Patent application title:

Repressor of skeletal muscle differentiation, nucleic acid coding therefor and the use thereof in diagnosis and therapy

Publication number:

US20070031395A1

Publication date:
Application number:

10/507,780

Filed date:

2003-03-13

Abstract:

Polypeptide sequences which play a part in the regulation of skeletal muscle differentiation, and nucleic acids coding therefor, and the use thereof in diagnosis and therapy are disclosed. Possible uses are also indicated for antibodies which are directed against corresponding epitopes of the GRIM1 polypeptide.

Inventors:

Assignee:

Interested in similar patents?

Get notified when new applications in this technology area are published.

Classification:

C07K16/18 »  CPC main

Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans

C07K14/4703 »  CPC further

Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates from mammals not used; Regulators; Modulating activity Inhibitors; Suppressors

C07K14/4716 »  CPC further

Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates from mammals not used Muscle proteins, e.g. myosin, actin

A61K38/00 »  CPC further

Medicinal preparations containing peptides

A61K38/54 IPC

Medicinal preparations containing peptides; Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof; Enzymes; Proenzymes; Derivatives thereof Mixtures of enzymes or proenzymes covered by more than a single one of groups  -  or  - 

C07H21/04 IPC

Compounds containing two or more mononucleotide units having separate phosphate or polyphosphate groups linked by saccharide radicals of nucleoside groups, e.g. nucleic acids with deoxyribosyl as saccharide radical

C12P21/06 IPC

Preparation of peptides or proteins produced by the hydrolysis of a peptide bond, e.g. hydrolysate products

C12N9/99 IPC

Enzymes; Proenzymes; Compositions thereof ; Processes for preparing, activating, inhibiting, separating or purifying enzymes Enzyme inactivation by chemical treatment

C12N15/86 IPC

Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor; Recombinant DNA-technology; Introduction of foreign genetic material using vectors; Vectors; Use of hosts therefor; Regulation of expression; Vectors or expression systems specially adapted for eukaryotic hosts for animal cells Viral vectors

Description

The present invention relates to a novel corepressor whose function has been substantially elucidated. Various possible uses of this corepressor are disclosed.

The designation GRIM1 which has been chosen for the corepressor of the invention represents the abbreviation of the designation “Global Repressor Involved in Myogenic Differentiation”. This name was chosen because the cloned factor plays an important part in particular during skeletal muscle differentiation.

In recent years a large number of molecules which prove to be responsible for direct transcriptional regulation has been found. Besides the DNA-binding factors (in the narrower sense referred to as transcription factors), there are regulatory molecules which, as coactivators, facilitate gene expression or which, as corepressors, actively bring about transcriptional repression. Cofactors are promiscuous and can be recruited in various combinations by various DNA-binding partners. The alternation between associated coactivator and corepressor complexes is an important regulatory step within cellular differentiation processes.

For the example of skeletal muscle differentiation, over the course of years a cascade of transcription factors which are necessary for myogenesis has been found. Besides other transcription factors, the bHLH proteins MyoD, myf5, MRF4 and myogenin bring about execution, in a proliferating myoblast precursor cell, of the genetic program which results in a terminally differentiated functional skeletal muscle cell. During the course of this phylogenesis, the cell passes through a cell cycle arrest, and it fuses with other committed muscle cells to give multinuclear myoblasts and expresses skeletal muscle-specific structural and metabolic enzymes.

The associated cofactors acting within this process have been investigated only in recent years. Positively regulated expression of myogenically specific genes takes place for example through a functional association of MyoD with the coactivator protein p300. Acetylated MyoD has far greater transcriptional activity than unmodified protein.

On the other hand, there are certain corepressors which actively prevent targeted repression of the expression of muscle-specific genes in proliferating cells. Thus, for example, a functional association between MyoD and the corepressor N-CoR has been described, and in this way revealed a new field of activity for the cofactors which had previously been assigned only to nuclear hormone receptors. In addition, members of the histone deacetylase (HDAC) family have been described as being involved in skeletal muscle differentiation (C2C12 cell culture model) and showing a subcellular relocalization during the first steps of differentiation.

Association of HDACs with active repression is regarded as one of the basic requirements for negative transcriptional regulation, because the reaction catalyzed by the HDACs is transmitted directly to the chromatin and provides a mechanistic explanation for the observed effects.

The data shown in this application describe GRIM1 as a novel “bona fide” transcriptional repressor with a novel mechanism of repression. GRIM1 is not associated with an HDAC activity, and the GRIM1-mediated repression cannot be influenced by specific HDAC inhibitors. GRIM1 is able to inhibit directly, via acidic domains in the N and C termini, the acetylation of histone N termini (one of the preconditions for directed transcriptional activation). Repression domains which have not to date been characterized in detail within GRIM1 likewise have high potential for repression of transcription activity. GRIM1 has the potential in transient transfections for dose-dependent repression of both complex and synthetic minimal promoters. Based on these data, the newly cloned factor has been designated GRIM1 (Global Repressor Involved in Myogenic differentiation).

GRIM1 shows relocalization during skeletal muscle differentiation, although at a distinctly later time than previously described for the HDACs 4, 5 and 7 in connection with MEF2-specific transcription. The available data suggest that the repression potential of GRIM1 must not be switched off until later times during skeletal muscle differentiation so that terminal differentiation of the myotubes is possible. In addition, GRIM1 likewise shows a subcellular change of localization during preadipocyte differentiation.

One function of GRIM1 is involvement as repressor in regulating the differentiation of skeletal muscle cells. The data show that GRIM1 shows a distinctly different role than the involved factors previously described. Elucidation of the in vivo role of GRIM1 takes place via GRIM1 knockout animals and transgenic mice. In the transgenic animals, GRIM1 mutants will express under skeletal muscle-specific promoters which can no longer reach the nucleus or which can no longer be transported out of the nucleus. The phenotype of the mice which results from the generated atypical localization of GRIM1 will contribute further to understanding the function of GRIM1 within differentiation processes.

Application of the present invention is particularly in the area of degenerative muscle disorders or in controlling muscle atrophy in the aging man. The therapeutic modification of the function of GRIM1 may in such cases counteract premature muscle degeneration or actively intervene in processes which build up muscle.

The present invention therefore relates firstly to polypeptides having a sequence of at least 20 consecutive amino acids from the sequence of hsGRIM1 (hs=homo sapiens) having the sequence ID No. 3.

The polypeptides of the invention preferably have a sequence of at least 40 consecutive amino acids. The polypeptides more preferably have a sequence of at least 80 consecutive amino acids, even more preferably a sequence of at least 120 consecutive amino acids and most preferably the polypeptides of the invention have a sequence of at least 200 consecutive amino acids from Seq. ID No. 3.

The invention further relates to polypeptides which have a sequence of at least 20 consecutive amino acids from the mmGRIM sequence (mm=mus musculus) having the Seq. ID No. 4.

These polypeptides more preferably have a sequence of at least 40 consecutive amino acids, even more preferably a sequence of at least 120 consecutive amino acids and very particularly preferably a sequence of at least 200 consecutive amino acids of Seq. ID No. 4.

The present invention further relates to antibodies which bind specifically to an epitope of a polypeptide of the invention. The antibodies of the invention can be prepared by customary standard methods. Either the polypeptides coding for GRIM1 can be used to immunize suitable laboratory animals such as, for example, rabbits or goats, and it is possible in this way to prepare suitable polyclonal antibodies. The antibodies of the invention may be directed against epitopes such as conformational epitopes, but also against peptides of the invention.

As an alternative to this it is possible to prepare suitable monoclonal antibodies by methods which have been well known since the publication by Köhler and Milstein in 1975 and belong to the standard repertoire of an average molecular biologist.

Antibodies of this type can be employed in therapy. However, to do this, it is usually necessary to prepare humanized antibodies, because antibodies having constituents derived from animals may cause unwanted side effects. If the binding regions of a suitable antibody have been sequenced, these sequences can be incorporated into a human basic antibody structure, and an antibody of this type can be used in therapy.

An alternative area of use of antibodies of this type is in diagnosis. It is perfectly possible for simple polyclonal antibodies, with which qualitative and/or quantitative detection of the presence of GRIM1 polypeptides in the cells or cell compartments of interest is possible, to suffice for this purpose. The average skilled worker can carry out suitable diagnostic methods with antibodies of this type. The present invention further relates to medicaments which comprise a polypeptide of the invention.

These medicaments are preferably employed for the treatment of disturbances of skeletal muscle differentiation and for the treatment of disturbances of fat cell differentiation.

The medicaments of the invention may comprise a polypeptide having the complete GRIM1 sequence or a suitable part of the sequence. The medicaments are administered in a suitable form to the patients to be treated. Oral or preferably parenteral pharmaceutical formulations are suitable in this connection.

The mechanism of action of the medicaments of the invention relies on modulation of the function of GRIM1. During skeletal muscle differentiation, GRIM1 is transported from the nucleus into the cytoplasm. The medicaments of the invention can intervene in this differentiation process by either specifically blocking importation or else blocking exportation. This can be achieved by incorporating the suitable segments of the polypeptides into appropriate formulations so that the target site of interest can be reached.

It has also been found within the scope of the present invention that GRIM1 is involved in further differentiation processes. GRIM1 shows a subnuclear relocalization during adipocyte differentiation. Involvement of GRIM1 in various other regulatory processes emerges from the findings of the present invention, in particular from the experimental data which show that GRIM1 shows a repression of a wide variety of complexes and synthetic promoters, and expression of GRIM1 is ubiquitous.

The present invention further relates to a method for identifying substances which influence the biological function of a polypeptide of the invention. This entails the substance to be identified being brought into contact with the polypeptide in a test system. It is possible with this test system to identify substances which interact with the GRIM1 polypeptide and inhibit or enhance the biological function of GRIM1.

The systems used according to the invention are preferably cellular differentiation systems which make use in particular of myogenic C2C12 cells or rapidly and inducibly differentiating 10T1/2 MyoD-ER cells. Detection of GRIM1 or the GRIM1 localization is possible for example immunohistologically. Suitable methods are, inter alia, the use of fluorescence-coupled or enzyme-coupled antibodies in a direct coloring step.

It is also possible to provide suitable cell lines which comprise an appropriate genetic construct with a GRIM1 gene. The substances to be investigated can then be brought into contact with the cells, and the effect of the substance to be investigated can be determined by appropriate comparative tests.

It is possible in a further embodiment to introduce suitable genetic constructs into laboratory animals and to use a transgenic animal for the test methods.

It is possible in a further embodiment of the invention to incubate recombinantly produced GRIM1 fragments in cell-free test systems with substances to be tested, and to obtain the desired result of the test by use of a suitable reporter molecule.

A further aspect of the invention is represented by the cDNA which codes for hsGRIM1 (homo sapiens) and which has a sequence of at least 1200 consecutive nucleotides from Seq. ID No. 1.

Another aspect of the invention is represented by the cDNA which codes for mmGRIM1 (mus musculus) and which has a sequence of at least 1200 consecutive nucleotides from Seq. ID No. 2.

The cDNAs of the invention can be employed in transfection vectors which have a cDNA of the invention. A preferred possibility in this connection is an adenoviral vector.

These transfection vectors are used to produce cells which have been transfected with such a vector.

In the examples which are described in detail below, besides customary standard methods, the following methods were preferably used, and the underlined sections of the methods are explained in more detail hereinafter:

Method 1 (Transient and Stable Transfection of Cell Culture Cells):

The cells were cultured in the media recommended by the ATCC on 15 cm cell culture dishes under sterile conditions. Cells are subcultured in a ratio of 1:5 to 1:20 every two to three days and kept at a maximum of 60% confluence. Old medium is removed, and the cells are washed with PBS buffer and treated with trypsin/EDTA solution (0.25% trypsin, 0.04% EDTA in PBS buffer) until they are detached from the culture dish. The cells are isolated in fresh medium and subcultured on new subculture dishes.

PBS buffer: 137 mM NaCl; 2.7 mM KCl; 8 mM Na2HPO4;
1.8 mM KH2PO4
Media used: DMEM (Gibco BRL), 100 IU
penicillin G/ml, 100 μg/ml streptomycin,
2 mM glutamine, 10% fetal calf serum. As
differentiation medium for C2C12 and L6
cells, 10% FCS was replaced by 2% horse
serum. 10T1/2 MyoD-ER cells were
cultured in hormone-free serum, and 1 μM
estradiol, 10 μg/ml insulin and 10 μg/ml
transferrin were supplemented as
differentiation medium.

To determine the transcriptional properties of hsGRIM1 proteins in eukaryotic cells, pCMX-hsGRIM1 expression plasmids were cotransfected with luciferase (LUC) reporter plasmids. Expression of the particular hsGRIM1 protein in a pCMX expression plasmid is under the control of the cytomegalovirus promoter. Luciferase expression in the LUC reporter plasmids used is controlled either by the thymidine kinase (TK) promoter, an E1b minimal promoter (TATA box), or by the respectively indicated complex promoters.

Transfection takes place by the calcium phosphate method or by the DOTAP liposomes method (Roche Diagnostics, product information). Unless otherwise indicated, 105 cells/well were seeded in 1 ml of culture medium in 12-well dishes. In the CaPO4 method, the plasmid DNA to be transfected is coprecipitated with calcium phosphate, and the precipitate is distributed to the cells capable of division. The calcium phosphate precipitate is prepared by preparing the mixture indicated below for duplicates in 12-well dishes:

Reporter plasmid 1 μg
hsGRIM1 expression plasmid 20-400 ng
Carrier DNA (pUC18) ad 8 μg
CaCl2 solution (2.5 M) 20 μl
ddH2O ad 80 μl

While agitating (vortexing), 80 μl of 2× BES buffer are slowly and uniformly added dropwise to this mixture. The precipitate is incubated at RT for 10 min and distributed uniformly to the cells (80 μl per well) and, after 8 hours, removed by washing with PBS. The cells are incubated in fresh culture medium for a further 18 to 24 h.

BES buffer (2x): 50 mM N,N-bis[2hydroxyethyl]-2-
aminoethanesulfonic acid; 280 mM
NaCl; 1.5 mM Na2HPO4.2H2O; pH 6.95

Stable transfection of cell culture cells is carried out with the pcDNA6-His system supplied by Invitrogen. Cells are transfected as described above, and stable integration of the plasmids used is detected by the selection antibiotic blasticidin S. Individual clones are picked, expanded and tested by Western blotting and immunodetection for stable expression.

Method 2 (Protein-Protein Interactions):

Yeast two-hybrid interaction assays, mammalian THS, pull-down analyses, immunoprecipitation of cellular proteins followed by immunodetection or in combination with in vitro translated 35S-methionine-labeled interactants, Phast gel system.

Glutathione S-transferase Pulldown

A protein is expressed as GST fusion protein in E. coli, immobilized on a GST-binding carrier material, and incubated with the potential interactant which is usually radiolabeled. In the subsequent washing steps, proteins which interact only weakly or not at all are washed off the carrier material or the carrier material-bound GST fusion protein. The amount of associated interactant can be determined by fractionation of the proteins by SDS-PAGE and subsequent autoradiography. To check the specificity of interaction between potential interactant and GST fusion protein, the interaction with GST alone is examined.

Aliquots of GST-GRIM1 fragments or GST-containing E. coli crude lysate are mixed in each case with 30 μl of glutathione(GSH)-Sepharose and incubated on a bohemian wheel at 4° C. for 1 h. The GSH-Sepharose is pelleted by centrifugation (1′ at 2000 rpm) and washed twice in pulldown buffer. The pellet is then resuspended in 500 μl of pulldown buffer and incubated with the in vitro translated, 35S-methionine-labeled potential interactant at 4° C. on the bohemian wheel for 1 h. After washing three times with pulldown buffer, the GSH-Sepharose pellet is boiled in 30 μl of SDS sample buffer, the proteins are fractionated by SDS-PAGE, and the gel is dried and then subjected to autoradiography.

Pulldown buffer: 20 mM HEPES (pH 7.7); 150 mM KCl;
0.1 mM EDTA; 25 mM MgCl2; 10 mM DTT;
0.15% (v/v) NP40.

Immunoprecipitation

If two proteins interact in solution, the stable complex of the two proteins can be precipitated with an antibody which is directed against only one of the two interactants. In this case, the protein-antibody complex is isolated from the solution with the aid of an antibody-binding carrier material (γ-bind G Sepharose, Pharmacia). To investigate interactions between GRIM1 and putative interactants, either native cell extracts or GRIM1-containing cell extracts are mixed with in vitro translated, 35S-methionine-labeled target proteins in 500 μl of IP buffer. 5 μg portions of anti-GRIM1 or nonspecific antibodies (rabbit IgG1) are mixed with 30 μl of preequilibrated γ-bind G Sepharose, and the mixture is incubated on a bohemian wheel at 4° C. for 60 min. The G-Sepharose is then pelleted at 2000 rpm for 1′ and washed three times with 300 μl each time of ice-cold IP buffer and finally the pellet is boiled in 30 μl of SDS sample buffer. The samples were finally separated by SDS-PAGE, and interaction was detected either by Western blotting or, in the case of the proteins translated in vitro in the presence of 35S-methionine, by autoradiography.

IP buffer: 20 mM TrisHCl (pH 8.0), 300 mM NaCl,
5 mM EDTA, 0.3% (v/v) NP40, 0.5 mM
Pefablock
Cell lysis buffer: 50 mM TrisHCl (pH 8.0), 170 mM NaCl,
0.1% NP40, 50 mM NaF, 2 mM NaO3V4,
0.2 mM DTT, 0.1 mM Pefablock, 1 μg/ml
aprotinin, 10% glycerol

Method 3 (Detection of Intracellular Localization):

Indirect immunofluorescence, cell fractionation followed by immunodetection.

Indirect Immunofluorescence (IIF)

Cells are seeded in the desired cell density on autoclaved slides and fixed on the support with 5% paraformaldehyde for 10′. Cell membranes are made permeable for antibodies by incubation in 0.2% TritonX100 for 10′. Before the incubation with the primary antibodies, the cells are blocked in 0.2% gelatin (in PBS) at RT for 1 h. Anti-hsGRIM1 antibodies are diluted 1:500 in 0.2% strength gelatin solution and incubated at RT for 1 h. After washing three times with PBS for 5′ each time, the respective fluorochrome-coupled secondary antibody is added 1:2000 in 0.2% gelatin solution and incubated in the dark at RT for 30′. After the washing steps, the nucleus is counterstained with DAPI (1 μg/ml PBS, Roche Diagnostics) and the cells are finally washed twice in 0.1% TritonX100 in order to minimize autofluorescences. The slides are preserved in Fluoromount M (Southern Biotechnology Associates) and analyzed using a fluorescence microscope.

Cell Fractionation

Intact nuclei can be isolated and lyzed separately by hypotonic lysis of the cell membrane. Cells are harvested in ice-cold PBS, pelleted and swollen in hypotonic lysis buffer (LB). The cell membrane is permeated by adding NP40 ad 0.1%, and the cytoplasmic constituents are released by gentle shaking and incubation on ice for 15′. Intact nuclei are pelleted by centrifugation at 14 000 rpm for 15′, the CP fraction is removed quantitatively, and the protein concentration is determined. Nuclei are lyzed by incubation in nuclear lysis buffer (NLB) while vortexing for 15′. Debris is pelleted and the soluble nuclear preparation is removed. The quality of the preparation is examined by Western blotting and immunodetection with nucleus-specific (e.g. TIF2) and cytoplasmic (e.g. RasGAP) markers.

LB: 10 mM HEPES (pH 7.9), 1.5 mM MgCl2, 10 mM KCl,
0.5 mM DTT, 0.5 mM Pefablock
NLB: 20 mM HEPES (pH 7.9), 420 mM NaCl, 1.5 mM
MgCl2, 0.2 mM EDTA, 0.5 mM DTT, 0.5 mM
Pefablock, 10% glycerol

Method 4 (Detection of Enzymatic Activities):

HDAC assay, INHAT assay, luciferase assays.

HDAC Assay

The histone deacetylation reactions which were carried out were carried out within the framework of a kit obtained from Upstate Biotechnology (3H-labeled histone H3 N-terminus as substrate). Alternative substrates used were histones 14C-acetyl-labeled with p300 or in vivo labeled histones (kindly provided by Dr Martin Göttlicher, Kernforschungszentrum Karlsruhe).

INHAT Assays

INHAT assays were carried out as described by Eckner et al. and by Seo et al. (Eckner et al., 1996, Genes and Development 10 (19), pp 2478-2490, Seo et al., 2001, Cell 104 (1), pp 119-130). Histones or histone mixtures are preincubated with the appropriate peptides in a total of 50 μl of HAT buffer, then mixed with bacterially expressed p300 HAT domains and 0.5 μCi of 14C-acetyl-coenzyme A, and incubated at 30° C. and 1000 rpm for 2 h. Reactions are stopped by adding SDS Laemmli buffer. Proteins are fractionated in denaturing SDS-PAGE, and the gels are incubated in Amplify (NEN) for 1 h. Acetylations are detected in autoradiographies.

Luciferase Assays

Transiently transfected cells are washed once with PBS and lyzed by adding 50 μl of reporter lysis buffer (Promega) and further disrupted by freezing at −80° C. Cell lysates are transferred into Eppendorf reaction vessels, and cell detritus is pelleted at 14 000 rpm for 2′. 10 μl portions of the lysates are pipetted into 96-well microtiter plates to determine the luciferase activity. The luciferase assay took place in an EG&G Berthold Microluminomat. 40 μl of luciferase assay buffer are injected into the 10 μl of cell lysate, and the resulting chemiluminescence is determined in a time integral of 10″. The measured values for the luciferase activity are related to the amount of protein present in the cell lysate. For this purpose, 3 μl portions of the lysates are mixed in 96-well microtiter plates with 100 μl of Bradford assay reagent (BioRad) diluted 1:5 with H2O, and the absorption of the solution is determined at 595 nm. Relative luciferase activities are found from the ratio of the luciferase activity to the protein absorption.

Luciferase assay buffer: 200 mM tricine; 1.07 mM (MgCO3).4Mg(OH) 2; 0.1 M MgSO4, 10 mM EDTA (pH 8.0); 33 mM DTT; 0.5 M ATP; 270 mM acetyl-coenzyme A; 470 mM glowworm luciferin.

The invention is explained in more detail by the following examples:

EXAMPLE 1

The cloned human GRIM1 gene includes 2250 base pairs and codes for 749 amino acids. The cloned human GRIM1 sequence obtained by sequencing was deposited for the first time as unknown cDNA in 1999 under the accession number AL050019 (protein DKFZp564C186) as part of a “Random EST sequencing” project of the DKFZ in Heidelberg. A sequence which had been revised further was deposited in March 2001 (Wiemann et al., 2001). The function of the protein DKFZp564c186 has not previously been described. The cDNA of the invention is depicted in FIG. 1. The sequence has Seq. ID No. 1.

EXAMPLE 2

It was possible to calculate from mouse EST databases by comparative analysis with the hsGRIM1 aa sequence from independent ESTs a full-length protein which has a total of 750 amino acids and a total of 60% identical and more than 85% homologous residues to the known hsGRIM1 sequence. Analysis of mouse cDNA libraries and mouse genomic libraries (Celera) have confirmed the calculated and expected mmGRIM1 aa sequence. It was possible to confirm the putative cDNA by RT-PCR analyses. The full-length cDNA of mmGRIM1 has not yet been described or deposited. The sequence having Seq. ID No. 2 is depicted in FIG. 2.

Seq. ID No. 2 was obtained by screening mmEST dbs with the hsGRIM1 aa sequence. The resulting data were compared with mm cDNA dbs and mouse genomic dbs and the virtual mmGRIM1 cDNA was constructed. The sequence was confirmed by RT-PCR and genomic sequencing, and by a direct sequence comparison with the mouse genomic database of Celera Inc.

EXAMPLE 3

Demonstration of homology between hs and mmGRIM1 at the cDNA and at the protein level is shown in FIG. 3. FIG. 3 depicts a comparative demonstration of the homology of the mmGRIM1 and hsGRIM1 amino acid sequences including conserved sequence motifs.

The amino acid sequence of mmGRIM1 (mouse) is Seq. ID No. 4 and the amino acid sequence of hsGRIM1 (human) is Seq. ID No. 3.

All the functional and potentially interesting sequence motifs described in detail below are sequence-identically conserved in the mouse and the human protein (nuclear localization sequence NLS, nuclear export signal NES, so-called CoRNR box with which corepressors with their associated transcription factors are able to interact). Further motifs are HMG box-like domains within the C terminus and N terminus of GRIM1 of both species, which may possibly bring about contact with DNA and/or histones. In addition, in total 5 so-called LXXLL or related motifs are present within the primary hsGRIM1 aa sequence, an alpha-helical structure which has been reported to be responsible solely for contact of cofactors with their associated transcription factors. Within the mmGRIM1 primary sequence, only 2 of these motifs are conserved vis-a-vis the human sequence. No functional data are available on these motifs as yet. According to calculations, hsGRIM1 mainly has an alpha-helical structure (Columbia University PHD predict program) and is non-globular (GLOBE of the Columbia University PredictProtein server). GRIM1 is localized in the nuclei of proliferating cells, while GRIM1 is relocated from the nucleus to the cytoplasm within cellular differentiation systems (e.g. in C2C12, L6, 10T1/2 and 3T3-L1 cells).

EXAMPLE 4

For the purposes of the present invention, only hsGRIM1 was used on the basis of cDNA. However, it is assumed that corresponding results will be obtained on use of mouse cDNA. Various constructs were produced by deletion- and sequence-specific point mutagenesis from the human GRIM1 for detailed functional characterization and are compiled in the following tables.

TABLE 1
hsGRIM1 point mutants used
Name aa positions Constructs used
ΔNES I L309K, L312A -. FLAG, His, Xpress, GFP
ΔNESII L309R, L312A, L315Q, -. FLAG, His, Xpress, GFP
L317A
ΔNLS I K649A, R650L, R651E, -. FLAG, His, Xpress, GFP
K652A
ΔNLS II K649A, R650L, R651E, -. FLAG, His, Xpress, GFP
K652A, R661D, K662I,
K665E
ΔCoRNR I439A, I440S, I443A -. FLAG

TABLE 2
hsGRIM1 deletion mutants used
Name aa positions Constructs used
GRIM1  1-749 jcdc5
mut A  3-609 Gal4-DBD, FLAG, GFP, GST, His
mut B  3-487 Gal4-DBD, GST, His
mut C  3-423 Gal4-DBD, GST, His
mut D  3-245 Gal4-DBD, GST, His
mut E  3-147 Gal4-DBD, GST, His
mut F 145-749 Gal4-DBD, GST, His
mut G 246-749 Gal4-DBD, GST, His
mut H 485-749 Gal4-DBD, GST, His
mut I 609-749 Gal4-DBD, FLAG, GFP, GST, His
mut J 145-609 Gal4-DBD, His
mut M 468-749 GST
mut N 246-609 Gal4-DBD
mut O 246-485 Gal4-DBD
mut P 485-609 Gal4-DBD
mut Q 246-423 Gal4-DBD
mut R 423-485 Gal4-DBD, GST
mut S 145-245 Gal4-DBD
246-334 246-334 FLAG, GFP
Δ246-334  3-245 FLAG, GFP
335-749

Many of the mutants used carry specific tags such as the Gal4 DNA-binding domain of the yeast GAL4 transcription factor [Gal4-DBD], green-fluorescent protein [GFP], herpes simplex virus transactivator protein 16 [VP16], the antibody-specific signal sequences FLAG tag [FLAG], Xpress tag [XPRESS], c-myc tag [MYC], nickel-binding epitope His tag [His], maltose-binding epitopes [MBP], glutathione-binding portions of glutathione S-transferase [GST]. The use of proteins modified in this way is identified through use of the epitope name in the GRIM1 construct employed. The function of the individual regions of the polypeptides of the invention was investigated by these experiments.

EXAMPLE 5

Database analyses have shown that hsGRIM1-homologous proteins are to be found in a large number of species. Homologous sequences are to be found in Shizosaccharomyces pombe, Saccharomyces cerevisiae, Rattus spec., Bos bovis, Mus musculus, Drosophila melanogaster, Caenorhabditis elegans, Danio rerio and also in Arabidopsis thaliana. A summarizing overview is obtained from the databases UNIGENE (National Center for Biotechnological Information, NCBI) and of the PredictProtein server of Columbia University and is shown in Table 3 below:

Selected Model Organisms in a Protein-Similarity Representation

Organism, protein, percent identity and length of the compared region.

H. sapiens: sp: Q9Y3T9 - YU20_HUMAN HYPOTHETICAL 84.9 KDA
PROTEIN DKFZP564C186 100% over 753 amino acids
(according to the invention)
M. musculus: sp: Q9WV70 - YU20 MOUSE HYPOTHETICAL PROTEIN
73% over 267 Aa
R. norvegicus: sp:- - |Segment 1 of 2| COLLAGEN ALPHA 1 (I) CHAIN
29% over 328 AA
A. thaliana: sp: Q9ZPV5 - YU20 ARATH HYPOTHETICAL PROTEIN
T30D6.27 IN CHROMOSOME II 27% over 722 AA
C. elegans: sp: O17580 - YTB2_CAEEL HYPOTHETICAL 82.0 KDA
PROTEIN C07E3.2 IN CHROMOSOME II 27% over 656 AA
D. melanogaster: sp: Q9VIF0 - YU20 DROME HYPOTHETICAL PROTEIN CG9246
37% over 681 AA
S. cerevisiae: sp. P39744 - YO26_YEAST HYPOTHETICAL 81.6 KDA
PROTEIN IN DEDI-RETI INTERGENIC REGION 29% over
674 AA

Table 3: Representation of the UNIGENE maximally homologous proteins from mouse, rat, Arabidopsis, threadworm, fruit fly and baker's yeast. The Swissprot accession numbers, UNIGENE accession numbers, investigated region and maximum homology are indicated (mouse Q9WV70 is not the full-length clone; compare with the described mouse clone described under Seq. ID No. 4).

FIG. 4 shows a comparison of the amino acids and establishment of a consensus sequence.

EXAMPLE 6

Genomic Organization

The characteristics of the genomic sequences of mmGRIM1 and hsGRIM1 are compared in Table 4 below. The genomic sequence of both species, including the detailed exon-intron boundaries, is indicated in FIGS. 5 and 6.

TABLE 4
Genomic organization comparison of mm (mouse)
versus hsGRIM1 (human).
hsGRIM1 mmGRIM1
Number of exons 19 19
Location Chr. 1p33.36 Chr. 4p
Pseudogenes Chr. 2 NT_022127.3 not known
Chr. 2 NT_022140.3
Chr. 11
STS WI-15347 not available
Accession # GenBank AF276983.1 Accession to the
revised version under complete sequence is
NCBI not available.
NT_021903 Individual exons are
UniGene Hs.134200 present in EST dbs.
Swissprot YU_20 human
ENSG00000077716
LokusLink 26155
GenBank AL050019.1
OMIM entries No muscle- or fat-related No muscle- or fat-
phenotype. related phenotype.
1p33 is a highly mutated
locus and is associated
with breast, prostate and
brain tumors
Spliced isoforms nothing known nothing known
fragmentary ESTs present
in various dbs. Northern
analyses show only one
isoform (exception:
heart, 3 isoforms).
Size of the 14.24 kb (Ensembl) 12.36 kb (Celera)
locus
Quality of the Chromosome 1 build 27 no Ordered up to 5.5 kb
contigs longer has any gaps; 5′- and 3′-flanking,
ordered structure only a small gap
between exons 2 and 3
(see annex 2).

FIG. 5 depicts the genomic sequence of hsGRIM1 (NCBI Human Genome Server, Chromosome 1 map view, build 27, December 2001). Exons have a shaded background, and the putative poly-A site is underlined. The sequence corresponds to Seq. ID No. 5.

FIG. 6 depicts the genomic sequence of mmGRIM1 including 5.5 kb flanking sequences (established from the public NCBI mouse genome db and the commercial Celera mouse genome gb). The exons have a shaded background, and intronic sequences are depicted in pale. Exon/intron junctions are depicted in bold. The putative poly-A site and the putative transcription start are underlined. As yet incompletely assembled sequence fragments are depicted by “N”. The genomic mouse sequence has the Seq. ID No. 6.

EXAMPLE 7

Expression of Recombinant GRIM1 Protein

Many different strategies and expression systems were tested for expression of recombinant hsGRIM1 protein, but only expression of short protein fragments either in the HiS or in the GST context was successful. The following lists briefly summarize the results and the methods used.

a) Expression Systems and Brief Description of the Characteristics for Expression of Full-Length hsGRIM1

Bacterial systems: all the systems used employ Escherichia coli safety strains which were purchased from Stratagene.

BL21 (DE3)lysGOLD His-fused: Expression in the pRSET system or in a modified pRSET vector with unique hexahistidine tag, purification on a nickel affinity matrix (TALON, Clontech). Coexpression with GroESL and hspHJK chaperones.

BL21(DE3)lysGOLD GST-fused: Expression in the pGEX4 or 6 systems from Pharmacia, purification on GSH affinity columns, expression inducible by IPTG. Coexpression with GroESL and hspHJK chaperones.

BL21(DE3)lysGOLD NusA-fused: Increase in solubility of the target protein via the NusA content, purification by GPC (Stratagene, Novagen)

BL21(DE3)lysGOLD MBP-fused: periplasmic expression, and thus reduced cytotoxicity (Stratagene, New England Biolabs pMAL system)

BL21(DE3)lysRIL: Codon-optimized BL21 strain (Stratagene). Both hexahistidine- and GST-fused protein expression.

ABLE C: Safety strain which downregulates endogenous plasmid copy numbers by a factor of 4× (Stratagene). Both hexahistidine- and GST-fused protein expression.

ABLE K: Safety strain which downregulates endogenous plasmid copy numbers by a factor of 10× (Stratagene). Both hexahistidine- and GST-fused protein expression.

Plant Systems:

Physcomitrella patens moss: stable integration of a CaMV-driven expression plasmid for GST-hsGRIM1 (pRT99/35S-GST-hsGRIM1) via non-homologous recombination, triple selection via two different selection antibiotics and multiple seedings (in cooperation with Prof. Ralf Reski, Plant Biotechnology Institute of Freiburg University).

Cellular Systems:

Expression of GST fusion protein in eukaryotic cell culture cells under the control of a constitutively active CMV promoter.

    • b) Expression of hsGRIM1 peptide Fragments

Short hsGRIM1 protein fragments were obtained both as hexahistidine- and as GST-fusion proteins only in BL21(DE3)lysGOLD without coexpression of chaperones. The following table summarizes the expression results obtained; unlisted fragments (compare table of the hsGRIM1 constructs used) could not be expressed:

TABLE 5
Bacterially expressed hsGRIM1 fragments
His-E (aa 3-147) +++
His-I (aa 609-749) +++
His-H (aa 485-749) ++
GST-E (aa 3-147) +++
GST-I (aa 609-749) +++
GST-H (aa 485-749) ++
GST-M (aa 468-749) +
GST-R (aa 423-485) ++

+++ very soluble, readily inducible

++ readily inducible, low yield

+ solubility poor in some cases, low yield

EXAMPLE 8

Generation and Description of the α-GRIM1 Antibodies Used

To produce hsGRIM1-specific antibodies, two hexahistidine-fused hsGRIM1 protein fragments were expressed in E. coli, purified and used to immunize rabbits. Amino acids 3-147 and 609-749 of hsGRIM1 served as epitopes for the antibody.

TABLE 6
N-terminal His6x-hsGRIM1 peptide (aa 3-147)
which was used to immuniz rabbits, peptide “E”
(S q. ID No. 7). The antibodies 2719 and 2720 resulted
therefrom.
N terminus
MHHHHHHGMASEFGSAGSRKRRLAFLTVDEFLASGFDSESESESENSPQAETREAREAAPEPDKPGGS
PSASRRKGRASEHKDQLSRLKDRDPEFYKFLQENDQSLLNFSDSDSSEEEEGPFHSLFDVLSEASSEE
DGAEEGEDGDRVPRGLKGDDNSVPSTI* C-terminus

TABLE 7
C-terminal His6x-hsGRIM1 peptide (aa 609-749)
which was used to immunize rabbits, peptide “I”
(Seq. ID No. 8). The antibodies 2910 and 2911 resulted
therefrom.
N terminus
MRGSHHHHHHGMASMTGGQQMGRDLYDDDDKDRWGSEEGTPLTLYYSHWRKLRDREIQEEISGKERLE
(Seq.
DLNFFEIKRRKMADRKDEDRKQFKDLFDLNSSEEDDTEGFSERGILRPLSTRHGVEDDREDEEEGEED
(Seq.
SSNSEDGDPDAEAGLAFGELQQLAQGPEDELEDLQLSEDD* C-terminus

These regions correspond to the putative INHAT domains of hsGRIM1 and are distinguished in particular by acidic (polyE/polyD clusters). The corresponding regions of the hsGRIM1 cDNA sequence were generated by restriction digestion with endogenous EcoRI (aa147) and XmaI (aa609) cleavage sites, and the products were cloned into the vector pRSET-B (Invitrogen) (aa 609-749) or pRSET-N+/H based on the PRSET-B with the difference that further tags have been deleted and the protein is expressed only with hexahistidine tag) (aa 3-147). The hexahistidine-fused hsGRIM1 protein fragments (aa 3-147 “E”, aa 609-749 “I ”) were overexpressed in E. coli BL21(DE3)lysGOLD and, after disruption of the bacteria, purified by TALON affinity chromatography. After isolation and purification from E. coli, both polypeptides had an estimated purity of about 80-90%. Rabbits were immunized with the polypeptides, and the raised antiserum was purified. The purified monospecific antibodies against aa 3-147 (2719, 2720) and against aa 609-749 (2910 and 2911) were functionally characterized.

The antibodies obtained in this way were employed in various immunological test methods that made it possible to detect expression of GRIM1. The two antibodies directed against the N terminus show exclusively nuclear localization of GRIM1 in subnuclear compartments which are generally referred to as “speckles”. The number and size of the nuclear speckles varies from cell line to cell line, only the exclusively nuclear localization of GRIM1 being common to proliferating cells. The two antibodies directed against the C terminus recognize exclusively nuclear GRIM1 in proliferating cells, but not in speckles, rather in a pan-nuclear localization in the entire nucleoplasm.

EXAMPLE 9

Expression of GRIM1 mRNA and Protein

cDNA/mRNA Expression of hsGRIM1 and mmGRIM1

hsGRIM1 cDNA expression is ubiquitous according to the report of the Unigene database (UniGene Cluster Hs. 134200, Homo sapiens DKFZP564C186/DKFZP564C186 protein with the cDNA library 2334BT0407 used). Expression was detected:

Cervix, Pancreas, amnion_normal, bone,bone marrow, brain, breast, cervix, colon, colon_est, colon_ins, denis_drash, ear, epid_tumor, esophagus, cyc, genitourinary tract, germ cell, head_neck, heart, kidney, kidney_tumor, liver, lung, lung_normal, lung_tumor, lymph, muscle, nervous_normal, ovary, pancreas, placenta, pool, pooled, pooled brain, lung, testis, pooled colon, kidney, stomach, pooled lung and spleen, prostate, prostate_tumor, salivary gland, skin, small intestine, stomach, testis, testis-cell line, thymus pooled tonsil, uterus, uterus_tumor, whole embryo

The expression pattern of hsGRIM1 was visualized by Northern blot analysis (CLONTECH hsMTN I and hsMTN II, probe: both full-length hGRIM1 cDNA and N- and C-terminal fragments). The hsGRIM1 transcript size is about 3.3 kb (consistent with the deposited full-length mRNA under Acc. # AL 050019):

heart (1), brain (2), placenta (3), lung (4), liver (5), skeletal muscle (6), kidney (7), pancreas (8), spleen (9), thymus (10), prostate (11), testis (12, ovaries (13), small bowel (14), large bowel (15), peripheral lympocytes (15

The expression of mmGRIM1 in various tissues of the adult mouse (4-6 weeks) was determined by RT-PCR. The following tissues and organs were classified as mmGRIM1-positive:

breast, breast of suckling animals, placenta, testis, ovaries, fat, skin, bone, cartilage, spleen, lung, adrenergic gland, kidney, liver, small bowel, stomach, pituitary, thymus, tongue, skeletal muscle, heart, eye, spinal cord, cerebellum, medulla, hypothalamus, cerebral cortex, whole brain

Expression of mmGRIM1 mRNA in embryonic development was determined via RT-PCR with complete embryo mRNA. A distinct mmGRIM1 signal is detected at all times, and no large change in mmGRIM1 mRNA expression during development is observable.

Table 8 depicts a UNIGENE database analysis on EST expression selected in homology to mm/hsGRIM1 protein. The accession numbers of the IMAGE clone or of the sequences which are unknown in some cases, and the tissue type from which the cDNAs were isolated, are indicated. GRIM1 appears to be expressed ubiquitously also at the protein level. In total, 308 ESTs were found, and those which show an unambiguous tissue assignment are listed below:

TABLE 8
BI070012 cervix R50545 breast BI870713 liver
BG335512 placenta H26449 breast BE253493 eye
BE903516 placenta AI674272 uterus BF345524 brain
BG699598 brain AL382825 esopitagus BE070314 breast
BI828140 brain R10573 pool AW375280 colon
BG163998 skin R10574 pool BG388020 prostate
BG760638 skin AW058011 thymus pooled BG179766 prostate
BE894669 skin AI660736 thymus pooled BE583040 brain
BG767001 skin AI765077 kidney BG764320 skin
BF207343 brain AI677761 pancreas BE263417 lung
BG337689 uterus AI266034 lung BE266643 lung
BG394462 eye AI948457 kidney BE273581 kidney
BF212645 bone marrow AA281338 tonsil BG674251 skin
BE278111 placenta AA213719 tonsil BE514600 ovary
BF984755 small intestine AI93564 lung BE778203 eye
BG332620 lung AI85822 lung BI258705 placenta
BG767665 skin AI660558 colon BI006483 kidney_tumor
BG764689 skin AI681255 lung AW675721 cervix
BG390277 prostate AI272873 colon BE874785 colon
BI489732 pooled brain AI935918 pancreas BE545263 placenta
lung testis AI799833 prostate BE746375 ovary
BG776759 lung AI655977 germ cell AI989734 colon
BG029437 breast AI633340 germ cell AW373221 colon
BG699275 brain AI971531 germ cell AW365265 head_neck
BE883535 uterus AA026277 heart BE746427 ovary
BI459847 testis cell line AA026278 heart AW575244 colon
BI461880 testis cell line AI400930 prostate BI113120 muscle
BG830390 pancreas AI420991 prostate AI471616 kidney
BI760633 pooled colon AI682274 prostate AL529521 brain
kidney AI744703 colon BE779713 eye
stomach U810701 prostate BI356811 placenta
BE732072 placenta BE869684 colon AW237492 kidney
AI254710 colon BE900176 placenta AW179094 stomach
AI611186 uterus AW572690 lymph AW512856 uterus
AI990470 thymus pooled BF868966 lung_tumor BE793414 lung
AW028378 stomach BF346952 brain AW366003 head_neck
R73178 breast AW673372 cervix AW104543 pool
R93124 breast BI085040 salivary gland BE257381 eye
AI678640 stomach BE515327 uterus BI222365 placenta
R50640 breast BE410145 placenta BE591125 uterus
BE746352 ovary AW365268 head_neck AW083553 colon
AW366001 head_neck BG328934 kidney BE783940 eye
BF874087 lung_tumor BE892015 skin BG327104 kidney
AA427964 whole embryo BE543377 placenta BE754506 normal
BE740821 ovary AW674628 placenta AW071075 breast
AL526148 brain AW551591 colon T16893 brain
BF341363 brain BF883105 lung_tumor BF773461 epid tumor
BE262764 brain AW151790 stomach BC284070 prostate
BH15932 lung BE391861 uterus AW366039 head_neck
BE391378 uterus BI254811 placenta BG436850 lung
BG576365 breast BE301196 kidney BE26490 lung
BI259365 placenta BE296203 muscle BG829981 pancreas
BG330302 lung BE278652 placenta AA315693 ATCC 111476
BI772656 pooled lung BF797114 lymph T19249 testis
and spleen BI857618 breast AW364797 denis_drash
BG761400 skin BG256028 prostate BF223807 germ cell
BG681166 skin AL526094 brain AA355948 ATCC 158121
AW365999 head_neck AW364751 denis_drash BI007523 kidney_tumor
BE841836 stomach BF765941 colon_est AW351978 head_neck
BE379093 uterus AW364764 denis drash AW582985 Pancreas
BF768551 epid_tumor BE070313 breast BE727721 skin
BE898791 ovary BF026345 skin AH366053 head_neck
BE760929 brain AW364775 denis drash BF509301 muscle
BI857073 breast AW673544 cervix BF830322 kidney tumor
BF883094 lung_tumor AW375245 colon BG110646 bone
BE882355 uterus AW375242 colon BI084623 salivary gland
AW473561 uterus BF907757 uterus_tumor BI033036 nervous
BG421457 kidney BG762371 skin normal
BE901462 placenta AI632285 germ cell A356032 head neck
AW351639 colon AA427857 whole embryo BE593548 germ cell
BI859530 breast AW351647 colon BI860984 breast
BG91171 brain BE332104 breast AW366056 head_neck
AW375257 colon AW351638 colon AW564784 denis drash
AA502771 colon AA448947 whole embryo BG25338 liver
BE742897 ovary BE795961 lung BE858431 prostate tumor
AW020647 ear T16894 brain BF955772 nervous
AI672826 colon AW366050 head_neck normal
BG330696 lung BE383442 brain AW366040 head neck
BG421512 kidney BF817292 colon_mus BG423930 kidney
BE536984 cervix AI346533 colon AA449675 whole embryo
AW375211 colon BF000005 colon BF913827 uterus_tumor
BF732410 ovary BI160700 pancreas AW074084
BE273057 kidney BG177975 prostate
AW365264 head_neck BI857814 breast AW528624 Cervix
AW365167 head_neck BI033534 nervous BG030810 breast
AW375277 colon normal BG110635 bone
AW575314 colon AW366007 head_neck AL563470 brain
AW594248 germ cell AW375312 colon AW365161 head neck
BE389202 uterus BI762663 pooled colon BI007446 kidney_tumor
U636573 germ cell kidney BF338161 brain
BE746451 ovary stomach AW387399 stomach
BF868930 lung_tumor AW272743 colon AW601835 breast
BE729701 skin AW675196 placenta AW601811 breast
AW806654 stomach AW179097 stomach BF846203 lung_normal
BG281880 skin BF338242 brain BG254482 prostate
BI094540 cervix BE896763 skin

EXAMPLE 10

Protein Expression

Since various experiments cannot be carried out directly on humans, cell culture and animal experiments which, however, also have validity for the human situation were carried out.

a) The expression of mmGRIM1 protein in primary cells and tissues is indicated below (all the listed cells are classified as GRIM1-positive in a Western blot (86 kD), and for cells the expression was also checked in IIF). Signals are obtained with both antibodies (N- and C-terminal epitope):

Mouse embryonic fibroblasts

Human cardiac tissue (DCM patients and normal heart)

Mouse smooth muscle cells (differentiated, undifferentiated and proliferating)

    • Mouse organs: testis, ovaries, spleen, thymus and in a small amount also in prostate and stomach (depicted in the following figure), brain, lung, liver.

b) It was possible to detect expression of mmGRIM1 protein by in situ immunohistochemistry on sagittal sections of E10.5 mouse embryos. mmGRIM1 is expressed in epithelial structures, in the dermomyotome of the rear extremities, in the inner epithelial regions of the neural tube and in other cell populations which are not determined in detail. Concentrated expression is detectable only in the dermomyotome; only a few mmGRIM1-positive cells are detectable in the remaining areas. Ubiquitous expression of GRIM1 was found in mRNA and EST analyses. It was possible to show by in situ immunohistochemical analyses of E10.5 mouse embryos that although there is mmGRIM1 expression in every tissue type, it is far from being in every cell, but rather in specialized cell populations. mmGRIM1 is not expressed in every cell type but distributed over the entire organism in specialized cell types.

c) The expression of rnGRIM1 (rn=rat) in the rat brain was detected by in situ immunohistochemistry in sagittal sections through the brain of a Sprague-Dawley rat (Rattus norvegicus ssp).

rnGRIM1 is expressed in Purkinje cells of the cerebellum (nuclear and in some cases also cytoplasmic; strong immunoreactivity in 1-2 subnuclear structures), in bipolar cells of the mitral layer of the olfactory lobe (nuclear and in some cases also cytoplasmic; strong immunoreactivity in 1-2 subnuclear structures), in all cells of the choroid plexus (nuclear and in some cases also cytoplasmic; strong immunoreactivity in 2 subnuclear structures in most cases), in cells which have not yet been determined in detail in the whole region of the cortex (nuclear and in some cases also cytoplasmic; strong immunoreactivity in 1-2 subnuclear structures). rnGRIM1 is not expressed in every cell type, but distributed over the entire brain area in specialized cell types.

d) Expression of GRIM1 protein in cell culture cells. All the stated lines are classified as GRIM1-positive in Western blot analyses (species-inclusive size of about 86 kD) and by indirect immunofluorescence (IIF). Both assays were carried out with all the available α-GRIM1 antibodies. In the proliferative state, GRIM1 is detectable in every cell line in so-called speckle structures (as also described in the literature for many corepressors):

Mouse: NIH3T3 fibroblasts, NIH3T3-L1
preadipocytes, NIH3T3-L1 adipocytes,
C2C12 undifferentiated skeletal muscle
cells, C2C12 differentiated skeletal
muscle cells, N2a neural cells, P19
teratocarcinoma cells, 10 T1/2 fibroblasts,
Monc-1 neural crest cells
Human: HL1 myocardial cells, 293 embryonic
kidney cells, LnCaP prostate carcinoma
cells, PC3 prostate carcinoma cells
Monkey: COS-7 and CV1 kidney cell lines
Rat: L6 skeletal muscle cells
Hamster: BHK fetal kidney cells

e) Drosophila melanogaster GRIM1

Expression of an hsGRIM1-like protein in Drosophila melanogaster was investigated by Western blotting and whole-fly in situ hybridizations.

No specific signal was detected with the anti-hsGRIM1-specific antibodies (resolution from 36 to 210 kD) either in whole-larva lysate or in whole-cell extracts from fly heads. Likewise, no specific dmGRIM1 (dm=Drosophila melanogaster) signal was detectable with the available GRIM1 antibodies in in situ hybridizations with various larval stages.

EXAMPLE 11

hGRIM1 Interactants

In the protein-protein interaction studies carried out to date, the following potential mm/hsGRIM1 interactants were investigated for direct or indirect interaction with the following methods:

METHOD for detecting protein-protein interaction Symbol
Co-IP from cell extracts of transfected cells tfIP
Co-IP from cell extracts of untransfected cells utfIP
Co-IP with in vitro translated proteins ivIP
Yeast THS yTHS
Mammalian THS mTHS
Pulldown analyses (direct interaction) PD
Transcriptional studies (transient transfections) tT

The underlined factors showed an interaction with hs/mm/maGRIM1 and are described separately at the end of the list (ma=mesocricetus aureus, BHK cells).

Nuclear Hormone Receptors

hsAR (PD, utfIP, tfIP, YTHS, tT), hsERα (utfIP, tfIP), hsERβ, rnGR (tT, tfIP), hsMR (tT), hsPR (tT), PPARγ (tT), hsRARα (tfIP), rnTRα (tT), hsTRβ-2 (tT), mmERR1 (tfIP, tT), mmGCNF (PD, ivIP, tfIP, tT), hsRevErbA (tT), mmRVR (tT, tfIP), mmSF1 (tT).

Transcription Factors

Myogenin (ivIP, tT), MEF2A (ivIP), MEF2B (ivIP), MEF2C (ivIP, tT), eHand (ivIP), dHand (ivIP), E47 (ivIP), E12 (ivIP), GATA4 (ivIP), MyoD (ivIP, tT), SEF (ivIP, tT), MRF4 (ivIP, tT), Myf5 (ivIP), Sp1 (tT), CBF (tT).

Transcriptional Corepressors.

N-COR (ivIP, tfIP, utfIP, PD), Sin3A (ivIP, tfIP, utfIP), Sin3B (tfIP, utfIP), SuN-CoR (ivIP, tT), SMRT (ivIP, tfIP, utfIP), HDAC1 (tfIP, utfIp), HDAC2 (tfIP, utfIP), RIP140 (ivIP).

Transcriptional Coactivators:

P300 (tT), FHL2 (ivIP, PD), FHL3 (PD), TIF2 (ivIP), RIP140 (ivIP)

Further factors: Histones H3, H4, H2A, H2B (PD)

It has been possible to date to show a strong direct interaction between hsGRIM1/mmGRIM1 only with the androgen receptor (hsAR) (detected by tfIP in both directions, utflP in both directions, YTHS, PD and tT). The interaction with the androgen receptor is ligand-independent and cannot be influenced by the presence of antagonists (Casodex, hydroxyflutamide, cyproterone acetate). GRIM1 interacts both with the “normal” AR having 17 glutamines and with AR isoforms which are associated with Kennedy's disease and comprise polyglutamine-rich insertions (17, 44 and 77 Q), likewise ligand-independently. The PD analyses were carried out with the GRIM1 fragments GST-I/E/H/M, and all the tested fragments apart from GRIM1 “E” (aa 3-147) interacted with the AR, in the sequence M≧H>>I. The physiological relevance of the AR-GRIM1 interaction is described in detail in a separate section.

Weak interactions were detected between hsGRIM1 and the nuclear orphan receptors Germ Cell Nuclear Factor (mmGCNF) and Estrogen receptor Related Receptor 1 (mmERR1) (only ivIP, tfIP and PD), and a weak interaction with the estrogen receptor α (hsERα; interaction was detected only in tfIP and proved to be ligand-independent both in the presence of agonists (estradiol), of antagonists (raloxifene, tamoxifen, ICI) and in the absence of a ligand). The physiological relevance, in vivo colocalization or in vivo interaction is very substantially unclear. It was not possible to show any direct association between GRIM1 and mmGCNF, mmERR1 or hsERα in transient transfections.

GRIM1 shows a strong interaction with the core histones H4, H2B, H2A and H3 in GST pulldown analyses. Recombinantly expressed GST-GRIM1 fusion proteins (GST-aa 3-147 and GST-aa 609-749) show a marked interaction with all four core histones, providing further support for the observed INHAT activity of the N- and C-terminal GRIM1 domains.

Potential mm/hsGRIM1 interactants can be identified by conventional methods. These methods include yeast two-hybrid screen with various cDNA libraries and direct protein biochemical methods such as Co-IP of GRIM1 and associated proteins, fractionation by 2-dimensional gel electrophoresis, mass spectrometric analysis and microspray sequencing of the potentially interacting proteins from various cell culture cell lines (C2C12 differentiated, C2C12 undifferentiated, 3T3L1 differentiated, 3T3L1 undifferentiated, BHK and many more).

EXAMPLE 12

Physiological Function of GRIML: Analysis of Repression Potential of hsGRIM1 in Transient Transfections

All the described data were obtained with the hsGRIM1 clone. GRIM1 is a potent transcriptional repressor when used as Gal4-DBD fusion protein in transient transfections. Gal-GRIM1 represses expression of reporter genes both of Gal4-RE-controlled complex and synthetic minimal reporter constructs. The repression potential of GRIM1 is distinctly greater for example compared with the corepressor Gal-SuN-CoR. In these experiments, the appropriate corepressors are transiently expressed as heterologous Ga14-DBD fusion proteins in cells. The repression capacity on various synthetic promoter-reporter constructs compared with equal quantities of transfected wild-type Gal4-DBD is determined by luciferase reporter gene expression.

Table 9: Gal-GRIM1 is a stronger repressor than Gal-SuN-COR. 293 cells were cotransfected with G5ElbTATA-LUC reporter and the stated amounts of corepressors. The same effect can be observed on testing complex promoters (Gal4 -tk-LUC).

Gal-GRIM1 is equally strong as a repressor as a large number of described corepressors such as, for example, Gal-HDAC1-10, Gal-CBF1, Gal-Alien and represses only insignificantly weaker than Gal-N-CoR-RD or Gal-SMRT-RD. The repression potential of Gal-GRIM1 was investigated in conjunction with the complex Gal4-tk-LUC and Gal-MMTV-LUC promoter/reporter constructs and in conjunction with the minimal promoter/reporter constructs Gal-E1b-TATA-box and Gal-βglobin-TATA-LUC. In addition, the repression capacity of Gal-GRIM1 was investigated on an autonomous VP16 transactivation domain bound to DNA by means of LexA-DBD, via a LexA-Gal-LUC reporter (provided by Dr S. Khochbhin). The data obtained on Gal-GRIM1 has been tested experimentally in the following cell lines: A7r5, C2C12, CV1, BHK, 293, N2a, COS-7. The following figure shows representative results for BHK and C2C12 cells.

The Gal-GRIM1 repression is not impaired by addition of the specific histone deacetylase (HDAC) inhibitors trichostatin A (TSA, 300 nM) and of sodium butyrate (Na-But, 5 mM), suggesting that the mechanism of repression is fundamentally different from that described for other corepressors. Comparable cases have been described for other repressors, although no explanation of the method is described. In addition, the described factors show no involvement in skeletal muscle differentiation or adipogenesis. Data on the independence of HDACs in transient transfections are depicted in the following figure for the example of BHK cells. The transcriptional activity of Gal-GRIM1 is uninfluenced by TSA in any cell line already tested.

To determine the GRIM1 domains involved in repression, a total of 11 deletion mutants of GRIM1 were constructed and all were tested in the Gal4-DBD context for their repression potential in all the reporter systems already described. All the GRIM1 domains used show transcriptional repression in the range from 2× (Gal-E and Gal-I) to 15-20× (full-length Gal-GRIM1). All the tested deletion mutants proved to be insensitive to HDAC inhibitors.

In summary, it was possible to show that GRIM1 has at least 5 independent repression domains, with the 3 main repression domains being located in the hydrophobic core region of the protein (mutQ, mutR, mutp). However, every analyzed deletion mutant shows a repression capacity which is significantly above the background in the Gal4-DBD context.

TABLE 12
Summarizing list of all hsGRIM1 deletion
mutants used as Ga14-DBD fusion in transient
transfections to investigate their repression
potential.
C-terminal N-terminal Intermediate
deletion mutants deletion mutants deletion mutants
aa aa aa
mut A 3-609 mut F 145-749 mut J 145-609
mut B 3-487 mut G 246-749 mut N 246-609
mut C 3-423 mut H 485-749 mut O 246-485
mut D 3-245 mut I 609-749 mut P 485-609
mut E 3-147 mut Q 246-423
mut R 423-485
mut S 145-245

The GRIM1 subdomains “E” and “I” described in the section “INHAT activity” show the smallest repressive effect as Gal4-DBD fusions in the transcriptional assays, but are involved in preventing histone acetylation by p300. No further information on the Q, P and R domains is available, and it was not possible to prove a direct involvement in the recruitment of additional corepressors by the interaction studies cited above. At the moment there is only speculation about the mechanism of repression used by GRIM1, although involvement of HDACs can be ruled out, and it appears that at least two different mechanisms are used (E and I in contrast to Q, R and P).

Results with the LexAGal system confirm these results but show a different relative repression of the individual fragments investigated (data not shown).

Full-length GRIM1 is able to repress both complex naturally occurring and synthetic minimal promoters. The following systems have been tested in transient transfections: GRIM1 and complex promoters (p21 (-4542)LUC, SKA-LUC, calponin-LUC, myogenin-LUC, myogenin proximal promoter-LUC, thymidine kinase-LUC, probasin-LUC, MMTV-LUC and many more).

Cotransfections of GRIM1 and E1b-TATA-box-containing minimal promoters with synthetic TF binding sites (AR, Gal4 and SEF binding sites) or with the complex MMTV promoter leads to repression of basal transcriptional activity (all transfections shown were carried out in BHK cells).

Repression of GRIM1 with minimal promoters without synthetic TF binding sites cannot be demonstrated more accurately owing to the low basal value of the constructs used.

The repression potential of GRIM1 on promoter-luciferase-reporter luciferase-reporter constructs which have been stably integrated into the genome of the particular cell line (HRL+N with RARE-LUC, NIH3T3 with cycA-LUC, 293 with NFkB-RE-LUC) is summarized in the next figure. Transfection of the cells with GRIM1 shows no effect on reporter gene transcription in the induced and in the basal state.

In addition, direct effects of GRIM1 on various transcription factors were investigated in transient transfections (compare also Example 11). Besides the AR, in particular mmGCNF, mmERR1 and mmRVR were analyzed experimentally as full-length proteins with the corresponding reporter constructs for a functional interaction with GRIM1. No significant effect was observable in any of the transfections.

Interactions of GRIM1 with further transcription factors or cofactors was investigated in the Gal4-DBD-based context, with the respective Gal4-DBD-fused factor being cotransfected in constant amount with an increasing amount of wild-type GRIM1. Factors investigated in this system are: Gal4-p300, Gal4-DBD, Gal-Sp1-4, Gal4-CBF). Once again, no significant effect was observed in any of the transfections.

EXAMPLE 13

Mechanism of GRIM1 Repression

a) HDAC Activity

The mechanism of repression by recruitment of histone deacetylases (HDACs), which is the most widespread to date, appears not to be involved with GRIM1. The repression potential of Gal4-DBD-GRIM1 in transient transfections is not impaired by application of specific HDAC inhibitors in a concentration of up to 5-fold above the KD (final concentration of trichostatin A 300 nM, of sodium butyrate 5 mM). Immunoaffinity-purified and high-stringency-washed GRIM1 shows no endogenous HDAC activity. Nor do associated complexes which have been coimmunoprecipitated with GRIM1 by mild washing conditions show any HDAC activity. In addition, direct involvement in HDAC/N-CoR/SMRT complexes have been ruled out by Co-IP studies.

b) INHAT Activity

A further possibility for transcriptional repression consists of direct masking of the histone N termini to prevent acetylation and thus loss of cohesion of the chromatin in the affected region. It was found by database analysis that the N terminus (aa 25-135) and the absolute C terminus (aa 638-749) of hsGRIM1 has acidic domains which display homology with a described INHAT domain of the Set protein. INHAT is an acronym for protein domains/proteins able to bind lysines and thus prevent histone acetylation.

It was possible to show in GST pulldown analyses that the N- and C-terminal fragments of hsGRIM1 can associate directly with histones in vitro. In addition, it can be shown in in vitro acetylation assays that recombinantly expressed GRIM1 aa 3-147 and aa 609-749 efficiently blocks acetylation of all four core histones (H3, H2A, H2B and H4) by p300. It was possible thereby to show that a possible mechanism of the GRIM1-mediated repression might be ensured by histone masking.

There are differences in the efficiency of inhibition of acetylation of individual histones by GRIM1. As yet, only blockage of acetylation of H2A and H2B have been unambiguously demonstrable.

c) Further Mechanisms of Repression

Lysin Methylation of Histones

Methylation of specific lysines in the free histone N termini (H3K9, H3K4) ensure compaction of the chromatin structure by preventing acetylation of the lysines which are important for regulation and thus preventing a loss of cohesion of the chromatin. In addition, methylated lysines represent a high-affinity binding site for the HP1 protein (heterochromatic protein 1). HP1 may subsequently recruit DNA methylases, MeCPs and also HDACs and lead to a targeted formation of transient or constitutive heterochromatin and thus repress transcriptional processes. Examples of HMTases described to date are Suv39h1, Suv39h2 and PRMT1.

Homology analyses show that no conserved SET domain responsible for histone methyltransferase (HMTase) activity is present in the GRIM1 sequence. It is therefore assumed that GRIM1 has no endogenous HMTase activity.

Recruitment of Chromatin-Reorganizing Complexes

A further possibility for specific repression would be targeted recruitment of chromatin-reorganizing complexes (e.g. BRG, SWI/SNF, CHRAC, ARC, RSC etc.). Promoter regions of the genes to be repressed can be wrapped up in compact chromatin by active chromatin reorganization in such a way that transcriptional initiation is distinctly impeded.

It is not possible to rule out a functional interaction of GRIM1 with one of the components of one of the remodeling complexes.

Blocking PIC Formation/Impeding th Initiation Reaction/Impeding Elongation

A further form of repression is impeding or preventing the formation of the preinitiation complex (PIC) at the start of transcription. Successful initiation is possible only if the TATA box-binding portion of TFIID can recruit the polymerase holocomplex at the starting point of transcription and if all the basal transcription factors involved are available in sufficient quantity. A further prerequisite for successful transcription is the need for the C terminus of RNAPII to be phosphorylated so that leaving of the initiation site is possible.

It is possible in an experiment familiar to the skilled worker to find whether GRIM1 directly interacts with one of the basal transcription factors or elongation factors and thus blocks efficient transcription (yeast two-hybrid system, pulldown analyses). No phosphatase domain can be found within the GRIM1 structure by homology analyses, and it is yet to be proven experimentally that GRIM1 is able to dephosphorylate RNAPII.

Titration out of Coactivators by Binding to GRIM1

The potential of GRIM1 to inactivate basal or general coactivators by binding and thus to repress the initiation or elongation process is currently under investigation by searching for potential hsGRIM1 interactants.

A total of at least 5 independent repressor domains (RDs) have been found within the GRIM1 protein in transient transfections. The fragments E and I of GRIM1 showed the smallest repression potential in transient transfections, but their function in repression by GRIM1 was demonstrated in the INHAT analyses.

However, the deletion mutants P, Q, R and also S show a far stronger repression function in Gal-based transfections, suggesting further mechanisms beyond the known facts. It is possible to find the contribution to repression made by the other regions of GRIM1 by conventional experiments. These were intended to identify interacting GRIM1 partner proteins in order to find whether there is an association with non-HDAC components of transcriptional corepressor complexes.

EXAMPLE 14

Analysis of Functional Motifs in hsGRIM1

Functional motifs within the hsGRIM1 structure were found by database homology analyses. A summary of the motifs found, their localization within the complete protein and the experimental strategy used is shown in the following table.

TABLE 19
Summary of the functional motifs in hsGRIM1.
Name Sequence aa position Detection
LxxLL IRDLI 212-216 Significance not yet confirmed
LQNLL 219-223 experimentally
LAFLV 312-316
LTELL 362-366
IIGCI 339-443
LFIL 476-480
ILRPL 686-690
NES LRVLALVL 309-317 Detected by GFP relocation
experiments and directed
point mutagenesis
NLS KRRKMADRKDEDRKQEK 649-666 Detected by directed point
mutagenesis and GFP-GRIMI
localization
CoRNR Box PLAQVIIGCIKLIP 435-446 Not yet confirmed experimentally.
Has no influence on AR-dependent
interactions
HMG Box poly E/poly D 25-51 INHAT activity of the investigated
like  68-134 fragments. Direct DNA and/or
658-683 histone binding not yet confirmed
697-749 experimentally.

LxxLL: interaction motif by which coactivators interact with NHRs.

NES: nuclear export signal.

NLS: nuclear localization signal.

CoRNR box: interation motif by which corepressors interact with NHRs.

HMG box: contact of HMG proteins to DNA and to histones.

Detection of the NES within hsGRIM1 For direct analysis of the motif, all four relevant lysines were inactivated by directed point mutagenesis so that the α-helical structure of the NES was destroyed. The inactivating mutations are depicted in the following figure. A directed inactivation of the two 3′-located lysines on its own proved to be insufficient to destroy the functionality of the NES.

TABLE 20
Directed mutagenesis to inactivate the four lysines involved in the NES.

To demonstrate the functionality of the export signal, hsGRIM1 protein fragments were fused to GFP (green fluorescent protein) (depicted in the following figure) and expressed in cells by transient transfection. The localization of the respective fragments was detected by fluorescence microscopy.

TABLE 21
GFP fusion proteins used to demonstrate the
functionality of the nuclear export signal (NES). ΔNES
characterizes the point mutations described above.
GFP*hsGRIM1
GFP* hsGRIM1ΔNES
GFP*hsGRIM1 Λ aa 246-334
GFP*hsGRIM1 aa 246-334

Only GFP showed a pan-cellular localization. Full-length GFP-hsGRIM1 was located exclusively in the nucleus through the dominance of the NLS, as were the NES deletion mutant and the fragment from which a region flanking the NES had been deleted (hsGRIM1 Δaa246-334). On fusion of the hsGRIM1 fragment which contains the NES to GFP (hsGRIM1 aa246-334), the resulting protein was located exclusively in the cytoplasm. On coupling of the point-mutated fragment of aa 246-334 to GFP, the pan-cellular localization was restored so that it was possible to demonstrate the functionality of the motif.

Detection of the NLS within hsGRIM1

To analyze the motif, besides the deletion mutants detailed hereinafter, all seven relevant basic residues were inactivated by directed point mutagenesis. Inactivation of the 3′-located 3 basic residues alone proved to be insufficient to inactivate the NLS.

TABLE 22
Directed mutagenesis for inactivation of the seven basic residues involved in the NLS.

To demonstrate the functionality of the import signal, hsGRIM1 protein fragments were fused to GFP (depicted in the following figure) and expressed in cells by transient transfection. The localization of the respective fragments was detected by fluorescence microscopy.

TABLE 23
GFP fusion proteins used to demonstrate the
functionality of the nuclear localization signal (NLS).
GFP*hsGRIM1
GFP* hsGRIM1 ΔNLS
GFP*hsGRIM1 aa 1-609
GFP*hsGRIM1 aa 609-749 and ΔNLSII

Only GFP showed a pan-cellular localization. Full-length GFP-hsGRIM1 was located exclusively in the nucleus. On deletion of the last 140 amino acids (hsGRIM1 aa1-609), the GFP fusion protein showed both a cytoplasmic and a weak nuclear localization, while the corresponding counterpart fused to GFP (GFP-hsGRIM1 aa609-749) shows an exclusively nuclear localization. The full-length hsGRIM1 with the seven-fold point mutation within the NLS showed the same distribution pattern as the hsGRIM1 aa1-609 deletion mutant and confirmed the functionality of the NLS. On coupling of the point-mutated fragment of aa609-749 to GFP, the fusion protein was likewise located in the cytoplasm.

Detection of the CoRNR Box within hsGRIM1

To analyze the CoRNR box, all three highly conserved and necessary isoleucines in the hydrophobic core of the helix were replaced by alanines or by a serine: I436A, I437S, I444A. Further functional characterization of the point mutations made have revealed to date only that the repression potential of hsGRIM1 is not impaired, and that the interaction with the AR is not impaired by destroying the CoRNR box.

Intracellular Relocalization of mmGRIM1 in Cell Culture-Based Differentiation Models

GRIM1 shows a change in its subcellular localization during specific differentiation processes. In cell culture systems, GRIM1 is transported from the nucleus into the surrounding cytoplasm during skeletal muscle differentiation of mouse C2C12 cells. The timeframe for the observed translocation of GRIM1 is in the range for the expression of the myogenic bHLH transcription factor myogenin (My14) and of the structural protein skeletal muscle myosin heavy chain (MHC), i.e. at a more advanced time during muscle differentiation than previously described factors such as HDAC4, HDAC5 and HDAC7. C2C12 cells differentiate under low-serum conditions within 6-8 days from proliferating myoblasts to fused, multinuclear myotubes. During this, the cells undergo a G0 arrest, the CDK inhibitor p21 is upregulated, and an ordered cascade of myogenic transcription factors such as Myf5, MyoD and myogenin provide the transcriptional precondition for myogenesis. In differentiating C2C12 skeletal muscle cells, GRIM1 leaves the nuclei of fused myotubes after about 6 to 8 days, whereas GRIM1 is always located in the nucleus in mononuclear myoblasts. Expression of the structural protein of muscle MHC takes place at the time when the first GRIM1-free nuclei are to be observed, and was used in IIFs as temporal marker for GRIM relocalization.

The data determined for C2C12 also apply to other cellular skeletal muscle differentiation systems. The same effect was also detectable in rat L6 skeletal muscle cells. The cells have different differentiation kinetics and do not fuse until day 10-12 in differentiation medium (DM). GRIM1 also relocalizes in L6 cells, and GRIM1-free nuclei are detectable only from day 16 onwards in DM. In a further differentiation system, mouse 10T1/2 fibroblasts were stably transfected with an estrogen-inducible MyoD expression cassette (cells kindly made available by Dr. D. Bergstrom). Addition of 1 μM estradiol enables skeletal muscle differentiation via MyoD expression. After only about 3-4 days in DM, many cells can be detected as multinuclear myotubes.

During skeletal muscle differentiation, the GRIM1 protein is not degraded and/or broken down but is present to the full extent also in the cytoplasm. GRIM1 immunoreactivity can be detected unchanged in Western blot analyses with whole cell extracts of C2C12 cell extracts which have been differentiated to myotubes in DM for 8 days (on day 8 after addition of DM, ≧60% of all the cells present were myotubes). The results can also be further confirmed by cell fractionations. In addition, RT-PCR analyses have confirmed that the amount of mmGRIM1-mRNA is not changed during C2C12 differentiation.

As a further check, it was investigated whether GRIM1 also experiences subcellular relocalization during smooth muscle differentiation. For this purpose, mouse smooth muscle cells were obtained ex vivo and dedifferentiated by growth factor addition. Cells were additionally differentiated again further to smooth muscle cells via differentiation medium in vitro. The results show that GRIM1 does not leave the nucleus during smooth muscle differentiation. In addition, a cell culture smooth muscle differentiation system (Monc-1 cells) was used in order to obtain in vitro data about possible GRIM1 relocalization. As already shown for the ex vivo cells, no GRIM1 relocalization in smooth muscle cells was observable during the investigated differentiation times.

A further in vitro differentiation model used for GRIM1 relocalization analyses is differentiation of 3T3-L1 preadipocytes to mature fat cells. In the total of three differentiation protocols carried out, GRIM1 twice showed a detectable relocalization from the core into the cytoplasm, while in one case no change in the localization of the GRIM1 immunoreactivity was detectable. Western blot analyses have shown that no decrease in GRIM1 immunoreactivity in whole-cell extracts was detectable in any of the three protocols.

EXAMPLE 15

Regulation of GRIM1 Function

Complete experimental results are not yet available on the regulation of GRIM1 function and on signal pathways which might be involved in the subcellular relocalization of GRIM1. No signal pathway modulating the transcriptional activity of GRIM1 has yet been unambiguously identifiable. Nor is there any experimental evidence of involvement of a signal cascade intervening in the GRIM1 relocalization process. The data available on this topic can be briefly summarized below.

Transcriptional Activity:

In the direct vicinity of the NES within the GRIM1 sequence there is a consensus PKC phosphorylation site (serine 308). The transcriptional activity of Gal-GRIM1 was investigated in transient transfections in various cell lines. Neither the treatment of the cells with the specific PKC inhibitor Gö6850 (Parke-Davis, formerly Gödecke AG) nor a stimulation with the PKC-activating agent TPA brought about a change in the transcriptional activity.

The sole experimental evidence for modification of GRIM1 is the detection of direct acetylation of GRIM1 (aa3-147 and of full-length GRIM1) by the HAT domain of p300.

Cotransfection of full-length p300 and Gal-GRIM1 shows no change in the repression pattern, and addition of trichostatin A (TSA) enhances general transcription but relative repression by Gal-GRIM1 remains unchanged.

Cotransfection of Gal-GRIM1 in combination with a constitutively active version of Rho GTPase (RhoAV14) likewise shows no change in the activity.

Relocalization:

Nuclear export of GFP-GRIM1 or of the mutant GFP-GRIM1 aa234-336 is not influenced by treatment of the cells with the bacterial toxin leptomycin B (LMB, 20 nM for 6 h before cell harvesting and analysis by IIF). LMB is a specific inhibitor of the export factor exportin1/Crm1, so that it can be concluded from the experiment that there must be an exportin-independent transport mechanism.

14-3-3 proteins are responsible for active removal of the HDACs 4, 5 and 7 from the nucleus and retention in the cytoplasm during muscle differentiation. It was possible by Co-IP studies to rule out an interaction between GRIM1 and 14-3-3 proteins (family members zeta, beta, tau).

Treatment of differentiating C2C12 skeletal muscle cells with various inhibitors of central signal transduction pathways have no effect on relocalization or the number of nuclear speckles of GRIM1 within the investigated differentiation from day 0 to day 6 after addition of the differentiation medium. Tested inhibitors: pan-HDAC inhibitors TSA and sodium butyrate, protein kinase inhibitors Gö6850 (specific PKC inhibitor, 1 μM), LY294002 (specific P13kinase inhibitor, 10 μM), Ro3l-8220 (PKC broad-spectrum inhibitor, 0.5 μM), PD98059 (MEK1 inhibitor, 10 μM), fasudil (Rock kinase inhibitor, 10 μM), SB203580 (p38α/β inhibitor). Overacetylation and blockade of central signal cascades had drastic morphologically visible consequences for some of the cells, but there was no effect on relocalization or the number of detectable GRIM1 speckles.

EXAMPLE 16

Interaction of hsGRIM1 and the Androgen Receptor (AR) and Functional Consequences Resulting therefrom

It was possible to demonstrate in a yeast two-hybrid interaction assay that GRIM1 interacts with the nuclear hormone receptor androgen receptor (AR). The GRIM1 interaction domain in the yeast-based assay is located in the C terminus between aa 606 to 749. Further functional characterization of the interaction domains within GRIM1 was carried out by pulldown analyses with the expressible fragments of GRIM1. The interaction of GRIM1 with the AR is independent of the type of ligand used (agonists, antagonists or no ligands). The available data are summarized in the following picture:

TABLE 24
The GRIM1 AR interaction domain
is located between aa460-609.

Regions of the protein depicted in white have not yet been expressed recombinantly.

The C terminus of GRIM1 shows, in contrast to the data obtained in yeast, no in vitro interaction with the AR, but the fragment from aa 460 to aa 609 shows a strong interaction independent of the ligand used.

The interaction between the AR and GRIM1 was likewise detectable in in vivo interaction assays. In co-immunoprecipitations, the interaction between GRIM1 and the AR was likewise ligand-independent and could not be significantly blocked even in washing buffer with 400 mM NaCl. It was possible to show the interaction with IP studies using antibodies both against the AR and against GRIM1.

The AR is a member of the superfamily of ligand-activatable nuclear hormone receptors. After binding of the natural AR ligand 5α-dihydrotestosterone, the AR is transported from the cytoplasm into the nucleus and brings about transcriptional activation of its target genes. Besides the activating ligands, each receptor has specific antagonists which likewise bring about translocation into the nucleus, but bring about a repressive conformation of the receptor ligand binding domain. Antagonist-bound receptor is able to recruit corepressor complexes and actively repress transcription. However, in some cell lines or in certain pathological situations, antagonists may become partial agonists and unnaturally bring about a transactivation by the receptor. It is known in the case of the AR that substances employed therapeutically for prostate carcinomas, such as cyproterone acetate, Casodex or hydroxyflutamide, may have partial agonistic effects in hormone-refractory tumors.

It was possible to show in the cell culture system that GRIM1 is able specifically to repress an AR transactivation brought about by CPA, Casodex or OH-flutamide. Non-liganded or DHT-loaded AR is not transcriptionally affected by GRIM1. The observed effect varies in the range between 2-3-fold repression of the CPA-induced AR transactivation.

TABLE 25
GRIM1 selectively represses antagonist-
activated AR.

Transient transfections were carried out in BHK cells in which the antagonists used act as partial agonists. A minimal promoter with synthetic AR binding sites was used as reporter (ARE2x-(tk)TATA-LUC). The same effect was obtained on use of 1 μM Casodex or OH-flutamide instead of 1 μM CPA.

A further indication of the functionality of the effect is that the superactivation of the CPA-loaded AR by the coactivator TIF2 in BHK cells can be repressed or at least markedly restricted by cotransfection of GRIM1.

TABLE 26
GRIM1 represses CPA-loaded and TIF2
superactivated androgen receptor.

Transient transfections were carried out in BHK cells in which CPA (1 μM) acts as partial agonist. ARE2x-(tk)TATA-LUC was used as reporter.

Claims

1. A polypeptide comprising at least 20 consecutive amino acids from the sequence of hsGRIM1 having the sequence ID No. 3.

2. The polypeptide as claimed in claim 1, comprising at least 40 consecutive amino acids.

3. The polypeptide as claimed in claim 1, comprising at least 80 consecutive amino acids.

4. The polypeptide as claimed in claim 1, comprising at least 120 consecutive amino acids.

5. The polypeptide as claimed in claim 1, comprising at least 200 consecutive amino acids.

6. A polypeptide comprising at least 20 consecutive amino acids from the mmGRIM sequence having the sequence ID No. 4.

7. The polypeptide comprising at least 40 consecutive amino acids.

8. The polypeptide as claimed in claim 6, comprising at least 120 consecutive amino acids.

9. The polypeptide as claimed in claim 6, comprising at least 200 consecutive amino acids.

10. An antibody that binds specifically to an epitope of a polypeptide as claimed in any of claims 1 to 9.

11. A medicament comprising a polypeptide as claimed in any of claims 1 to 9, and a pharmaceutically acceptable excipient.

12. The medicament as claimed in claim 11, that is employed for the treatment of disturbances of skeletal muscle differentiation.

13. The medicament as claimed in claim 11, characterized that is employed for the treatment of disturbances of fat cell differentiation.

14. A method for identifying substances which influence the biological function of a polypeptide as claimed in any of claims 1 to 9, comprising contacting the substance to be identified with said polypeptide in a test system.

15. A cDNA which codes for hsGRIM1, comprising at least 1200 consecutive nucleotides from the sequence ID No.1.

16. A cDNA which codes for mmGRIM, comprising at least 1200 consecutive nucleotides from the sequence ID No.2.

17. A transfection vector comprising a cDNA as claimed in claim 15 or 16.

18. The transfection vector as claimed in claim 17, which is an adenoviral vector.

19. A cell transfected with a vector as claimed in claim 17.

20. The cell of claim 19, wherein said vector is an adenovector.

21. A method of treating a disturbance of skeletal muscle differentiation comprising administering to a subject in need thereof an effective amount of the medicament of claim 12.

22. A method of treating disturbances of fat cell differentiation comprising administering to a subject in need thereof an effective amount of the medicament of claim 13.

Resources

Images & Drawings included:

Sources:

Similar patent applications:

Recent applications in this class:

Recent applications for this Assignee: