeric association of the respective Fc domains (or Fc moieties) of its two heavy chains, in which a native Fc region is homodimeric and comprises two polypeptide chains; or a genetically-fused Fc region or a single-chain Fc region (scFc region), in which a synthetic dimeric Fc region comprised of Fc domains (or Fc moieties) are genetically linked within a single polypeptide chain (i.e., encoded in a single contiguous genetic sequence) as described. In one embodiment, the construct includes a complete Fc region, whether present as one polypeptide chain (an scFc molecule) or in the wild-type form as two polypeptide chains.

The Fc region can include a hinge (e.g., upper, middle, and/or lower hinge region) domain, a CH2 domain, a CH3 domain, a CH4 domain, or a variant, portion, or fragment thereof. In other embodiments, an Fc moiety comprises a complete Fc domain (i.e., a hinge domain, a CH2 domain, and a CH3 domain). In one embodiment, a Fc moiety comprises a hinge domain (or portion thereof) fused to a CH3 domain (or portion thereof). In another embodiment, an Fc moiety comprises a CH2 domain (or portion thereof) fused to a CH3 domain (or portion thereof). In another embodiment, an Fc moiety consists of a CH3 domain or portion thereof. In another embodiment, an Fc moiety consists of a hinge domain (or portion thereof) and a CH3 domain (or portion thereof). In another embodiment, a Fc moiety consists of a CH2 domain (or portion thereof) and a CH3 domain. In another embodiment, a Fc moiety consists of a hinge domain (or portion thereof) and a CH2 domain (or portion thereof). In one embodiment, an Fc moiety lacks at least a portion of a CH2 domain (e.g., all or part of a CH2 domain).

The Fc domains or moieties of a polypeptide may be from any isotype (A, E, G, or M) and may be derived from different immunoglobulin molecules. For example, an Fc domain or moiety of a polypeptide may comprise a CH2 and/or CH3 domain derived from an IgG1 molecule and a hinge region derived from an IgG3 molecule. In another example, an Fc domain or moiety can comprise a chimeric hinge region derived, in part, from an IgG1 molecule and, in part, from an IgG3 molecule. In another example, an Fc domain or moiety can comprise a chimeric hinge derived, in part, from an IgG1 molecule and, in part, from an IgG4 molecule.

The constructs herein can be modified antibodies, which includes synthetic forms of antibodies which are altered such that they are not naturally occurring, e.g., antibodies that comprise at least two heavy chain portions but not two complete heavy chains (such as, domain deleted antibodies or minibodies); engineered antibodies having synthetic linkers, such as any described herein; and multispecific forms of antibodies (e.g., bispecific, trispecific, etc., forms of any antibody, such as a nanobody) altered to bind to two or more different antigens e.g., to the RBD of a coronavirus and another therapeutically relevant target binding site.

Modified antibodies can include other types of modifications, such as chemical modification (e.g., pegylation, glycosylation, lipidation, etc.), attachment to a particle or liposome, or bonding to a protein (e.g., a serum protein, a cytokine) or a cell (e.g., a CAR-T cell).

The constructs herein can be “chimeric” or “fusion” proteins. Such proteins comprises a first amino acid sequence linked to a second amino acid sequence to which it is not naturally linked in nature. The amino acid sequences may normally exist in separate proteins that are brought together in the fusion polypeptide or they may normally exist in the same protein but are placed in a new arrangement in the fusion polypeptide. A chimeric protein may be created using methods well known in the art, for example, by chemical synthesis, or by creating and translating a polynucleotide in which the peptide regions are encoded in the desired relationship.

Such forms or fusions can include a linker disposed between any number of domains, in which non-limiting linkers are described herein. Any useful linker can be employed, such as a peptide linker that can be cleavable or non-cleavable. Linkers can include or consist of a sequence according to the formula [(Gly)m(Ser)]n(Gly)p, where each of m, n, and p is, independently, 0, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, or 20. In some embodiments, m=1, 2, 3, 4, 5, or 6; n=1, 2, 3, 4, 5, 6, 7, 8, 9, or 10; and p=0, 1, 2, 3, or 4. Alternatively, the linker sequence includes or consists of a sequence according to the formula (Gly)p[(Ser)(Gly)m]n, where each of m, n, and p is, independently, 0, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, or 20. In some embodiments, m=1, 2, 3, 4, 5, or 6; n=1, 2, 3, 4, 5, 6, 7, 8, 9, or 10; and p=0, 1, 2, 3, or 4. In another embodiment, the linker sequence includes or consists of a sequence according to the formula [(Gly)m(Ser)(Gly)p]n, where each of m, n, and p is, independently, 0, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, or 20. In some embodiments, m=1, 2, 3, 4, 5, or 6; n=1, 2, 3, 4, 5, 6, 7, 8, 9, or 10; and p=0, 1, 2, 3, or 4. Further non-limiting linkers include any described herein, such as in SEQ ID NOs:310-319 (Table 1).

TABLE 1
Non-limiting linkers
Name Sequence SEQ ID NO:
G3 GGG 310
G3S GGGS 311
G4 GGGG 312
G4S GGGGS 313
G2SG GGSG 314
(G4S)2 GGGGSGGGGS 315
(G4S)3 GGGGSGGGGSGGGGS 316
(G4S)4 GGGGSGGGGSGGGGSGGGGS 317
(G2SG)2 GGSGGGSG 318
(G2SG)3 GGSGGGSGGGSG 319

The constructs can include other variations. Such variations can include one or more amino acids that facilitate humanization of an initial sequence. Humanization can include use of one or more amino acids present in a human form of the constant or variable regions (e.g., frameworks regions or CDRs). In other embodiments, the variation can include a sequence that lacks Cys and Met residues. In yet other embodiments, the CDR can have an altered length, such as a length from about 4-9 amino acids, 9-12 amino acids, or 12-15 amino acids.

The construct can be characterized in any useful manner. In one instance, the construct can bind a target (e.g., any described herein), in which such binding can be characterized by a dissociation constant (Kd) of about 0.5 nM to 1 ÎźM and/or a half maximal inhibitory concentration (IC50) of about 0.001-100 nM. In other embodiments, efficacy of binding can be characterized by a half maximal effective concentration (EC50) of about 0.001-100 nM.

Binding Domains

The binding domain can have any useful sequence. In one embodiment, the binding domain includes or is a polypeptide sequence having at least 90% sequence identity to any one of SEQ ID NOs: 1-34 (FIGS. 2A-2C) or a fragment thereof. Non-limiting fragments can include a polypeptide that is one amino acid shorter than the reference sequence of SEQ ID NOs: 1-34. The omitted amino acid can be removed from the C-terminus.

FIG. 3 shows a non-limiting sequence logo obtained for nanobody sequences of SEQ ID NOs:1-34. As can be seen, a nanobody sequence can include framework regions (amino acid at positions 1-26, 34-52, 61-98, and 114-125) and CDRs (amino acid at positions 27-33, 53-60, and 99-113).

Within the variable domain of the antibody, three CDRs can be present. Non-limiting CDRs can include a first CDR, a second CDR, and a third CDR. Any of these CDRs can include or be a polypeptide sequence having at least 90% sequence identity to SEQ ID NOs:40-141 (FIG. 4) or a fragment thereof. The fragment can include a polypeptide that is one, two, or three amino acids shorter than the reference sequence of SEQ ID NOs:40-141. The omitted amino acid(s) can be removed from the C-terminus and/or the N-terminus.

FIGS. 5A-5B provide a phylogentic tree and consensus sequences for non-limiting CDR1 sequences. In some embodiments, the first CDR includes or is a polypeptide sequence having at least 90% sequence identity to SEQ ID NO:150:

    • X1TX3GX5YR,
    • wherein:
    • X1 is G, R, H, K, N, Q, S, T, F, Y, or absent (e.g., G, R, H, Q, S, T, F, or absent);
    • X3 is A, V, D, E, S T, F, or Y (e.g., A, D, S, F, or Y); and
    • X5 is G, A, V, I, L, D, E, R, H, K, N, Q, S, T, F, Y, or W (e.g., L, R, H, S, T, Y, or W).

In some embodiments, each X in SEQ ID NO: 150 can be an amino acid in any one of SEQ ID NOs:40-73 when any one of the sequences in SEQ ID NOs:40-73 is used as a reference sequence to be optimally aligned with SEQ ID NO:150. In other embodiments, each X in SEQ ID NO:150 can be an amino acid in any one of SEQ ID NOs:40-58 when any one of the sequences in SEQ ID NOs:40-58 is used as a reference sequence to be optimally aligned with SEQ ID NO:150.

In some embodiments, the first CDR includes or is a polypeptide sequence having at least 90% sequence identity to SEQ ID NOs: 151-154:

    • X1TFGX5YR (SEQ ID NO:151),
    • X1TSGX5YR (SEQ ID NO:152),
    • X1AFGX5YR (SEQ ID NO:153), or
    • X1FFGX5YR (SEQ ID NO:154),
    • wherein:
    • X1 is G, R, H, K, N, Q, S, T, F, Y, or absent (e.g., G, R, H, Q, S, T, F, or absent); and
    • X5 is G, A, V, I, L, D, E, R, H, K, N, Q, S, T, F, Y, or W (e.g., L, R, H, S, T, Y, or W).

In some embodiments, each X in SEQ ID NOs: 151-154 can be an amino acid in any one of SEQ ID NOs:40-73 when any one of the sequences in SEQ ID NOs:40-73 is used as a reference sequence to be optimally aligned with SEQ ID NOs:151-154. In other embodiments, each X in SEQ ID NOs: 151-154 can be an amino acid in any one of SEQ ID NOs:40-58 when any one of the sequences in SEQ ID NOs:40-58 is used as a reference sequence to be optimally aligned with SEQ ID NOs: 151-154.

In some embodiments, the first CDR includes or is a polypeptide sequence having at least 90% sequence identity to SEQ ID NO: 155:

    • X1X2YGX5YR
    • wherein:
    • X1 is G, R, H, K, N, Q, S, T, F, Y, or absent (e.g., G, R, H, Q, S, T, F, or absent);
    • X2 is A, V, I, L, R, H, K, S, T, F, Y, or P (e.g., A, R, S, T, F, or P); and
    • X5 is G, A, V, I, L, D, E, R, H, K, N, Q, S, T, F, Y, or W (e.g., L, R, H, S, T, Y, or W).

In some embodiments, each X in SEQ ID NO: 155 can be an amino acid in any one of SEQ ID NOs:40-73 when any one of the sequences in SEQ ID NOs:40-73 is used as a reference sequence to be optimally aligned with SEQ ID NO:155. In other embodiments, each X in SEQ ID NO:155 can be an amino acid in any one of SEQ ID NOs:40-58 when any one of the sequences in SEQ ID NOs:40-58 is used as a reference sequence to be optimally aligned with SEQ ID NO: 155.

FIGS. 6A-6B provide a phylogentic tree and consensus sequences for non-limiting CDR2 sequences. In some embodiments, the second CDR includes or is a polypeptide sequence having at least 90% sequence identity to SEQ ID NO:160:

    • SX3SGX6STR,
    • wherein:
    • X3 is G, D, E, S, T, F, Y, W, or absent (e.g., G, D, S, T, W, or absent); and
    • X6 is G, A, V, D, E, R, H, K, N, Q, S, T, F, Y, or absent (e.g., G, A, D, K, Q, S, T, Y, or absent).

In some embodiments, each X in SEQ ID NO: 160 can be an amino acid in any one of SEQ ID NOs: 74-107 when any one of the sequences in SEQ ID NOs:74-107 is used as a reference sequence to be optimally aligned with SEQ ID NO:160. In other embodiments, each X in SEQ ID NO:160 can be an amino acid in any one of SEQ ID NOs: 74-92 when any one of the sequences in SEQ ID NOs: 74-92 is used as a reference sequence to be optimally aligned with SEQ ID NO:160.

In other embodiments, the second CDR includes or is a polypeptide sequence having at least 90% sequence identity to SEQ ID NO:161:

    • X5GX7X8GHTR,
    • wherein:
    • X5 is G, D, E, S, T, or absent (e.g., G, D, S, or absent);
    • X7 is G, A, V, I, L, D, E, R, H, K, S, T, or absent (e.g., G, A, E, H, S, or absent); and
    • X8 is G, A, V, I, L, D, E, R, H, K, N, Q, S, T, F, or Y (e.g., G, A, D, R, Q, T, or F).

In some embodiments, each X in SEQ ID NO:161 can be an amino acid in any one of SEQ ID NOs: 74-107 when any one of the sequences in SEQ ID NOs: 74-107 is used as a reference sequence to be optimally aligned with SEQ ID NO: 161. In other embodiments, each X in SEQ ID NO:161 can be an amino acid in any one of SEQ ID NOs: 74-92 when any one of the sequences in SEQ ID NOs: 74-92 is used as a reference sequence to be optimally aligned with SEQ ID NO: 161.

In yet other embodiments, the second CDR includes or is a polypeptide sequence having at least 90% sequence identity to SEQ ID NO: 162:

    • X1AX3AGYAQ,
    • wherein:
    • X1 is G, D, E, R, H, K, or absent (e.g., D, R, or absent); and
    • X3 is G, D, E, S, T, F, Y, W, or absent (e.g., G, D, S, T, W, or absent).

In some embodiments, each X in SEQ ID NO: 162 can be an amino acid in any one of SEQ ID NOs: 74-107 when any one of the sequences in SEQ ID NOs: 74-107 is used as a reference sequence to be optimally aligned with SEQ ID NO:162. In other embodiments, each X in SEQ ID NO:162 can be an amino acid in any one of SEQ ID NOs: 74-92 when any one of the sequences in SEQ ID NOs:74-92 is used as a reference sequence to be optimally aligned with SEQ ID NO:162.

In some embodiments, the second CDR includes or is a polypeptide sequence having at least 90% sequence identity to SEQ ID NO: 163:

    • GX3X4DX6STX9,
    • wherein:
    • X3 is G, D, E, S, T, F, Y, W, or absent (e.g., G, D, S, T, W, or absent);
    • X4 is G, A, V, I, L, S, or T (e.g., G, A, or S);
    • X6 is G, A, V, D, E, R, H, K, N, Q, S, T, F, Y, W, or absent (e.g., G, A, D, K, Q, S, T, Y, or absent); and
    • X9 is G, A, V, I, L, R, H, K, N, Q, S, T, F, Y, W, or absent (e.g., G, A, R, H, K, Q, T, F, Y, W, or absent).

In some embodiments, each X in SEQ ID NO:163 can be an amino acid in any one of SEQ ID NOs: 74-107 when any one of the sequences in SEQ ID NOs: 74-107 is used as a reference sequence to be optimally aligned with SEQ ID NO:163. In other embodiments, each X in SEQ ID NO: 163 can be an amino acid in any one of SEQ ID NOs: 74-92 when any one of the sequences in SEQ ID NOs: 74-92 is used as a reference sequence to be optimally aligned with SEQ ID NO: 163.

In other embodiments, the second CDR includes or is a polypeptide sequence having at least 90% sequence identity to SEQ ID NO: 164:

    • X2WX4GX6SAX9,
    • wherein:
    • X2 is G, A, V, I, L, D, E, S, T, or absent (e.g., G, A, D, S, T, or absent);
    • X4 is G, A, V, I, L, S, or T (e.g., G, A, or S);
    • X6 is G, A, V, D, E, R, H, K, N, Q, S, T, F, Y, W, or absent (e.g., G, A, D, K, Q, S, T, Y, or absent); and
    • X9 is G, A, V, I, L, R, H, K, N, Q, S, T, F, Y, W, or absent (e.g., G, A, R, H, K, Q, T, F, Y, W, or absent).

In some embodiments, each X in SEQ ID NO:164 can be an amino acid in any one of SEQ ID NOs: 74-107 when any one of the sequences in SEQ ID NOs: 74-107 is used as a reference sequence to be optimally aligned with SEQ ID NO:164. In other embodiments, each X in SEQ ID NO:164 can be an amino acid in any one of SEQ ID NOs: 74-92 when any one of the sequences in SEQ ID NOs: 74-92 is used as a reference sequence to be optimally aligned with SEQ ID NO:164.

In yet other embodiments, the second CDR includes or is a polypeptide sequence having at least 90% sequence identity to SEQ ID NO: 165:

    • X2WX4GX6SX8X9,
    • wherein:
    • X2 is G, A, V, I, L, D, E, S, T, or absent (e.g., G, A, D, S, T, or absent);
    • X4 is G, A, V, I, L, S, or T (e.g., G, A, or S);
    • X6 is G, A, V, D, E, R, H, K, N, Q, S, T, F, Y, W, or absent (e.g., G, A, D, K, Q, S, T, Y, or absent);
    • X8 is G, A, V, I, L, D, E, R, H, K, N, Q, S, T, F, Y, or W (e.g., G, A, D, R, Q, T, or F); and
    • X9 is G, A, V, I, L, R, H, K, N, Q, S, T, F, Y, W, or absent (e.g., G, A, R, H, K, Q, T, F, Y, W, or absent).

In some embodiments, each X in SEQ ID NO: 165 can be an amino acid in any one of SEQ ID NOs: 74-107 when any one of the sequences in SEQ ID NOs: 74-107 is used as a reference sequence to be optimally aligned with SEQ ID NO:165. In other embodiments, each X in SEQ ID NO:165 can be an amino acid in any one of SEQ ID NOs: 74-92 when any one of the sequences in SEQ ID NOs: 74-92 is used as a reference sequence to be optimally aligned with SEQ ID NO: 165.

In other embodiments, the second CDR includes or is a polypeptide sequence having at least 90% sequence identity to SEQ ID NO:166:

TX3X4GX6X7X8R,

    • wherein:
    • X3 is G, D, E, S, T, F, Y, W, or absent (e.g., G, D, S, T, W, or absent);
    • X4 is G, A, V, I, L, S, or T (e.g., G, A, or S);
    • X6 is G, A, V, D, E, R, H, K, N, Q, S, T, F, Y, W, or absent (e.g., G, A, D, K, Q, S, T, Y, or absent);
    • X7 is G, A, V, I, L, D, E, R, H, K, S, T, or absent (e.g., G, A, E, H, S, or absent); and
    • X8 is G, A, V, I, L, D, E, R, H, K, N, Q, S, T, F, Y, or W (e.g., G, A, D, R, Q, T, or F).

In some embodiments, each X in SEQ ID NO:166 can be an amino acid in any one of SEQ ID NOs: 74-107 when any one of the sequences in SEQ ID NOs: 74-107 is used as a reference sequence to be optimally aligned with SEQ ID NO:166. In other embodiments, each X in SEQ ID NO:166 can be an amino acid in any one of SEQ ID NOs: 74-92 when any one of the sequences in SEQ ID NOs: 74-92 is used as a reference sequence to be optimally aligned with SEQ ID NO:166.

In yet other embodiments, the second CDR includes or is a polypeptide sequence having at least 90% sequence identity to SEQ ID NO:167:

TX3X4G-X7X8X9X10,

    • wherein:
    • X3 is G, D, E, S, T, F, Y, W, or absent (e.g., G, D, S, T, W, or absent);
    • X4 is G, A, V, I, L, S, or T (e.g., G, A, or S);
    • X7 is G, A, V, I, L, D, E, R, H, K, S, T, or absent (e.g., G, A, E, H, S, or absent);
    • X8 is G, A, V, I, L, D, E, R, H, K, N, Q, S, T, F, Y, or W (e.g., G, A, D, R, Q, T, or F);
    • X9 is G, A, V, I, L, R, H, K, N, Q, S, T, F, Y, W, or absent (e.g., G, A, R, H, K, Q, T, F, Y, W, or absent); and
    • X10 is G, S, T, R, H, K, or absent (e.g., S, T, R, H, K, or absent).

In some embodiments, each X in SEQ ID NO: 167 can be an amino acid in any one of SEQ ID NOs: 74-107 when any one of the sequences in SEQ ID NOs: 74-107 is used as a reference sequence to be optimally aligned with SEQ ID NO: 167. In other embodiments, each X in SEQ ID NO:167 can be an amino acid in any one of SEQ ID NOs: 74-92 when any one of the sequences in SEQ ID NOs: 74-92 is used as a reference sequence to be optimally aligned with SEQ ID NO: 167.

FIGS. 7A-7B provide a phylogentic tree and consensus sequences for non-limiting CDR3 sequences. In some embodiments, the third CDR includes or is a polypeptide sequence having at least 90% sequence identity to SEQ ID NO:170:

    • X6WX8X9EX11X12FX14X15X16X17VX19X20E,
    • wherein:
    • X6 is G, A, V, I, L, D, E, R, H, K, S, T, P, F, Y, or absent (e.g., A, L, D, R, S, Y, or absent);
    • X8 is G, A, V, I, L, D, E, R, H, K, P, F, Y, or absent (e.g., A, D, K, F, Y, or absent);
    • X9 is G, A, V, I, L, R, H, K, N, Q, P, F, Y, or absent (e.g., A, I, R, Q, F, Y, or absent);
    • X11 is G, A, V, I, L, R, H, K, N, Q, P, F, Y, or absent (e.g., G, L, R, K, Q, P, or absent);
    • X12 is G, A, V, I, L, P, F, Y, W, or absent (e.g., V, I, L, P, W, or absent);
    • X14 is D, E, R, H, K, S, T, P, F, Y, W, or absent (e.g., D, R, H, S, T, P, or absent);
    • X15 is A, V, I, L, D, E, R, H, K, N, Q, P, F, Y, W, or absent (e.g., A, E, R, Q, F, or absent);
    • X16 is A, V, I, L, D, E, R, H, K, N, Q, or absent (e.g., A, L, D, R, N, or absent);
    • X17 is G, A, V, I, L, R, H, K, N, Q, S, T, P, F, Y, W, or absent (e.g., G, A, V, R, Q, S, F, or absent);
    • X19 is A, V, I, L, D, E, R, H, K, S, T, P, F, Y, W, or absent (e.g., A, L, E, R, S, T, P, Y, or absent); and
    • X20 is G, D, E, N, Q, P, F, Y, W, or absent (e.g., G, D, E, N, P, or absent).

In some embodiments, each X in SEQ ID NO: 170 can be an amino acid in any one of SEQ ID NOs: 108-141 when any one of the sequences in SEQ ID NOs: 108-141 is used as a reference sequence to be optimally aligned with SEQ ID NO:170. In other embodiments, each X in SEQ ID NO:170 can be an amino acid in any one of SEQ ID NOs: 108-126 when any one of the sequences in SEQ ID NOs: 108-126 is used as a reference sequence to be optimally aligned with SEQ ID NO:170.

In some embodiments, the third CDR includes or is a polypeptide sequence having at least 90% sequence identity to SEQ ID NO:171:

    • NAQLGPX22X23DKIG,
    • wherein:
    • X22 is G, A, V, I, L, D, E, R, H, K, N, Q, or absent (e.g., G, A, V, E, H, K, Q, or absent); and
    • X23 is P, F, Y, W, or absent (e.g., F, Y, W, or absent).

In some embodiments, each X in SEQ ID NO: 171 can be an amino acid in any one of SEQ ID NOs: 108-141 when any one of the sequences in SEQ ID NOs: 108-141 is used as a reference sequence to be optimally aligned with SEQ ID NO:171. In other embodiments, each X in SEQ ID NO:171 can be an amino acid in any one of SEQ ID NOs: 108-126 when any one of the sequences in SEQ ID NOs: 108-126 is used as a reference sequence to be optimally aligned with SEQ ID NO: 171.

In other embodiments, the third CDR includes or is a polypeptide sequence having at least 90% sequence identity to SEQ ID NO:172:

    • X6WDX9X10GX12X13X14X15-------FX24,
    • wherein:
    • X6 is G, A, V, I, L, D, E, R, H, K, S, T, P, F, Y, or absent (e.g., A, L, D, R, S, Y, or absent);
    • X9 is G, A, V, I, L, R, H, K, N, Q, P, F, Y, or absent (e.g., A, I, R, Q, F, Y, or absent);
    • X10 is G, A, V, I, L, D, E, N, Q, S, T, P, F, Y, W, or absent (e.g., V, A, E, N, Q, S, T, P, F, Y, or absent);
    • X12 is G, A, V, I, L, P, F, Y, W, or absent (e.g., V, I, L, P, W, or absent);
    • X13 is G, A, V, I, L, N, Q, R, H, K, P, F, Y, W, or absent (e.g., I, V, N, H, P, F, or absent);
    • X14 is D, E, R, H, K, S, T, P, F, Y, W, or absent (e.g., D, R, H, S, T, P, or absent);
    • X15 is A, V, I, L, D, E, R, H, K, N, Q, P, F, Y, W, or absent (e.g., A, E, R, Q, F, or absent); and
    • X24 is D, E, R, H, K, P, F, Y, W, or absent (e.g., D, R, K, P, or absent).

In some embodiments, each X in SEQ ID NO: 172 can be an amino acid in any one of SEQ ID NOs: 108-141 when any one of the sequences in SEQ ID NOs: 108-141 is used as a reference sequence to be optimally aligned with SEQ ID NO:172. In other embodiments, each X in SEQ ID NO:172 can be an amino acid in any one of SEQ ID NOs: 108-126 when any one of the sequences in SEQ ID NOs: 108-126 is used as a reference sequence to be optimally aligned with SEQ ID NO:172.

In other embodiments, the third CDR includes or is a polypeptide sequence having at least 90% sequence identity to SEQ ID NO:173:

    • YWX8X9NGX12X13PF-----X23X24,
    • wherein:
    • X8 is G, A, V, I, L, D, E, R, H, K, P, F, Y, or absent (e.g., A, D, K, F, Y, or absent);
    • X9 is G, A, V, I, L, R, H, K, N, Q, P, F, Y, or absent (e.g., A, I, R, Q, F, Y, or absent);
    • X12 is G, A, V, I, L, P, F, Y, W, or absent (e.g., V, I, L, P, W, or absent);
    • X13 is G, A, V, I, L, N, Q, R, H, K, P, F, Y, W, or absent (e.g., I, V, N, H, P, F, or absent);
    • X23 is P, F, Y, W, or absent (e.g., F, Y, W, or absent); and
    • X24 is D, E, R, H, K, P, F, Y, W, or absent (e.g., D, R, K, P, or absent).

In some embodiments, each X in SEQ ID NO:173 can be an amino acid in any one of SEQ ID NOs: 108-141 when any one of the sequences in SEQ ID NOs: 108-141 is used as a reference sequence to be optimally aligned with SEQ ID NO:173. In other embodiments, each X in SEQ ID NO:173 can be an amino acid in any one of SEQ ID NOs: 108-126 when any one of the sequences in SEQ ID NOs:108-126 is used as a reference sequence to be optimally aligned with SEQ ID NO:173.

In other embodiments, the third CDR includes or is a polypeptide sequence having at least 90% sequence identity to SEQ ID NO:174:

    • FPX12X13D--X17X18X19X20X21X22W,
    • wherein:
    • X12 is G, A, V, I, L, P, F, Y, W, or absent (e.g., V, I, L, P, W, or absent);
    • X13 is G, A, V, I, L, N, Q, R, H, K, P, F, Y, W, or absent (e.g., I, V, N, H, P, F, or absent);
    • X17 is G, A, V, I, L, R, H, K, N, Q, S, T, P, F, Y, W, or absent (e.g., G, A, V, R, K, Q, S, F, or absent);
    • X18 is G, A, V, I, L, R, H, K, N, Q, or absent (e.g., G, V, L, K, N, Q, or absent);
    • X19 is A, V, I, L, D, E, R, H, K, S, T, P, F, Y, W, or absent (e.g., A, L, E, R, S, T, P, Y, or absent);
    • X20 is G, D, E, N, Q, P, F, Y, W, or absent (e.g., G, D, E, N, P, or absent);
    • X21 is A, V, I, L, R, H, K, D, E, S, T, N, Q, P, F, Y, W, or absent (e.g., L, R, E, T, N, P, Y, or absent); and
    • X22 is G, A, V, I, L, D, E, R, H, K, N, Q, or absent (e.g., G, A, V, E, H, K, Q, or absent).

In some embodiments, each X in SEQ ID NO:174 can be an amino acid in any one of SEQ ID NOs: 108-141 when any one of the sequences in SEQ ID NOs: 108-141 is used as a reference sequence to be optimally aligned with SEQ ID NO:174. In other embodiments, each X in SEQ ID NO:174 can be an amino acid in any one of SEQ ID NOs: 108-126 when any one of the sequences in SEQ ID NOs: 108-126 is used as a reference sequence to be optimally aligned with SEQ ID NO: 174.

In yet other embodiments, the third CDR includes or is a polypeptide sequence having at least 90% sequence identity to SEQ ID NO:175:

    • FPLX13D--X17X18X19X20X21GW,
    • wherein:
    • X13 is G, A, V, I, L, N, Q, R, H, K, P, F, Y, W, or absent (e.g., I, V, N, H, P, F, or absent);
    • X17 is G, A, V, I, L, R, H, K, N, Q, S, T, P, F, Y, W, or absent (e.g., G, A, V, R, K, Q, S, F, or absent);
    • X18 is G, A, V, I, L, R, H, K, N, Q, or absent (e.g., G, V, L, K, N, Q, or absent);
    • X19 is A, V, I, L, D, E, R, H, K, S, T, P, F, Y, W, or absent (e.g., A, L, E, R, S, T, P, Y, or absent);
    • X20 is G, D, E, N, Q, P, F, Y, W, or absent (e.g., G, D, E, N, P, or absent); and
    • X21 is A, V, I, L, R, H, K, D, E, S, T, N, Q, P, F, Y, W, or absent (e.g., L, R, E, T, N, P, Y, or absent).

In some embodiments, each X in SEQ ID NO: 175 can be an amino acid in any one of SEQ ID NOs: 108-141 when any one of the sequences in SEQ ID NOs: 108-141 is used as a reference sequence to be optimally aligned with SEQ ID NO:175. In other embodiments, each X in SEQ ID NO: 175 can be an amino acid in any one of SEQ ID NOs: 108-126 when any one of the sequences in SEQ ID NOs: 108-126 is used as a reference sequence to be optimally aligned with SEQ ID NO: 175.

The construct can include one or more binding domains. The binding domain can also be characterized by its binding affinity to a binding sequence. The terms “binding sequence,” “binding domain,” or “binding site”, as used herein, refer to the portion, region, or site of polypeptide that mediates specific binding with a target molecule (e.g., a SARS-COV-2 as the target, including the spike protein or RBD thereof). Exemplary binding domains include an antigen binding site (e.g., a VHH, VH, and/or VL domain) or molecules comprising such a binding site (e.g., an antibody or a single domain antibody). In one instance, a plurality of CDRs can be taken together to form a binding domain for the construct.

Non-limiting constructs have CDRs and framework regions (FRs). As can be seen, each CDR can be disposed between two FRs. As seen in FIG. 8A, a non-limiting construct can include framework region 1 (FR1) attached to an N-terminus of CDR1; FR2 disposed between CDR1 and CD2; FR3 disposed between CDR2 and CDR3; and FR4 attached to a C-terminus of CDR3. Examples of sequences for CDR1, CDR2, and CDR3 include, e.g., any sequences for first CDR, second CDR, and third CDR, respectively, as described herein.

FIG. 8B shows non-limiting constructs, which provides sequences for framework regions disposed between regions indicated as CDR1, CDR2, and CDR3. SEQ ID NOs: 180-182 provide consensus sequences, in which each X in SEQ ID NOs: 180-182 can be an amino acid in any one of SEQ ID NOs: 183-186 when any one of the sequences in SEQ ID NOs: 183-186 is used as a reference sequence to be optimally aligned with one of SEQ ID NOs: 180-182.

In some embodiments, the construct includes or is a polypeptide sequence having at least 90% sequence identity to SEQ ID NO:180:

    • X1VQLX5X6SGX9X10X11X12X13X14X15X16X17LX19LX21CX23X24SGX27X28X29X30-CDR1-X31X32WX34X35X36X37X38X39X40X41X42X43X44X45X46X47X48X49-CDR2-X50X51X52X53X54X55X56X57X58X59X60X61X62X63DX65X66X67X68X69X70X71X72X73X74X75
    • X76X77X78X79X80DX82X83X84YX86X87X88X89-CDR3-X90X91GX93GX95X96X97X98
    • VSX101,
    • wherein:
    • X1 is A, V, I, L, D, E, R, H, K, N, or Q (e.g., A, D, E, H, or Q);
    • X5 is A, V, I, L, N, or Q (e.g., V, L, or Q);
    • X6 is A, V, I, L, D, E, N, or Q (e.g., A, E, or Q);
    • X9 is G, A, V, I, L, P, F, Y, or W (e.g., G, A, or P);
    • X10 is G, A, V, I, L, D, E, N, Q, S, or T (e.g., G, A, E, N, or S);
    • X11 is A, V, I, L, S, T, F, Y, or W (e.g., V, L, S, or F);
    • X12 is A, V, I, L, R, H, K, M, S, or T (e.g., V, K, or M);
    • X13 is R, H, K, N, or Q (e.g., R, K, or Q);
    • X14 is A, V, I, L, F, Y, or P (e.g., A or P);
    • X15 is G, S, or T (e.g., G or S);
    • X16 is G, A, V, I, L, D, E, R, H, K, N, Q, S, or T (e.g., G, A, D, E, R, Q, or S);
    • X17 is S, T, N, or Q (e.g., S or T);
    • X19 is R, H, K, S, or T (e.g., R, K, S, or T);
    • X21 is S, T, N, or Q (e.g., S or T);
    • X23 is G, A, V, I, L, R, H, K, S, or T (e.g., A, V, K, or T);
    • X24 is A, V, I, L, F, Y, or W (e.g., A, V, I, or F);
    • X27 is G, F, Y, W, or absent (e.g., G, F, or absent);
    • X28 is R, H, K, S, T, P, F, Y, W, or absent (e.g., K, S, T, P, or absent);
    • X29 is A, V, I, L, D, E, R, H, K, F, Y, W, or absent (e.g., V, I, E, R, F, or absent);
    • X30 is G, D, E, N, Q, S, T, F, Y, W, or absent (e.g., G, D, E, N, T, Y, or absent);
    • X31 is A, V, I, L, M, S, T, F, Y, W, or absent (e.g., I, V, M, W, or absent);
    • X32 is G, A, V, I, L, N, Q, R, H, K, or absent (e.g., G, A, N, H, or absent);
    • X34 is A, V, I, L, P, F, Y or W (e.g., I, V, F, or Y);
    • X35 is R, H, or K (e.g., R or K);
    • X36 is R, H, K, N, or Q (e.g., R or Q);
    • X37 is A, V, I, L, R, H, K, P, F, Y, or W (e.g., A, V, R, or P);
    • X38 is R, H, K, S, T, P, F, Y, or W (e.g., H, S, T, or P);
    • X39 is G, D, or E (e.g., G or E);
    • X40 is G, R, H, K, N, or Q (e.g., G, R, K, N, or Q);
    • X41 is G, A, V, I, L, D, E, R, H, K, N, or Q (e.g., G, A, E, R, or Q);
    • X42 is A, V, I, L, R, H, K, P, F, Y, or W (e.g., L, R, P, or F);
    • X43 is D, E, S or T (e.g., D or E);
    • X44 is G, A, V, I, L, P, F, Y, or W (e.g., G, A, L, F, or W);
    • X45 is A, V, I, L, M, S, or T (e.g., V, I, L, or M);
    • X46 is G, A, V, I, L, S, or T (e.g., G, A, V, or S);
    • X47 is A, V, I, L, R, H, K, M, S, T, or absent (e.g., A, V, I, R, S, T, or absent);
    • X48 is A, V, I, L, M, S, T, or absent (e.g., V, I, L, M, or absent);
    • X49 is A, V, I, L, D, E, R, H, K, M, S, T, or absent (e.g., A, D, R, S, or absent);
    • X50 is A, V, I, L, D, E, R, H, K, N, Q, S, T, F, Y, W, or absent (e.g., L, D, R, N, T, Y, or absent);
    • X51 is R, H, K, S, T, F, Y, W, or absent (e.g., H, S, F, Y, or absent);
    • X52 is G, A, V, I, L, D, E, R, H, K, N, Q, S, T, or absent (e.g., G, A, V, L, D, E, R, N, T, or absent);
    • X53 is G, D, E, N, Q, S, T, P, F, Y, W, or absent (e.g., G, D, E, Q, S, P, or absent);
    • X54 is A, V, I, L, R, H, K, S, T, F, Y, W, or absent (e.g., A, K, S, F, or absent);
    • X55 is A, V, I, L, M, S, T, F, Y, W, or absent (e.g., A, V, L, M, F, or absent);
    • X56 is D, E, R, H, K, N, Q, or absent (e.g., E, R, K, Q, or absent);
    • X57 is G, D, E, S, T, or absent (e.g., G, D, S, or absent);
    • X58 is R, H, or K (e.g., R or K);
    • X59 is A, V, I, L, F, Y, or W (e.g., A, V, L, or F);
    • X60 is A, V, I, L, C, M, S, or T (e.g., A, C, S, or T);
    • X61 is A, V, I, L, C, M, S, T, F, Y, or W (e.g., A, I, L, M, S, or F);
    • X62 is C, M, S, or T (e.g., S or T);
    • X63 is A, V, I, L, R, H, K, N, or Q (e.g., A, V, R, K, or Q);
    • X65 is A, V, I, L, D, E, R, H, K, N, Q, S, or T (e.g., I, D, R, K, N, S, or T);
    • X66 is G, A, V, I, L, D, E, R, H, K, N, Q, S, or T (e.g., G, A, D, R, K, N, or S);
    • X67 is A, V, I, L, R, H, K, S, or T (e.g., A, R, K, S, or T);
    • X68 is R, H, K, N, Q, S, or T (e.g., K, N, S, or T);
    • X69 is A, V, I, L, C, M, N, Q, S, or T (e.g., A, L, M, Q, S, or T);
    • X70 is A, V, I, L, C, M, F, Y, or W (e.g., A, V, L, M, or F);
    • X71 is S, T, F, Y, or W (e.g., S, T, F, or Y);
    • X72 is A, V, I, L, C, or M (e.g., L or M);
    • X73 is D, E, R, H, K, N, Q, S, T, F, Y, or W (e.g., E, R, K, Q, S, or F);
    • X74 is A, V, I, L, C, or M (e.g., L or M);
    • X75 is D, E, N, Q, S, or T (e.g., D, N, or S);
    • X76 is R, H, K, N, Q, S, or T (e.g., R, N, or S);
    • X77 is A, V, I, or L (e.g., V or L);
    • X78 is R, H, K, N, Q, S, or T (e.g., R, K, Q, or T);
    • X79 is A, V, I, L, R, H, K, S, T, P, F, Y, or W (e.g., A, V, L, R, S, T, P, or Y);
    • X80 is A, V, I, L, D, or E (e.g., A, D, or E);
    • X82 is C, S, or T (e.g., S or T);
    • X83 is G, A, V, I, or L (e.g., G or A);
    • X84 is A, V, I, L, C, M, D, E, S or T (e.g., V, I, M, D, E, or T);
    • X86 is S, T, F, Y, or W (e.g., T, F, or Y);
    • X87 is A, V, I, L, C, or M (e.g., V or C);
    • X88 is A, V, I, L, N, Q, S, T, F, Y, W, or absent (e.g., A, V, N, Q, T, Y, or absent);
    • X89 is G, A, V, I, L, R, H, K, F, Y, W, or absent (e.g., G, A, V, R, K, Y, or absent);
    • X90 is any amino acid or absent (e.g., V, H, Q, S, F, Y, or absent);
    • X91 is R, H, K, F, Y, or W (e.g., R or W);
    • X93 is R, H, K, N, Q, P, F, Y, or W (e.g., R, K, Q, or P);
    • X95 is A, V, I, L, S, or T (e.g., L or T);
    • X96 is A, V, I, L, C, M, N, Q, S, or T (e.g., L, M, Q, S, or T);
    • X97 is A, V, I, or L (e.g., V or L);
    • X98 is A, V, I, L, S, or T (e.g., V or T);
    • X101 is S, T, or absent (e.g., S or absent);
    • CDR1 is any CDR described herein (e.g., SEQ ID NOs:40-73 and 150-155);
    • CDR2 is any CDR described herein (e.g., SEQ ID NOs:74-107 and 160-167); and
    • CDR3 is any CDR described herein (e.g., SEQ ID NOs: 108-141 and 170-175).

In other embodiments, the construct includes or is a polypeptide sequence having at least 90% sequence identity to SEQ ID NO:181:

    • X1X2X3LX5X6X7GX9X10X11X12X13PX15X16X17X18X19X20X21CX23X24X25X26-CDR1-X31X32WX34X35X36X37X38X39X40X41X42EX44X45X46X47X48X49-CDR2-X50X51X52X53X54X55X56X57X58X59X60X61X62X63X64X65X66X67X68X69X70X71X72X73
    • X74X75X76X77X78X79X80DX82X83X84YX86X87X88X89-CDR3-X90WGX93X94X95X96
    • X97X98VSX101,
    • wherein:
    • X1 is A, V, I, L, D, E, R, H, K, N, or Q (e.g., A, D, E, H, or Q);
    • X2 is A, V, I, or L (e.g., V or L);
    • X3 is N, Q, S, or T (Q or T);
    • X5 is A, V, I, L, N, or Q (e.g., V, L, or Q);
    • X6 is A, V, I, L, D, E, N, or Q (e.g., A, E, or Q);
    • X7 is S, T, P, F, Y, or W (e.g., S, T, or P);
    • X9 is G, A, V, I, L, P, F, Y, or W (e.g., G, A, or P);
    • X10 is G, A, V, I, L, D, E, N, Q, S, or T (e.g., G, A, E, N, or S);
    • X11 is A, V, I, L, S, T, F, Y, or W (e.g., V, L, S, or F);
    • X12 is A, V, I, L, R, H, K, M, S, or T (e.g., V, K, or M);
    • X13 is R, H, K, N, or Q (e.g., R, K, or Q);
    • X15 is G, S, or T (e.g., G or S);
    • X16 is G, A, V, I, L, D, E, R, H, K, N, Q, S, or T (e.g., G, A, D, E, R, Q, or S);
    • X17 is S, T, N, or Q (e.g., S or T);
    • X18 is A, V, I, or L (e.g., V, I, or L);
    • X19 is R, H, K, S, or T (e.g., R, K, S, or T);
    • X20 is A, V, I, or L (e.g., V, I, or L);
    • X21 is S, T, N, or Q (e.g., S or T);
    • X23 is G, A, V, I, L, R, H, K, S, or T (e.g., A, V, K, or T);
    • X24 is A, V, I, L, F, Y, or W (e.g., A, V, I, or F);
    • X25 is S or T;
    • X26 is G, A, V, I, L, D, E, R, H, K, or absent (e.g., G, A, E, R, or absent);
    • X31 is A, V, I, L, M, S, T, F, Y, W, or absent (e.g., I, V, M, W, or absent);
    • X32 is G, A, V, I, L, N, Q, R, H, K, or absent (e.g., G, A, N, H, or absent);
    • X34 is A, V, I, L, P, F, Y or W (e.g., I, V, F, or Y);
    • X35 is R, H, or K (e.g., R or K);
    • X36 is R, H, K, N, or Q (e.g., R or Q);
    • X37 is A, V, I, L, R, H, K, P, F, Y, or W (e.g., A, V, R, or P);
    • X38 is R, H, K, S, T, P, F, Y, or W (e.g., H, S, T, or P);
    • X39 is G, D, or E (e.g., G or E);
    • X40 is G, R, H, K, N, or Q (e.g., G, R, K, N, or Q);
    • X41 is G, A, V, I, L, D, E, R, H, K, N, or Q (e.g., G, A, E, R, or Q);
    • X42 is A, V, I, L, R, H, K, P, F, Y, or W (e.g., L, R, P, or F);
    • X43 is G, A, V, I, L, P, F, Y, or W (e.g., G, A, L, F, or W);
    • X45 is A, V, I, L, M, S, or T (e.g., V, I, L, or M);
    • X46 is G, A, V, I, L, S, or T (e.g., G, A, V, or S);
    • X47 is A, V, I, L, R, H, K, M, S, T, or absent (e.g., A, V, I, R, S, T, or absent);
    • X48 is A, V, I, L, M, S, T, or absent (e.g., V, I, L, M, or absent);
    • X49 is A, V, I, L, D, E, R, H, K, M, S, T, or absent (e.g., A, D, R, S, or absent);
    • X50 is A, V, I, L, D, E, R, H, K, N, Q, S, T, F, Y, W, or absent (e.g., L, D, R, N, T, Y, or absent);
    • X51 is R, H, K, S, T, F, Y, W, or absent (e.g., H, S, F, Y, or absent);
    • X52 is G, A, V, I, L, D, E, R, H, K, N, Q, S, T, or absent (e.g., G, A, V, L, D, E, R, N, T, or absent);
    • X53 is G, D, E, N, Q, S, T, P, F, Y, W, or absent (e.g., G, D, E, Q, S, P, or absent);
    • X54 is A, V, I, L, R, H, K, S, T, F, Y, W, or absent (e.g., A, K, S, F, or absent);
    • X55 is A, V, I, L, M, S, T, F, Y, W, or absent (e.g., A, V, L, M, F, or absent);
    • X56 is D, E, R, H, K, N, Q, or absent (e.g., E, R, K, Q, or absent);
    • X57 is G, D, E, S, T, or absent (e.g., G, D, S, or absent);
    • X58 is R, H, or K (e.g., R or K);
    • X59 is A, V, I, L, F, Y, or W (e.g., A, V, L, or F);
    • X60 is A, V, I, L, C, M, S, or T (e.g., A, C, S, or T);
    • X61 is A, V, I, L, C, M, S, T, F, Y, or W (e.g., A, I, L, M, S, or F);
    • X62 is C, M, S, or T (e.g., S or T);
    • X63 is A, V, I, L, R, H, K, N, or Q (e.g., A, V, R, K, or Q);
    • X64 is D or E;
    • X65 is A, V, I, L, D, E, R, H, K, N, Q, S, or T (e.g., I, D, R, K, N, S, or T);
    • X66 is G, A, V, I, L, D, E, R, H, K, N, Q, S, or T (e.g., G, A, D, R, K, N, or S);
    • X67 is A, V, I, L, R, H, K, S, or T (e.g., A, R, K, S, or T);
    • X68 is R, H, K, N, Q, S, or T (e.g., K, N, S, or T);
    • X69 is A, V, I, L, C, M, N, Q, S, or T (e.g., A, L, M, Q, S, or T);
    • X70 is A, V, I, L, C, M, F, Y, or W (e.g., A, V, L, M, or F);
    • X71 is S, T, F, Y, or W (e.g., S, T, F, or Y);
    • X72 is A, V, I, L, C, or M (e.g., L or M);
    • X73 is D, E, R, H, K, N, Q, S, T, F, Y, or W (e.g., E, R, K, Q, S, or F);
    • X74 is A, V, I, L, C, or M (e.g., L or M);
    • X75 is D, E, N, Q, S, or T (e.g., D, N, or S);
    • X76 is R, H, K, N, Q, S, or T (e.g., R, N, or S);
    • X77 is A, V, I, or L (e.g., V or L);
    • X78 is R, H, K, N, Q, S, or T (e.g., R, K, Q, or T);
    • X79 is A, V, I, L, R, H, K, S, T, P, F, Y, or W (e.g., A, V, L, R, S, T, P, or Y);
    • X80 is A, V, I, L, D, or E (e.g., A, D, or E);
    • X82 is C, S, or T (e.g., S or T);
    • X83 is G, A, V, I, or L (e.g., G or A);
    • X84 is A, V, I, L, C, M, D, E, S or T (e.g., V, I, M, D, E, or T);
    • X86 is S, T, F, Y, or W (e.g., T, F, or Y);
    • X87 is A, V, I, L, C, or M (e.g., V or C);
    • X88 is A, V, I, L, N, Q, S, T, F, Y, W, or absent (e.g., A, V, N, Q, T, Y, or absent);
    • X89 is G, A, V, I, L, R, H, K, F, Y, W, or absent (e.g., G, A, V, R, K, Y, or absent);
    • X90 is any amino acid or absent (e.g., V, H, Q, S, F, Y, or absent);
    • X93 is R, H, K, N, Q, P, F, Y, or W (e.g., R, K, Q, or P);
    • X94 is G, A, V, I, or L (e.g., G);
    • X95 is A, V, I, L, S, or T (e.g., L or T);
    • X96 is A, V, I, L, C, M, N, Q, S, or T (e.g., L, M, Q, S, or T);
    • X97 is A, V, I, or L (e.g., V or L);
    • X98 is A, V, I, L, S, or T (e.g., V or T);
    • X101 is S, T, or absent (e.g., S or absent);
    • CDR1 is any CDR described herein (e.g., SEQ ID NOs:40-73 and 150-155);
    • CDR2 is any CDR described herein (e.g., SEQ ID NOs:74-107 and 160-167); and
    • CDR3 is any CDR described herein (e.g., SEQ ID NOs: 108-141 and 170-175).

In yet other embodiments, the construct includes or is a polypeptide sequence having at least 90% sequence identity to SEQ ID NO:182:

    • X1VX3LX5X6SGGGX11X12X13X14GX16SLX19LSCAASG-CDR1-X31X32WX34RX36X37PX39X40X41X42X43X44X45X46X47X48X49-CDR2-X50YX52X53X54X55X56X57RFX60X61SX63DX65X66X67X68X69X70X71LX73X74X75X76X77X78
    • X79X80DTX83X84YX86CAX89-CDR3-X90X91GX93GTX96VTVSX101,
    • wherein:
    • X1 is A, V, I, L, D, E, R, H, K, N, or Q (e.g., A, D, E, H, or Q);
    • X3 is N, Q, S, or T (Q or T);
    • X5 is A, V, I, L, N, or Q (e.g., V, L, or Q);
    • X6 is A, V, I, L, D, E, N, or Q (e.g., A, E, or Q);
    • X11 is A, V, I, L, S, T, F, Y, or W (e.g., V, L, S, or F);
    • X12 is A, V, I, L, R, H, K, M, S, or T (e.g., V, K, or M);
    • X13 is R, H, K, N, or Q (e.g., R, K, or Q);
    • X14 is A, V, I, L, F, Y, or P (e.g., A or P);
    • X16 is G, A, V, I, L, D, E, R, H, K, N, Q, S, or T (e.g., G, A, D, E, R, Q, or S);
    • X19 is R, H, K, S, or T (e.g., R, K, S, or T);
    • X31 is A, V, I, L, M, S, T, F, Y, W, or absent (e.g., I, V, M, W, or absent);
    • X32 is G, A, V, I, L, N, Q, R, H, K, or absent (e.g., G, A, N, H, or absent);
    • X34 is A, V, I, L, P, F, Y or W (e.g., I, V, F, or Y);
    • X36 is R, H, K, N, or Q (e.g., R or Q);
    • X37 is A, V, I, L, R, H, K, P, F, Y, or W (e.g., A, V, R, or P);
    • X39 is G, D, or E (e.g., G or E);
    • X40 is G, R, H, K, N, or Q (e.g., G, R, K, N, or Q);
    • X41 is G, A, V, I, L, D, E, R, H, K, N, or Q (e.g., G, A, E, R, or Q);
    • X42 is A, V, I, L, R, H, K, P, F, Y, or W (e.g., L, R, P, or F);
    • X43 is D or E;
    • X44 is G, A, V, I, L, P, F, Y, or W (e.g., G, A, L, F, or W);
    • X45 is A, V, I, L, M, S, or T (e.g., V, I, L, or M);
    • X46 is G, A, V, I, L, S, or T (e.g., G, A, V, or S);
    • X47 is A, V, I, L, R, H, K, M, S, T, or absent (e.g., A, V, I, R, S, T, or absent);
    • X48 is A, V, I, L, M, S, T, or absent (e.g., V, I, L, M, or absent);
    • X49 is A, V, I, L, D, E, R, H, K, M, S, T, or absent (e.g., A, D, R, S, or absent);
    • X50 is A, V, I, L, D, E, R, H, K, N, Q, S, T, F, Y, W, or absent (e.g., L, D, R, N, T, Y, or absent);
    • X52 is G, A, V, I, L, D, E, R, H, K, N, Q, S, T, or absent (e.g., G, A, V, L, D, E, R, N, T, or absent);
    • X53 is G, D, E, N, Q, S, T, P, F, Y, W, or absent (e.g., G, D, E, Q, S, P, or absent);
    • X54 is A, V, I, L, R, H, K, S, T, F, Y, W, or absent (e.g., A, K, S, F, or absent);
    • X55 is A, V, I, L, M, S, T, F, Y, W, or absent (e.g., A, V, L, M, F, or absent);
    • X56 is D, E, R, H, K, N, Q, or absent (e.g., E, R, K, Q, or absent);
    • X57 is G, D, E, S, T, or absent (e.g., G, D, S, or absent);
    • X60 is A, V, I, L, C, M, S, or T (e.g., A, C, S, or T);
    • X61 is A, V, I, L, C, M, S, T, F, Y, or W (e.g., A, I, L, M, S, or F);
    • X63 is A, V, I, L, R, H, K, N, or Q (e.g., A, V, R, K, or Q);
    • X65 is A, V, I, L, D, E, R, H, K, N, Q, S, or T (e.g., I, D, R, K, N, S, or T);
    • X66 is G, A, V, I, L, D, E, R, H, K, N, Q, S, or T (e.g., G, A, D, R, K, N, or S);
    • X67 is A, V, I, L, R, H, K, S, or T (e.g., A, R, K, S, or T);
    • X68 is R, H, K, N, Q, S, or T (e.g., K, N, S, or T);
    • X69 is A, V, I, L, C, M, N, Q, S, or T (e.g., A, L, M, Q, S, or T);
    • X70 is A, V, I, L, C, M, F, Y, or W (e.g., A, V, L, M, or F);
    • X71 is S, T, F, Y, or W (e.g., S, T, F, or Y);
    • X73 is D, E, R, H, K, N, Q, S, T, F, Y, or W (e.g., E, R, K, Q, S, or F);
    • X74 is A, V, I, L, C, or M (e.g., L or M);
    • X75 is D, E, N, Q, S, or T (e.g., D, N, or S);
    • X76 is R, H, K, N, Q, S, or T (e.g., R, N, or S);
    • X77 is A, V, I, or L (e.g., V or L);
    • X78 is R, H, K, N, Q, S, or T (e.g., R, K, Q, or T);
    • X79 is A, V, I, L, R, H, K, S, T, P, F, Y, or W (e.g., A, V, L, R, S, T, P, or Y);
    • X80 is A, V, I, L, D, or E (e.g., A, D, or E);
    • X83 is G, A, V, I, or L (e.g., G or A);
    • X84 is A, V, I, L, C, M, D, E, S or T (e.g., V, I, M, D, E, or T);
    • X86 is S, T, F, Y, or W (e.g., T, F, or Y);
    • X89 is G, A, V, I, L, R, H, K, F, Y, W, or absent (e.g., G, A, V, R, K, Y, or absent);
    • X90 is any amino acid or absent (e.g., V, H, Q, S, F, Y, or absent);
    • X91 is F, Y, or W (e.g., W);
    • X93 is R, H, K, N, Q, P, F, Y, or W (e.g., R, K, Q, or P);
    • X96 is A, V, I, L, C, M, N, Q, S, or T (e.g., L, M, Q, S, or T);
    • X101 is S, T, or absent (e.g., S or absent);
    • CDR1 is any CDR described herein (e.g., SEQ ID NOs:40-73 and 150-155);
    • CDR2 is any CDR described herein (e.g., SEQ ID NOs:74-107 and 160-167); and
    • CDR3 is any CDR described herein (e.g., SEQ ID NOs: 108-141 and 170-175).

In some embodiments, the construct includes or is a polypeptide sequence having at least 90% sequence identity to SEQ ID NOs: 183-186. In particular embodiments, CDR1 is any CDR described herein (e.g., SEQ ID NOs:40-73 and 150-155); CDR2 is any CDR described herein (e.g., SEQ ID NOs: 74-107 and 160-167); and CDR3 is any CDR described herein (e.g., SEQ ID NOs:108-141 and 170-175).

Any of the constructs herein can include any of the FRs described herein. FIG. 9A provides non-limiting FR1 sequences. In some embodiments, the first FR includes or is a polypeptide sequence having at least 90% sequence identity to SEQ ID NOs: 190-212. In other embodiments, the first FR includes or is a polypeptide sequence having at least 90% sequence identity to SEQ ID NO:213:

    • X1VQLX5X6SGX9X10X11X12X13X14X15X16X17LX19LX21CX23X24SGX27X28X29X30,
    • wherein:
    • X1 is A, V, I, L, D, E, R, H, K, N, or Q (e.g., A, D, E, H, or Q);
    • X5 is A, V, I, L, N, or Q (e.g., V, L, or Q);
    • X6 is A, V, I, L, D, E, N, or Q (e.g., A, E, or Q);
    • X9 is G, A, V, I, L, P, F, Y, or W (e.g., G, A, or P);
    • X10 is G, A, V, I, L, D, E, N, Q, S, or T (e.g., G, A, E, N, or S);
    • X11 is A, V, I, L, S, T, F, Y, or W (e.g., V, L, S, or F);
    • X12 is A, V, I, L, R, H, K, M, S, or T (e.g., V, K, or M);
    • X13 is R, H, K, N, or Q (e.g., R, K, or Q);
    • X14 is A, V, I, L, F, Y, or P (e.g., A or P);
    • X15 is G, S, or T (e.g., G or S);
    • X16 is G, A, V, I, L, D, E, R, H, K, N, Q, S, or T (e.g., G, A, D, E, R, Q, or S);
    • X17 is S, T, N, or Q (e.g., S or T);
    • X19 is R, H, K, S, or T (e.g., R, K, S, or T);
    • X21 is S, T, N, or Q (e.g., S or T);
    • X23 is G, A, V, I, L, R, H, K, S, or T (e.g., A, V, K, or T);
    • X24 is A, V, I, L, F, Y, or W (e.g., A, V, I, or F);
    • X27 is G, F, Y, W, or absent (e.g., G, F, or absent);
    • X28 is R, H, K, S, T, P, F, Y, W, or absent (e.g., K, S, T, P, or absent);
    • X29 is A, V, I, L, D, E, R, H, K, F, Y, W, or absent (e.g., V, I, E, R, F, or absent); and
    • X30 is G, D, E, N, Q, S, T, F, Y, W, or absent (e.g., G, D, E, N, T, Y, or absent).

In some embodiments, each X in SEQ ID NO:213 can be an amino acid in any one of SEQ ID NOs: 190-212 when any one of the sequences in SEQ ID NOs: 190-212 is used as a reference sequence to be optimally aligned with SEQ ID NO:213.

In other embodiments, the first FR includes or is a polypeptide sequence having at least 90% sequence identity to SEQ ID NO:214:

    • X1X2X3LX5X6X7GX9X10X11X12X13X14X15X16X17X18X19X20X21CX23X24X25X26,
    • wherein:
    • X1 is A, V, I, L, D, E, R, H, K, N, or Q (e.g., A, D, E, H, or Q);
    • X2 is A, V, I, or L (e.g., V or L);
    • X3 is N, Q, S, or T (Q or T);
    • X5 is A, V, I, L, N, or Q (e.g., V, L, or Q);
    • X6 is A, V, I, L, D, E, N, or Q (e.g., A, E, or Q);
    • X7 is S, T, P, F, Y, or W (e.g., S, T, or P);
    • X9 is G, A, V, I, L, P, F, Y, or W (e.g., G, A, or P);
    • X10 is G, A, V, I, L, D, E, N, Q, S, or T (e.g., G, A, E, N, or S);
    • X11 is A, V, I, L, S, T, F, Y, or W (e.g., V, L, S, or F);
    • X12 is A, V, I, L, R, H, K, M, S, or T (e.g., V, K, or M);
    • X13 is R, H, K, N, or Q (e.g., R, K, or Q);
    • X14 is A, V, I, L, F, Y, or P (e.g., A or P);
    • X15 is G, S, or T (e.g., G or S);
    • X16 is G, A, V, I, L, D, E, R, H, K, N, Q, S, or T (e.g., G, A, D, E, R, Q, or S);
    • X17 is S, T, N, or Q (e.g., S or T);
    • X18 is A, V, I, or L (e.g., V, I, or L);
    • X19 is R, H, K, S, or T (e.g., R, K, S, or T);
    • X20 is A, V, I, or L (e.g., V, I, or L);
    • X21 is S, T, N, or Q (e.g., S or T);
    • X23 is G, A, V, I, L, R, H, K, S, or T (e.g., A, V, K, or T);
    • X24 is A, V, I, L, F, Y, or W (e.g., A, V, I, or F);
    • X25 is S or T; and
    • X26 is G, A, V, I, L, D, E, R, H, K, or absent (e.g., G, A, E, R, or absent).

In some embodiments, each X in SEQ ID NO:214 can be an amino acid in any one of SEQ ID NOs: 190-212 when any one of the sequences in SEQ ID NOs: 190-212 is used as a reference sequence to be optimally aligned with SEQ ID NO:214.

In yet other embodiments, the first FR includes or is a polypeptide sequence having at least 90% sequence identity to SEQ ID NO:215:

    • X1VQLX5X6SGX9X10X11X12X13X14X15X16X17LX19LX21CX23X24SG,
    • wherein:
    • X1 is A, V, I, L, D, E, R, H, K, N, or Q (e.g., A, D, E, H, or Q);
    • X5 is A, V, I, L, N, or Q (e.g., V, L, or Q);
    • X6 is A, V, I, L, D, E, N, or Q (e.g., A, E, or Q);
    • X9 is G, A, V, I, L, P, F, Y, or W (e.g., G, A, or P);
    • X10 is G, A, V, I, L, D, E, N, Q, S, or T (e.g., G, A, E, N, or S);
    • X11 is A, V, I, L, S, T, F, Y, or W (e.g., V, L, S, or F);
    • X12 is A, V, I, L, R, H, K, M, S, or T (e.g., V, K, or M);
    • X13 is R, H, K, N, or Q (e.g., R, K, or Q);
    • X14 is A, V, I, L, F, Y, or P (e.g., A or P);
    • X15 is G, S, or T (e.g., G or S);
    • X16 is G, A, V, I, L, D, E, R, H, K, N, Q, S, or T (e.g., G, A, D, E, R, Q, or S);
    • X17 is S, T, N, or Q (e.g., S or T);
    • X19 is R, H, K, S, or T (e.g., R, K, S, or T);
    • X21 is S, T, N, or Q (e.g., S or T);
    • X23 is G, A, V, I, L, R, H, K, S, or T (e.g., A, V, K, or T); and
    • X24 is A, V, I, L, F, Y, or W (e.g., A, V, I, or F).

In some embodiments, each X in SEQ ID NO:215 can be an amino acid in any one of SEQ ID NOs: 190-212 when any one of the sequences in SEQ ID NOs: 190-212 is used as a reference sequence to be optimally aligned with SEQ ID NO:215.

In some embodiments, the first FR includes or is a polypeptide sequence having at least 90% sequence identity to SEQ ID NO:216:

    • QVQLVESGGGL VQX14GGSLRLSCAASGX27X28X29X30,
    • wherein:
    • X14 is A, V, I, L, F, Y, or P (e.g., A or P);
    • X27 is G, F, Y, W, or absent (e.g., G, F, or absent);
    • X28 is R, H, K, S, T, P, F, Y, W, or absent (e.g., K, S, T, P, or absent);
    • X29 is A, V, I, L, D, E, R, H, K, F, Y, W, or absent (e.g., V, I, E, R, F, or absent); and
    • X30 is G, D, E, N, Q, S, T, F, Y, W, or absent (e.g., G, D, E, N, T, Y, or absent).

In other embodiments, each X in SEQ ID NO:216 can be an amino acid in any one of SEQ ID NOs: 190-212 when any one of the sequences in SEQ ID NOs: 190-212 is used as a reference sequence to be optimally aligned with SEQ ID NO:216.

In yet other embodiments, the first FR includes or is a polypeptide sequence having at least 90% sequence identity to SEQ ID NO:217:

    • QVQLVESGGGLVQX14GGSLRLSCAASG,
    • wherein:
    • X14 is A, V, I, L, F, Y, or P (e.g., A or P).

FIG. 9B provides non-limiting FR2 sequences. In some embodiments, the second FR includes or is a polypeptide sequence having at least 90% sequence identity to SEQ ID NOs:220-243. In other embodiments, the second FR includes or is a polypeptide sequence having at least 90% sequence identity to SEQ ID NO:244:

    • X31X32WX34X35X36X37X38X39X40X41X42X43X44X45X46X47X48X49,
    • wherein:
    • X31 is A, V, I, L, M, S, T, F, Y, W, or absent (e.g., I, V, M, W, or absent);
    • X32 is G, A, V, I, L, N, Q, R, H, K, or absent (e.g., G, A, N, H, or absent);
    • X34 is A, V, I, L, P, F, Y or W (e.g., I, V, F, or Y);
    • X35 is R, H, or K (e.g., R or K);
    • X36 is R, H, K, N, or Q (e.g., R or Q);
    • X37 is A, V, I, L, R, H, K, P, F, Y, or W (e.g., A, V, R, or P);
    • X38 is R, H, K, S, T, P, F, Y, or W (e.g., H, S, T, or P);
    • X39 is G, D, or E (e.g., G or E);
    • X40 is G, R, H, K, N, or Q (e.g., G, R, K, N, or Q);
    • X41 is G, A, V, I, L, D, E, R, H, K, N, or Q (e.g., G, A, E, R, or Q);
    • X42 is A, V, I, L, R, H, K, P, F, Y, or W (e.g., L, R, P, or F);
    • X43 is D, E, S or T (e.g., D or E);
    • X4 is G, A, V, I, L, P, F, Y, or W (e.g., G, A, L, F, or W);
    • X45 is A, V, I, L, M, S, or T (e.g., V, I, L, or M);
    • X46 is G, A, V, I, L, S, or T (e.g., G, A, V, or S);
    • X47 is A, V, I, L, R, H, K, M, S, T, or absent (e.g., A, V, I, R, S, T, or absent);
    • X48 is A, V, I, L, M, S, T, or absent (e.g., V, I, L, M, or absent); and
    • X49 is A, V, I, L, D, E, R, H, K, M, S, T, or absent (e.g., A, D, R, S, or absent).

In yet other embodiments, each X in SEQ ID NO:244 can be an amino acid in any one of SEQ ID NOs:220-243 when any one of the sequences in SEQ ID NOs:220-243 is used as a reference sequence to be optimally aligned with SEQ ID NO:244.

In some embodiments, the second FR includes or is a polypeptide sequence having at least 90% sequence identity to SEQ ID NO:245:

    • X31X32WX34RQAX38GX40X41X42EX4X45X46X47X48X49,
    • wherein:
    • X31 is A, V, I, L, M, S, T, F, Y, W, or absent (e.g., I, V, M, W, or absent);
    • X32 is G, A, V, I, L, N, Q, R, H, K, or absent (e.g., G, A, N, H, or absent);
    • X34 is A, V, I, L, P, F, Y or W (e.g., I, V, F, or Y);
    • X38 is R, H, K, S, T, P, F, Y, or W (e.g., H, S, T, or P);
    • X40 is G, R, H, K, N, or Q (e.g., G, R, K, N, or Q);
    • X41 is G, A, V, I, L, D, E, R, H, K, N, or Q (e.g., G, A, E, R, or Q);
    • X42 is A, V, I, L, R, H, K, P, F, Y, or W (e.g., L, R, P, or F);
    • X44 is G, A, V, I, L, P, F, Y, or W (e.g., G, A, L, F, or W);
    • X45 is A, V, I, L, M, S, or T (e.g., V, I, L, or M);
    • X46 is G, A, V, I, L, S, or T (e.g., G, A, V, or S);
    • X47 is A, V, I, L, R, H, K, M, S, T, or absent (e.g., A, V, I, R, S, T, or absent);
    • X48 is A, V, I, L, M, S, T, or absent (e.g., V, I, L, M, or absent); and
    • X49 is A, V, I, L, D, E, R, H, K, M, S, T, or absent (e.g., A, D, R, S, or absent).

In other embodiments, each X in SEQ ID NO:245 can be an amino acid in any one of SEQ ID NOs:220-243 when any one of the sequences in SEQ ID NOs:220-243 is used as a reference sequence to be optimally aligned with SEQ ID NO:245.

In some embodiments, the second FR includes or is a polypeptide sequence having at least 90% sequence identity to SEQ ID NO:246:

    • X31X32WX34RQAX38GX40X41X42EX44X45X46,
    • wherein:
    • X31 is A, V, I, L, M, S, T, F, Y, W, or absent (e.g., I, V, M, W, or absent);
    • X32 is G, A, V, I, L, N, Q, R, H, K, or absent (e.g., G, A, N, H, or absent);
    • X34 is A, V, I, L, P, F, Y or W (e.g., I, V, F, or Y);
    • X38 is R, H, K, S, T, P, F, Y, or W (e.g., H, S, T, or P);
    • X40 is G, R, H, K, N, or Q (e.g., G, R, K, N, or Q);
    • X41 is G, A, V, I, L, D, E, R, H, K, N, or Q (e.g., G, A, E, R, or Q);
    • X42 is A, V, I, L, R, H, K, P, F, Y, or W (e.g., L, R, P, or F);
    • X43 is G, A, V, I, L, P, F, Y, or W (e.g., G, A, L, F, or W);
    • X45 is A, V, I, L, M, S, or T (e.g., V, I, L, or M); and
    • X46 is G, A, V, I, L, S, or T (e.g., G, A, V, or S).

In other embodiments, each X in SEQ ID NO:246 can be an amino acid in any one of SEQ ID NOs:220-243 when any one of the sequences in SEQ ID NOs:220-243 is used as a reference sequence to be optimally aligned with SEQ ID NO:246.

In some embodiments, the second FR includes or is a polypeptide sequence having at least 90% sequence identity to SEQ ID NO:247:

    • MX32WFRQAPGKEREWVAX47X48X49,
    • wherein:
    • X32 is G, A, V, I, L, N, Q, R, H, K, or absent (e.g., G, A, N, H, or absent);
    • X47 is A, V, I, L, R, H, K, M, S, T, or absent (e.g., A, V, I, R, S, T, or absent);
    • X48 is A, V, I, L, M, S, T, or absent (e.g., V, I, L, M, or absent); and
    • X49 is A, V, I, L, D, E, R, H, K, M, S, T, or absent (e.g., A, D, R, S, or absent).

In other embodiments, each X in SEQ ID NO:247 can be an amino acid in any one of SEQ ID NOs:220-243 when any one of the sequences in SEQ ID NOs:220-243 is used as a reference sequence to be optimally aligned with SEQ ID NO:247.

In yet other embodiments, the second FR includes or is a polypeptide sequence having at least 90% sequence identity to SEQ ID NO:248:

    • MX32WFRQAPGKEREWVA,
    • wherein:
    • X32 is G, A, V, I, L, N, Q, R, H, K, or absent (e.g., G, A, N, H, or absent).

FIG. 9C provides non-limiting FR3 sequences. In some embodiments, the third FR includes or is a polypeptide sequence having at least 90% sequence identity to SEQ ID NOs:250-284. In other embodiments, the third FR includes or is a polypeptide sequence having at least 90% sequence identity to SEQ ID NO:285:

    • X50X51X52X53X54X55X56X57X58X59X60X61X62X63DX65X66X67X68X69X70X71X72X73X74X75
    • X76X77X78X79X80DX82X83X84YX86CX88X89,
    • wherein:
    • X50 is A, V, I, L, D, E, R, H, K, N, Q, S, T, F, Y, W, or absent (e.g., L, D, R, N, T, Y, or absent);
    • X51 is R, H, K, S, T, F, Y, W, or absent (e.g., H, S, F, Y, or absent);
    • X52 is G, A, V, I, L, D, E, R, H, K, N, Q, S, T, or absent (e.g., G, A, V, L, D, E, R, N, T, or absent);
    • X53 is G, D, E, N, Q, S, T, P, F, Y, W, or absent (e.g., G, D, E, Q, S, P, or absent);
    • X54 is A, V, I, L, R, H, K, S, T, F, Y, W, or absent (e.g., A, K, S, F, or absent);
    • X55 is A, V, I, L, M, S, T, F, Y, W, or absent (e.g., A, V, L, M, F, or absent);
    • X56 is D, E, R, H, K, N, Q, or absent (e.g., E, R, K, Q, or absent);
    • X57 is G, D, E, S, T, or absent (e.g., G, D, S, or absent);
    • X58 is R, H, or K (e.g., R or K);
    • X59 is A, V, I, L, F, Y, or W (e.g., A, V, L, or F);
    • X60 is A, V, I, L, C, M, S, or T (e.g., A, C, S, or T);
    • X61 is A, V, I, L, C, M, S, T, F, Y, or W (e.g., A, I, L, M, S, or F);
    • X62 is C, M, S, or T (e.g., S or T);
    • X63 is A, V, I, L, R, H, K, N, or Q (e.g., A, V, R, K, or Q);
    • X65 is A, V, I, L, D, E, R, H, K, N, Q, S, or T (e.g., I, D, R, K, N, S, or T);
    • X66 is G, A, V, I, L, D, E, R, H, K, N, Q, S, or T (e.g., G, A, D, R, K, N, or S);
    • X67 is A, V, I, L, R, H, K, S, or T (e.g., A, R, K, S, or T);
    • X68 is R, H, K, N, Q, S, or T (e.g., K, N, S, or T);
    • X69 is A, V, I, L, C, M, N, Q, S, or T (e.g., A, L, M, Q, S, or T);
    • X70 is A, V, I, L, C, M, F, Y, or W (e.g., A, V, L, M, or F);
    • X71 is S, T, F, Y, or W (e.g., S, T, F, or Y);
    • X72 is A, V, I, L, C, or M (e.g., L or M);
    • X73 is D, E, R, H, K, N, Q, S, T, F, Y, or W (e.g., E, R, K, Q, S, or F);
    • X74 is A, V, I, L, C, or M (e.g., L or M);
    • X75 is D, E, N, Q, S, or T (e.g., D, N, or S);
    • X76 is R, H, K, N, Q, S, or T (e.g., R, N, or S);
    • X77 is A, V, I, or L (e.g., V or L);
    • X78 is R, H, K, N, Q, S, or T (e.g., R, K, Q, or T);
    • X79 is A, V, I, L, R, H, K, S, T, P, F, Y, or W (e.g., A, V, L, R, S, T, P, or Y);
    • X80 is A, V, I, L, D, or E (e.g., A, D, or E);
    • X82 is C, S, or T (e.g., S or T);
    • X83 is G, A, V, I, or L (e.g., G or A);
    • X84 is A, V, I, L, C, M, D, E, S or T (e.g., V, I, M, D, E, or T);
    • X86 is S, T, F, Y, or W (e.g., T, F, or Y);
    • X88 is A, V, I, L, N, Q, S, T, F, Y, W, or absent (e.g., A, V, N, Q, T, Y, or absent); and
    • X89 is G, A, V, I, L, R, H, K, F, Y, W, or absent (e.g., G, A, V, R, K, Y, or absent).

In other embodiments, each X in SEQ ID NO:285 can be an amino acid in any one of SEQ ID NOs:250-284 when any one of the sequences in SEQ ID NOs:250-284 is used as a reference sequence to be optimally aligned with SEQ ID NO:285.

In some embodiments, the third FR includes or is a polypeptide sequence having at least 90% sequence identity to SEQ ID NO:286:

    • X50X51X52X53X54X55X56X57RX59X60IX62RDX65X66X67X68X69VX71LX73X74X75X76X77X78
    • X79EDTAX84YYX87X88X89,
    • wherein:
    • X50 is A, V, I, L, D, E, R, H, K, N, Q, S, T, F, Y, W, or absent (e.g., L, D, R, N, T, Y, or absent);
    • X51 is R, H, K, S, T, F, Y, W, or absent (e.g., H, S, F, Y, or absent);
    • X52 is G, A, V, I, L, D, E, R, H, K, N, Q, S, T, or absent (e.g., G, A, V, L, D, E, R, N, T, or absent);
    • X53 is G, D, E, N, Q, S, T, P, F, Y, W, or absent (e.g., G, D, E, Q, S, P, or absent);
    • X54 is A, V, I, L, R, H, K, S, T, F, Y, W, or absent (e.g., A, K, S, F, or absent);
    • X55 is A, V, I, L, M, S, T, F, Y, W, or absent (e.g., A, V, L, M, F, or absent);
    • X56 is D, E, R, H, K, N, Q, or absent (e.g., E, R, K, Q, or absent);
    • X57 is G, D, E, S, T, or absent (e.g., G, D, S, or absent);
    • X59 is A, V, I, L, F, Y, or W (e.g., A, V, L, or F);
    • X60 is A, V, I, L, C, M, S, or T (e.g., A, C, S, or T);
    • X62 is C, M, S, or T (e.g., S or T);
    • X65 is A, V, I, L, D, E, R, H, K, N, Q, S, or T (e.g., I, D, R, K, N, S, or T);
    • X66 is G, A, V, I, L, D, E, R, H, K, N, Q, S, or T (e.g., G, A, D, R, K, N, or S);
    • X67 is A, V, I, L, R, H, K, S, or T (e.g., A, R, K, S, or T);
    • X68 is R, H, K, N, Q, S, or T (e.g., K, N, S, or T);
    • X69 is A, V, I, L, C, M, N, Q, S, or T (e.g., A, L, M, Q, S, or T);
    • X71 is S, T, F, Y, or W (e.g., S, T, F, or Y);
    • X73 is D, E, R, H, K, N, Q, S, T, F, Y, or W (e.g., E, R, K, Q, S, or F);
    • X74 is A, V, I, L, C, or M (e.g., L or M);
    • X75 is D, E, N, Q, S, or T (e.g., D, N, or S);
    • X76 is R, H, K, N, Q, S, or T (e.g., R, N, or S);
    • X77 is A, V, I, or L (e.g., V or L);
    • X78 is R, H, K, N, Q, S, or T (e.g., R, K, Q, or T);
    • X79 is A, V, I, L, R, H, K, S, T, P, F, Y, or W (e.g., A, V, L, R, S, T, P, or Y);
    • X84 is A, V, I, L, C, M, D, E, S or T (e.g., V, I, M, D, E, or T);
    • X87 is F, Y, or W (e.g., Y);
    • X88 is A, V, I, L, N, Q, S, T, F, Y, W, or absent (e.g., A, V, N, Q, T, Y, or absent); and
    • X89 is G, A, V, I, L, R, H, K, F, Y, W, or absent (e.g., G, A, V, R, K, Y, or absent).

In other embodiments, each X in SEQ ID NO:286 can be an amino acid in any one of SEQ ID NOs:250-284 when any one of the sequences in SEQ ID NOs:250-284 is used as a reference sequence to be optimally aligned with SEQ ID NO:286.

In some embodiments, the third FR includes or is a polypeptide sequence having at least 90% sequence identity to SEQ ID NO:287:

    • X50X51X52X53X54X55X56X57RX59X60IX62RDX65X66X67X68X69VX71LX73X74X75X76X77X78
    • X79EDTAX84YYX87X88,
    • wherein:
    • X50 is A, V, I, L, D, E, R, H, K, N, Q, S, T, F, Y, W, or absent (e.g., L, D, R, N, T, Y, or absent);
    • X51 is R, H, K, S, T, F, Y, W, or absent (e.g., H, S, F, Y, or absent);
    • X52 is G, A, V, I, L, D, E, R, H, K, N, Q, S, T, or absent (e.g., G, A, V, L, D, E, R, N, T, or absent);
    • X53 is G, D, E, N, Q, S, T, P, F, Y, W, or absent (e.g., G, D, E, Q, S, P, or absent);
    • X54 is A, V, I, L, R, H, K, S, T, F, Y, W, or absent (e.g., A, K, S, F, or absent);
    • X55 is A, V, I, L, M, S, T, F, Y, W, or absent (e.g., A, V, L, M, F, or absent);
    • X56 is D, E, R, H, K, N, Q, or absent (e.g., E, R, K, Q, or absent);
    • X57 is G, D, E, S, T, or absent (e.g., G, D, S, or absent);
    • X59 is A, V, I, L, F, Y, or W (e.g., A, V, L, or F);
    • X60 is A, V, I, L, C, M, S, or T (e.g., A, C, S, or T);
    • X62 is C, M, S, or T (e.g., S or T);
    • X65 is A, V, I, L, D, E, R, H, K, N, Q, S, or T (e.g., I, D, R, K, N, S, or T);
    • X66 is G, A, V, I, L, D, E, R, H, K, N, Q, S, or T (e.g., G, A, D, R, K, N, or S);
    • X67 is A, V, I, L, R, H, K, S, or T (e.g., A, R, K, S, or T);
    • X68 is R, H, K, N, Q, S, or T (e.g., K, N, S, or T);
    • X69 is A, V, I, L, C, M, N, Q, S, or T (e.g., A, L, M, Q, S, or T);
    • X71 is S, T, F, Y, or W (e.g., S, T, F, or Y);
    • X73 is D, E, R, H, K, N, Q, S, T, F, Y, or W (e.g., E, R, K, Q, S, or F);
    • X74 is A, V, I, L, C, or M (e.g., L or M);
    • X75 is D, E, N, Q, S, or T (e.g., D, N, or S);
    • X76 is R, H, K, N, Q, S, or T (e.g., R, N, or S);
    • X77 is A, V, I, or L (e.g., V or L);
    • X78 is R, H, K, N, Q, S, or T (e.g., R, K, Q, or T);
    • X79 is A, V, I, L, R, H, K, S, T, P, F, Y, or W (e.g., A, V, L, R, S, T, P, or Y);
    • X84 is A, V, I, L, C, M, D, E, S or T (e.g., V, I, M, D, E, or T);
    • X87 is F, Y, or W (e.g., Y); and
    • X88 is A, V, I, L, N, Q, S, T, F, Y, W, or absent (e.g., A, V, N, Q, T, Y, or absent).

In other embodiments, each X in SEQ ID NO:287 can be an amino acid in any one of SEQ ID NOs:250-284 when any one of the sequences in SEQ ID NOs:250-284 is used as a reference sequence to be optimally aligned with SEQ ID NO:287.

In some embodiments, the third FR includes or is a polypeptide sequence having at least 90% sequence identity to SEQ ID NO:288:

    • X50YADSVKGRFTISRDNAKNTVYLQMNSLKPEDTAVYYCAX89,
    • wherein:
    • X50 is A, V, I, L, D, E, R, H, K, N, Q, S, T, F, Y, W, or absent (e.g., L, D, R, N, T, Y, or absent); and
    • X89 is G, A, V, I, L, R, H, K, F, Y, W, or absent (e.g., G, A, V, R, K, Y, or absent).

In other embodiments, the third FR includes or is a polypeptide sequence having at least 90% sequence identity to SEQ ID NO:289:

    • X50YADSVKGRFTISRDNAKNTVYLQMNSLKPEDTAVYYCA,
    • wherein:
    • X50 is A, V, I, L, D, E, R, H, K, N, Q, S, T, F, Y, W, or absent (e.g., L, D, R, N, T, Y, or absent).

FIG. 9D provides non-limiting FR4 sequences. In some embodiments, the fourth FR includes or is a polypeptide sequence having at least 90% sequence identity to SEQ ID NOs:290-301. In other embodiments, the fourth FR includes or is a polypeptide sequence having at least 90% sequence identity to SEQ ID NO:302:

    • X90WGX93GX95X96X97TVSX101,
    • wherein:
    • X90 is A, V, I, L, R, H, K, N, Q, S, T, F, Y, W, or absent (e.g., V, H, Q, S, F, Y, or absent);
    • X93 is R, H, K, N, Q, P, F, Y, or W (e.g., R, K, Q, or P);
    • X95 is A, V, I, L, S, or T (e.g., L or T);
    • X96 is A, V, I, L, C, M, N, Q, S, or T (e.g., L, M, Q, S, or T);
    • X97 is A, V, I, or L (e.g., V or L); and
    • X101 is S, T, or absent (e.g., S or absent).

In other embodiments, each X in SEQ ID NO:302 can be an amino acid in any one of SEQ ID NOs:290-301 when any one of the sequences in SEQ ID NOs:290-301 is used as a reference sequence to be optimally aligned with SEQ ID NO:302.

In some embodiments, the fourth FR includes or is a polypeptide sequence having at least 90% sequence identity to SEQ ID NO:303:

    • X90WGX93GX95X96X97TVS,
    • wherein:
    • X90 is A, V, I, L, R, H, K, N, Q, S, T, F, Y, W, or absent (e.g., V, H, Q, S, F, Y, or absent);
    • X93 is R, H, K, N, Q, P, F, Y, or W (e.g., R, K, Q, or P);
    • X95 is A, V, I, L, S, or T (e.g., L or T);
    • X96 is A, V, I, L, C, M, N, Q, S, or T (e.g., L, M, Q, S, or T); and
    • X97 is A, V, I, or L (e.g., V or L).

In other embodiments, each X in SEQ ID NO:303 can be an amino acid in any one of SEQ ID NOs:290-301 when any one of the sequences in SEQ ID NOs:290-301 is used as a reference sequence to be optimally aligned with SEQ ID NO:303.

In some embodiments, the fourth FR includes or is a polypeptide sequence having at least 90% sequence identity to SEQ ID NO:304:

    • WGX93GX95X96X97TVSX101,
    • wherein:
    • X93 is R, H, K, N, Q, P, F, Y, or W (e.g., R, K, Q, or P);
    • X95 is A, V, I, L, S, or T (e.g., L or T);
    • X96 is A, V, I, L, C, M, N, Q, S, or T (e.g., L, M, Q, S, or T);
    • X97 is A, V, I, or L (e.g., V or L); and
    • X101 is S, T, or absent (e.g., S or absent).

In other embodiments, each X in SEQ ID NO:304 can be an amino acid in any one of SEQ ID NOs:290-301 when any one of the sequences in SEQ ID NOs:290-301 is used as a reference sequence to be optimally aligned with SEQ ID NO:304.

In some embodiments, the fourth FR includes or is a polypeptide sequence having at least 90% sequence identity to SEQ ID NO:305:

    • X90X91GX93GTX96X97X98VSX101,
    • wherein:
    • X90 is A, V, I, L, R, H, K, N, Q, S, T, F, Y, W, or absent (e.g., V, H, Q, S, F, Y, or absent);
    • X91 is P, F, Y, or W (e.g., W);
    • X93 is R, H, K, N, Q, P, F, Y, or W (e.g., R, K, Q, or P);
    • X96 is A, V, I, L, C, M, N, Q, S, or T (e.g., L, M, Q, S, or T);
    • X97 is A, V, I, or L (e.g., V or L);
    • X98 is S or T; and
    • X101 is S, T, or absent (e.g., S or absent).

In other embodiments, each X in SEQ ID NO:305 can be an amino acid in any one of SEQ ID NOs:290-301 when any one of the sequences in SEQ ID NOs:290-301 is used as a reference sequence to be optimally aligned with SEQ ID NO:305.

In some embodiments, the fourth FR includes or is a polypeptide sequence having at least 90% sequence identity to SEQ ID NO:306:

    • X90WGQGTQVTVSS,
    • wherein:
    • X90 is A, V, I, L, R, H, K, N, Q, S, T, F, Y, W, or absent (e.g., V, H, Q, S, F, Y, or absent).

In other embodiments, the fourth FR includes or is a polypeptide sequence having at least 90% sequence identity to SEQ ID NO:307:

    • X90WGQGTQVTVS,
    • wherein:
    • X90 is A, V, I, L, R, H, K, N, Q, S, T, F, Y, W, or absent (e.g., V, H, Q, S, F, Y, or absent).
      Targets

A target can be an antigen that can be bound by any construct described herein. Non-limiting targets include a coronavirus or a portion thereof. Non-limiting portions of a coronavirus includes a spike protein (e.g., a S-glycoprotein) or a receptor-binding domain (RBD). Non-limiting sequences for such spike proteins and RBDs include one or more of the following: UniProtKB No. P0DTC2 (amino acids 13-1273 for the spike glycoprotein, amino acids 13-685 for the spike protein 1, amino acids 319-541 for the RBD, or amino acids 437-508 for a receptor-binding motif that binds to human ACE2); UniProtKB No. A0A6B9WHD3 (amino acids 31-1228 for the spike glycoprotein, amino acids 31-592 for the spike protein 1, or amino acids 349-526 for the RBD); UniProtKB No. P59594 (amino acids 14-1255 for the spike glycoprotein, amino acids 14-667 for the spike protein S1, amino acids 306-527 for the RBD, or amino acids 424-494 for a receptor-binding motif that binds to human ACE2); UniProtKB No. Q5GDB5 (amino acids 14-667 for spike protein S1, amino acids 306-527 for the RBD, or amino acids 335-512 for the RBD); UniProtKB No. Q3LZX1 (amino acids 14-1242 for the spike glycoprotein, amino acids 14-654 for the spike protein S1, or amino acids 310-514 for the RBD); UniProtKB No. Q315J5 (amino acids 14-1241 for the spike glycoprotein, amino acids 14-653 for the spike protein S1, or amino acids 310-513 for the RBD); and UniProtKB No. QOQ475 (amino acids 14-1241 for the spike glycoprotein, amino acids 14-653 for the spike protein S1, or amino acids 310-513 for the RBD).

Targets can also include a polypeptide sequence having at least 90% sequence identity to any one of SEQ ID NOs:320-327 (FIGS. 12A-12D) or a fragment thereof. In other embodiments, each X in SEQ ID NO:327 can be an amino acid in any one of SEQ ID NOs:320-326 when any one of the sequences in SEQ ID NOs:320-326 is used as a reference sequence to be optimally aligned with SEQ ID NO:327.

In yet other embodiments, the target can include the following one or more mutations: LSF, V341I, K417N, K417T, A435S, N439K, L452R, K458R, 1472V, E484K, N501Y, D614G, H655Y, R682Q, D936Y, S939F, and/or S943T, using the numbering provided for SEQ ID NO:320 or for another sequence that is optimally aligned with SEQ ID NO:320.

Targets can also include a polypeptide sequence having at least 90% sequence identity to any one of SEQ ID NOs: 328-336 (FIG. 12E) or a fragment thereof. In other embodiments, each X in SEQ ID NO:335 can be an amino acid in any one of SEQ ID NOs:328-334 when any one of the sequences in SEQ ID NOs:328-334 is used as a reference sequence to be optimally aligned with SEQ ID NO:335. In yet other embodiments, each X in SEQ ID NO:336 can be an amino acid in any one of SEQ ID NOs:328-334 when any one of the sequences in SEQ ID NOs:328-334 is used as a reference sequence to be optimally aligned with SEQ ID NO:336.

In some embodiments, the target is or includes a polypeptide sequence having at least 90% sequence identity to SEQ ID NO:335:

RVX321PX323X324X325X326X327RFPNITNX335CPFX339X340X341FNAX345X346FX348

    • X349VYAWX354RX356X357ISX360CVADYX366VLYNSX372X373FSTFKCYGVSX384
    • X385KLX388DLCFX393X394VYADX399FX401X402X403X404X405X406VRQX410APGX414TGX417IADYNYKLPDDFX430GCVX434X435WNX438X439X440X441DX443X444X445X446G
    • X448X449X450YX452YRX455X456RX458X459X460LX462PFERDX468SX470X471X472X473
    • X474X475X476X477X478X479X480X481X482X483X484X485X486NX488X489X490X491LX493X494YX496FX498X499X500X501X502X503X504X505QX507X508RVVVLSFELLX519APATVCGPKX529S
    • TX532LX534KNX537CVNF
    • wherein:
    • X321 is A, V, I, L, N, Q, S, or T (e.g., V, Q, S, or T);
    • X323, X345, X366, X385, X393, X399, X404, and X438 is, independently, G, S, or T (e.g., S or T);
    • X324, X339, X354, X360, X414, and X532 is, independently, G, D, E, N or Q (e.g., G, D, E, or Q; E or N; D or N; or E or Q);
    • X325 and X405 is, independently, D, E, S, or T (e.g., D, E, or S);
    • X326, X327, X341, X401, X402, X410, X434, X468, X503, and X534 is, independently, A, V, I, or L (e.g., V or I; or V or L);
    • X335 and X529 is, independently, A, V, I, L, R, H, or K (e.g., L or R; or V or K);
    • X340 is D, E, R, H, or K (e.g., E or K);
    • X346, X356, and X403 is, independently, R, H, K, S, or T (e.g., R, K, or T);
    • X348, X384, X489, X502, and X507 is, independently, G, A, V, I, L, P, F, Y, or W (e.g., A or P; V or W; G or P; G or W);
    • X349, X394, X470, and X500 is, independently, N, Q, S, or T (e.g., N or S);
    • X357, X458, and X462 is, independently, R, H, or K (e.g., R or K);
    • X372 and X435 is, independently, A, V, I, L, S, or T (e.g., A or T; or A or S);
    • X373, X491, and X499 is, independently, S, T, P, F, Y, or W (e.g., S or F; or T or P);
    • X388 is A, V, I, L, N, or Q (e.g., I or N);
    • X406, X496, and X504 is, independently, G, A, V, I, L, D, or E (e.g., D or E; or G, A, or E);
    • X417, X439, X441, and X443 is, independently, A, V, I, L, R, H, K, N, Q, S, or T (e.g., V, K, N, or T; A, R, K, or N; A, Q, S, or T; or L, I, H, or Q);
    • X430 is L, C, M, S, or T (e.g., M or T);
    • X440, X450, X460, X519, and X537 is, independently, R, H, K, N or Q (e.g., N, K, or Q);
    • X444, X446, and X478 is, independently, G, R, H, K, S, T, or absent (e.g., K, T, or absent; or G, T, or absent; or K, T, or absent);
    • X445, X459, X471, X476, X477, and X485 is, independently, G, A, V, I, L, D, E, S, T, or absent (e.g., V, E, S, or absent; G, A, E, S, or T; V, D, or E; G, D, E, or absent; G, S, or absent; E, T, or absent; or G, A, or absent);
    • X448 is N, Q, or absent (e.g., N or absent);
    • X449, X473, X479, and X482 is, independently, G, P, F, Y, W, or absent (e.g., F, Y, or absent; P or absent; or G, P, or absent);
    • X452, X456, X490, and X505 is, independently, A, V, I, L, R, H, K, F, Y, or W (e.g., L, R, K or Y; or L, H, F, or Y; or R, F, Y, or W; or H or Y);
    • X455 and X508 is, independently, A, V, I, L, S, T, F, Y, or W (e.g., L, S, or Y; or T or Y);
    • X472, X475, and X483 is, independently, A, V, I, L, D, E, N, Q, P, or absent (e.g., V, I, D, P, or absent; A, P, or absent; or V, Q, P, or absent);
    • X474 and X481 is, independently, N, Q, S, T, or absent (e.g., Q, S, or absent; N, T, or absent);
    • X480 and X488 is, independently, G, C, M, or absent (e.g., C or absent);
    • X486 is G, A, V, I, L, D, E, P, F, Y, or W (e.g., G, L, E, P, or F);
    • X493 and X498 is, independently, N, Q, S, T, F, Y, or W (e.g., N, Q, S, or Y; or N, Q, or Y);
    • X484 and X494 is, independently, G, D, E, R, H, K, S, T, or absent (e.g., G, D, R, S, or T; or E, K, T, or absent); and
    • X501 is any amino acid, such as A, V, I, L, D, E, N, Q, S, T, F, Y, or W (e.g., V, I, D, N, S, T, or Y).

In yet other embodiments, the target can include the following one or more mutations: V341I, K417N, K417T, A435S, N439K, L452R, K458R, 1472V, E484K, and/or N501Y using the numbering provided for SEQ ID NOs:335-336 or for another sequence that is optimally aligned with one of SEQ ID NOs:335-336.

Therapeutic or Diagnostic Agents

The present disclosure also encompasses a construct that can be directly or indirectly attached to one or more therapeutic or diagnostic agents. Such agents can include a therapeutic antibody, a complementarity determining region (CDR), a small molecule, a chemotherapeutic agent, an antiviral agent, an antibacterial agent, an anti-inflammatory agent, a scavenging agent, an imaging agent, a marker, a dye, a detectable moiety, or a label.

Any of the constructs herein (e.g., isolated or purified antibodies or fragments thereof) can be employed to bind to a target. Binding can be accomplished, e.g., by using CDRs specific for that target. In one embodiment, the therapeutic or diagnostic agent includes one or more CDRs for viral targets. Exemplary targets include a virus, such as Coronaviridae (e.g., severe acute respiratory syndrome-related coronavirus (SARS-COV), severe acute respiratory syndrome coronavirus 2 (SARS-COV-2), or variants thereof); or a portion of a virus, such as a spike protein or a receptor-binding domain (RBD) of a coronavirus.

Other non-limiting therapeutic or diagnostic agents include a nucleic acid (e.g., oligonucleotides, polynucleotides, nucleotides, nucleosides, molecules of DNA, or molecules of RNA, including a chromosome, a plasmid, a viral genome, a primer, or a gene); a protein (e.g., a glycoprotein, a metalloprotein, an enzyme, a prion, or an immunoglobulin); a metabolite; a sugar; a lipid; or a lipopolysaccharide.

Non-limiting detectable moieties may be a radioisotope (e.g., 32P), a fluorescent or chemiluminescent compound such as rhodamine or luciferin, or an enzyme, such as alkaline phosphatase or horseradish peroxidase. Non-limiting labels include a radiolabel, an isotope, a visible or near-infrared fluorescent label, a reporter molecule, biotin, or the like.

The therapeutic or diagnostic agent can be a peptide, an enzyme (e.g., horseradish peroxidase, alkaline phosphatase, glucose-6-phosphatase or beta-galactosidase), a nucleic acid, a virus, a fluorophore (e.g., green fluorescent protein (GFP), blue fluorescent dyes excited at wavelengths in the ultraviolet (UV) part of the spectrum (e.g., AMCA (7-amino-4-methylcoumarin-3-acetic acid); Alexa Fluor 350), green fluorescent dyes excited by blue light (e.g., FITC, Cy2, Alexa Fluor 488), red fluorescent dyes excited by green light (e.g., rhodamines, Texas Red, Cy3, Alexa Fluor dyes 546, 564 and 594), or dyes excited with far-red light (e.g., Cy5) to be visualized with electronic detectors (CCD cameras, photomultipliers)), a heavy metal (including chelates thereof, such as those including europium, lanthanum or yttrium), a chemical entity, or a radioisotope (e.g., [18F]fluorodeoxy glucose, 11C-, 125I-, 131I-, 3H-, 14C-, 35S-, or 99Tc-labelled compounds).

The therapeutic or diagnostic agent can include a drug, an antigen binding fragment of an antibody molecule or portion thereof (e.g., F(ab), scFv, a VH domain, or a VL domain) (e.g., to impart, induce or block a biological response), a ligand binding portion of a receptor or a receptor binding portion of a ligand, an enzyme, therapeutically useful amino acids, peptides, proteins, nucleic acids, including but not limited to polynucleotides, oligonucleotides, carbohydrates and lipids. Yet other exemplary agents include cytokines, neurotrophic factors, growth factors, enzymes, antibodies, neurotransmitters, neuromodulators, antibiotics, antiviral agents, antifungal agents, imaging or detectable agents, isotopes, and chemotherapeutic agents, and the like. The therapeutic or diagnostic agents can also include drugs, prodrugs, and precursors that can be activated when the therapeutic agent is delivered to the target tissue.

Methods

The present disclosure also encompasses methods that employ any construct described herein. In particular embodiments, the methods include method of treatment or prophylaxis of one or more diseases or conditions. Non-limiting diseases and conditions include a viral infection.

Methods can also include use of the construct as a therapeutic or diagnostic agent, which can be administered to a subject (a mammal or a human) by injection, preferably by intravenous, intraperitoneal, intramuscular or subcutaneous injection. The constructs herein (e.g., with a therapeutic or diagnostic agent) can be used in imaging or in diagnosing viral spread.

Methods can also include providing a construct or a pharmaceutical composition thereof (e.g., as described herein) for use in the treatment of viral infections or any disorder or condition herein. A pharmaceutical composition can include any construct, described herein either with a therapeutic or diagnostic agent, and a pharmaceutically acceptable carrier.

As used herein, “pharmaceutically acceptable carrier” is intended to include any and all solvents, adjuvants, dispersion media, coatings, antibacterial and antifungal agents, isotonic and absorption delaying agents, and the like, compatible with pharmaceutical administration. Suitable carriers are described in the most recent edition of Remington's Pharmaceutical Sciences, a standard reference text in the field. Preferred examples of such carriers or diluents include, but are not limited to, water, saline, Ringer's solutions, dextrose solution, and 5% human serum albumin. Liposomes, cationic lipids and non-aqueous vehicles such as fixed oils may also be used. The use of such media and agents for pharmaceutically active substances is well known in the art. Except insofar as any conventional media or agent is incompatible with a therapeutic agent as defined hereabove, use thereof in the composition of the present invention is contemplated.

EXAMPLES

Example 1: Highly Effective SARS-COV-2 Neutralizing Humanized Nanobodies

A high-diversity synthetic nanobody phage library was used to identify 34 humanized nanobodies that show nanomolar to low picomolar efficacy in preventing cell infection by replicating VSV-SARSCOV-2 virus. In particular, we developed a high diversity humanized nanobody library (more than 3×1010 nanobody variants), which was designed to have three different CDR3 lengths and incorporated the natural prevalence of amino acids at specific CDR positions for CDR1 and CDR2 derived from numerous effective nanobodies. For CDR3, all amino acids were used with the exception of cysteine and methionine.

FIG. 1 provides a non-limiting method of constructing a nanobody phage library. In particular, the library was constructed using novel DNA synthesis technology, thereby ensuring high quality and full length nanobodies with low incidence of stop codons. These attributes allowed for the identification of highly potent binders to desired targets with femtomolar to nanomolar dissociation constants. This library was cloned into the pADL20c M13 phagemid vector, which allows for expression of nanobodies as a fusion protein to coat protein gIIIp of M13 phage. This library was screening against full length soluble SARS-COV-2 stabilized spike protein for three rounds, followed by a single round against the SARS-COV-2 receptor-binding domain (RBD).

From this biopanning campaign, we identified numerous potential candidate nanobodies. Reconformation screening using nanobody-human Fc fusion proteins elucidated 34 nanobodies, which specifically prevented infection of green monkey kidney cells (vero) with VSV-SARS-COV-2 virus with enhanced efficacy. These candidates also were able to compete with human ACE2 binding on full length SARS-COV-2 spike protein in an in vitro competition enzyme-linked immunosorbent assay (ELISA). Results for the competition assays and neutralization assays are seen in FIGS. 10A-10C and FIGS. 11A-11C. Subsequent testing to validate efficacy can include testing against BSL-3 SARS-COV-2 infection of vero cells and in transgenic mouse models.

OTHER EMBODIMENTS

All publications, patents, and patent applications mentioned in this specification are incorporated herein by reference to the same extent as if each independent publication or patent application was specifically and individually indicated to be incorporated by reference.

While the invention has been described in connection with specific embodiments thereof, it will be understood that it is capable of further modifications and this application is intended to cover any variations, uses, or adaptations of the invention following, in general, the principles of the invention and including such departures from the present disclosure that come within known or customary practice within the art to which the invention pertains and may be applied to the essential features hereinbefore set forth, and follows in the scope of the claims.

Other embodiments are within the claims.

Claims

The invention claimed is:

1. An isolated or purified single-domain antibody comprising a variable domain, wherein the variable domain comprises:

(i) a first complementarity determining region comprising a polypeptide sequence of SEQ ID NO:40, a second complementarity determining region comprising a polypeptide sequence of SEQ ID NO:74, and a third complementarity determining region comprising a polypeptide sequence of SEQ ID NO:108; or

(ii) a first complementarity determining region comprising a polypeptide sequence of SEQ ID NO:41, a second complementarity determining region comprising a polypeptide sequence of SEQ ID NO:75, and a third complementarity determining region comprising a polypeptide sequence of SEQ ID NO:109; or

(iii) a first complementarity determining region comprising a polypeptide sequence of SEQ ID NO:42, a second complementarity determining region comprising a polypeptide sequence of SEQ ID NO:76, and a third complementarity determining region comprising a polypeptide sequence of SEQ ID NO:110; or

(iv) a first complementarity determining region comprising a polypeptide sequence of SEQ ID NO:43, a second complementarity determining region comprising a polypeptide sequence of SEQ ID NO:77, and a third complementarity determining region comprising a polypeptide sequence of SEQ ID NO:111,

wherein the variable domain binds to a spike protein of a coronavirus or a receptor-binding domain of a coronavirus, and wherein the coronavirus is severe acute respiratory syndrome coronavirus 2.

2. The single-domain antibody of claim 1, wherein the variable domain further comprises:

a first framework region attached to an N-terminus of the first complementarity determining region;

a second framework region disposed between the first and second complementarity determining regions;

a third framework region disposed between the second and third complementarity determining regions; and

a fourth framework region attached to a C-terminus of the third complementarity determining region.

3. The single-domain antibody of claim 2, wherein the variable domain comprises a polypeptide sequence of any one of SEQ ID NOS:1-4.

4. The single-domain antibody of claim 2, wherein the first framework region comprises a polypeptide sequence of SEQ ID NO:191, wherein the second framework region comprises a polypeptide sequence of SEQ ID NO:221, wherein the third framework region comprises a polypeptide sequence of SEQ ID NO:252, and wherein the fourth framework region comprises a polypeptide sequence of SEQ ID NO:290.

5. The single-domain antibody of claim 2, wherein the first framework region comprises a polypeptide sequence of SEQ ID NO:190, wherein the second framework region comprises a polypeptide sequence of SEQ ID NO:220, wherein the third framework region comprises a polypeptide sequence of SEQ ID NO:251, and wherein the fourth framework region comprises a polypeptide sequence of SEQ ID NO:290.

6. The single-domain antibody of claim 1, wherein the spike protein comprises a polypeptide sequence of any one of SEQ ID NOS:320-326; or wherein the receptor-binding domain comprises a polypeptide sequence of any one of SEQ ID NOS:328-334.

7. The single-domain antibody of claim 1, further comprising a therapeutic agent or a diagnostic agent attached directly or indirectly to the variable domain.

8. A method of treating or prophylactically treating a viral infection, the method comprising:

administering a single-domain antibody of claim 1 to a subject in need thereof,

wherein the viral infection comprises an infection from a coronavirus, and wherein the coronavirus is severe acute respiratory syndrome coronavirus 2.

Resources

Images & Drawings included:

Sources:

Similar patent applications:

Recent applications in this class:

Recent applications for this Assignee: