US20070269811A1
2007-11-22
11/499,505
2006-08-04
The present invention provides a superoxide dismutase gene from Potentilla atrosanguinea, a construct containing the gene coding for superoxide dismutase and transformed E.coli producing the SOD protein.
Get notified when new applications in this technology area are published.
C12N9/0089 » CPC main
Enzymes; Proenzymes; Compositions thereof ; Processes for preparing, activating, inhibiting, separating or purifying enzymes; Oxidoreductases (1.) acting on superoxide as acceptor (1.15)
C12Q1/68 IPC
Measuring or testing processes involving enzymes, nucleic acids or microorganisms ; Compositions therefor; Processes of preparing such compositions involving nucleic acids
C07H21/04 IPC
Compounds containing two or more mononucleotide units having separate phosphate or polyphosphate groups linked by saccharide radicals of nucleoside groups, e.g. nucleic acids with deoxyribosyl as saccharide radical
C07K14/415 IPC
Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from plants
C12N15/00 IPC
Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
The present invention relates to a Superoxide dismutase (SOD). Superoxide dismutase (SOD) cDNA of SEQ ID No. 2 obtained from Potentilla atrosanguinea containing coding gene sequence of SEQ ID No. 3 which codes for a polypeptide of SEQ ID No. 1 having Superoxide dismutase enzyme activity.
Further, it also relates to a set of primers useful for the amplification of Superoxide dismutase (SOD) gene coding cDNA of SEQ ID No. 3, wherein
| Forward primer | 5′-ATGGCAAAGGGCGTTGCTGTACTT-3′ | |
| and; | ||
| Reverse primer | 5′-TCATCCTTGAAGGCCAATAATACCA-3′ |
More particularly, it relates to a method of identifying and cloning of Superoxide dismutase (SOD) gene of SEQ ID NO 3, which on expression gives a Superoxide dismutase enzyme (EC 1.15.1.1) with the characteristics disclose in U.S. Pat. No. 6,485,950.
BACKGROUND AND PRIOR ART REFERENCES TO THE INVENTION SOD is a ubiquitous enzyme present in plants, animals and microbes, which protects them against oxidative damage caused by superoxide radical (hereinafter, referred to O2−). The enzyme dismutates superoxide radical into hydrogen peroxide and oxygen as per the following redox reaction:
2O2−.+2H+═H2O2+O2
Thus, SOD has implications in all those reactions, wherein O2−. is produced in the amount leading to cellular injury. According to the U.S. Pat. No. 6,485,950, we have extracted an autoclavable superoxide dismutase from Potentilla that could be autoclaved and shows activity at sub-zero temperature. Due to prevalence of Potentilla at difficult to access location of high altitude, and industrial implications of SOD as mentioned in our U.S. Pat. No. 6,485,950, it was essential to develop a system for the production of SOD of Potentilla in E.coli so as to obtain the SOD when desired.
Below is given state of the art knowledge in relation to isolation of SOD genes from various sources and their expression in E.coli, to produce SOD in recoverable quantities.
Reference may be made to document (1) by Wang, Z., He, Z., Shen, Q., Gu, Y., Li, S. and Yuan, Q. (J. of Chromatography B, 2005. 826: 114-121) wherein Cu/Zn SOD gene from Cordyceps militaris was overexpressed in E. coli.
Yet another reference may be made to document (2) by Liu, W., Zhu, R. H., Li, G. P., and Wang, D. C. (Protein Expr. Purif. 2002. 25: 379-388) wherein production of high yield of recombinant duck Cu/Zn SOD was achieved in E. coli.
Reference may be made to yet another document (3) by Pan, S. M., Hwang, G. B., and Liu, H. C. (Bot. Bull. Acad. Sin. 1999. 40: 275-281) wherein over-expression and characterization of cytosolic Cu/Zn SOD from rice in E. coli was achieved.
Reference may be made to document (4) by Hartman, J. R., Geller, T., Yavin, Z., Bartfeld, D., Kanner, D., Aviv, H., and Gorecki, M. (Proc. Natl. Acad. Sci. USA. 1986. 83: 7142-7146) wherein high-level expression of enzymatically active human Cu/Zn SOD was reported in E. coli.
Reference may be made to document (5) by Ken, C. F., Lin, C. T., Shaw, J. F., and Wu, J. L. (Marine Biotech. 2003. 5: 167-173) wherein the Cu/Zn SOD from zebrafish was over-expressed in E. coli and the active enzyme was purified.
Reference may be made to document (6) by Kim, T. S., Jung, Y., Na, B. K., Kim, K. S., and Chung, P. R. (Infect. Immun. 2000. 68: 3941-3948) wherein the Cu/Zn SOD gene from Fasciola hepatica was cloned and expressed in E. coli.
The drawbacks are:
4. There is no SOD gene that is made to express in E.coli leading to SOD protein that is shown to function at sub-zero temperature.
| Comparative data of present SOD with other known SOD |
| Present invention | Prior art |
| The maximum thermostability of | The maximum thermostability of SOD is |
| SOD described so far is at 80° C. | 37° C. to 50° C. |
| reference from Bueno P., Verla, J., | |
| Gallego, G. G., and Rio del A. L. (Plant | |
| Physiol. 1995. 108: 1151-1160) wherein | |
| the thermostability of Cu/Zn SOD | |
| isolated from the cotyledon of water | |
| melon has been shown, SOD activity | |
| reduced: | |
| (a) by 40% after 4 hour of incubation at | |
| 50.° C.; | |
| (b) by 50% after 15 minute of incubation | |
| at70° C.; | |
| (c) by 80% after 60 minute of incubation | |
| at 80° C.; | |
| and | |
| (d) by 100% after 15 minute of | |
| incubation at 100° C. | |
| Reference may be made to Document by | |
| Miyata, K., Maejima, K., and Tomoda, | |
| K. (U.S. Pat. No. 4,563,349; Jan. | |
| 7, 1986) wherein SOD has been reported | |
| from a microorganism belonging to | |
| genus Serratia having the thermostability | |
| characters as follows: (a) Stable at 37° C. | |
| for 60 minutes; Inactivated by 50% when | |
| incubated at 50-60° C. for60 minutes; | |
| and Inactivated by 100% when incubated | |
| at 80° C. for 5 minutes. | |
| stability without adding an external | External stabilizer is required to enhance |
| stabilizer [the addition of hydrogen | the stability of the product contains this |
| peroxide trapping agent, polyols, and | enzyme. |
| sugars etc. are required to stabilise the | Reported SODs do not retain their |
| enzyme from other sources such as | activity at ambient temperature unless |
| germinated plant seeds | stabilized by the addition of polyols, |
| sugars or any other stabilizing agent | |
| (Bresson-Rival; Delphine; Boivin; | |
| Patrick; Linden; Guy; Perrier; Erric; | |
| Humbert; Gerard; 1999; U. S. Pat. No. | |
| Wide range of temperature | Temperature range for SOD activity has |
| functionality from sub-zero to above | been reported between 5 to 45. degree. C. |
| 50.degree. C. temperature which | Hakam, N. and Simon, J. P. 1996. |
| would immensely enhance the utility | Physiol. Plant. 97: 209-216). However, |
| of the enzyme and its products and be | thermostability and lower temperature |
| safer for use for humans. | for catalyzing dismutation of |
| O.sub.2.sup.−. are not reported for the | |
| same enzyme. | |
| Present enzyme is autoclavable. | There is no report for autoclavable SOD. |
| When SOD is to be injected in the | |
| body, a sterile composition would be | |
| needed and for that an autoclavable | |
| SOD would be an ideal one. | |
| Moreover, in reperfusion applications | |
| and storage of organs at low | |
| temperature, an autoclavable SOD | |
| would be required which can function | |
| efficiently at low temperature as well. | |
| Apart from the use of autoclaved | |
| SOD in Pharmaceuticals and medical | |
| fields, sterile SOD will also be a | |
| choice in the cosmetic and food | |
| industry. | |
The main object of the invention is to provide a superoxide dismutase (SOD) Superoxide dismutase (SOD) cDNA of SEQ ID No. 2 obtained from Potentilla atrosanguinea containing coding gene sequence of SEQ ID No. 3 which codes for a polypeptide of SEQ ID No. 1 having Superoxide dismutase enzyme activity
Another object of the present invention is to provide a set of primers useful for the amplification of Superoxide dismutase (SOD) gene coding cDNA of SEQ ID No. 3, wherein
| Forward primer | 5′-ATGGCAAAGGGCGTTGCTGTACTT-3′ | |
| and; | ||
| Reverse primer | 5′-TCATCCTTGAAGGCCAATAATACCA-3′ |
Further, another object of the present invention is to provide a method of identifying and cloning of superoxide dismutase (SOD) gene of SEQ ID NO 3, which on expression gives a superoxide dismutase enzyme (EC 1.15.1.1) with the characteristics disclose in U.S. Pat. No. 6,485,950.
Yet another object of the present invention is to provide a gene responsible for autoclavable superoxide dismutase from Potentilla.
Still another object of the present invention is to provide a gene responsible for autoclavable superoxide dismutase from Potentilla that is also functional at sub-zero temperature.
Still another object of the present invention is to provide a recombinant gene of SOD, which shows activity upon autoclaving and also shows activity at low temperature, in a plasmid vector leading to a new vector which carries the nucleotide sequence synthesizing the said SOD.
Still another object of the present invention is to transform bacterial host E. coli with the above said recombinant plasmid vector for expression of the SOD gene in the bacterial host.
BRIEF DESCRIPTION OF FIGURESFIG. 1 represents effect of assay temperature on SOD activity. Potentilla SOD expressing in E. coli was purified and assayed before and after autoclaving at different temperatures.
FIG. 2 represents comparison of the nucleotide sequence of the Potentilla Cu/Zn SOD with sequences from other plant species. Regions of complete homology are indicated with asterisks.
FIG. 3 represents comparison of the deduced amino acid sequence of the Potentilla Cu/Zn SOD with sequences from other plant species. Regions of complete homology are indicated with asterisks.
FIG. 4(A) represents expression and purification of Potentilla SOD in E. coli. C, Control; I, Protein induced by IPTG; P, Purified SOD. The gel was stained by silver staining. (B). Activity staining of the gel to depict the activity of purified SOD. P, Purified SOD.
FIG. 5 represents the result of alignment of present sod gene with the sod gene of other plant species
FIG. 6 represents the details of Polypeptide sequence of SOD gene SEQ ID NO. 1.
FIG. 7 represents the details of full length cDNA SOD gene of SEQ ID No. 2
FIG. 8 represents the details of coding sequence of potentialla SOD gene of SEQ ID NO. 3
FIG. 9 represents the details of positive cDNA clone of SEQ ID No. 4
FIG. 10 represents primer Sequence SEQ ID No. 5(a) Forward Primer and Primer sequence SEQ ID No. 5(b): Reverse primer.
FIG. 10 represents Details of primers used for RACE
(a) Primer Sequence of SEQ ID No. 6(a) GSP1:Forward primer.
(b) Primer sequence of SEQ ID No. 6(b) NES1: Reverse Primer
(c) Primer Sequence of SEQ ID No. 6(c) GSP2: Forward Primer
(d) Primer sequence of SEQ ID No. 6(d) NES2: Reverse Primer
SUMMARY OF THE INVENTIONThe present invention provides superoxide dismutase gene from Potentilla atrosanguinea and its expression in heterologous system and comprises of a construct which carries the coding nucleotide sequence of SEQ ID 3 which is responsible fore synthesis of said SOD and transformed E.coli producing the SOD protein. This SOD protein is autoclavable and also functions at sub-zero temperature.
DETAILED DESCRIPTION OF THE INVENTIONAccordingly, the present invention provides a superoxide dismutase (SOD) cDNA of SEQ ID No. 2 obtained from Potentilla atrosanguinea, wherein the said cDNA comprises 856 nucleotide bases.
In an embodiment of the present invention, the said cDNA has entire coding sequence along with pre- and post-coding sequences.
The present invention also provides a superoxide dismutase (SOD) gene coding cDNA of SEQ ID No. 3, wherein the said coding cDNA comprises 459 nucleotide bases.
Further, it also provides a superoxide dismutase (SOD) polypeptide of SEQ ID No. 1, wherein the said polypeptide comprises 152 amino acids.
In an embodiment of the present invention, the said polypeptide is autoclavable.
In another embodiment of the present invention, the said polypeptide is functional at temperature range of <−10° C. to +80° C.
The present invention further provides a set of primers useful for the amplification of Superoxide dismutase (SOD) gene coding cDNA of SEQ ID No. 3, wherein
| Forward primer | 5′-ATGGCAAAGGGCGTTGCTGTACTT-3′ | |
| and; | ||
| Reverse primer | 5′-TCATCCTTGAAGGCCAATAATACCA-3′ |
f) amplifying the said DNA using the primers comprising:
| Forward Primer: | 5′-GTTGTAAAACGACGTGCCAGT-3′ | ||
| Reverse Primer: | 5′-CACAGGAAACAGCTATGACC-3′; |
g) amplifying the ends of cDNA obtained from step (e) through rapid amplification of cDNA ends technique (RACE) using two set of primers to get the full length desired Superoxide dismutase (SOD) DNA of SEQ ID NO. 2 wherein the said primers comprising:
| Forward Primer: | 5′-CCAGTGGATTTGCTAAGCTCATGTCCA-3′ | |
| Reverse Primer: | 5′-GTCATCAGGGTCTGCATGGACAACAAC-3′ | |
| Forward Primer: | 5′-ATGGTTGCATGTCAACTGGACCACATT-3′ | |
| Reverse Primer: | 5′-TTGCATGTCAACTGGACCACATTTCAA-3′ |
g) amplifying the ends of cDNA obtained from step (e) through rapid amplification of cDNA ends technique (RACE) using different set of primers to get the full length desired Superoxide dismutase (SOD) DNA of SEQ ID NO. 2 wherein the said primers comprising:
| Forward Primer (GSP1): | |
| 5′-CCAGTGGATTTGCTAAGCTCATGTCCA-3′ | |
| Reverse Primer (NES1): | |
| 5′-GTCATCAGGGTCTGCATGGACAACAAC-3′ | |
| Forward Primer (GSP2): | |
| 5′-ATGGTTGCATGTCAACTGGACCACATT-3′ | |
| Reverse Primer (NES2): | |
| 5′-TTGCATGTCAACTGGACCACATTTCAA-3′ | |
| SMART II A Oligonucleotide: | |
| 5′AAGCAGTGGTATCAACGCAGAGTACGCGGG-3′ | |
| 3′-RACE CDS Primer A (3′-CDS): | |
| 5′AAGCAGTGGTATCAACGCAGAGTAC(T)30N-1N-3′ | |
| 5′-RACE CDS Primer (5′-CDS) | |
| 5′-(T)25N-1N-3′ | |
| Universel Primer Mix A (UPM):Long: | |
| 5′TAATACGACTCACTATAGGGCAAGCAGTGGTATCAACGCAGAGT-3′ | |
| Universel Primer Mix A (UPM):Short: | |
| 5′-CTAATACGACTCACTATAGGGC-3′ | |
| Nested Universal Primer A (NUP): | |
| 5′-AAGCAGTGGTATCAACGCAGAGT-3′ |
h) amplifying the coding sequence of Superoxide dismutase (SOD) of SEQ ID No. 3 using a set of primers designed from start and stop codon of full length desired Superoxide dismutase (SOD) DNA of SEQ ID NO. 2 wherein the said primers have the following sequences:
| Forward Primer: | 5′-ATGGCAAAGGGCGTTGCTGTACTT-3′ | |
| Reverse Primer: | 5′-TCATCCTTGAAGGCCAATAATACCA-3′ |
In an embodiment of the present invention, the polyclonal antibodies were raised against the purified SOD and used for cDNA library screening synthesized from young leaf mRNA.
In another embodiment of the present invention, library was screened and positive cDNA clones were amplified by polymerase chain reaction (hereinafter called as PCR) and two PCR products were obtained. These were sequenced and approximately 85% of the gene encoding SOD was obtained.
Further, in another embodiment of the present invention, the sequences of the said cDNA clones does not have the start and end codon and smaller by 21%.
In yet another embodiment of the present invention, primers were designed based on the sequences of positive cDNA clones and the rapid amplification of cDNA ends technique (hereinafter called as RACE) was employed to amplify the SOD full length gene.
In still another embodiment of the present invention, the said SOD gene is sequenced and analyzed comprising the sequences set forth in SEQ ID No. 2.
In still another embodiment of the present invention, the said full length SOD gene contains 856 nucleotide bases.
In still another embodiment of the present invention, the said full length SOD gene has entire coding sequence along with pre- and post-coding sequences.
In still another embodiment of the present invention, a set of primers are designed based on the full length SOD gene to amplify the superoxide dismutase (SOD) gene coding cDNA of SEQ ID No. 3.
In still another embodiment of the present invention, the said coding cDNA comprises 459 nucleotide bases.
In still another embodiment of the present invention, said SOD gene is ligated into a vector to yield a recombinant plasmid which upon transformation into a suitable E. coli host resulted into a clone.
In still another embodiment of the present invention, the said coding sequence of SOD gene of SEQ ID No. 3 corresponding to polynucleotides encoding Superoxide dismutase (SOD) enzyme.
Further, the present invention also provides an expression construct included sequences encoding a selectable marker and a terminator sequence.
In the present invention, leaves of Potentilla plant growing at Kunzum Pass (altitude 4517 m; 32° 24′ N; 077° 38′ E) in Lahaul and Spiti district of Himachal Pradesh in Western Himalaya of India were collected and stored in liquid nitrogen. We had earlier reported in our U.S. Pat. NO. 6,485,950 that the leaves of this plant has SOD that is autoclavable and functions at sub-zero temperature. Thus the gene encoding such a SOD was identified, isolated and cloned in E.coli by techniques well known and routinely practiced in the art. The present SOD gene was sequenced and analyzed for its sense orientation, comprising the sequences set forth in SEQ ID No;2. The term “sense” as used herein, refers to a substantial run of RNA bases having essentially the same bases as a specific RNA sequence (e.g., mRNA). The invention also embraced polynucleotides encoding the amino acid sequences set out in SEQ ID No. 1. The invention also provided host cells, comprising a polynucleotide of the invention in a manner that permits expression of the encoded SOD polypeptide. Suitable host cells for transformation with the SOD gene of the invention include bacterial cells e.g. E. coli. Polynucleotides of the invention may be introduced into the host cell as a part of a circular plasmid using the well known methods for introducing DNA into the host cell and routinely practiced in the art. Host cells of the invention are a valuable source for industrial scale production of recombinant SOD.
Polyclonal antibody, in the present invention refers to an antibody produced in the normal immune system in response to an antigen consists of a number of closely related, but not identical proteins).
Vector, in the present invention refers to the sequence of DNA capable of accepting foreign DNA and take the form of a circular plasmid DNA that shows resistance to a given antibiotic The gene sequence of the invention was compared with the SOD reported from other plants to figure out the uniqueness of the gene (FIG. 2). Sequences unique to the polypeptides of the invention are recognizable through sequence comparison to other known polypeptides, and can be identified through use of alignment programs routinely utilized in the art, e.g., those made available in public sequence databases (FIG. 3). This suggested that the sequence obtained were incomplete. SEQ ID No;3 however, shared at least 80%, at least 82%, at least 83%, at least 85%, at least 86% sequence homology with SOD genes reported from other plants. Percent sequence “homology” with respect to polynucleotides of the invention is defined herein as the percentage of nucleotide bases in the candidate sequence that are identical to the nucleotides in the SOD coding sequence after aligning the sequences, if necessary, to achieve the maximum percent sequence identity.
It is cumulative effect/combination of amino acids for the entire 100% amino acid composition that this property is observed. This entire composition provides this protein the effect that protein has this effect.
The following examples are given by way of illustration of the present invention and should not be construed to limit the scope of the present invention.
EXAMPLE-1Raising Antibodies Against SOD in Rabbit
Polyclonal antibodies against purified protein were raised in one-year-old male rabbit (New Zealand type). Purified SOD protein (100 μg in 500 μl of potassium phosphate buffer; pH, 7.0) was emulsified in 1 ml of Freund's complete adjuvant and administered intramuscularly using disposable syringe. Complete Freund's adjuvant was obtained from Bangalore Genei, India that contained paraffin oil, mannide monooleate as an emulsifier and heat killed Mycobacterium tuberculosis. After 7th days of primary injection, a booster dose (1 ml, containing 60 μg of purified protein emulsified in 1 ml of incomplete adjuvant) was administered. Adjuvant (500 μl) was thoroughly emulsified with the purified enzyme (500 μl: 100 μg) to obtain a stable antigen-adjuvant emulsion by rapidly withdrawing and expelling the antigen-adjuvant mix using a 22 gauge needle fitted to a sterile syringe. Complete emulsification was tested by placing a drop of the mixture onto a still surface of distilled water. The intactness of the droplet assures complete mixing. Antigen-adjuvant mixture (800 μl) was injected in thigh muscles of rabbit using a 22 gauge needle. Blood was collected from heart of the rabbit and allowed to clot for 2 hours at room temperature. After overnight storage at 4° C., the edges of the clot were rimmed using a Pasture pipette and centrifuged at 150×g for 5 min. Supernatant was collected and centrifuged for 15 min at 350×g to remove cell debris. Sodium azide was added to a concentration of 0.025% and the serum was stored at 4° C. After second booster dose, a small amount of blood was collected to test for the presence of the antibody using Ouchterlony Double Diffussion (hereinafter known as ODD) as described by Kanematsu, S. and Asada, K.(1990) Plant Cell Physiol. 31: 99-112. Thus, in a 85 mm petri plate, 1.5% agar prepared in 0.15 M NaCl, 20 mM potassium phosphate of pH 7.0 and 0.02% sodium azide was poured to a thickness of 3 mm. Antigen (20 μl containing 4 μg of protein) and antibody were loaded into the 3 mm diameter well cut with the help of cork-borer. Petri plate was covered and kept in a humid environment for 16-24 hour at 37° C. and examined for line of immune precipitation.
EXAMPLE-2RNA Isolation, Quantification of RNA, Gel-Electrophoresis and Purification of Poly A+ mRNA from Total RNA
Ribonucleic acid (hereinafter known as, RNA) from young leaf tissue of Potentilla was isolated using the modified guanidine hydrochloride procedure (Lal. L., Sahoo. R., Gupta. R. K., Sharma. P. and kumar. S. Plant Molecular Biology Reporter 19: 181a-181f.). Leaf tissue (500 mg) was ground in liquid nitrogen to fine powder. Powder was transferred into a new mortar containing 5 ml of the GH buffer (8M guanidine hydrochloride, 20 mM EDTA, 20 mM MES, 100 mM βME) and was ground further. Resulting homogenate was transferred to an oak-ridge tube containing equal volume of phenol:chloroform:isoamylalcohal (25:24:1). Phases were emulsified by vortexing and separated by centrifugation at 10,000 rpm for 20 min (7° C.). Upper aqueous phase was transferred to a fresh oak-ridge tube and extracted with the equal volume of chloroform:isoamylalcohal (24:1). Resulting upper aqueous phase was transferred to a corex tube and RNA was precipitated by adding 0.2 volume of 1 M acetic acid and 0.7 volume of chilled ethanol. The tubes were kept at −72° C. for 3 h. Precipitate was pelleted by centrifugation at 10,000 rpm for 10 min at 4° C. Pellet was washed thrice using 5 ml of 3 M sodium acetate (pH 5.2) followed by final washing with 70% chilled ethanol. Pellet was dried and dissolved in minimum volume of DEPC-treated autoclaved water. RNA was quantified by measuring absorbance at 260 nm and the purity was monitored by calculating the ratio of absorbance measured at 260 and 280 nm. A value >1.8 at 260/280 nm was considered ideal for the purity of RNA used in the present investigation. The formula used to calculate RNA concentration and yield was as follows:
Concentration of RNA (μg/ml)=A260 (absorbance at 260 nm)×40×dilution factor
Total yield (μg)=concentration×volume of stock RNA sample
To check the integrity of RNA, 5-6 μg of RNA in 4.5 μl of DEPC treated autoclaved water was diluted with 15.5 μl of M1 solution (2 μl of 5× MOPS buffer, 3.5 μl of formaldehyde, and 10 μl of formamide [5× MOPS buffer: 300 mM sodium acetate, 10 mM MOPS (3-{N-morpholino]propanesulfonic acid}, 0.5 mM ethylene diamine tetra-acetic acid (EDTA)] and incubated for 15 minutes at 65° C. RNA was loaded onto 1.0% formaldehyde agarose-gel after adding 2 μl of formaldehyde-gel loading buffer [50% glycerol, 1 mM EDTA (pH, 8.0), 0.25% bromophenol blue, 0.25% xylene cyanol FF], and electrophoresed at 72 volts in 1× MOPS buffer (60 mM sodium acetate, 2 mM MOPS, 0.1 mM EDTA), (Sambrook, J., Fritsch, E. F. and Maniatis, T. 1989. Molecular Cloning: A Laboratory Manual, Cold Spring Harbor Laboratory Press, Plainview, N.Y.).
Poly-A mRNA was purified from the total RNA using dC10T30 oligonucleotides attached covalently to polystyrene-latex particles (Oligotex™, Qiagen Inc). Oligotex selectively binds mRNA with poly-A tail to allow purification leaving all other RNA species that lack poly-A tail. 1 mg of total RNA was used as the starting material for the isolation of the mRNA and manufacturer's instructions were followed during the procedure.
EXAMPLE-3Construction of a Directional Complementary DNA Library (Hereinafter Referred to cDNA Library)
Poly-A+ mRNA was used to synthesize cDNA using TimeSaver™ cDNA synthesis kit (Amersham Pharmacia Biotech. USA). First strand was synthesized using MMLV-reverse transcriptase in the presence of a bifunctional primer [5′d(AAC TGG AAG AAT TCG CGG CCG CAG GAA T18)p 3′] having an oligo (dT18) tract at the 3′-end of a restriction site for Not I. Second strand synthesis is initiated by DNA polymerase I after RNase H has nicked the RNA strand of the RNA:cDNA hybrid. The cDNA produced is extracted with phenol/chloroform and purified on a Sepharose CL-4B spun column. An Eco RI adaptor (5′-d[AATTCGGCACGAGG]-3′, [GCCGTGCTCC]p-5′) is ligated to other end of the cDNA. cDNA was digested with Not I to release site on oligo (dT18-Not I) primer. cDNA's with Eco RI and Not I overhangs were phosphorylated to disallow self-ligation but ligation to the dephosphorylated vector.
Bacteriophage λ vector (λ ExCell Not I/Eco RI/CIP) was selected for cloning of cDNA's with Eco RI and Not I overhang generated as above. λ ExCell is derived from a λ Charon vector engineered to contain an internal, linearized copy of pExCell. Following the construction and screening using the lawn cells (E. coli strain NM522), the bacteriophage containing the clone of interest were used to infect a special E. coli strain (NP66) that enables the in vivo release of pExCell, a circular, autonomously replicating pUC-based phagemid. In vivo excision of pExCell is accomplished by site-specific recombination between attL and attR sites that flank the phagemid within the λ ExCell DNA. NP66 carries the accessory proteins require for excision under the control of a thermo-inducible promoter. In vivo excision is accomplished by infection of NP66 with λ ExCell followed by growth at 39° C., which enables the expression of these accessory proteins.
The ligated vector and the cDNA fragments were packaged in an in vitro packaging system (Ready to Go Lambda packaging kit, Amersham Pharmacia Biotech. USA). In vitro packaging system for lambda DNA uses single lysogen, which codes for all necessary packaging proteins. The extract was prepared from E.coli lysogen in which the prophage carries a cos mutation. The cos mutation is a deletion in the cos site which prevents the endogenous prophage from being packaged; the exogenous recombinant DNA is, however, efficiently packaged. Packaging extracts also lack Eco K and other DNA restriction systems that recognize methylated DNA, which results in the efficient packaging of methylated and unmethylated cDNA.
EXAMPLE-4Library Screening and Identification, Amplification and Purification of Positive Phage
Library was screened using polyclonal antibodies raised against purified SOD as probe. Immobilized antibodies were detected using chemiluminescence based detection method (ECL™ western blotting analysis system, Amersham Inc.). The library was plated by making the serial dilutions of packaging reaction in SM buffer (100 mM NaCl, 8 mM MgSO4, 50 mM Tris-HCl and 0.01% gelatin). Autoclaved and dried nitrocellulose filter membranes fitting to the size of petri plate (82 mm) were used. Membranes were soaked in 10 mM isopropyl β-D-thiogalactopyranoside (hereinafter referred to IPTG) for 5 min, air-dried and used for screening. After 6 h incubation of the plated library or as the plaques started appearing, the plates were overlaid with IPTG-soaked nitrocellulose filters. The filters were overlaid by gently holding filters with blunt ended forceps at opposite edges and centering filter over plate, without trapping any air bubble. Filter was not moved once contact is made with the plate. The plates-filters (inverted) were incubated for another 4 h at 37° C. After incubation, the plates were marked with 18-gauge needle by puncturing asymmetrically for future alignment. Filters were removed from plates with protein side up. Positive plaques were selected using the correct orientation of the developed X-ray, filter and the plate. After marking plagues were cored out and placed in 300 μl of SM buffer for incubation at room temperature. After 2 h, it was centrifuged at 13,000×g for 10 min. The supernatant was collected in a fresh sterile tube followed by addition of 30 μl chloroform. The amplified phage was replated for secondary and tertiary screening. After tertiary screening the positive plaques were cored for in vivo phagemid release. For primary screening 105 plaque forming unit (pfu) were taken and transferred to membrane. Membranes were hybridized with polyclonal antibody and developed as ECL instruction. Three strong positive clones were obtained and further taken for secondary screening which gave 70% positive signal. A few clones were taken for tertiary screening and this time all the clones gave 100% positive signal after tertiary screening. All the positive plaques were used to release the vector pExCell containing the cloned fragment.
EXAMPLE-5In Vivo Release of Phagemid pExcell from Selected Clones
Host cells were prepared from released strain of E.coli NP66 in 2× YT medium (2× YT medium: 12 g trypton, 24 g yeast extract and 5 g glycerol in 1 litre of final volume in distilled/deionized water) containing 50 μg/ml spectinomycin, 30 μg/ml of chloramphenicol and 0.2% maltose. The culture was grown overnight at 32° C. 5ml of 2× YT containing 50 μg/ml spectinomycin, 30 μg/ml of chloramphenicol and 0.2% maltose was incubated with 50 μl of the overnight culture. This culture was grown at 32° C. with shaking to an A600 of 0.5-0.8. and cells were harvested by centrifugation at 3000×g. The pellet was re-suspended NZCYM broth (NZCYM broth: 10 g casein hydrolysate, 5 g yeast extract, 5 g NaCl, 1 g casamino acid and 2 g MgSO4.7H2O in 1 litre of final volume in distilled/deionized water) containing 50 μg/ml spectinomycin to a final A600 of 2.0. Cells were used within 1 h. To release the pExCell, 100 μl of the prepared NP66 cells were placed in a 15 ml sterile glass tube and incubated at 39° C. for 20 min to allow for expression of the His proteins required for site-specific recombination between attL and attR sites. 100 μl of the phage SM solution was added from to the cells and incubated at 39° C. for an additional 20 min. To this NP66/phage mixture, 200 μl of 1 M sodium citrate was added to terminate the infection of NP66 with λ ExCell and 5 ml of pre-warmed (32° C.) 2× YT broth containing 50 μg/ml spectinomycin was added. The culture was incubated at 32° C. with moderate shaking for 1.5 h to yield ‘released culture’. To prepare overnight cultures for subsequent isolation of pExCell DNA, 50 μl of the released culture was incubated at 37° C. in 5 ml of LB medium (LB medium: 10 g trypton, 5 g yeast extract, 10 g sodium chloride in 1 litre of final volume in distilled/deionized water) containing 100 μg/ml ampicillin.
EXAMPLE-6Analysis and Sequencing of Cloned cDNA
The cultures were streaked and the colonies were randomly picked up using a pipette tip. The colony was suspended in 50 μl of lysis buffer (colony lysis buffer: TE (Tris-Cl 10 mM, 1 mM EDTA, pH 8.0) with 0.1% tween 20), boiled for 10 min in a water bath followed by snap cooling on ice. Plasmid released in the colony lysate was amplified using 0.2 μM of each ‘forward’(5′-GTTGTAAAACGACGGCCAGT-3′) and ‘reverse’ (5′-CACAGGAAACAGCTATGACC-3′) flanking primer, 20 μM of dNTPs and 1 Units of Thermus aquaticus (hereinafter referred to Taq) DNA polymerase (purchased from M/S. Qiagen, Germany) in 1× PCR buffer (20 mM Tris-Cl (pH, 8.4), 50 mM KCl, 1.5 mM MgCl2 ). In the present invention, dNTPs refere to deoxy nucleoside triphosphate which comprises of deoxyadenosine triphosphate (hereinafter referred to dATP), deoxyguanosine triphosphate (hereinafter referred to dGTP), deoxycytidine triphosphate (hereinafter referred to dCTP) and deoxythymidine triphosphate (hereinafter referred to dTTP). Thermocycler program consisted of 30 cycles of 94° C. for 40 sec, 52° C. for 1 min and 72° C. for 2 min. This was followed by a 5 min extension at 72° C. Amplified products were run on 1.2% agarose gel in 1× TAE buffer (TAE buffer: 0.04 M Tris-acetate, 0.002 M EDTA, pH 8.5) containing ethidium bromide (final concentration of 0.5 μg/ml) and analyzed for correct size of insert by comparing with standard DNA molecular weight marker. Plasmids were isolated using QIAGEN plasmid mini kit (Cat#12125). These were quantified, checked on 1% agarose gel and sequencing was performed using the BigDye terminator (version 3.1) cycle sequencing mix (Applied Biosystems, USA) on automated DNA sequencer (ABI Prism 310, Genetic Analyzer, Applied Biosystems, USA). Protocols were followed essentially as described by respective manufacturers. Sequencing primers used were ‘forward’ 5′-
| INFORMATION FOR SEQ ID NO:4 | |
| (i) SEQUENCE CHARACTERISTICS: | |
| (A) LENGTH: 365 base pairs | |
| (B) TYPE: nucleic acid | |
| (C) STRANDEDNESS: double | |
| (D) TOPOLOGY: circular | |
| (ii) MOLECULE TYPE: cDNA | |
| (iii) SEQUENCE DESCRIPTION: SEQ ID NO:4 | |
| 5′CAAGAGGGAGATGGCCCAACTACTGTGACCGGAAACATTTCTGGCCTC | |
| AAGCCTGGGCTTCATGGTTTCCATGTTCATGCTCTTGGGGACACAACCAA | |
| TGGTTGCATGTCAACTGGACCACATTTCAATCCTGCTGGCAAAGAGCATG | |
| GGTCTCCTGAAGATGAGACTCGTCATGCTGGTGATCTTGGAAATATCACT | |
| GTTGGGGATGACGGAACTGCTTGCTTCACAATTGTTGACAAACAGATTCC | |
| TCTCACTGGACCACACTCTATCATTGGTAGGGCTGTTGTTGTCCATGCAG | |
| ATCCTGATGACCTTGGCAAGGGTGGACATGAGCTTAGCAAATCCACTGGA | |
| AATGCTGGTGGCAGGAT 3′ |
Sequence mentioned in example 6 was searched for homology in the gene databases available at URL www.ncbi.nlm.nih.gov. using Basic Local Alignment Search Tool (hereinafter called as BLAST). It was clear from the results that the sequence had a homology between 80-90% with the SOD sequences submitted in the databases.
EXAMPLE-8Cloning of Full Length Gene Using Rapid Amplification of cDNA Ends (Hereinafter Referred to RACE)
Rapid amplification of cDNA ends (RACE) was used to isolate full length SOD gene from Potentilla atrosanguinea. RACE amplifies DNA sequences from a messenger RNA template between a defined internal site and unknown sequences of either the 3′ or 5′ end (Frohman, M. A., Dush. M. K. and Martin, G. R. (1988) Proc. Natl. Acad. Sci. USA 85: 8998-9002; U.S. Pat. Nos. 5,962,271 and 5,962,272). A set of gene specific primers were used to generate 5′ and 3′ ends of the gene separately. The partial cDNA sequence (SEQ ID No; 1) was used to design two sets of primers. Primers were designed such that the amplified 5′ and 3′ ends overlap each other over a small stretch of nucleotides. For 5′ RACE, a gene specific primer (hereinafter referred to GSP1),5′-CCAGTGGATTTGCTAAGCTCATGTCCA-3′ for primary PCR and one nested gene specific primer (hereinafter referred to NES1), 5′-GTCATCAGGGTCTGCATGGACAACAAC-3′ for secondary PCR (RACE). It has been used 1 μl of 10 μM nested primers stock for secondary PCR. For 3′ RACE a gene specific primer (hereinafter referred to GSP2), 5′-ATGGTTGCATGTCAACTGGACCACATT-3′ for primary PCR and one nested primer (hereinafter referred to NES2), 5′-TTGCATGTCAACTGGACCACATTTCAA-3′ were designed. Primers were designed such that the amplified 5′ and 3′ ends overlap each other over a small stretch of nucleotides.
The cDNA for 5′-RACE was synthesized using a modified lock-docking oligo(dT) primer and SMART II A oligo (dT) primer. The modified oligo (dT) primer, termed the 5′-RACE CDS Primer (5′-CDS) has two degenerate nucleotide positions at the 3′ end.
1 μg of total RNA was reverse transcribed in separate reactions to yield 5′ and 3′ RACE ready cDNA using an enzyme known as reverse transcriptase. For 5′ cDNA synthesis, the reaction was carried out using 1 μM of 5′-CDS primer in a reaction mixture containing RNA and 1 μM SMART II oligo (dT) primer. The 3′-RACE cDNA is synthesized using a traditional reverse transcription procedure, but with a special oligo (dT) primer. This 3′-RACE CDS Primer A (3′-CDS) primer includes the lock-docking nucleotide positions as in the 5′-CDS and also has a portion of the smart sequence at its 5′ end. Sterile H2O was added to a final volume of 5 μl for each reaction, mixed and centrifuged. The reaction mix was incubated at 70° C. for 2 min and cooled on ice for 2 min. First-strand buffer (50 mM Tris-Cl (pH, 8.3), 75 mM KCl and 6 mM MgCl2 ), 1 mM dNTPs, 2mM DTT and reverse transcriptase were added to each reaction and incubated at 42° C. for 1.5 hr in an air incubator. Diluted the first-strand reaction product with 100 μl of Tricine-EDTA buffer (10 mM Tricine-KOH (pH 8.5), 1.0 mM EDTA) and heated tubes at 72° C. for 7 min. (Reverse transcription system was a component of SMART RACE cDNA amplification kit from BD Biosciences, USA).
Sequences of Primers Used for RACE Were as Follows (Purchased from BD Biosciences, USA as a Part of RACE Kit).
| Primer | Primer Sequence |
| SMART II A Oligonucleotide | 5′-AAGCAGTGGTATCAACGCAGA | |
| GTACGCGGG-3′ | ||
| 3′-RACE CDS Primer A | 5′-AAGCAGTGGTATCAACGCAGA | |
| (3′-CDS) | GTAC(T)30N-1N-3′ | |
| 5′-RACE CDS Primer | 5′-(T)25N-1N-3′ | |
| (5′-CDS) | ||
| 10X Universel | Long: | |
| Primer Mix A (UPM) | 5′-TAATACGACTCACTATAGGGC | |
| AAGCAGTGGTATCAACGCAGAGT- | ||
| 3′ | ||
| Short: | ||
| 5′-CTAATACGACTCACTATAGGG | ||
| C-3′ | ||
| Nested Universal Primer A | 5′-AAGCAGTGGTATCAACGCAGA | |
| (NUP) | GT-3′ | |
5′ and 3′ RACE cDNA were amplified using 0.2 μM GSP1, GSP2 primer and 1× universal primer (UPM), 0.2 mM dNTP and 1× BD polymerase mix. Thermocycler program consisted of 30 cycles of 94° C. for 30 sec, 68° C. for 30 sec and 72° C. for 3 min. The reaction was up-scaled to 50 μl and after the completion of PCR, 45 μl of PCR sample was run on 1.2% agarose gel in TAE buffer containing ethidium bromide (final concentration of 0.5 μg/ml) Rest of the amplified product was stored at −20° C. for secondary PCR if needed. Amplicons were cut from the gel and DNA was eluted from the gel using QIAEX II gel extraction kit from M/S Qiagen, Germany following the manufacturer's instructions. The purified DNA was cloned in pGEM-T easy vector (Promega, USA), plasmids were isolated using the Qiagen plasmid mini-isolation kit, and sequencing was performed using the BigDye terminator (version 3.1) cycle sequencing mix (Applied Biosystems, USA) on an automated DNA sequencer (ABI Prism 310, Genetic Analyzer, Applied Biosystems). Protocols were followed essentially as described by respective manufacturers. The RACE products were analyzed by BLAST.
| (3) INFORMATION FOR SEQ ID NO:2 | |
| (i) SEQUENCE CHARACTERISTICS: | |
| (A) LENGTH: 856 base pairs | |
| (B) TYPE: nucleic acid | |
| (C) STRANDEDNESS: double | |
| (D) TOPOLOGY: circular | |
| (ii) MOLECULE TYPE: cDNA | |
| (iii) SEQUENCE DESCRIPTION: SEQ ID NO:2 | |
| 5′ACGGGGGGGGGACTGAAATAAATAGAGAGGGTCATAGTCACATTTGCA | |
| TTTAGGTATCTGATTCCATTCACAAACCTCCAACTCCCACCTCTCTCTCT | |
| ATTTCTCTTCATCTTCATCATCTTAGGGTGCACTGAGATCACTTTGAAAC | |
| ATGGCAAAGGGCGTTGCTGTACTTAGCTCCAGTGAGGGTGTTGCTGGAAC | |
| TATCCTCTTTACCCAAGAGGGAGATGGCCCAACTACTGTGACCGGAAACA | |
| TTTCTGGCCTCAAGCCTGGGCTTCATGGTTTCCATGTTCATGCTCTTGGG | |
| GACACAACCAATGGTTGCATGTCAACTGGACCACATTTCAATCCTGCTGG | |
| CAAAGAGCATGGGTCTCCTGAAGATGAGACTCGTCATGCTGGTGATCTTG | |
| GAAATATCACTGTTGGGGATGACGGAACTGCTTGCTTCACAATTGTTGAC | |
| AAACAGATTCCTCTCACTGGACCACACTCTATCATTGGTAGGGCTGTTGT | |
| TGTCCATGCAGATCCTGATGACCTTGGCAAGGGTGGACATGAGCTTAGCA | |
| AATCCACTGGAAATGCTGGTGGCAGGATAGCTTGTGGTATTATTGGCCTT | |
| CAAGGATGAACTGGACCAGGGAGCGAAACACAGGCATCTTGTTGAATTAA | |
| AACTTGAGATATTAGCGAACTCTTCGGAATTGAGTATTGAAACAAGGAAT | |
| ACATTTGTCATTACCAATACGTTTGGCTTAGACCTGTATTCTGTATCTCA | |
| ATAGTTTTCTGTGTGGTTGTTTGACAGTTATTTGTGCTCAGGCTATTTCA | |
| AAGGGATAAACACAGTAACTTTCTTGCTTTGACAAAAAAAAAAAAAAAAA | |
| AAAAAAAA 3′ |
Amplification of Coding Sequence (Hereinafter Known as CDS) of SOD and Cloning into an Expression Vector
CDS of SOD was amplified by PCR using the forward primer 5′-ATGGCAAAGGGCGTTGCTGTACTT-3′ and reverse primer 5′-TCATCCTTGAAGGCCAATAATACCA-3′ designed from start codon and stop codon. The amplified product was cloned into pQE 30 expression vector and transformed into competent E. coli cells. The plasmid was isolated using the standard plasmid isolation protocol (Sambrook, J., Fritsch, E. F. and Maniatis, T. 1989. Molecular Cloning: A Laboratory Manual, Cold Spring Harbor Laboratory Press, Plainview, N.Y.) and sequencing was performed using the BigDye terminator (version 3.1) cycle sequencing mix (Applied Biosystems, USA) on an automated DNA sequencer (ABI Prism 310, Genetic Analyzer, Applied Biosystems) to confirm cloning of insert. Protocols were followed essentially as described by the manufacturer.
| (4) | INFORMATION FOR SEQ ID NO: 3 | |
| (i) | SEQUENCE CHARACTERISTICS: | |
| (A) | LENGTH: 459 base pairs | |
| (B) | TYPE: nucleic acid | |
| (C) | STRANDEDNESS: double | |
| (D) | TOPOLOGY: circular | |
| (ii) | MOLECULE TYPE: cDNA | |
| (iii) | SEQUENCE DESCRIPTION: SEQ ID NO: 3 | |
| 5′ ATGGCAAAGGGCGTTGCTGTACTTAGCTCCAGTGAGGGTGTTGCTGG | |
| AACTATCCTCTTTACCCAAGAGGGAGATGGCCCAACTACTGTGACCGGAA | |
| ACATTTCTGGCCTCAAGCCTGGGCTTCATGGTTTCCATGTTCATGCTCTT | |
| GGGGACACAACCAATGGTTGCATGTCAACTGGACCACATTTCAATCCTGC | |
| TGGCAAAGAGCATGGGTCTCCTGAAGATGAGACTCGTCATGCTGGTGATC | |
| TTGGAAATATCACTGTTGGGGATGACGGAACTGCTTGCTTCACAATTGTT | |
| GACAAACAGATTCCTCTCACTGGACCACACTCTATCATTGGTAGGGCTGT | |
| TGTTGTCCATGCAGATCCTGATGACCTTGGCAAGGGTGGACATGAGCTTA | |
| GCAAATCCACTGGAAATGCTGGTGGCAGGATAGCTTGTGGTATTATTGGC | |
| CTTCAAGGATGA 3′ | |
| (5) | INFORMATION FOR Pro SEQ ID NO: 1 | |
| (i) | SEQUENCE CHARACTERISTICS: | |
| (A) | LENGTH: 152 amino acids | |
| (B) | TYPE: amino acid | |
| (ii) | MOLECULE TYPE: polypeptide | |
| (iii) | SEQUENCE DESCRIPTION: Pro SEQ ID NO: 1 | |
| MAKGVAVLSSSEGVAGTILFTQEGDGPTTVTGNISGLKPGLHGFHVHALG | |
| DTTNGCMSTGPHFNPAGKEHGSPEDETRHAGDLGNITVGDDGTACFTIVD | |
| KQIPLTGPHSIIGRAVVVHADPDDLGKGGHELSKSTGNAGGRIACGIIGL | |
| QG |
Induction and Purification of Expressed Protein
E. coli containing SOD gene from Potentilla was grown at 37° C. in 100 ml of LB medium with 100 μg ml−1 and 25 μg ml−1 kanamycin. When that culture had grown to an absorbance of 0.6 at 600 nm, IPTG was added to a final concentration of 1 mM. CuSO4 and ZnSO4 were added to a final concentration of 100 ppm and 2 ppm, respectively. After inducing the expression of the SOD protein for 5 h at 37° C., cells were harvested, washed and resuspended in 4 ml of lysis buffer (50 mM NaH2PO4 buffer, pH 8.0, containing 300 mM NaCl and 10 mM imidazole). The cell suspension was sonicated, and the lysate was cleared by centrifugation at 12000 g and 4° C. for 20 min. The supernatant was then poured into the column loaded with nickel-nitrilotriacitic acid (Ni-NTA) agarose, washed with wash buffer (50 mM NaH2PO4 buffer, pH 8.0, containing 300 mM NaCl and 20 mM imidazole), and SOD protein was eluted with elution buffer (50 mM NaH2PO4 buffer, pH 8.0, containing 300 mM NaCl and 250 mM imidazole). The purified SOD was evaluated by 10% SDS-PAGE using silver staining to visualize the protein (FIG. 4A).
The protein estimation was performed before and after autoclaving purified SOD that shows ±25% loss of protein. Since 50 μl of protein sample was used for assaying SOD activity, the loss in protein was calculated while calculating the enzyme activity. Reaction medium contained 0.05 M potassium phosphate buffer (pH, 7.0), 5.7×10−5 M nitroblue tetrazolium (hereinafter referred to NBT), 9.9×10−3 M methionine, 1.17×10−6 M riboflavin and 0.025% Triton X-100 in a total volume of 3.0 ml. Reaction (performed in a 30 ml glass vial) was initiated by illuminating the reaction with light intensity of 1000 μ Einstein/m2/second using a fiber optic light source (Nikon). The reaction was terminated after 2 min and the absorbance was read at 560 nm.
A control reaction was always performed wherein all the steps and components were exactly the same as described above except that purified enzyme was replaced with equal volume of homogenizing buffer. Activity of SOD is expressed as per cent inhibition in color development as compared to the control reaction (higher the inhibition, higher the SOD activity). Activity data was shown in FIG. 1.
EXAMPLE-11SOD Activity at Different Temperatures in Purified SOD
The purified SOD enzyme was assayed at temperatures ranging between −10 to 80 ° C. in the buffer composition as described in Example 10 except that 50% glycerol was added in the reaction mixture to avoid freezing at low temperature. A glass beaker of 100 ml capacity was filled with either alcohol (for working at temperatures of −10, −5, 0° C.) or distilled water (for working at rest of the temperatures) was used to maintain the temperature of the reaction medium while assaying SOD. Reaction medium along with the enzyme was pre-equilibrated at desired temperature to avoid time lag in attaining the required temperature. As can be seen from FIG. 1 that the enzyme showed highest activity (87.5% inhibition) at 0° C. The enzyme was functional even up to −10° C. (82% inhibition). The enzyme is expected at temperature lower than −10° C.
Control reactions, as mentioned in Example 10, were always performed at all the temperatures.
EXAMPLE-12Localization of SOD by Activity Staining of Native Gel
The purified SOD was localized on 10% polyacrylamide gel by activity staining as described by Beauchamp and Fridovich (Anal. Biochem. 1971; 44: 246-287). After electrophoresis, the gel was rinsed with distilled water followed by 30 min incubation in 50 ml phosphate buffer (50 mM; pH 7.0) containing 2.5 mM NBT in dark at room temperature. Gel was then immersed in 1.17×10−6 M riboflavin for 20 min, followed by exposure to light source (Nikon). Light exposure led to photogeneration of O2−, which converts NBT into insoluble purple colored formazan. The purple color was developed throughout the gel except for the location where SOD was localized as shown in FIG. 4B.
ADVANTAGESThe main advantages of the present invention are:
1. Superoxide dismutase (SOD) cDNA of SEQ ID No. 2 obtained from Potentilla atrosanguinea, wherein the said cDNA comprising of 856 nucleotide bases.
2. Superoxide dismutase (SOD) cDNA as claimed in claim 1, wherein the said cDNA has entire coding sequence along with pre- and post-coding sequences.
3. Superoxide dismutase (SOD) gene coding cDNA of SEQ ID No. 3, wherein the said coding cDNA comprising of 459 nucleotide bases.
4. Superoxide dismutase (SOD) polypeptide of SEQ ID No. 1, wherein the said polypeptide comprising of 152 amino acids.
5. Superoxide dismutase (SOD) polypeptide as claimed in claim 4, wherein the said polypeptide is autoclavable.
6. Superoxide dismutase (SOD) polypeptide as claimed in claim 4, wherein the said polypeptide is functional at temperature range of <−10° C. to +80° C.
7. A set of primers useful for the amplification of Superoxide dismutase (SOD) gene coding cDNA of SEQ ID No. 3, wherein
Forward primer 5′-ATGGCAAAGGGCGTTGCTGTACTT-3′ (SEQ ID NO: 5) and;
Rreverse primer 5′-TCATCCTTGMGGCCMTMTACCA-3′ (SEQ ID NO: 6)
8. A method of identifying and cloning of superoxide dismutase (SOD) gene of SEQ ID NO 3 which codes for a polypeptide of SEQ ID No. 1 having Superoxide dismutase enzyme activity, wherein the said method comprising the steps of:
a) isolating the mRNA from leaves of potentialla;
b) synthesizing the cDNA from mRNA as obtained from step (a);
c) constructing a cDNA library of the DNA of potentilla followed by the cloning of the cDNA obtained from step (b) in a suitable vector preferably in bacteriophage;
d) screening the said library obtained from step (c) followed by the primary, secondary and tertiary screening for identification of positive cDNA clones;
e) isolating the DNA from positive cDNA clones obtained from step (d);
f) amplifying the said DNA using the primers comprising:
| Forward Primer: | |||
| 5′-GTTGTAAAACGACGTGCCAGT-3′ | (SEQ ID NO: 13) | ||
| Reverse Primer: | |||
| 5′-CACAGGAAACAGCTATGACC-3′; | (SEQ ID NO: 14) | ||
h) amplifying the ends of cDNA obtained from step (e) through rapid amplification of cDNA ends technique (RACE) using different set of primers to get the full length desired Superoxide dismutase (SOD) DNA of SEQ ID NO. 2 wherein the said primers comprising:
| Forward Primer (GSP1): |
| (SEQ ID NO: 7) |
| 5′-CCAGTGGATTTGCTAAGCTCATGTCCA-3′ | ||
| Reverse Primer (NES1): |
| (SEQ ID NO: 8) |
| 5′-GTCATCAGGGTCTGCATGGACAACAAC-3′ | ||
| Forward Primer (GSP2): |
| (SEQ ID NO: 9) |
| 5′-ATGGTTGCATGTCAACTGGACCACATT-3′ | ||
| Reverse Primer (NES2): |
| (SEQ ID NO: 10) |
| 5′-TTGCATGTCAACTGGACCACATTTCAA-3′ | ||
| SMART II A Oligonucleotide: |
| (SEQ ID NO: 11) |
| 5′AAGCAGTGGTATCAACGCAGAGTAC GCGGG-3′ | ||
| 3′- RACE CDS Primer A (3′- CDS): |
| (SEQ ID NO: 73) |
| 5′AAGCAGTGGTATCAACGCAGA | ||
| GTAC (T)30 N−1N-3′ | ||
| 5′- RACE CDS Primer (5′- CDS) |
| (SEQ ID NO: 15) |
| 5′- (T)25 N−1N- 3′ | ||
| Universel Primer Mix A (UPM): Long: |
| (SEQ ID NO: 16) |
| 5′TAATACGACTCACTATAGGGC | ||
| AAGCAGTG GTATCAACGCAGAGT-3′ | ||
| Universel Primer Mix A (UPM): Short: |
| (SEQ ID NO: 17) |
| 5′-CTAATACGACTCACTATAGG | ||
| GC-3′ | ||
| Nested Universal Primer A (NUP): |
| (SEQ ID NO: 23) |
| 5′-AAGCAGTGGTATCAACGCAGAGT-3′ | ||
i) amplifying the coding sequence of Superoxide dismutase (SOD) of SEQ ID No. 3 using a set of primers designed from start and stop codon of full length desired Superoxide dismutase (SOD) DNA of SEQ ID NO. 2 wherein the said primers have the following sequences:
| Forward Primer: | ||
| 5′-ATGGCAAAGGGCGTTGCTGTACTT-3′ | (SEQ ID NO: 5) | |
| Reverse Primer: | ||
| 5′-TCATCCTTGAAGGCCAATAATACCA-3′ | (SEQ ID NO: 6) | |
j) cloning the amplified product obtained from step (g) into pQE 30 expression vector followed by the transformation it into competent E.coli cells to get an expression construct;
k) isolating the plasmid DNA by conventional method followed by sequencing to confirm the said SOD gene.
9. A method as claimed in claim 9, wherein the polyclonal antibodies were raised against the purified SOD and used for cDNA library screening synthesized from young leaf mRNA.
10. A method as claimed in claim 9, wherein the 105 plaque forming units (pfu) are taken for primary screening.
11. A method as claimed in claim 11, wherein three strong positive clones are obtained from the primary cloning.
12. A method as claimed in claim 12, wherein the said positive clones are taken for secondary screening which gives about 70% positive clones.
13. A method as claimed in claim 13, wherein the said positive clones are randomly taken for tertiary screening which gives 100% positive signal after tertiary screening.
14. A method as claimed in claim 9, wherein the said RACE Primers are designed such that the amplified 5′ and 3′end overlap each other over a small stretch of nucleotides.
15. A method as claimed in claim 9, wherein the said full length SOD gene of SEQ ID No. 2 contains 856 nucleotide bases.
16. A method as claimed in claim 16, wherein the said full length SOD gene of SEQ ID No. 2 has entire coding sequence along with pre- and post-coding sequences
17. A method as claimed in claim 9, wherein the said coding cDNA of SEQ ID No. 3 comprises 459 nucleotide bases.
18. A method as claimed in claim 18, wherein the said coding sequence of SOD gene of SEQ ID No. 3 corresponding to polynucleotides encoding Superoxide dismutase (SOD) enzyme.
19. An expression construct comprises a nucleotide sequence of superoxide dismutase (SOD) gene of SEQ ID NO 3 which codes for a polypeptide of SEQ ID No. 1 having Superoxide dismutase enzyme activity, a selectable marker and a terminator sequence.