US20080125369A1
2008-05-29
11/926,480
2007-10-29
The present invention provides a soluble T cell receptor (sTCR), which comprises (i) all or part of a TCRα chain, except the transmembrane domain thereof, and (ii) all or part of a TCR β chain, except the transmembrane domain thereof. (i) and (ii) each comprise a functional variable domain and at least a part of the constant domain of the TCR chain, and are linked by a disulphide bond between constant domain residues which is not present in native TCR.
Get notified when new applications in this technology area are published.
C07K14/7051 » CPC main
Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans; Receptors; Cell surface antigens; Cell surface determinants; Immunoglobulin superfamily T-cell receptor (TcR)-CD3 complex
A61P3/10 » CPC further
Drugs for disorders of the metabolism for glucose homeostasis for hyperglycaemia, e.g. antidiabetics
A61P31/12 » CPC further
Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics Antivirals
A61P31/18 » CPC further
Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics; Antivirals for RNA viruses for HIV
A61P35/00 » CPC further
Antineoplastic agents
A61P37/02 » CPC further
Drugs for immunological or allergic disorders Immunomodulators
A61K38/00 » CPC further
Medicinal preparations containing peptides
A61K38/17 IPC
Medicinal preparations containing peptides; Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
C07K14/435 IPC
Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
This application is a division of Ser. No. 10/486,924 filed Feb. 24, 2004, which is a national stage application of PCT/GB02/03986 filed Aug. 30, 2002, which was published in English on Mar. 13, 2003 and which claims the benefit of GB 0121187.9 filed Aug. 31, 2001, GB 0219146.8 filed Aug. 16, 2002, and Ser. No. 60/404,182 filed Aug. 16, 2002.
The present invention relates to soluble T cell receptors (TCRs).
As is described in WO 99/60120, TCRs mediate the recognition of specific Major Histocompatibility Complex (MHC)-peptide complexes by T cells and, as such, are essential to the functioning of the cellular arm of the immune system.
Antibodies and TCRs are the only two types of molecules which recognise antigens in a specific manner, and thus the TCR is the only receptor for particular peptide antigens presented in MHC, the alien peptide often being the only sign of an abnormality within a cell. T cell recognition occurs when a T-cell and an antigen presenting cell (APC) are in direct physical contact, and is initiated by ligation of antigen-specific TCRs with pMHC complexes.
The TCR is a heterodimeric cell surface protein of the immunoglobulin superfamily which is associated with invariant proteins of the CD3 complex involved in mediating signal transduction. TCRs exist in αβ and γδ forms, which are structurally similar but T cells expressing them have quite distinct anatomical locations and probably functions. The extracellular portion of the receptor consists of two membrane-proximal constant domains, and two membrane-distal variable domains bearing polymorphic loops analogous to the complementarity determining regions (CDRs) of antibodies. It is these loops which form the binding site of the TCR molecule and determine peptide specificity. The MHC class I and class II ligands are also immunoglobulin superfamily proteins but are specialised for antigen presentation, with a polymorphic peptide binding site which enables them to present a diverse array of short peptide fragments at the APC cell surface.
Soluble TCRs are useful, not only for the purpose of investigating specific TCR-pMHC interactions, but also potentially as a diagnostic tool to detect infection, or to detect autoimmune disease markers. Soluble TCRs also have applications in staining, for example to stain cells for the presence of a particular peptide antigen presented in the context of the MHC. Similarly, soluble TCRs can be used to deliver a therapeutic agent, for example a cytotoxic compound or an immunostimulating compound, to cells presenting a particular antigen. Soluble TCRs may also be used to inhibit T cells, for example, those reacting to an auto-immune peptide antigen.
Proteins which are made up of more than one polypeptide subunit and which have a transmembrane domain can be difficult to produce in soluble form because, in many cases, the protein is stabilised by its transmembrane region. This is the case for the TCR, and is reflected in the scientific literature which describes truncated forms of TCR, containing either only extracellular domains or extracellular and cytoplasmic domains, which can be recognised by TCR-specific antibodies (indicating that the part of the recombinant TCR recognised by the antibody has correctly folded), but which cannot be produced at a good yield, which are not stable at low concentrations and/or which cannot recognise MHC-peptide complexes. This literature is reviewed in WO 99/60120.
A number of papers describe the production of TCR heterodimers which include the native disulphide bridge which connects the respective subunits (Garboczi, et al., (1996), Nature 384(6605): 134-41; Garboczi, et al., (1996), J Immunol 157(12): 5403-10; Chang et al., (1994), PNAS USA 91: 11408-11412; Davodeau et al., (1993), J. Biol. Chem. 268(21): 15455-15460; Golden et al., (1997), J. Imm. Meth. 206: 163-169; U.S. Pat. No. 6,080,840). However, although such TCRs can be recognised by TCR-specific antibodies, none were shown to recognise its native ligand at anything other than relatively high concentrations and/or were not stable.
In WO 99/60120, a soluble TCR is described which is correctly folded so that it is capable of recognising its native ligand, is stable over a period of time, and can be produced in reasonable quantities. This TCR comprises a TCR α or γ chain extracellular domain dimerised to a TCR β or δ chain extracellular domain respectively, by means of a pair of C-terminal dimerisation peptides, such as leucine zippers. This strategy of producing TCRs is generally applicable to all TCRs.
Reiter et al, Immunity, 1995, 2:281-287, details the construction of a soluble molecule comprising disulphide-stabilised TCR α and β variable domains, one of which is linked to a truncated form of Pseudomonas exotoxin (PE38). One of the stated reasons for producing this molecule was to overcome the inherent instability of single-chain TCRs. The position of the novel disulphide bond in the TCR variable domains was identified via homology with the variable domains of antibodies, into which these have previously been introduced (for example see Brinkmann, et al. (1993), Proc. Natl. Acad. Sci. USA 90: 7538-7542, and Reiter, et al. (1994) Biochemistry 33: 5451-5459). However, as there is no such homology between antibody and TCR constant domains, such a technique could not be employed to identify appropriate sites for new inter-chain disulphide bonds between TCR constant domains.
Given the importance of soluble TCRs, it would be desirable to provide an alternative way of producing such molecules.
According to a first aspect, the present invention provides a soluble T cell receptor (sTCR), which comprises (i) all or part of a TCR α chain, except the transmembrane domain thereof, and (ii) all or part of a TCR β chain, except the transmembrane domain thereof, wherein (i) and (ii) each comprise a functional variable domain and at least a part of the constant domain of the TCR chain, and are linked by a disulphide bond between constant domain residues which is not present in native TCR.
In another aspect, the invention provides a soluble αβ-form T cell receptor (sTCR), wherein a covalent disulphide bond links a residue of the immunoglobulin region of the constant domain of the α chain to a residue of the immunoglobulin region of the constant domain of the β chain.
The sTCRs of the present invention have the advantage that they do not contain heterologous polypeptides which may be immunogenic, or which may result in the sTCR being cleared quickly from the body. Furthermore, TCRs of the present invention have a three-dimensional structure which is highly similar to the native TCRs from which they are derived and, due to this structural similarity, they are not likely to be immunogenic. sTCRs in accordance with the invention may be for recognising Class I MHC-peptide complexes or Class II MHC-peptide complexes.
TCRs of the present invention are soluble. In the context of this application, solubility is defined as the ability of the TCR to be purified as a mono disperse heterodimer in phosphate buffered saline (PBS) (KCL 2.7 mM, KH2PO4 1.5 mM, NaCl 137 mM and Na2PO4 8 mM, pH 7.1-7.5. Life Technologies, Gibco BRL) at a concentration of 1 mg/ml and for >90% of said TCR to remain as a mono disperse heterodimer after incubation at 25° C. for 1 hour. In order to assess the solubility of the TCR, it is first purified as described in Example 2. Following this purification, 100 μg of the TCR is analysed by analytical size exclusion chromatography e.g. using a Pharmacia Superdex 75 HR column equilibrated in PBS. A further 100 μg of the TCR is incubated at 25° C. for 1 hour and then analysed by size exclusion chromatography as before. The size exclusion traces are then analysed by integration and the areas under the peaks corresponding to the mono disperse heterodimer are compared. The relevant peaks may be identified by comparison with the elution position of protein standards of known molecular weight. The mono disperse heterodimeric soluble TCR has a molecular weight of approximately 50 kDa. As stated above, the TCRs of the present invention are soluble. However, as explained in more detail below, the TCRs can be coupled to a moiety such that the resulting complex is insoluble, or they may be presented on the surface of an insoluble solid support.
The numbering of TCR amino acids used herein follows the IMGT system described in The T Cell Receptor Factsbook, 2001, LeFranc & LeFranc, Academic Press. In this system, the α chain constant domain has the following notation: TRAC*01, where “TR” indicates T Cell Receptor gene; “A” indicates α chain gene; C indicates constant region; and “*01” indicates allele 1. The β chain constant domain has the following notation: TRBC1*01. In this instance, there are two possible constant region genes “C1” and “C2”. The translated domain encoded by each allele can be made up from the genetic code of several exons; therefore these are also specified. Amino acids are numbered according to the exon of the particular domain in which they are present.
The extracellular portion of native TCR consists of two polypeptides (αβ or γδ) each of which has a membrane-proximal constant domain, and a membrane-distal variable domain (see FIG. 1). Each of the constant and variable domains includes an intra-chain disulphide bond. The variable domains contain the highly polymorphic loops analogous to the complementarity determining regions (CDRs) of antibodies. CDR3 of the TCR interacts with the peptide presented by MHC, and CDRs 1 and 2 interact with the peptide and the MHC. The diversity of TCR sequences is generated via somatic rearrangement of linked variable (V), diversity (D), joining (J), and constant genes. Functional α chain polypeptides are formed by rearranged V-J-C regions, whereas β chains consist of V-D-J-C regions. The extracellular constant domain has a membrane proximal region and an immunoglobulin region. The membrane proximal region consists of the amino acids between the transmembrane domain and the membrane proximal cysteine residue. The constant immunoglobulin domain consists of the remainder of the constant domain amino acid residues, extending from the membrane proximal cysteine to the beginning of the joining region, and is characterised by the presence of an immunoglobulin-type fold. There is a single α chain constant domain, known as Cα1 or TRAC*01, and two different β constant domains, known as Cβ1 or TRBC1*01 and Cβ2 or TRBC2*01. The difference between these different β constant domains is in respect of amino acid residues 4, 5 and 37 of exon 1. Thus, TRBC1*01 has 4N, 5K and 37 in exon 1 thereof, and TRBC2*01 has 4K, 5N and 37Y in exon 1 thereof. The extent of each of the TCR extracellular domains is somewhat variable.
In the present invention, the disulphide bond is introduced between residues located in the constant domains (or parts thereof) of the respective chains. The respective chains of the TCR comprise sufficient of the variable domains thereof to be able to interact with its pMHC complex. Such interaction can be measured using a BIAcore 3000™ or BIAcore 2000™ instrument as described in Example 3 herein or in WO99/6120 respectively.
In one embodiment, the respective chains of the sTCR of the invention also comprise the intra-chain disulphide bonds thereof. The TCR of the present invention may comprise all of the extracellular constant Ig region of the respective TCR chains, and preferably all of the extracellular domain of the respective chains, i.e. including the membrane proximal region. In native TCR, there is a disulphide bond linking the conserved membrane proximal regions of the respective chains. In one embodiment of the present invention, this disulphide bond is not present. This may be achieved by mutating the appropriate cysteine residues (amino acid 4, exon 2 of the TRAC*01 gene and amino acid 2 of both the TRBC1*01 and TRBC2*01 genes respectively) to another amino acid, or truncating the respective chains so that the cysteine residues are not included. A preferred soluble TCR according to the invention comprises the native α and β TCR chains truncated at the C-terminus such that the cysteine residues which form the native interchain disulphide bond are excluded, i.e. truncated at the residue 1, 2, 3, 4, 5, 6, 7, 8, 9 or 10 residues N-terminal to the cysteine residues. It is to be noted however that the native inter-chain disulphide bond may be present in TCRs of the present invention, and that, in certain embodiments, only one of the TCR chains has the native cysteine residue which forms the native interchain disulphide bond. This cysteine can be used to attach moieties to the TCR.
However, the respective TCR chains may be shorter. Because the constant domains are not directly involved in contacts with the peptide-MHC ligands, the C-terminal truncation point may be altered substantially without loss of functionality.
Alternatively, a larger fragment of the constant domains may be present than is preferred herein, i.e. the constant domains need not be truncated just prior to the cysteines forming the interchain disulphide bond. For instance, the entire constant domain except the transmembrane domain (i.e. the extracellular and cytoplasmic domains) could be included. It may be advantageous in this case to mutate one or more of the cysteine residues forming the interchain disulphide bond in the cellular TCR to another amino acid residue which is not involved in disulphide bond formation, or to delete one or more of these residues.
The signal peptide may be omitted if the soluble TCR is to be expressed in prokaryotic cells, for example E. coli, since it does not serve any purpose in the mature TCR for its ligand binding ability, and may in some circumstances prevent the formation of a functional soluble TCR. In most cases, the cleavage site at which the signal peptide is removed from the mature TCR chains is predicted but not experimentally determined. Engineering the expressed TCR chains such that they are a few, i.e. up to about 10 for example, amino acids longer or shorter at the N-terminal end may have no significance for the functionality (i.e. the ability to recognise pMHC) of the soluble TCR. Certain additions which are not present in the original protein sequence could be added. For example, a short tag sequence which can aid in purification of the TCR chains could be added, provided that it does not interfere with the correct structure and folding of the antigen binding site of the TCR.
For expression in E. coli, a methionine residue may be engineered onto the N-terminal starting point of the predicted mature protein sequence in order to enable initiation of translation.
Far from all residues in the variable domains of TCR chains are essential for antigen specificity and functionality. Thus, a significant number of mutations can be introduced in this domain without affecting antigen specificity and functionality. Far from all residues in the constant domains of TCR chains are essential for antigen specificity and functionality. Thus, a significant number of mutations can be introduced in this region without affecting antigen specificity.
The TCR β chain contains a cysteine residue which is unpaired in the cellular or native TCR. It is preferred if this cysteine residue is removed or mutated to another residue to avoid incorrect intrachain or interchain pairing. Substitutions of this cysteine residue for another residue, for example serine or alanine, can have a significant positive effect on refolding efficiencies in vitro.
The disulphide bond may be formed by mutating non-cysteine residues on the respective chains to cysteine, and causing the bond to be formed between the mutated residues. Residues whose respective β carbons are approximately 6 Å (0.6 nm) or less, and preferably in the range 3.5 Å (0.35 nm) to 5.9 Å (0.59 nm) apart in the native TCR are preferred, such that a disulphide bond can be formed between cysteine residues introduced in place of the native residues. It is preferred if the disulphide bond is between residues in the constant immunoglobulin region, although it could be between residues of the membrane proximal region. Preferred sites where cysteines can be introduced to form the disulphide bond are the following residues in exon 1 of TRAC*01 for the TCR α chain and TRBC1*01 or TRBC2*01 for the TCR β chain:
| Native β carbon | |||
| TCR α chain | TCR β chain | separation (nm) | |
| Thr 48 | Ser 57 | 0.473 | |
| Thr 45 | Ser 77 | 0.533 | |
| Tyr 10 | Ser 17 | 0.359 | |
| Thr 45 | Asp 59 | 0.560 | |
| Ser 15 | Glu 15 | 0.59 | |
One sTCR of the present invention is derived from the A6 Tax TCR (Garboczi et al, Nature, 1996, 384(6605): 134-141). In one embodiment, the sTCR comprises the whole of the TCR α chain which is N-terminal of exon 2, residue 4 of TRAC*01 (amino acid residues 1-182 of the α chain according to the numbering used in Garboczi et al) and the whole of the TCR β chain which is N-terminal of exon 2, residue 2 of both TRBC1*01 and TRCB2*01 (amino acid residues 1-210 of the β chain according to the numbering used in Garboczi et al). In order to form the disulphide bond, threonine 48 of exon 1 in TRAC*01 (threonine 158 of the α chain according to the numbering used in Garboczi et al) and serine 57 of exon 1 in both TRBC1*01 and TRBC2*01 (serine 172 of the β chain according to the numbering used in Garboczi et al) may each be mutated to cysteine. These amino acids are located in β strand D of the constant domain of α and β TCR chains respectively.
It is to be noted that, in FIGS. 3a and 3b, residue 1 (according to the numbering used in Garboczi et al) is K and N respectively. The N-terminal methionine residue is not present in native A6 Tax TCR and, as mentioned above, is sometimes present when the respective chains are produced in bacterial expression systems.
Now that the residues in human TCRs which can be mutated into cysteine residues to form a new interchain disulphide bond have been identified, those of skill in the art will be able to mutate any TCR in the same way to produce a soluble form of that TCR having a new interchain disulphide bond. In humans, the skilled person merely needs to look for the following motifs in the respective TCR chains to identify the residue to be mutated (the shaded residue is the residue for mutation to a cysteine).
| α Chain Thr 48: | ||
| (amino acids 39-58 of exon | ||
| 1 of the TRAC*01 gene) (SEQ ID NO:1) | ||
| α Chain Thr 45: | ||
| (amino acids 36-55 of exon 1 | ||
| of the TRAC*01 gene) (SEQ ID NO:2) | ||
| α Chain Tyr 10: | ||
| (amino acids 1-20 of exon 1 of | ||
| the TRAC*01 gene) (SEQ ID NO:3) | ||
| α Chain Ser 15: | ||
| (amino acids 6-25 of exon 1 | ||
| of the TRAC*O1 gene) (SEQ ID NO:4) | ||
| α Chain Ser 57: | ||
| (amino acids 48-67 of exon 1 | ||
| of the TRBC1*01 & TRBC2*01 genes) | ||
| (SEQ ID NO:5) | ||
| β Chain Ser 77: | ||
| (amino acids 68-87 of exon 1 | ||
| of the TRBC1*01 & TRBC2*01 genes) | ||
| (SEQ ID NO:6) | ||
| β Chain Ser 17: | ||
| (amino acids 8-27 of exon 1 of | ||
| the TRBC1*01 & TRBC2*01 genes) | ||
| (SEQ ID NO:7) | ||
| β Chain Asp 59: | ||
| (amino acids 50-69 of exon 1 | ||
| of the TRBC1*01 & TRBC2*01 genes gene) | ||
| (SEQ ID NO:8) | ||
| β Chain Glu 15: | ||
| (amino acids 6-25 of exon 1 of | ||
| the TRBC1*01 & TRBC2*01 genes) | ||
| (SEQ ID NO:9) | ||
In other species, the TCR chains may not have a region which has 100% identity to the above motifs. However, those of skill in the art will be able to use the above motifs to identify the equivalent part of the TCR α or β chain and hence the residue to be mutated to cysteine. Alignment techniques may be used in this respect. For example, ClustalW, available on the European Bioinformatics Institute website can be used to compare the motifs above to a particular TCR chain sequence in order to locate the relevant part of the TCR sequence for mutation.
The present invention includes within its scope human disulphide-linked αβ TCRs, as well as disulphide-linked αβ TCRs of other mammals, including, but not limited to, mouse, rat, pig, goat and sheep. As mentioned above, those of skill in the art will be able to determine sites equivalent to the above-described human sites at which cysteine residues can be introduced to form an inter-chain disulphide bond. For example, the following shows the amino acid sequences of the mouse Cα and Cβ soluble domains, together with motifs showing the murine residues equivalent to the human residues mentioned above that can be mutated to cysteines to form a TCR interchain disulphide bond (where the relevant residues are shaded):
| Mouse Cα soluble domain: |
| PYIQNPEPAVYQLKDPRSQDSTLCLFTDFDSQINVPKTMESGTFITDKTVLDMKAMDS |
| KSNGAIAWSNQTSFTCQDIFKETNATYPSSDVP (SEQ ID NO: 10) |
| Mouse Cβ soluble domain: |
| EDLRNVTPPKVSLFEPSKAEIANKQKATLVCLARGFFPDHVELSWWVNGREVHSGVST |
| DPQAYKESNYSYCLSSRLRVSATFWHNPRNHFRCQVQFHGLSEEDKWPEGSPKPVTQN |
| ISAEAWGRAD (SEQ ID NO:11) |
| Murine equivalent of human α Chain Thr 48: |
| (SEQ ID NO:12) |
| Murine equivalent of human α Chain Thr 45: |
| (SEQ ID NO:13) |
| Murine equivalent of human α Chain Tyr 10: |
| (SEQ ID NO:14) |
| Murine equivalent of human α Chain Ser 15: |
| (SEQ ID NO:15) |
| Murine equivalent of human β Chain Ser 57: |
| (SEQ ID NO:16) |
| Murine equivalent of human β Chain Ser 77: |
| (SEQ ID NO:17) |
| Murine equivalent of human β Chain Ser 17: |
| (SEQ ID NO:18) |
| Murine equivalent of human β Chain Asp 59: |
| (SEQ ID NO:19) |
| Murine equivalent of human β Chain Glu 15: |
| (SEQ ID NO:20) |
In a preferred embodiment of the present invention, (i) and (ii) of the TCR each comprise the functional variable domain of a first TCR fused to all or part of the constant domain of a second TCR, the first and second TCRs being from the same species and the inter-chain disulphide bond being between residues in said respective all or part of the constant domain not present in native TCR. In one embodiment, the first and second TCRs are human. In other words, the disulphide bond-linked constant domains act as a framework on to which variable domains can be fused. The resulting TCR will be substantially identical to the native TCR from which the first TCR is obtained. Such a system allows the easy expression of any functional variable domain on a stable constant domain framework.
The constant domains of the A6 Tax sTCR described above, or indeed the constant domains of any of the mutant αβ TCRs having a new interchain disulphide bond described above, can be used as framework onto which heterologous variable domains can be fused. It is preferred if the fusion protein retains as much of the conformation of the heterologous variable domains as possible. Therefore, it is preferred that the heterologous variable domains are linked to the constant domains at any point between the introduced cysteine residues and the N terminus of the constant domain. For the A6 Tax TCR, the introduced cysteine residues on the α and β chains are preferably located at threonine 48 of exon 1 in TRAC*01 (threonine 158 of the α chain according to the numbering used in Garboczi et al) and serine 57 of exon 1 in both TRBC1*01 and TRBC2*01 (serine 172 of the β chain according to the numbering used in Garboczi et al) respectively. Therefore it is preferred if the heterologous α and β chain variable domain attachment points are between residues 48 (159 according to the numbering used in Garboczi et al) or 58 (173 according to the numbering used in Garboczi et al) and the N terminus of the α or β constant domains respectively.
The residues in the constant domains of the heterologous α and β chains corresponding to the attachment points in the A6 Tax TCR can be identified by sequence homology. The fusion protein is preferably constructed to include all of the heterologous sequence N-terminal to the attachment point.
As is discussed in more detail below, the sTCR of the present invention may be derivatised with, or fused to, a moiety at its C or N terminus. The C terminus is preferred as this is distal from the binding domain. In one embodiment, one or both of the TCR chains have a cysteine residue at its C and/or N terminus to which such a moiety can be fused.
A soluble TCR (which is preferably human) of the present invention may be provided in substantially pure form, or as a purified or isolated preparation. For example, it may be provided in a form which is substantially free of other proteins.
A plurality of soluble TCRs of the present invention may be provided in a multivalent complex. Thus, the present invention provides, in one aspect, a multivalent T cell receptor (TCR) complex, which comprises a plurality of soluble T cell receptors as described herein. Each of the plurality of soluble TCRs is preferably identical.
In another aspect, the invention provides a method for detecting MHC-peptide complexes which method comprises:
(i) providing a soluble T cell receptor or a multivalent T cell receptor complex as described herein;
(ii) contacting the soluble T cell receptor or multivalent TCR complex with the MHC-peptide complexes; and
(iii) detecting binding of the soluble T cell receptor or multivalent TCR complex to the MHC-peptide complexes.
In the multivalent complex of the present invention, the TCRs may be in the form of multimers, and/or may be present on or associated with a lipid bilayer, for example, a liposome.
In its simplest form, a multivalent TCR complex according to the invention comprises a multimer of two or three or four or more T cell receptor molecules associated (e.g. covalently or otherwise linked) with one another, preferably via a linker molecule. Suitable linker molecules include, but are not limited to, multivalent attachment molecules such as avidin, streptavidin, neutravidin and extravidin, each of which has four binding sites for biotin. Thus, biotinylated TCR molecules can be formed into multimers of T cell receptors having a plurality of TCR binding sites. The number of TCR molecules in the multimer will depend upon the quantity of TCR in relation to the quantity of linker molecule used to make the multimers, and also on the presence or absence of any other biotinylated molecules. Preferred multimers are dimeric, trimeric or tetrameric TCR complexes.
Structures which are a good deal larger than TCR tetramers may be used in tracking or targeting cells expressing specific MHC-peptide complex. Preferably the structures are in the range 10 nm to 10 μm in diameter. Each structure may display multiple TCR molecules at a sufficient distance apart to enable two or more TCR molecules on the structure to bind simultaneously to two or more MHC-peptide complexes on a cell and thus increase the avidity of the multimeric binding moiety for the cell.
Suitable structures for use in the invention include membrane structures such as liposomes and solid structures which are preferably particles such as beads, for example latex beads. Other structures which may be externally coated with T cell receptor molecules are also suitable. Preferably, the structures are coated with T cell receptor multimers rather than with individual T cell receptor molecules.
In the case of liposomes, the T cell receptor molecules or multimers thereof may be attached to or otherwise associated with the membrane. Techniques for this are well known to those skilled in the art.
A label or another moiety, such as a toxic or therapeutic moiety, may be included in a multivalent TCR complex of the present invention. For example, the label or other moiety may be included in a mixed molecule multimer. An example of such a multimeric molecule is a tetramer containing three TCR molecules and one peroxidase molecule. This could be achieved by mixing the TCR and the enzyme at a molar ratio of 3:1 to generate tetrameric complexes, and isolating the desired complex from any complexes not containing the correct ratio of molecules. These mixed molecules could contain any combination of molecules, provided that steric hindrance does not compromise or does not significantly compromise the desired function of the molecules. The positioning of the binding sites on the streptavidin molecule is suitable for mixed tetramers since steric hindrance is not likely to occur.
Alternative means of biotinylating the TCR may be possible. For example, chemical biotinylation may be used. Alternative biotinylation tags may be used, although certain amino acids in the biotin tag sequence are essential (Schatz, (1993). Biotechnology N Y 11(10): 1138-43). The mixture used for biotinylation may also be varied. The enzyme requires Mg-ATP and low ionic strength, although both of these conditions may be varied e.g. it may be possible to use a higher ionic strength and a longer reaction time. It may be possible to use a molecule other than avidin or streptavidin to form multimers of the TCR. Any molecule which binds biotin in a multivalent manner would be suitable. Alternatively, an entirely different linkage could be devised (such as poly-histidine tag to chelated nickel ion (Quiagen Product Guide 1999, Chapter 3 “Protein Expression, Purification, Detection and Assay” p. 35-37). Preferably, the tag is located towards the C-terminus of the protein so as to minimise the amount of steric hindrance in the interaction with peptide-MHC complexes.
One or both of the TCR chains may be labelled with a detectable label, for example a label which is suitable for diagnostic purposes. Thus, the invention provides a method for detecting MHC-peptide complexes which method comprises contacting the MHC-peptide complexes with a TCR or multimeric TCR complex in accordance with the invention which is specific for the MHC-peptide complex; and detecting binding of the TCR or multimeric TCR complex to the MHC-peptide complex. In tetrameric TCR formed using biotinylated heterodimers, fluorescent streptavidin (commercially available) can be used to provide a detectable label. A fluorescently-labelled tetramer is suitable for use in FACS analysis, for example to detect antigen presenting cells carrying the peptide for which the TCR is specific.
Another manner in which the soluble TCRs of the present invention may be detected is by the use of TCR-specific antibodies, in particular monoclonal antibodies. There are many commercially available anti-TCR antibodies, such as αF1 and βF1, which recognise the constant regions of the α and β chain, respectively.
The TCR (or multivalent complex thereof) of the present invention may alternatively or additionally be associated with (e.g. covalently or otherwise linked to) a therapeutic agent which may be, for example, a toxic moiety for use in cell killing, or an immunostimulating agent such as an interleukin or a cytokine. A multivalent TCR complex of the present invention may have enhanced binding capability for a pMHC compared to a non-multimeric T cell receptor heterodimer. Thus, the multivalent TCR complexes according to the invention are particularly useful for tracking or targeting cells presenting particular antigens in vitro or in vivo, and are also useful as intermediates for the production of further multivalent TCR complexes having such uses. The TCR or multivalent TCR complex may therefore be provided in a pharmaceutically acceptable formulation for use in vivo.
The invention also provides a method for delivering a therapeutic agent to a target cell, which method comprises contacting potential target cells with a TCR or multivalent TCR complex in accordance with the invention under conditions to allow attachment of the TCR or multivalent TCR complex to the target cell, said TCR or multivalent TCR complex being specific for the MHC-peptide complexes and having the therapeutic agent associated therewith.
In particular, the soluble TCR or multivalent TCR complex can be used to deliver therapeutic agents to the location of cells presenting a particular antigen. This would be useful in many situations and, in particular, against tumours. A therapeutic agent could be delivered such that it would exercise its effect locally but not only on the cell it binds to. Thus, one particular strategy envisages anti-tumour molecules linked to T cell receptors or multivalent TCR complexes specific for tumour antigens.
Many therapeutic agents could be employed for this use, for instance radioactive compounds, enzymes (perforin for example) or chemotherapeutic agents (cis-platin for example). To ensure that toxic effects are exercised in the desired location the toxin could be inside a liposome linked to streptavidin so that the compound is released slowly. This will prevent damaging effects during the transport in the body and ensure that the toxin has maximum effect after binding of the TCR to the relevant antigen presenting cells.
Other suitable therapeutic agents include:
Soluble TCRs or multivalent TCR complexes of the invention may be linked to an enzyme capable of converting a prodrug to a drug. This allows the prodrug to be converted to the drug only at the site where it is required (i.e. targeted by the sTCR).
Examples of suitable MHC-peptide targets for the TCR according to the invention include, but are not limited to, viral epitopes such as HTLV-1 epitopes (e.g. the Tax peptide restricted by HLA-A2; HTLV-1 is associated with leukaemia), HIV epitopes, EBV epitopes, CMV epitopes; melanoma epitopes (e.g. MAGE-1 HLA-A1 restricted epitope) and other cancer-specific epitopes (e.g. the renal cell carcinoma associated antigen G250 restricted by HLA-A2); and epitopes associated with autoimmune disorders, such as rheumatoid arthritis. Further disease-associated pMHC targets, suitable for use in the present invention, are listed in the HLA Factbook (Barclay (Ed) Academic Press), and many others are being identified.
A multitude of disease treatments can potentially be enhanced by localising the drug through the specificity of soluble TCRs.
Viral diseases for which drugs exist, e.g. HIV, SIV, EBV, CMV, would benefit from the drug being released or activated in the near vicinity of infected cells. For cancer, the localisation in the vicinity of tumours or metastasis would enhance the effect of toxins or immunostimulants. In autoimmune diseases, immunosuppressive drugs could be released slowly, having more local effect over a longer time-span while minimally affecting the overall immuno-capacity of the subject. In the prevention of graft rejection, the effect of immunosuppressive drugs could be optimised in the same way. For vaccine delivery, the vaccine antigen could be localised in the vicinity of antigen presenting cells, thus enhancing the efficacy of the antigen. The method can also be applied for imaging purposes.
The soluble TCRs of the present invention may be used to modulate T cell activation by binding to specific pMHC and thereby inhibiting T cell activation. Autoimmune diseases involving T cell-mediated inflammation and/or tissue damage would be amenable to this approach, for example type I diabetes. Knowledge of the specific peptide epitope presented by the relevant pMHC is required for this use.
Medicaments in accordance with the invention will usually be supplied as part of a sterile, pharmaceutical composition which will normally include a pharmaceutically acceptable carrier. This pharmaceutical composition may be in any suitable form, (depending upon the desired method of administering it to a patient). It may be provided in unit dosage form, will generally be provided in a sealed container and may be provided as part of a kit. Such a kit would normally (although not necessarily) include instructions for use. It may include a plurality of said unit dosage forms.
The pharmaceutical composition may be adapted for administration by any appropriate route, for example by the oral (including buccal or sublingual), rectal, nasal, topical (including buccal, sublingual or transdermal), vaginal or parenteral (including subcutaneous, intramuscular, intravenous or intradermal) route. Such compositions may be prepared by any method known in the art of pharmacy, for example by admixing the active ingredient with the carrier(s) or excipient(s) under sterile conditions.
Pharmaceutical compositions adapted for oral administration may be presented as discrete units such as capsules or tablets; as powders or granules; as solutions, syrups or suspensions (in aqueous or non-aqueous liquids; or as edible foams or whips; or as emulsions). Suitable excipients for tablets or hard gelatine capsules include lactose, maize starch or derivatives thereof, stearic acid or salts thereof. Suitable excipients for use with soft gelatine capsules include for example vegetable oils, waxes, fats, semi-solid, or liquid polyols etc.
For the preparation of solutions and syrups, excipients which may be used include for example water, polyols and sugars. For the preparation of suspensions oils (e.g. vegetable oils) may be used to provide oil-in-water or water in oil suspensions.
Pharmaceutical compositions adapted for transdermal administration may be presented as discrete patches intended to remain in intimate contact with the epidermis of the recipient for a prolonged period of time. For example, the active ingredient may be delivered from the patch by iontophoresis as generally described in Pharmaceutical Research, 3(6):318 (1986). Pharmaceutical compositions adapted for topical administration may be formulated as ointments, creams, suspensions, lotions, powders, solutions, pastes, gels, sprays, aerosols or oils. For infections of the eye or other external tissues, for example mouth and skin, the compositions are preferably applied as a topical ointment or cream. When formulated in an ointment, the active ingredient may be employed with either a paraffinic or a water-miscible ointment base. Alternatively, the active ingredient may be formulated in a cream with an oil-in-water cream base or a water-in-oil base. Pharmaceutical compositions adapted for topical administration to the eye include eye drops wherein the active ingredient is dissolved or suspended in a suitable carrier, especially an aqueous solvent. Pharmaceutical compositions adapted for topical administration in the mouth include lozenges, pastilles and mouth washes.
Pharmaceutical compositions adapted for rectal administration may be presented as suppositories or enemas. Pharmaceutical compositions adapted for nasal administration wherein the carrier is a solid include a coarse powder having a particle size for example in the range 20 to 500 microns which is administered in the manner in which snuff is taken, i.e. by rapid inhalation through the nasal passage from a container of the powder held close up to the nose. Suitable compositions wherein the carrier is a liquid, for administration as a nasal spray or as nasal drops, include aqueous or oil solutions of the active ingredient. Pharmaceutical compositions adapted for administration by inhalation include fine particle dusts or mists which may be generated by means of various types of metered dose pressurised aerosols, nebulizers or insufflators. Pharmaceutical compositions adapted for vaginal administration may be presented as pessaries, tampons, creams, gels, pastes, foams or spray formulations. Pharmaceutical compositions adapted for parenteral administration include aqueous and non-aqueous sterile injection solution which may contain anti-oxidants, buffers, bacteriostats and solutes which render the formulation substantially isotonic with the blood of the intended recipient; and aqueous and non-aqueous sterile suspensions which may include suspending agents and thickening agents. Excipients which may be used for injectable solutions include water, alcohols, polyols, glycerine and vegetable oils, for example. The compositions may be presented in unit-dose or multi-dose containers, for example sealed ampoules and vials, and may be stored in a freeze-dried (lyophilized) condition requiring only the addition of the sterile liquid carried, for example water for injections, immediately prior to use. Extemporaneous injection solutions and suspensions may be prepared from sterile powders, granules and tablets.
The pharmaceutical compositions may contain preserving agents, solubilising agents, stabilising agents, wetting agents, emulsifiers, sweeteners, colourants, odourants, salts (substances of the present invention may themselves be provided in the form of a pharmaceutically acceptable salt), buffers, coating agents or antioxidants. They may also contain therapeutically active agents in addition to the substance of the present invention.
Dosages of the substances of the present invention can vary between wide limits, depending upon the disease or disorder to be treated, the age and condition of the individual to be treated, etc. and a physician will ultimately determine appropriate dosages to be used. The dosage may be repeated as often as appropriate. If side effects develop the amount and/or frequency of the dosage can be reduced, in accordance with normal clinical practice.
Gene cloning techniques may be used to provide a sTCR of the invention, preferably in substantially pure form. These techniques are disclosed, for example, in J. Sambrook et al Molecular Cloning 2nd Edition, Cold Spring Harbor Laboratory Press (1989). Thus, in a further aspect, the present invention provides a nucleic acid molecule comprising a sequence encoding a chain of the soluble TCR of the present invention, or a sequence complementary thereto. Such nucleic acid sequences may be obtained by isolating TCR-encoding nucleic acid from T-cell clones and making appropriate mutations (by insertion, deletion or substitution).
The nucleic acid molecule may be in isolated or recombinant form. It may be incorporated into a vector and the vector may be incorporated into a host cell. Such vectors and suitable hosts form yet further aspects of the present invention.
The invention also provides a method for obtaining a TCR chain, which method comprises incubating such a host cell under conditions causing expression of the TCR chain and then purifying the polypeptide.
The soluble TCRs of the present invention may obtained by expression in a bacterium such as E. coli as inclusion bodies, and subsequent refolding in vitro.
Refolding of the TCR chains may take place in vitro under suitable refolding conditions. In a particular embodiment, a TCR with correct conformation is achieved by refolding solubilised TCR chains in a refolding buffer comprising a solubilising agent, for example urea. Advantageously, the urea may be present at a concentration of at least 0.1M or at least 1M or at least 2.5M, or about 5M. An alternative solubilising agent which may be used is guanidine, at a concentration of between 0.1M and 8M, preferably at least 1M or at least 2.5M. Prior to refolding, a reducing agent is preferably employed to ensure complete reduction of cysteine residues. Further denaturing agents such as DTT and guanidine may be used as necessary. Different denaturants and reducing agents may be used prior to the refolding step (e.g. urea, β-mercaptoethanol). Alternative redox couples may be used during refolding, such as a cystamine/cysteamine redox couple, DTT or β-mercaptoethanol/atmospheric oxygen, and cysteine in reduced and oxidised forms.
Folding efficiency may also be increased by the addition of certain other protein components, for example chaperone proteins, to the refolding mixture. Improved refolding has been achieved by passing protein through columns with immobilised mini-chaperones (Altamirano, et al. (1999). Nature Biotechnology 17: 187-191; Altamirano, et al. (1997). Proc Natl Acad Sci USA 94(8): 3576-8).
Alternatively, soluble TCR the present invention may obtained by expression in a eukaryotic cell system, such as insect cells.
Purification of the TCR may be achieved by many different means. Alternative modes of ion exchange may be employed or other modes of protein purification may be used such as gel filtration chromatography or affinity chromatography.
Soluble TCRs and multivalent TCR complexes of the present invention also find use in screening for agents, such as small chemical compounds, which have the ability to inhibit the binding of the TCR to its pMHC complex. Thus, in a further aspect, the present invention provides a method for screening for an agent which inhibits the binding of a T cell receptor to a peptide-MHC complex, comprising monitoring the binding of a soluble T cell receptor of the invention with a peptide-MHC complex in the presence of an agent; and selecting agents which inhibit such binding.
Suitable techniques for such a screening method include the Surface Plasmon Resonance-based method described in WO 01/22084. Other well-known techniques that could form the basis of this screening method are Scintillation Proximity Analysis (SPA) and Amplified Luminescent Proximity Assay.
Agents selected by screening methods of the invention can be used as drugs, or as the basis of a drug development programme, being modified or otherwise improved to have characteristics making them more suitable for administration as a medicament. Such medicaments can be used for the treatment of conditions which include an unwanted T cell response component. Such conditions include cancer (e.g. renal, ovarian, bowel, head & neck, testicular, lung, stomach, cervical, bladder, prostate or melanoma), autoimmune disease, graft rejection and graft versus host disease.
Preferred features of each aspect of the invention are as for each of the other aspects mutatis mutandis. The prior art documents mentioned herein are incorporated to the fullest extent permitted by law.
The invention is further described in the following examples, which do not limit the scope of the invention in any way.
Reference is made in the following to the accompanying drawings in which:
FIG. 1 is a schematic diagram of a soluble TCR with an introduced inter-chain di-sulphide bond in accordance with the invention;
FIGS. 2a and 2b show respectively the nucleic acid sequences of the α (SEQ ID NO:107) and β (SEQ ID NO:108) chains of a soluble A6 TCR, mutated so as to introduce a cysteine codon. The shading indicates the introduced cysteine codon;
FIG. 3a shows the A6 TCR α chain extracellular amino acid sequence (SEQ ID NO:128), including the T48→C mutation (underlined) used to produce the novel disulphide inter-chain bond, and FIG. 3b shows the A6 TCR β chain extracellular amino acid sequence (SEQ ID NO:109), including the S57→C mutation (underlined) used to produce the novel disulphide inter-chain bond;
FIG. 4 is a trace obtained after anion exchange chromatography of soluble A6 TCR, showing protein elution from a POROS 50HQ column using a 0-500 mM NaCl gradient, as indicated by the dotted line;
FIG. 5—A. Reducing SDS-PAGE (Coomassie-stained) of fractions from column run in FIG. 4, as indicated. B. Non-reducing SDS-PAGE (Coomassie-stained) of fractions from column run in FIG. 4, as indicated. Peak 1 clearly contains mainly non-disulphide linked β-chain, peak 2 contains TCR heterodimer which is inter-chain disulphide linked, and the shoulder is due to E. coli contaminants, mixed in with the inter-chain disulphide linked sTCR, which are poorly visible on this reproduction;
FIG. 6 is a trace obtained from size-exclusion chromatography of pooled fractions from peak 1 in FIG. 5. The protein elutes as a single major peak, corresponding to the heterodimer;
FIG. 7 is a BIAcore response curve of the specific binding of disulphide-linked A6 soluble TCR to HLA-A2-tax complex. Insert shows binding response compared to control for a single injection of disulphide-linked A6 soluble TCR;
FIG. 8a shows the A6 TCR α chain sequence (SEQ ID NO:107) including novel cysteine residue mutated to incorporate a BamH1 restriction site. Shading indicates the mutations introduced to form the BamH1 restriction site. FIGS. 8b and 8c show the DNA sequence of α (SEQ ID NO:107) and β (SEQ ID NO:112) chain of the JM22 TCR mutated to include additional cysteine residues to form a non-native disulphide bond;
FIGS. 9a and 9b show respectively the JM22 TCR α (SEQ ID NO:113) and β (SEQ ID NO:114) chain extracellular amino acid sequences produced from the DNA sequences of FIGS. 8a and 8b;
FIG. 10 is a trace obtained after anion exchange chromatography of soluble disulphide-linked JM22 TCR showing protein elution from a POROS 50HQ column using a 0-500 mM NaCl gradient, as indicated by the dotted line;
FIG. 11a shows a reducing SDS-PAGE (Coomassie-stained) of fractions from column run in FIG. 10, as indicated and FIG. 11b shows a non-reducing SDS-PAGE (Coomassie-stained) of fractions from column run in FIG. 10, as indicated. Peak 1 clearly contains TCR heterodimer which is inter-chain disulphide linked.
FIG. 12 is a trace obtained from size-exclusion chromatography of pooled fractions from peak 1 in FIG. 10. The protein elutes as a single major peak, corresponding to the heterodimer. Yield is 80%;
FIG. 13—A. BIAcore response curve of the specific binding of disulphide-linked JM22 soluble TCR to HLA-Flu complex. B. Binding response compared to control for a single injection of disulphide-linked JM22 soluble TCR;
FIGS. 14a and 14b show the DNA sequence of α (SEQ ID NO:115) and β (SEQ ID NO:116) chain of the NY-ESO mutated to include additional cysteine residues to form a non-native disulphide bond;
FIGS. 15a and 15b show respectively the NY-ESO TCR α (SEQ ID NO:117) and β (SEQ ID NO:118) chain extracellular amino acid sequences produced from the DNA sequences of FIGS. 14a and 14b
FIG. 16 is a trace obtained from anion exchange chromatography of soluble NY-ESO disulphide-linked TCR showing protein elution from a POROS 50HQ column using a 0-500 mM NaCl gradient, as indicated by the dotted line;
FIG. 17—A. Reducing SDS-PAGE (Coomassie-stained) of fractions from column run in FIG. 16, as indicated. B. Non-reducing SDS-PAGE (Coomassie-stained) of fractions from column run in FIG. 16, as indicated. Peak 1 and 2 clearly contain TCR heterodimer which is inter-chain disulphide linked;
FIG. 18. Size-exclusion chromatography of pooled fractions from peak 1 (A) and peak 2 (B) in FIG. 17. The protein elutes as a single major peak, corresponding to the heterodimer;
FIG. 19 shows a BIAcore response curve of the specific binding of disulphide-linked NY-ESO soluble TCR to HLA-NYESO complex. A. peak 1, B. peak 2;
FIGS. 20a and 20b show respectively the DNA sequences of the α (SEQ ID NO:119) and β (SEQ ID NO:120) chains of a soluble NY-ESO TCR, mutated so as to introduce a novel cysteine codon (indicated by shading). The sequences include the cysteine involved in the native disulphide inter-chain bond (indicated by the codon in bold);
FIGS. 21a and 21b show respectively the NY-ESO TCR α (SEQ ID NO:121) and β (SEQ ID NO:122) chain extracellular amino acid sequences produced from the DNA sequences of FIGS. 20a and 21b;
FIG. 22 shows a trace obtained from anion exchange chromatography of soluble NY-ESO TCRαcysβcys showing protein elution from a POROS 50HQ column using a 0-500 mM NaCl gradient, as indicated by the dotted line;
FIG. 23 shows a trace obtained from anion exchange chromatography of soluble NY-ESO TCRαcys showing protein elution from a POROS 50HQ column using a 0-500 mM NaCl gradient, as indicated by the dotted line;
FIG. 24 shows a trace obtained from anion exchange chromatography of soluble NY-ESO TCRβcys showing protein elution from a POROS 50HQ column using a 0-500 mM NaCl gradient, as indicated by the dotted line;
FIG. 25 shows a reducing SDS-PAGE (Coomassie-stained) of NY-ESO TCRαcys βcys, TCRαcys, and TCRβcys fractions from anion exchange column runs in FIGS. 22-24 respectively. Lanes 1 and 7 are MW markers, lane 2 is NYESOdsTCR1g4 α-cys β peak (EB/084/033); lane 3 is NYESOdsTCR1g4 α-cys β small peak (EB/084/033), lane 4 is NYESOdsTCR1g4 α β-cys (EB/084/034), lane 5 is NYESOdsTCR1g4 α-cys β-cys small peak (EB/084/035), and lane 6 is NYESOdsTCR1g4 α-cys β-cys peak (EB/084/035);
FIG. 26 shows a non-reducing SDS-PAGE (Coomassie-stained) of NY-ESO TCRαcysβcys, TCRαcys, and TCRβcys fractions from anion exchange column runs in FIGS. 22-24 respectively. Lanes 1 and 7 are MW markers, lane 2 is NYESOdsTCR1g4 α-cys β peak (EB/084/033); lane 3 is NYESOdsTCR1g4 α-cys β small peak (EB/084/033), lane 4 is NYESOdsTCR1g4 α β-cys (EB/084/034), lane 5 is NYESOdsTCR1g4 α-cys β-cys small peak (EB/084/035), and lane 6 is NYESOdsTCR1g4 α-cys β-cys peak (EB/084/035);
FIG. 27 is a trace obtained from size exclusion exchange chromatography of soluble NY-ESO TCRαcysβcys showing protein elution of pooled fractions from FIG. 22. The protein elutes as a single major peak, corresponding to the heterodimer;
FIG. 28 is a trace obtained from size exclusion exchange chromatography of soluble NY-ESO TCRαcys showing protein elution of pooled fractions from FIG. 22. The protein elutes as a single major peak, corresponding to the heterodimer;
FIG. 29 is a trace obtained from size exclusion exchange chromatography of soluble NY-ESO TCRβcys showing protein elution of pooled fractions from FIG. 22. The protein elutes as a single major peak, corresponding to the heterodimer;
FIG. 30 is a BIAcore response curve of the specific binding of NY-ESO TCRαcys βcys to HLA-NY-ESO complex;
FIG. 31 is a BIAcore response curve of the specific binding of NY-ESO TCRαcys to HLA-NY-ESO complex;
FIG. 32 is a BIAcore response curve of the specific binding of NY-ESO TCRβcys to HLA-NY-ESO complex;
FIGS. 33a and 33b show respectively the DNA sequences of the α (SEQ ID NO:123) and β (SEQ ID NO:124) chains of a soluble AH-1.23 TCR, mutated so as to introduce a novel cysteine codon (indicated by shading). The sequences include the cysteine involved in the native disulphide inter-chain bond (indicated by the codon in bold);
FIGS. 34a and 34b show respectively the AH-1.23 TCR α (SEQ ID NO:125) and β (SEQ ID NO:126) chain extracellular amino acid sequences produced from the DNA sequences of FIGS. 33a and 33b;
FIG. 35 is a trace obtained from anion exchange chromatography of soluble AH-1.23 TCR showing protein elution from a POROS 50HQ column using a 0-500 mM NaCl gradient, as indicated by the dotted line;
FIG. 36 is a reducing SDS-PAGE (10% Bis-Tris gel, Coomassie-stained) of AH-1.23 TCR fractions from anion exchange column run in FIG. 35. Proteins examined are the anion exchange fractions of TCR 1.23 S-S from refold 3. Lane 1 is MW markers, lane 2 is B4, lane 3 is C2, lane 4 is C3, lane 5 is C4, lane 6 is C5, lane 7 is C6, lane 8 is C7, lane 9 is C8, and lane 10 is C9;
FIG. 37 is a non-reducing SDS-PAGE (10% Bis-Tris gel, Coomassie-stained) of AH-1.23 TCR fractions from anion exchange column run in FIG. 35. Proteins examined are the anion exchange fractions of TCR 1.23 S-S from refold 3. Lane 1 is MW markers, lane 2 is B4, lane 3 is C2, lane 4 is C3, lane 5 is C4, lane 6 is C5, lane 7 is C6, lane 8 is C7, lane 9 is C8, and lane 10 is C9;
FIG. 38 is a trace obtained from size exclusion exchange chromatography of soluble AH-1.23 TCR showing protein elution of pooled fractions from FIG. 35. The protein elutes as a single major peak, corresponding to the heterodimer;
FIGS. 39a and 39b show respectively the DNA (SEQ ID NO:127) and amino acid (SEQ ID NO:128) sequences of the α chain of a soluble A6 TCR, mutated so as to introduce a novel cysteine at residue 48 in exon 1 of TRAC*01. The shaded nucleotides indicate the introduced novel cysteine codon and the underlined amino acid indicates the introduced cysteine;
FIGS. 40a and 40b show respectively the DNA (SEQ ID NO:129) and amino acid (SEQ ID NO:130) sequences of the α chain of a soluble A6 TCR, mutated so as to introduce a novel cysteine at residue 45 in exon 1 of TRAC*01. The shaded nucleotides indicate the introduced novel cysteine codon and the underlined amino acid indicates the introduced cysteine;
FIGS. 41a and 41b show respectively the DNA (SEQ ID NO:131) and amino acid (SEQ ID NO:132) sequences of the α chain of a soluble A6 TCR, mutated so as to introduce a novel cysteine at residue 61 in exon 1 of TRAC*01. The shaded nucleotides indicate the introduced novel cysteine codon and the underlined amino acid indicates the introduced cysteine;
FIGS. 42a and 42b show respectively the DNA (SEQ ID NO:133) and amino acid (SEQ ID NO:134) sequences of the α chain of a soluble A6 TCR, mutated so as to introduce a novel cysteine at residue 50 in exon 1 of TRAC*01. The shaded nucleotides indicate the introduced novel cysteine codon and the underlined amino acid indicates the introduced cysteine;
FIGS. 43a and 43b show respectively the DNA (SEQ ID NO:135) and amino acid (SEQ ID NO:136) sequences of the α chain of a soluble A6 TCR, mutated so as to introduce a novel cysteine at residue 10 in exon 1 of TRAC*01. The shaded nucleotides indicate the introduced novel cysteine codon and the underlined amino acid indicates the introduced cysteine;
FIGS. 44a and 44b show respectively the DNA (SEQ ID NO:137) and amino acid (SEQ ID NO:138) sequences of the α chain of a soluble A6 TCR, mutated so as to introduce a novel cysteine at residue 15 in exon 1 of TRAC*01. The shaded nucleotides indicate the introduced novel cysteine codon and the underlined amino acid indicates the introduced cysteine;
FIGS. 45a and 45b show respectively the DNA (SEQ ID NO:139) and amino acid (SEQ ID NO:140) sequences of the α chain of a soluble A6 TCR, mutated so as to introduce a novel cysteine at residue 12 in exon 1 of TRAC*01. The shaded nucleotides indicate the introduced novel cysteine codon and the underlined amino acid indicates the introduced cysteine;
FIGS. 46a and 46b show respectively the DNA (SEQ ID NO:141) and amino acid (SEQ ID NO:142) sequences of the α chain of a soluble A6 TCR, mutated so as to introduce a novel cysteine at residue 22 in exon 1 of TRAC*01. The shaded nucleotides indicate the introduced novel cysteine codon and the underlined amino acid indicates the introduced cysteine;
FIGS. 47a and 47b show respectively the DNA (SEQ ID NO:143) and amino acid (SEQ ID NO:144) sequences of the α chain of a soluble A6 TCR, mutated so as to introduce a novel cysteine at residue 52 in exon 1 of TRAC*01. The shaded nucleotides indicate the introduced novel cysteine codon and the underlined amino acid indicates the introduced cysteine;
FIGS. 48a and 48b show respectively the DNA (SEQ ID NO:145) and amino acid (SEQ ID NO:146) sequences of the α chain of a soluble A6 TCR, mutated so as to introduce a novel cysteine at residue 43 in exon 1 of TRAC*01. The shaded nucleotides indicate the introduced novel cysteine codon and the underlined amino acid indicates the introduced cysteine;
FIGS. 49a and 49b show respectively the DNA (SEQ ID NO:147) and amino acid (SEQ ID NO:148) sequences of the α chain of a soluble A6 TCR, mutated so as to introduce a novel cysteine at residue 57 in exon 1 of TRAC*01. The shaded nucleotides indicate the introduced novel cysteine codon and the underlined amino acid indicates the introduced cysteine;
FIGS. 50a and 50b show respectively the DNA (SEQ ID NO:149) and amino acid (SEQ ID NO:150) sequences of the β chain of a soluble A6 TCR, mutated so as to introduce a novel cysteine at residue 77 in exon 1 of TRBC2*01. The shaded nucleotides indicate the introduced novel cysteine codon and the underlined amino acid indicates the introduced cysteine;
FIGS. 51a and 51b show respectively the DNA (SEQ ID NO:151) and amino acid (SEQ ID NO:152) sequences of the β chain of a soluble A6 TCR, mutated so as to introduce a novel cysteine at residue 17 in exon 1 of TRBC2*01. The shaded nucleotides indicate the introduced novel cysteine codon and the underlined amino acid indicates the introduced cysteine;
FIGS. 52a and 52b show respectively the DNA (SEQ ID NO:153) and amino acid (SEQ ID NO:154) sequences of the β chain of a soluble A6 TCR, mutated so as to introduce a novel cysteine at residue 13 in exon 1 of TRBC2*01. The shaded nucleotides indicate the introduced novel cysteine codon and the underlined amino acid indicates the introduced cysteine;
FIGS. 53a and 53b show respectively the DNA (SEQ ID NO:155) and amino acid (SEQ ID NO:156) sequences of the β chain of a soluble A6 TCR, mutated so as to introduce a novel cysteine at residue 59 in exon 1 of TRBC2*01. The shaded nucleotides indicate the introduced novel cysteine codon and the underlined amino acid indicates the introduced cysteine;
FIGS. 54a and 54b show respectively the DNA (SEQ ID NO:157) and amino acid (SEQ ID NO:158) sequences of the β chain of a soluble A6 TCR, mutated so as to introduce a novel cysteine at residue 79 in exon 1 of TRBC2*01. The shaded nucleotides indicate the introduced novel cysteine codon and the underlined amino acid indicates the introduced cysteine;
FIGS. 55a and 55b show respectively the DNA (SEQ ID NO:159) and amino acid (SEQ ID NO:160) sequences of the β chain of a soluble A6 TCR, mutated so as to introduce a novel cysteine at residue 14 in exon 1 of TRBC2*01. The shaded nucleotides indicate the introduced novel cysteine codon and the underlined amino acid indicates the introduced cysteine;
FIGS. 56a and 56b show respectively the DNA (SEQ ID NO:161) and amino acid (SEQ ID NO:162) sequences of the β chain of a soluble A6 TCR, mutated so as to introduce a novel cysteine at residue 55 in exon 1 of TRBC2*01. The shaded nucleotides indicate the introduced novel cysteine codon and the underlined amino acid indicates the introduced cysteine;
FIGS. 57a and 57b show respectively the DNA (SEQ ID NO:163) and amino acid (SEQ ID NO:164) sequences of the β chain of a soluble A6 TCR, mutated so as to introduce a novel cysteine at residue 63 in exon 1 of TRBC2*01. The shaded nucleotides indicate the introduced novel cysteine codon and the underlined amino acid indicates the introduced cysteine;
FIGS. 58a and 58b show respectively the DNA (SEQ ID NO:165) and amino acid (SEQ ID NO:166) sequences of the β chain of a soluble A6 TCR, mutated so as to introduce a novel cysteine at residue 15 in exon 1 of TRBC2*01. The shaded nucleotides indicate the introduced novel cysteine codon and the underlined amino acid indicates the introduced cysteine;
FIGS. 59-64 are traces obtained from anion exchange chromatography of soluble A6 TCR containing a novel disulphide inter-chain bond between: residues 48 of exon 1 of TRAC*01 and 57 of exon 1 of TRBC2*01; residues 45 of exon 1 of TRAC*01 and 77 of exon 1 of TRBC2*01; residues 10 of exon 1 of TRAC*01 and 17 of exon 1 of TRBC2*01; residues 45 of exon 1 of TRAC*01 and 59 of exon 1 of TRBC2*01; residues 52 of exon 1 of TRAC*01 and 55 of exon 1 of TRBC2*01; residues 15 of exon 1 of TRAC*01 and 15 of exon 1 of TRBC2*01, respectively, showing protein elution from a POROS 50 column using a 0-500 mM NaCl gradient, as indicated by the dotted line;
FIGS. 65a and 65b are, respectively, reducing and non-reducing SDS-PAGE (Coomassie-stained) of soluble A6 TCR containing a novel disulphide inter-chain bond between residues 48 of exon 1 of TRAC*01 and 57 of exon 1 of TRBC2*01, fractions run were collected from anion exchange column run in FIG. 59;
FIGS. 66a and 66b are, respectively, reducing and non-reducing SDS-PAGE (Coomassie-stained) of soluble A6 TCR containing a novel disulphide inter-chain bond between residues 45 of exon 1 of TRAC*01 and 77 of exon 1 of TRBC2*01, fractions run were collected from anion exchange column run in FIG. 60;
FIGS. 67a and 67b are, respectively, reducing and non-reducing SDS-PAGE (Coomassie-stained) of soluble A6 TCR containing a novel disulphide inter-chain bond between residues 10 of exon 1 of TRAC*01 and 17 exon 1 of TRBC2*01, fractions run were collected from anion exchange column run in FIG. 61;
FIGS. 68a and 68b are, respectively, reducing and non-reducing SDS-PAGE (Coomassie-stained) of soluble A6 TCR containing a novel disulphide inter-chain bond between residues 45 of exon 1 of TRAC*01 and 59 of exon 1 of TRBC2*01, fractions run were collected from anion exchange column run in FIG. 62;
FIGS. 69a and 69b are, respectively, reducing and non-reducing SDS-PAGE (Coomassie-stained) of soluble A6 TCR containing a novel disulphide inter-chain bond between residues 52 of exon 1 of TRAC*01 and 55 of exon 1 of TRBC2*01, fractions run were collected from anion exchange column run in FIG. 63;
FIGS. 70a and 70b are, respectively, reducing and non-reducing SDS-PAGE (Coomassie-stained) of soluble A6 TCR containing a novel disulphide inter-chain bond between residues 15 of exon 1 of TRAC*01 and 15 of exon 1 of TRBC2*01, fractions run were collected from anion exchange column run in FIG. 64;
FIG. 71 is a trace obtained from size exclusion chromatography of soluble A6 TCR containing a novel disulphide inter-chain bond between residues 48 of exon 1 of TRAC*01 and 57 of exon 1 of TRBC2*01, showing protein elution from a Superdex 200 HL gel filtration column. Fractions run were collected from anion exchange column run in FIG. 59;
FIG. 72 is a trace obtained from size exclusion chromatography of soluble A6 TCR containing a novel disulphide inter-chain bond between residues 45 of exon 1 of TRAC*01 and 77 of exon 1 of TRBC2*01, showing protein elution from a Superdex 200 HL gel filtration column. Fractions run were collected from anion exchange column run in FIG. 60;
FIG. 73 is a trace obtained from size exclusion chromatography of soluble A6 TCR containing a novel disulphide inter-chain bond between residues 10 of exon 1 of TRAC*01 and 17 of exon 1 of TRBC2*01, showing protein elution from a Superdex 200 HL gel filtration column. Fractions run were collected from anion exchange column run in FIG. 61;
FIG. 74 is a trace obtained from size exclusion chromatography of soluble A6 TCR containing a novel disulphide inter-chain bond between residues 45 of exon 1 of TRAC*01 and 59 of exon 1 of TRBC2*01, showing protein elution from a Superdex 200 HL gel filtration column. Fractions run were collected from anion exchange column run in FIG. 62;
FIG. 75 is a trace obtained from size exclusion chromatography of soluble A6 TCR containing a novel disulphide inter-chain bond between residues 52 of exon 1 of TRAC*01 and 55 of exon 1 of TRBC2*01, showing protein elution from a Superdex 200 HL gel filtration column. Fractions run were collected from anion exchange column run in FIG. 63;
FIG. 76 is a trace obtained from size exclusion chromatography of soluble A6 TCR containing a novel disulphide inter-chain bond between residues 15 of exon 1 of TRAC*01 and 15 of exon 1 of TRBC2*01, showing protein elution from a Superdex 200 HL gel filtration column. Fractions run were collected from anion exchange column run in FIG. 64; and
FIGS. 77-80 are BIAcore response curves showing, respectively, binding of soluble A6 TCR containing a novel disulphide inter-chain bond between: residues 48 of exon 1 of TRAC*01 and 57 of exon 1 of TRBC2*01; residues 45 of exon 1 of TRAC*01 and 77 of exon 1 of TRBC2*01; residues 10 of exon 1 of TRAC*01 and 17 of exon 1 of TRBC2*01; and residues 45 of exon 1 of TRAC*01 and 59 of exon 1 of TRBC2*01 to HLA-A2-tax pMHC.
FIG. 81 is a BIAcore trace showing non-specific binding of soluble A6 TCR containing a novel disulphide inter-chain bond between residues 52 of exon 1 of TRAC*01 and 55 of exon 1 of TRBC2*01 to HLA-A2-tax and to HLA-A2-NY-ESO pMHC;
FIG. 82 is a BIAcore response curve showing binding of soluble A6 TCR containing a novel disulphide inter-chain bond between residues 15 of exon 1 of TRAC*01 and 15 of exon 1 of TRBC2*01 to HLA-A2-tax pMHC;
FIG. 83a is an electron density map around the model with 1BD2 sequence (Chain A Thr164, Chain B Ser 174). Map contoured at 1.0, 2.0 and 3.0 σ. FIG. 83b is an electron density map after refinement with Cys in the two positions A1164 and B174. The map is contoured at the same σ levels as for FIG. 83a;
FIG. 84 compares the structures of 1BD2 TCR with an NY-ESO TCR of the present invention by overlaying said structures in ribbon and coil representations;
FIGS. 85a and 85b show the DNA (SEQ ID NO:167) and amino acid sequences (SEQ ID NO:168) respectively of the β chain of the NY-ESO TCR incorporating a biotin recognition site. The biotin recognition site is highlighted;
FIGS. 86a and 86b show the DNA (SEQ ID NO:169) and amino acid (SEQ ID NO:170) sequences respectively of the β chain of the NY-ESO TCR incorporating the hexa-hisitidine tag. The hexa-hisitidine tag is highlighted;
FIG. 87 illustrates the elution of soluble NY-ESO TCR containing a novel disulphide bond and a biotin recognition sequence from a POROS 50HQ anion exchange column using a 0-500 mM NaCl gradient, as indicated by the dotted line;
FIG. 88 illustrates the elution of soluble NY-ESO TCR containing a novel disulphide bond and a hexa-histidine tag from a POROS 50HQ anion exchange columns using a 0-500 mM NaCl gradient, as indicated by the dotted line;
FIG. 89 is a protein elution profile from gel filtration chromatography of pooled fractions from the NY-ESO-biotin tagged anion exchange column run illustrated by FIG. 87;
FIG. 90 is a protein elution profile from gel filtration chromatography of pooled fractions from the NY-ESO-hexa-histidine tagged anion exchange column run illustrated by FIG. 88;
FIGS. 91a-h are FACS histograms illustrating the staining intensity produced from 25,000 events for HLA-A2 positive EBV transformed B cell line (PP LCL) incubated with the following concentrations of NY-ESO peptide and fluorescent NY-ESO TCR tetramers respectively: NYESO 0 TCR 5 μg, NYESO 10−4M TCR 5 μg, NYESO 10−5M TCR 5 μg, NYESO 10−6M TCR 5 μg, NYESO 0 TCR 10 μg, NYESO 10−4M TCR 10 μg, NYESO 10−5M TCR 10 μg, NYESO 10−6M TCR 10 μg;
FIG. 92 is the DNA sequence (SEQ ID NO:165) of the beta-chain of A6 TCR incorporating the TRBC1*01 constant region;
FIG. 93 is an anion exchange chromatography trace of soluble A6 TCR incorporating the TRBC1*01 constant region showing protein elution from a POROS 50HQ column using a 0-500 mM NaCl gradient, as indicated by the dotted line;
FIG. 94—A. Reducing SDS-PAGE (Coomassie-stained) of fractions from column run in FIG. 93, as indicated. B. Non-reducing SDS-PAGE (Coomassie-stained) of fractions from column run in FIG. 93, as indicated;
FIG. 95—Size-exclusion chromatography of pooled fractions from peak 2 in FIG. 93. Peak 1 contains TCR heterodimer which is inter-chain disulphide linked;
FIG. 96—A. BIAcore analysis of the specific binding of disulphide-linked A6 soluble TCR to HLA-Flu complex. B. Binding response compared to control for a single injection of disulphide-linked A6 soluble TCR;
FIG. 97 shows the nucleic acid sequence (SEQ ID NO:165) of the mutated beta chain of the A6 TCR incorporating the ‘free’ cysteine;
FIG. 98—Anion exchange chromatography of soluble A6 TCR incorporating the ‘free’ cysteine showing protein elution from a POROS 50HQ column using a 0-500 mM NaCl gradient, as indicated by the dotted line;
FIG. 99—A. Reducing SDS-PAGE (Coomassie-stained) of fractions from column run in FIG. 98, as indicated. B. Non-reducing SDS-PAGE (Coomassie-stained) of fractions from column run in FIG. 98, as indicated;
FIG. 100—Size-exclusion chromatography of pooled fractions from peak 2 in FIG. 98. Peak 1 contains TCR heterodimer which is inter-chain disulphide linked;
FIG. 101—A. BIAcore analysis of the specific binding of disulphide-linked A6 soluble TCR incorporating the ‘free’ cysteine to HLA-Flu complex. B. Binding response compared to control for a single injection of disulphide-linked A6 soluble TCR;
FIG. 102 shows the nucleic acid sequence (SEQ ID NO:173) of the mutated beta chain of the A6 TCR incorporating a serine residue mutated in for the ‘free’ cysteine;
FIG. 103—Anion exchange chromatography of soluble A6 TCR incorporating a serine residue mutated in for the ‘free’ cysteine showing protein elution from a POROS 50HQ column using a 0-500 mM NaCl gradient, as indicated by the dotted line;
FIG. 104—A. Reducing SDS-PAGE (Coomassie-stained) of fractions from column run in FIG. 103, as indicated. B. Non-reducing SDS-PAGE (Coomassie-stained) of fractions from column run in FIG. 103, as indicated. Peak 2 clearly contains TCR heterodimer which is inter-chain disulphide linked;
FIG. 105—Size-exclusion chromatography of pooled fractions from peak 2 in FIG. 103. Peak 1 contains TCR heterodimer which is inter-chain disulphide linked;
FIG. 106—A. BIAcore analysis of the specific binding of disulphide-linked A6 soluble TCR incorporating a serine residue mutated in for the ‘free’ cysteine to HLA-Flu complex. B. Binding response compared to control for a single injection of disulphide-linked A6 soluble TCR;
FIG. 107 shows the nucleotide sequence of pYX112 (SEQ ID NO:174);
FIG. 108 shows the nucleotide sequence of pYX122 (SEQ ID NO:175);
FIG. 109 shows the DNA (SEQ ID NO:177) and protein (SEQ ID NO:178) sequences of pre-pro mating factor alpha fused to TCR α chain;
FIG. 110 shows the DNA (SEQ ID NO:179) and protein (SEQ ID NO:178) sequence of pre-pro mating factor alpha fused to TCR β chain;
FIG. 111 shows a Western Blot of soluble TCR expressed in S. cerevisiae strain SEY6210. Lane C contains 60 ng of purified soluble NY-ESO TCR as a control. Lanes 1 and 2 contain the proteins harvested from the two separate TCR transformed yeast cultures;
FIG. 112 shows the nucleic acid sequence (SEQ ID NO:180) of the KpnI to EcoRI insert of the pEX172 plasmid. The remainder of the plasmid is pBlueScript II KS-;
FIG. 113 is a schematic diagram of the TCR chains for cloning into baculovirus;
FIG. 114 shows the nucleic acid sequence (SEQ ID NO:181) of disulphide A6 α TCR construct as a BamHI insert for insertion into pAcAB3 expression plasmid;
FIG. 115 shows the disulphide A6 β TCR construct (SEQ ID NO:182) as a BamHI for insertion into pAcAB3 expression plasmid; and
FIG. 116 shows a Coomassie stained gel and Western Blot against the bacterially-produced disulphide A6 TCR and the Insect disulphide A6 TCR.
In all of the following examples, unless otherwise stated, the soluble TCR chains produced are truncated immediately C-terminal to the cysteine residues which form the native interchain disulphide bond.
For mutating A6 Tax threonine 48 of exon 1 in TRAC*01 to cysteine, the following primers were designed (mutation shown in lower case):
| (SEQ ID NO:21) |
| 5′-C ACA GAC AAA tgT GTG CTA GAC AT | ||
| (SEQ ID NO:22) |
| 5′-AT GTC TAG CAC Aca TTT GTC TGT G |
For mutating A6 Tax serine 57 of exon 1 in both TRBC1*01 and TRBC2*01 to cysteine, the following primers were designed (mutation shown in lower case):
| (SEQ ID NO:23) |
| 5′-C AGT GGG GTC tGC ACA GAC CC | ||
| (SEQ ID NO:24) |
| 5′-GG GTC TGT GCa GAC CCC ACT G |
Expression plasmids containing the genes for the A6 Tax TCR α or β chain were mutated using the α-chain primers or the β-chain primers respectively, as follows. 100 ng of plasmid was mixed with 5 μl 10 mM dNTP, 25 μl 10×Pfu-buffer (Stratagene), 10 units Pfu polymerase (Stratagene) and the final volume was adjusted to 240 μl with H2O. 48 μl of this mix was supplemented with primers diluted to give a final concentration of 0.2 μM in 50 μl final reaction volume. After an initial denaturation step of 30 seconds at 95° C., the reaction mixture was subjected to 15 rounds of denaturation (95° C., 30 sec.), annealing (55° C., 60 sec.), and elongation (73° C., 8 min.) in a Hybaid PCR express PCR machine. The product was then digested for 5 hours at 37° C. with 10 units of DpnI restriction enzyme (New England Biolabs). 10 μl of the digested reaction was transformed into competent XL1-Blue bacteria and grown for 18 hours at 37° C. A single colony was picked and grown over night in 5 ml TYP+ampicillin (16 g/l Bacto-Tryptone, 16 g/l Yeast Extract, 5 g/l NaCl, 2.5 g/l K2HPO4, 100 mg/l Ampicillin). Plasmid DNA was purified on a Qiagen mini-prep column according to the manufacturer's instructions and the sequence was verified by automated sequencing at the sequencing facility of Department of Biochemistry, Oxford University. The respective mutated nucleic acid and amino acid sequences are shown in FIGS. 2a and 3a for the α chain and FIGS. 2b and 3b for the β chain.
The expression plasmids containing the mutated α-chain and β-chain respectively were transformed separately into E. coli strain BL21pLysS, and single ampicillin-resistant colonies were grown at 37° C. in TYP (ampicillin 100 μg/ml) medium to OD600 of 0.4 before inducing protein expression with 0.5 mM IPTG. Cells were harvested three hours post-induction by centrifugation for 30 minutes at 4000 rpm in a Beckman J-6B. Cell pellets were re-suspended in a buffer containing 50 mM Tris-HCl, 25% (w/v) sucrose, 1 mM NaEDTA, 0.1% (w/v) NaAzide, 10 mM DTT, pH 8.0. After an overnight freeze-thaw step, re-suspended cells were sonicated in 1 minute bursts for a total of around 10 minutes in a Milsonix XL2020 sonicator using a standard 12 mm diameter probe. Inclusion body pellets were recovered by centrifugation for 30 minutes at 13000 rpm in a Beckman J2-21 centrifuge. Three detergent washes were then carried out to remove cell debris and membrane components. Each time the inclusion body pellet was homogenised in a Triton buffer (50 mM Tris-HCl, 0.5% Triton-X100, 200 mM NaCI, 10 mM NaEDTA, 0.1% (w/v) NaAzide, 2 mM DTT, pH 8.0) before being pelleted by centrifugation for 15 minutes at 13000 rpm in a Beckman J2-21. Detergent and salt was then removed by a similar wash in the following buffer: 50 mM Tris-HCl, 1 mM NaEDTA, 0.1% (w/v) NaAzide, 2 mM DTT, pH 8.0. Finally, the inclusion bodies were divided into 30 mg aliquots and frozen at −70° C. Inclusion body protein yield was quantitated by solubilising with 6M guanidine-HCl and measurement with a Bradford dye-binding assay (PerBio).
Approximately 30 mg (i.e. 1 μmole) of each solubilised inclusion body chain was thawed from frozen stocks, samples were then mixed and the mixture diluted into 15 ml of a guanidine solution (6 M Guanidine-hydrochloride, 10 mM Sodium Acetate, 10 mM EDTA), to ensure complete chain de-naturation. The guanidine solution containing fully reduced and denatured TCR chains was then injected into 1 litre of the following refolding buffer: 100 mM Tris pH 8.5, 400 mM L-Arginine, 2 mM EDTA, 5 mM reduced Glutathione, 0.5 mM oxidised Glutathione, 5M urea, 0.2 mM PMSF. The solution was left for 24 hrs. The refold was then dialysed twice, firstly against 10 litres of 100 mM urea, secondly against 10 litres of 100 mM urea, 10 mM Tris pH 8.0. Both refolding and dialysis steps were carried out at 6-8° C.
sTCR was separated from degradation products and impurities by loading the dialysed refold onto a POROS 50HQ anion exchange column and eluting bound protein with a gradient of 0-500 mM NaCl over 50 column volumes using an Akta purifier (Pharmacia) as in FIG. 4. Peak fractions were stored at 4° C. and analysed by Coomassie-stained SDS-PAGE (FIG. 5) before being pooled and concentrated. Finally, the sTCR was purified and characterised using a Superdex 200HR gel filtration column (FIG. 6) pre-equilibrated in HBS-EP buffer (10 mM HEPES pH 7.4, 150 mM NaCl, 3.5 mM EDTA, 0.05% nonidet p40). The peak eluting at a relative molecular weight of approximately 50 kDa was pooled and concentrated prior to characterisation by BIAcore surface plasmon resonance analysis.
A surface plasmon resonance biosensor (BIAcore 3000™) was used to analyse the binding of a sTCR to its peptide-MHC ligand. This was facilitated by producing single pMHC complexes (described below) which were immobilised to a streptavidin-coated binding surface in a semi-oriented fashion, allowing efficient testing of the binding of a soluble T-cell receptor to up to four different pMHC (immobilised on separate flow cells) simultaneously. Manual injection of HLA complex allows the precise level of immobilised class I molecules to be manipulated easily.
Such immobilised complexes are capable of binding both T-cell receptors and the coreceptor CD8αα, both of which may be injected in the soluble phase. Specific binding of TCR is obtained even at low concentrations (at least 40 μg/ml), implying the TCR is relatively stable. The pMHC binding properties of sTCR are observed to be qualitatively and quantitatively similar if sTCR is used either in the soluble or immobilised phase. This is an important control for partial activity of soluble species and also suggests that biotinylated pMHC complexes are biologically as active as non-biotinylated complexes.
Biotinylated class I HLA-A2-peptide complexes were refolded in vitro from bacterially-expressed inclusion bodies containing the constituent subunit proteins and synthetic peptide, followed by purification and in vitro enzymatic biotinylation (O'Callaghan et al. (1999) Anal. Biochem. 266: 9-15). HLA-heavy chain was expressed with a C-terminal biotinylation tag which replaces the transmembrane and cytoplasmic domains of the protein in an appropriate construct. Inclusion body expression levels of ˜75 mg/litre bacterial culture were obtained. The HLA light-chain or β2-microglobulin was also expressed as inclusion bodies in E. coli from an appropriate construct, at a level of 500 mg/litre bacterial culture.
E. coli cells were lysed and inclusion bodies are purified to approximately 80% purity. Protein from inclusion bodies was denatured in 6 M guanidine-HCl, 50 mM Tris pH 8.1, 100 mM NaCl, 10 mM DTT, 10 mM EDTA, and was refolded at a concentration of 30 mg/litre heavy chain, 30 mg/litre β2m into 0.4 M L-Arginine-HCl, 100 mM Tris pH 8.1, 3.7 mM cystamine, mM cysteamine, 4 mg/ml peptide (e.g. tax 11-19), by addition of a single pulse of denatured protein into refold buffer at <5° C. Refolding was allowed to reach completion at 4° C. for at least 1 hour.
Buffer was exchanged by dialysis in 10 volumes of 10 mM Tris pH 8.1. Two changes of buffer were necessary to reduce the ionic strength of the solution sufficiently. The protein solution was then filtered through a 1.5 μm cellulose acetate filter and loaded onto a POROS 50HQ anion exchange column (8 ml bed volume). Protein was eluted with a linear 0-500 mM NaCl gradient. HLA-A2-peptide complex eluted at approximately 250 mM NaCl, and peak fractions were collected, a cocktail of protease inhibitors (Calbiochem) was added and the fractions were chilled on ice.
Biotinylation tagged HLA complexes were buffer exchanged into 10 mM Tris pH 8.1, 5 mM NaCl using a Pharmacia fast desalting column equilibrated in the same buffer. Immediately upon elution, the protein-containing fractions were chilled on ice and protease inhibitor cocktail (Calbiochem) was added. Biotinylation reagents were then added: 1 mM biotin, 5 mM ATP (buffered to pH 8), 7.5 mM MgCl2, and 5 μg/ml BirA enzyme (purified according to O'Callaghan et al. (1999) Anal. Biochem. 266: 9-15). The mixture was then allowed to incubate at room temperature overnight.
Biotinylated HLA complexes were purified using gel filtration chromatography. A Pharmacia Superdex 75 HR 10/30 column was pre-equilibrated with filtered PBS and 1 ml of the biotinylation reaction mixture was loaded and the column was developed with PBS at 0.5 ml/min. Biotinylated HLA complexes eluted as a single peak at approximately 15 ml. Fractions containing protein were pooled, chilled on ice, and protease inhibitor cocktail was added. Protein concentration was determined using a Coomassie-binding assay (PerBio) and aliquots of biotinylated HLA complexes were stored frozen at −20° C. Streptavidin was immobilised by standard amine coupling methods.
The interactions between A6 Tax sTCR containing a novel inter-chain bond and its ligand/MHC complex or an irrelevant HLA-peptide combination, the production of which is described above, were analysed on a BIAcore 3000™ surface plasmon resonance (SPR) biosensor. SPR measures changes in refractive index expressed in response units (RU) near a sensor surface within a small flow cell, a principle that can be used to detect receptor ligand interactions and to analyse their affinity and kinetic parameters. The probe flow cells were prepared by immobilising the individual HLA-peptide complexes in separate flow cells via binding between the biotin cross linked onto β2m and streptavidin which have been chemically cross linked to the activated surface of the flow cells. The assay was then performed by passing sTCR over the surfaces of the different flow cells at a constant flow rate, measuring the SPR response in doing so. Initially, the specificity of the interaction was verified by passing sTCR at a constant flow rate of 5 μl min-1 over two different surfaces; one coated with ˜5000 RU of specific peptide-HLA complex, the second coated with ˜5000 RU of non-specific peptide-HLA complex (FIG. 7 insert). Injections of soluble sTCR at constant flow rate and different concentrations over the peptide-HLA complex were used to define the background resonance. The values of these control measurements were subtracted from the values obtained with specific peptide-HLA complex and used to calculate binding affinities expressed as the dissociation constant, Kd (Price & Dwek, Principles and Problems in Physical Chemistry for Biochemists (2nd Edition) 1979, Clarendon Press, Oxford), as in FIG. 7.
The Kd value obtained (1.8 μM) is close to that reported for the interaction between A6 Tax sTCR without the novel di-sulphide bond and pMHC (0.91 μM—Ding et al, 1999, Immunity 11:45-56).
The β chain of the soluble A6 TCR prepared in Example 1 contains in the native sequence a BglII restriction site (AAGCTT) suitable for use as a ligation site.
PCR mutagenesis was carried as detailed below to introduce a BamH1 restriction site (GGATCC) into the α chain of soluble A6 TCR, 5′ of the novel cysteine codon. The sequence described in FIG. 2a was used as a template for this mutagenesis. The following primers were used:
| |BamHI | | ||
| 5′-ATATCCAGAACCCgGAtCCTGCCGTGTA-3′ | (SEQ ID NO:25) | |
| 5′-TACACGGCAGGAaTCcGGGTTCTGGATAT-3′ | (SEQ ID NO:26) |
100 ng of plasmid was mixed with 5 μl 10 mM dNTP, 25 μl 10×Pfu-buffer (Stratagene), 10 units Pfu polymerase (Stratagene) and the final volume was adjusted to 240 μl with H2O. 48 μl of this mix was supplemented with primers diluted to give a final concentration of 0.2 μM in 50 μl final reaction volume. After an initial denaturation step of 30 seconds at 95° C., the reaction mixture was subjected to 15 rounds of denaturation (95° C., 30 sec.), annealing (55° C., 60 sec.), and elongation (73° C., 8 min.) in a Hybaid PCR express PCR machine. The product was then digested for 5 hours at 37° C. with 10 units of DpnI restriction enzyme (New England Biolabs). 10 μl of the digested reaction was transformed into competent XL1-Blue bacteria and grown for 18 hours at 37° C. A single colony was picked and grown over night in 5 ml TYP+ampicillin (16 g/l Bacto-Tryptone, 16 g/l Yeast Extract, 5 g/l NaCl, 2.5 g/l K2HPO4, 100 mg/l Ampicillin). Plasmid DNA was purified on a Qiagen mini-prep column according to the manufacturer's instructions and the sequence was verified by automated sequencing at the sequencing facility of Department of Biochemistry, Oxford University. The mutations introduced into the α chain were “silent”, therefore the amino acid sequence of this chain remained unchanged from that detailed in FIG. 3a. The DNA sequence for the mutated α chain is shown in FIG. 8a.
In order to produce a soluble JM22 TCR incorporating a novel disulphide bond, A6 TCR plasmids containing the α chain BamH1 and β chain BglII restriction sites were used as templates. The following primers were used:
| | Nde1 | | ||
| 5′-GGAGATATACATATGCAACTACTAGAACAA-3′ | (SEQ ID NO:27) | |
| 5′-TACACGGCAGGATCCGGGTTCTGGATATT-3′ | (SEQ ID NO:28) | |
| | BamHI| | ||
| |Nde1 | | ||
| 5′-GGAGATATACATATGGTGGATGGTGGAATC-3′ | (SEQ ID NO:29) | |
| 5′-CCCAAGCTTAGTCTGCTCTACCCCAGGCCTCGGC-3′ | (SEQ ID NO:30) | |
| |BglII| |
JM22 TCR α and β-chain constructs were obtained by PCR cloning as follows. PCR reactions were performed using the primers as shown above, and templates containing the JM22 TCR chains. The PCR products were restriction digested with the relevant restriction enzymes, and cloned into pGMT7 to obtain expression plasmids. The sequence of the plasmid inserts were confirmed by automated DNA sequencing. FIGS. 8b and 8c show the DNA sequence of the mutated α and β chains of the JM22 TCR respectively, and FIGS. 9a and 9b show the resulting amino acid sequences.
The respective TCR chains were expressed, co-refolded and purified as described in Examples 1 and 2. FIG. 10 illustrates the elution of soluble disulphide-linked JM22 TCR protein elution from a POROS 50HQ column using a 0-500 mM NaCl gradient, as indicated by the dotted line. FIG. 11 shows the results of both reducing SDS-PAGE (Coomassie-stained) and non-reducing SDS-PAGE (Coomassie-stained) gels of fractions from the column run illustrated by FIG. 10. Peak 1 clearly contains TCR heterodimer which is inter-chain disulphide linked. FIG. 12 shows protein elution from a size-exclusion column of pooled fractions from peak 1 in FIG. 10.
A BIAcore analysis of the binding of the JM22 TCR to pMHC was carried out as described in Example 3. FIG. 13a shows BIAcore analysis of the specific binding of disulphide-linked JM22 soluble TCR to HLA-Flu complex. FIG. 13b shows the binding response compared to control for a single injection of disulphide-linked JM22 soluble TCR. The Kd of this disulphide-linked TCR for the HLA-flu complex was determined to be 7.9±0.51 μM
cDNA encoding NY-ESO TCR was isolated from T cells supplied by Enzo Cerundolo (Institute of Molecular Medicine, University of Oxford) according to known techniques. cDNA encoding NY-ESO TCR was produced by treatment of the mRNA with reverse transcriptase.
In order to produce a soluble NY-ESO TCR incorporating a novel disulphide bond, A6 TCR plasmids containing the α chain BamHI and β chain BglII restriction sites were used as templates as described in Example 4. The following primers were used:
| | NdeI | | ||
| 5′-GGAGATATACATATGCAGGAGGTGACACAG-3′ | (SEQ ID NO:31) | |
| 5′-TACACGGCAGGATCCGGGTTCTGGATATT-3′ | (SEQ ID NO:32) | |
| | BamHI| | ||
| |NdeI | | ||
| 5′-GGAGATATACATATGGGTGTCACTCAGACC-3′ | (SEQ ID NO:33) | |
| 5′-CCCAAGCTTAGTCTGCTCTACCCCAGGCCTCGGC-3′ | (SEQ ID NO:34) | |
| |BglII| |
NY-ESO TCR α and β-chain constructs were obtained by PCR cloning as follows. PCR reactions were performed using the primers as shown above, and templates containing the NY-ESO TCR chains. The PCR products were restriction digested with the relevant restriction enzymes, and cloned into pGMT7 to obtain expression plasmids. The sequence of the plasmid inserts were confirmed by automated DNA sequencing. FIGS. 14a and 14b show the DNA sequence of the mutated α and β chains of the NY-ESO TCR respectively, and FIGS. 15a and 15b show the resulting amino acid sequences.
The respective TCR chains were expressed, co-refolded and purified as described in Examples 1 and 2, except for the following alterations in protocol
Denaturation of soluble TCRs; 30 mg of the solubilised TCR β-chain inclusion body and 60 mg of the solubilised TCR α-chain inclusion body was thawed from frozen stocks. The inclusion bodies were diluted to a final concentration of 5 mg/ml in 6M guanidine solution, and DTT (2M stock) was added to a final concentration of 10 mM. The mixture was incubated at 37° C. for 30 min.
Refolding of soluble TCRs: 1 L refolding buffer was stirred vigorously at 5° C.±3° C. The redox couple (2-mercaptoethylamine and cystamine (to final concentrations of 6.6 mM and 3.7 mM, respectively) were added approximately 5 minutes before addition of the denatured TCR chains. The protein was then allowed to refold for approximately 5 hours±15 minutes with stirring at 5° C.±3° C.
Dialysis of refolded soluble TCRs: The refolded TCR was dialysed in Spectrapor 1 membrane (Spectrum; Product No. 132670) against 10 L 10 mM Tris pH 8.1 at 5° C.±3° C. for 18-20 hours. After this time, the dialysis buffer was changed to fresh 10 mM Tris pH 8.1 (10 L) and dialysis was continued at 5° C.±3° C. for another 20-22 hours.
FIG. 16 illustrates the elution of soluble NY-ESO disulphide-linked TCR protein elution from a POROS 50HQ column using a 0-500 mM NaCl gradient, as indicated by the dotted line. FIG. 17 shows the results of both reducing SDS-PAGE (Coomassie-stained) and non-reducing SDS-PAGE (Coomassie-stained) gels of fractions from the column run illustrated by FIG. 16. Peaks 1 and 2 clearly contain TCR heterodimer which is inter-chain disulphide linked. FIG. 18 shows size-exclusion chromatography of pooled fractions from peak 1 (A) and peak 2 (B) in FIG. 17. The protein elutes as a single major peak, corresponding to the heterodimer.
A BIAcore analysis of the binding of the disulphide-linked NY-ESO TCR to pMHC was carried out as described in Example 3. FIG. 19 shows BIAcore analysis of the specific binding of disulphide-linked NY-ESO soluble TCR to HLA-NYESO complex. A. peak 1, B. peak 2.
The Kd of this disulphide-linked TCR for the HLA-NY-ESO complex was determined to be 9.4±0.84 μM.
In order to produce a soluble NY-ESO TCR incorporating a novel disulphide bond and at least one of the cysteine residues involved in the native disulphide inter-chain bond, plasmids containing the α chain BamHI and β chain BglII restriction sites were used as a framework as described in Example 4. The following primers were used:
| | NdeI | | ||
| 5′-GGAGATATACATATGCAGGAGGTGACACAG-3′ | (SEQ ID NO:35) | |
| 5′-CCCAAGCTTAACAGGAACTTTCTGGGCTGGGGAAGAA-3′ | (SEQ ID NO:36) | |
| | HindIII| | ||
| | NdeI | | ||
| 5′-GGAGATATACATATGGGTGTCACTCAGACC-3′ | (SEQ ID NO:37) | |
| 5′-CCCAAGCTTAACAGTCTGCTCTACCCCAGGCCTCGGC-3′ | (SEQ ID NO:38) | |
| |BglII | |
NY-ESO TCR α and β-chain constructs were obtained by PCR cloning as follows. PCR reactions were performed using the primers as shown above, and templates containing the NY-ESO TCR chains. The PCR products were restriction digested with the relevant restriction enzymes, and cloned into pGMT7 to obtain expression plasmids. The sequence of the plasmid inserts were confirmed by automated DNA sequencing. FIGS. 20a and 20b show the DNA sequence of the mutated α and β chains of the NY-ESO TCR respectively, and FIGS. 21a and 21b show the resulting amino acid sequences.
To produce a soluble NY-ESO TCR containing both a non-native disulphide inter-chain bond and the native disulphide inter-chain bond, DNA isolated using both of the above primers was used. To produce soluble NY-ESO TCRs with a non-native disulphide inter-chain bond and only one of the cysteine residues involved in the native disulphide inter-chain bond, DNA isolated using one of the above primers together with the appropriate primer from Example 5 was used.
The respective TCR chains were expressed, co-refolded and purified as described in Example 5.
FIGS. 22-24 illustrate the elution of soluble NY-ESO TCRαcysβcys (i.e. with non-native and native cysteines in both chains), TCRαcys (with non-native cysteines in both chains but the native cysteine in the α chain only), and TCRβcys (with non-native cysteines in both chains but the native cysteine in the P chain only) protein elution from POROS 50HQ anion exchange columns using a 0-500 mM NaCl gradient, as indicated by the dotted line. FIGS. 25 and 26 respectively show the results of reducing SDS-PAGE (Coomassie-stained) and non-reducing SDS-PAGE (Coomassie-stained) gels of fractions from the NY-ESO TCRαcysβcys, TCRαcys, and TCRβcys column runs illustrated by FIGS. 22-24. These clearly indicate that TCR heterodimers which are inter-chain disulphide linked have been formed. FIGS. 27-29 are protein elution profiles from gel filtration chromatography of pooled fractions from the NY-ESO TCRαcysβcys, TCRαcys, and TCRβcys anion exchange column runs illustrated by FIGS. 22-24 respectively. The protein elutes as a single major peak, corresponding to the TCR heterodimer.
A BIAcore analysis of sTCR binding to pMHC was carried out as described in Example 3. FIGS. 30-32 show BIAcore analysis of the specific binding of NY-ESO TCRαcysβcys, TCRαcys, and TCRβcys respectively to HLA-NYESO complex.
TCRαcysβcys had a Kd of 18.08±2.075 μM, TCRαcys had a Kd of 19.24±2.01 μM, and TCRβcys had a Kd of 22.5±4.0692 μM.
cDNA encoding AH-1.23 TCR was isolated from T cells supplied by Hill Gaston (Medical School, Addenbrooke's Hospital, Cambridge) according to known techniques. cDNA encoding NY-ESO TCR was produced by treatment of the mRNA with reverse transcriptase.
In order to produce a soluble AH-1.23 TCR incorporating a novel disulphide bond, TCR plasmids containing the α chain BamHI and β chain BglII restriction sites were used as a framework as described in Example 4. The following primers were used:
| | NdeI | | ||
| 5′-GGGAAGCTTACATATGAAGGAGGTGGAGCAGAATTCTGG-3′ | (SEQ ID NO:39) | |
| 5′-TACACGGCAGGATCCGGGTTCTGGATATT-3′ | (SEQ ID NO:40) | |
| | BamHI| | ||
| | NdeI | | ||
| 5′-TTGGAATTCACATATGGGCGTCATGCAGAACCCAAGACAC-3′ | (SEQ ID NO:41) | |
| 5′-CCCAAGCTTAGTCTGCTCTACCCCAGGCCTCGGC-3′ | (SEQ ID NO:42) | |
| |BglII| |
AH-1.23 TCR α and β-chain constructs were obtained by PCR cloning as follows. PCR reactions were performed using the primers as shown above, and templates containing the AH-1.23 TCR chains. The PCR products were restriction digested with the relevant restriction enzymes, and cloned into pGMT7 to obtain expression plasmids. The sequence of the plasmid inserts were confirmed by automated DNA sequencing. FIGS. 33a and 33b show the DNA sequence of the mutated α and β chains of the AH-1.23 TCR respectively, and FIGS. 34a and 34b show the resulting amino acid sequences.
The respective TCR chains were expressed, co-refolded and purified as described in Example 5.
FIG. 35 illustrates the elution of soluble AH-1.23 disulphide-linked TCR protein elution from a POROS 50HQ anion exchange column using a 0-500 mM NaCl gradient, as indicated by the dotted line. FIGS. 36 and 37 show the results of reducing SDS-PAGE (Coomassie-stained) and non-reducing SDS-PAGE (Coomassie-stained) gels respectively of fractions from the column run illustrated by FIG. 35. These gels clearly indicate the presence of a TCR heterodimer which is inter-chain disulphide linked. FIG. 38 is the elution profile from a Superdex 75 HR gel filtration column of pooled fractions from the anion exchange column run illustrated in FIG. 35. The protein elutes as a single major peak, corresponding to the heterodimer.
The following experiments were carried out in order to investigate whether it was possible to form functional soluble TCRs which include a novel disulphide bond in the TCR immunoglobulin region at a position other than between threonine 48 of exon 1 in TRAC*01 and serine 57 of exon 1 in both TRBC1*01/TRBC2*01.
For the mutating the A6 TCR α-chain, the following primers were designed (the numbers in the primer names refer to the position of the amino acid residue to be mutated in exon 1 of TRAC*01, mutated residues are shown in lower case):
| T48→C Mutation |
| (SEQ ID NO:43) |
| 5′-CACAGACAAAtgTGTGCTAGACAT-3′ | ||
| (SEQ ID NO:44) |
| 5′-ATGTCTAGCACAcaTTTGTCTGTG-3′ | ||
| Y10→C Mutation |
| (SEQ ID NO:45) |
| 5′-CCCTGCCGTGTgCCAGCTGAGAG-3′ | ||
| (SEQ ID NO:46) |
| 5′-CTCTCAGCTGGcACACGGCAGGG-3′ | ||
| L12→C Mutation |
| (SEQ ID NO:47) |
| 5′-CCGTGTACCAGtgcAGAGACTCTAAATC-3′ | ||
| (SEQ ID NO:48) |
| 5′-GATTTAGAGTCTCTgcaCTGGTACACGG-3′ | ||
| S15→C Mutation |
| (SEQ ID NO:49) |
| 5′-CAGCTGAGAGACTgTAAATCCAGTGAC-3′ | ||
| (SEQ ID NO:50) |
| 5′-GTCACTGGATTTAcAGTCTCTCAGCTG-3′ | ||
| V22→C Mutation |
| (SEQ ID NO:51) |
| 5′-CAGTGACAAGTCTtgCTGCCTATTCAC-3′ | ||
| (SEQ ID NO:52) |
| 5′-GTGAATAGGCAGcaAGACTTGTCACTG-3′ | ||
| Y43→C Mutation |
| (SEQ ID NO:53) |
| 5′-GATTCTGATGTGTgTATCACAGACAAAT-3′ | ||
| (SEQ ID NO:54) |
| 5′-ATTTGTCTGTGATAcACACATCAGAATC-3′ | ||
| T45→C Mutation |
| (SEQ ID NO:55) |
| 5′-CTGATGTGTATATCtgtGACAAAACTGTGC-3′ | ||
| (SEQ ID NO:56) |
| 5′-GCACAGTTTTGTCacaGATATACACATCAG-3′ | ||
| L50→C Mutation |
| (SEQ ID NO:57) |
| 5′-AGACAAAACTGTGtgtGACATGAGGTCT-3′ | ||
| (SEQ ID NO:58) |
| 5′-AGACCTCATGTCacaCACAGTTTTGTCT-3′ | ||
| M52→C Mutation |
| (SEQ ID NO:59) |
| 5′-ACTGTGCTAGACtgtAGGTCTATGGAC-3′ | ||
| (SEQ ID NO:60) |
| 5′-GTCCATAGACCTacaGTCTAGCACAGT-3′ | ||
| S61→C Mutation |
| (SEQ ID NO:61) |
| 5′-CTTCAAGAGCAACtGTGCTGTGGCC-3′ | ||
| (SEQ ID NO:62) |
| 5′-GGCCACAGCACaGTTGCTCTTGAAG-3′ |
For mutating the TCR A6 β-chain, the following primers were designed (the numbers in the primer names refer to the position of the amino acid residue to be mutated in exon 1 of TRBC2*01. Mutated residues are shown in lower case):
| S57→C Mutation |
| (SEQ ID NO:63) |
| 5′-CAGTGGGGTCtGCACAGACCC-3′ | ||
| (SEQ ID NO:64) |
| 5′-GGGTCTGTGCaGACCCCACTG-3′ | ||
| V13→C Mutation |
| (SEQ ID NO:65) |
| 5′-CCGAGGTCGCTtgtTTTGAGCCATCAG-3′ | ||
| (SEQ ID NO:66) |
| 5′-CTGATGGCTCAAAacaAGCGACCTCGG-3′ | ||
| F14→C Mutation |
| (SEQ ID NO:67) |
| 5′-GGTCGCTGTGtgtGAGCCATCAGA-3′ | ||
| (SEQ ID NO:68) |
| 5′-TCTGATGGCTCacaCACAGCGACC-3′ | ||
| S17→C Mutation |
| (SEQ ID NO:69) |
| 5′-GTGTTTGAGCCATgtGAAGCAGAGATC-3′ | ||
| (SEQ ID NO:70) |
| 5′-GATCTCTGCTTCacATGGCTCAAACAC-3′ | ||
| G55→C Mutation |
| (SEQ ID NO:71) |
| 5′-GAGGTGCACAGTtGtGTCAGCACAGAC-3′ | ||
| (SEQ ID NO:72) |
| 5′-GTCTGTGCTGACaCaACTGTGCACCTC-3′ | ||
| D59→C Mutation |
| (SEQ ID NO:73) |
| 5′-GGGTCAGCACAtgCCCGCAGCCC-3′ | ||
| (SEQ ID NO:74) |
| 5′-GGGCTGCGGGcaTGTGCTGACCC-3′ | ||
| L63→C Mutation |
| (SEQ ID NO:75) |
| 5′-CCCGCAGCCCtgCAAGGAGCAGC-3′ | ||
| (SEQ ID NO:76) |
| 5′-GCTGCTCCTTGCaGGGCTGCGGG-3′ | ||
| S77→C Mutation |
| (SEQ ID NO:77) |
| 5′-AGATACGCTCTGtGCAGCCGCCT-3′ | ||
| (SEQ ID NO:78) |
| 5′-AGGCGGCTGCaCAGAGCGTATCT-3′ | ||
| R79→C Mutation |
| (SEQ ID NO:79) |
| 5′-CTCTGAGCAGCtGCCTGAGGGTC-3′ | ||
| (SEQ ID NO:80) |
| 5′-GACCCTCAGGCaGCTGCTCAGAG-3′ | ||
| E15→C Mutation |
| (SEQ ID NO:81) |
| 5′-GCTGTGTTTtgtCCATCAGAA-3′ | ||
| (SEQ ID NO:82) |
| 5′-TTCTGATGGacaAAACACAGC-3′ |
PCR mutagenesis, α and β TCR construct amplification, ligation and plasmid purification was carried out as described in Example 1 using the appropriate combination of the above primers in order to produce soluble TCRs including novel disulphide inter-chain bonds between the following pairs of amino acids:
| TCR α chain | TCR β chain | α Primer used | β Primer used | |
| Thr 48 | Ser 57 | T48→C | S57→C | |
| Thr 45 | Ser 77 | T45→C | S77→C | |
| Ser 61 | Ser 57 | S61→C | S57→C | |
| Leu 50 | Ser 57 | L50→C | S57→C | |
| Tyr 10 | Ser 17 | Y10→C | S17→C | |
| Ser 15 | Val 13 | S15→C | V13→C | |
| Thr 45 | Asp 59 | T45→C | D59→C | |
| Leu 12 | Ser 17 | L12→C | S17→C | |
| Ser 61 | Arg 79 | S61→C | R79→C | |
| Leu 12 | Phe 14 | L12→C | F14→C | |
| Val 22 | Phe 14 | V22→C | F14→C | |
| Met 52 | Gly 55 | M52→C | G55→C | |
| Tyr 43 | Leu 63 | Y43→C | L63→C | |
| Ser 15 | Glu 15 | S15→C | E15→C | |
FIGS. 39 to 58 show the DNA and amino acid sequences of the mutated A6 TCR chains amplified by the above primers. The codons encoding the mutated cysteines are highlighted.
The respective TCR chains were expressed, co-refolded and purified as described in Example 5. Following purification on POROS 50HQ anion exchange column, the resulting proteins were run on SDS-Page gels in order to assess whether any correctly-refolded soluble TCR had been formed. These gels were also assessed to ascertain the presence or absence of any disulphide-linked protein of the correct molecular weight in the purified material. TCRs under investigation containing the following novel disulphide inter-chain bonds failed to produce disulphide-linked protein of the correct molecular weight using this bacterial expression system and these were not further assessed. However, alternative prokaryotic or eukaryotic expression systems are available.
| TCR α chain | TCR β chain | |
| Ser 61 | Ser 57 | |
| Leu 50 | Ser 57 | |
| Ser 15 | Val 13 | |
| Leu 12 | Ser 17 | |
| Ser 61 | Arg 79 | |
| Leu 12 | Phe 14 | |
| Val 22 | Phe 14 | |
| Tyr 43 | Leu 63 | |
FIGS. 59 to 64 respectively illustrate the elution of soluble TCRs containing novel disulphide interchain bonds between the following residues: Thr 48-Ser 57, Thr 45-Ser 77, Tyr 10-Ser 17, Thr 45-Asp 59, Met 52-Gly 55 and Ser 15-Glu 15 from a POROS 200HQ anion exchange column using a 0-500 mM NaCl gradient, as indicated by the dotted line. FIGS. 65 to 70 show the results of reducing SDS-PAGE (Coomassie-stained) and non-reducing SDS-PAGE (Coomassie-stained) gels respectively of fractions from the column runs illustrated by FIGS. 59 to 64. These gels clearly indicate the presence of TCR heterodimers that are inter-chain disulphide linked.
FIGS. 71 to 76 are elution profiles from a Superdex 200 HR gel filtration column of pooled fractions from the anion exchange column runs illustrated in FIGS. 59 to 64. A BIAcore analysis of the binding of the TCRs to pMHC was carried out as described in Example 3. FIGS. 77-82 are BIAcore traces demonstrating the ability of the purified soluble TCRs to bind to HLA-A2 tax pMHC complexes.
Thr 48-Ser 57 had a Kd of 7.8 μM, Thr 45-Ser 77 had a Kd of 12.7 μM, Tyr 10-Ser 17 had a Kd of 34 μM, Thr 45-Asp 59 had a Kd of 14.9 μM, and Ser 15-Glu 15 had a Kd of 6.3 μM Met 52-Gly 55 was capable of binding to its native “target”, the HLA-A2 tax complex, although it also bound in a similar manner to an “irrelevant” target, the HLA-A2-NY-ESO complex (see FIG. 81)
The NY-ESO dsTCR was cloned as described in Example 5, and expressed as follows.
The expression plasmids containing the mutated α-chain and β-chain respectively were transformed separately into E. coli strain BL21 pLysS, and single ampicillin-resistant colonies were grown at 37° C. in TYP (ampicillin 100 μg/ml) medium to OD600 of 0.7 before inducing protein expression with 0.5 mM IPTG. Cells were harvested 18 hours post-induction by centrifugation for 30 minutes at 4000 rpm in a Beckman J-6B. Cell pellets were resuspended in lysis buffer containing 10 mM Tris-HCI pH 8.1, 10 mM MgCl2, 150 mM NaCl, 2 mM DTT, 10% glycerol. For every 1 L of bacterial culture 100 μl of lysozyme (20 mg/ml) and 100 μl of Dnase I (20 μg/ml) were added. After incubation on ice for 30 minutes, the bacterial suspension was sonicated in 1 minute bursts for a total of 10 minutes using a Milsonix XL2020 sonicator with a standard 12 mm diameter probe. Inclusion body pellets were recovered by centrifugation for 30 minutes at 13000 rpm in a Beckman J2-21 centrifuge (4° C.). Three washes were then carried out in Triton wash buffer (50 mM Tris-HCI pH 8.1, 0.5% Triton-X100, 100 mM NaCl, 10 mM NaEDTA, 0.1% (w/v), 2 mM DTT) to remove cell debris and membrane components. Each time, the inclusion body pellet was homogenised in Triton wash buffer before being pelleted by centrifugation for 15 minutes at 13000 rpm in a Beckman J2-21. Detergent and salt was then removed by a similar wash in Resuspension buffer (50 mM Tris-HCl pH 8.1 100 mM NaCl, 10 mM NaEDTA, 0.1% (w/v) NaAzide, 2 mM DTT). Finally, the inclusion bodies were solubilised in 6 M guanidine buffer (6 M Guanidine-hydrochloride, 50 mM Tris pH 8.1, 100 mM NaCl, 10 mM EDTA, 10 mM DTT), divided into 120 mg aliquots and frozen at −70° C. Inclusion bodies were quantitated by solubilising with 6M guanidine-HCl and measurement with a Bradford dye-binding assay (PerBio).
Approximately 60 mg (i.e. 2.4 μmole) of frozen solubilised alpha chain was mixed with 30 mg (i.e. 1.2 μmole) of frozen solubilised beta chain. The TCR mixture was diluted to a final volume of 18 ml with 6 M guanidine buffer and heated to 37° C. for 30 min to ensure complete chain denaturation. The guanidine solution containing fully reduced and denatured TCR chains was then mixed into 1 litre of cold refolding buffer (100 mM Tris pH 8.1, 400 mM L-Arginine-HCl, 2 mM EDTA, 6.6 mM 2-mercapthoethylamine, 3.7 mM Cystamine, 5M urea) with stirring. The solution was left for 5 hrs in the cold room (5° C.±3° C.) to allow refolding to take place. The refold was then dialysed against 12 litres of water for 18-20 hours, followed by 12 litres of 10 mM Tris pH 8.1 for 18-20 hours (5° C.±3° C.). Spectrapor 1 (Spectrum Laboratories product no. 132670) dialysis membrane that has a molecular weight cut off of 6-8000 kDa was used for this dialysis process. The dialysed protein was filtered through 0.45 μm pore size filters (Schleicher and Schuell, Ref. number, 10 404012) fitted to a Nalgene filtration unit.
The refolded NY-ESO TCR was separated from degradation products and impurities by loading the dialysed refold onto a POROS 50HQ (Applied Biosystems) anion exchange column using an ÄKTA purifier (Amersham Biotech). A POROS 50 HQ column was pre-equilibrated with 10 column volumes of buffer A (10 mM Tris pH 8.1) prior to loading with protein. The bound protein was eluted with a gradient of 0-500 mM NaCI over 7 column volumes. Peak fractions (1 ml) were analysed on denaturing SDS-PAGE using reducing and non-reducing sample buffer. Peak fractions containing the heterodimeric alpha-beta complex were further purified using a Superdex 75HR gel filtration column pre-equilibrated in 25 mM MES pH 6.5. The protein peak eluting at a relative molecular weight of approximately 50 kDa was pooled, concentrated to 42 mg/ml in Ultrafree centrifugal concentrators (Millipore, part number UFV2BGC40) and stored at −80° C.
Crystallisation of NY-ESO TCR was performed by hanging drop technique at 18° C. using 1 μl of protein solution (8.4 mg/ml) in 5 mM Mes pH 6.5 mixed with an equivalent volume of crystallisation buffer. Crystals appeared under several different conditions using Crystal Screen buffers (Hampton Research). Single cubic crystals (<100 μm) were grown in 30% PEG 4000, 0.1 M Na Citrate pH 5.6, 0.2 M ammonium acetate buffer and used for structure determination.
Crystals of the NY-ESO TCR were flash-frozen and tested for diffraction in the X-ray beam of the Daresbury synchrotron. The crystals diffracted to 0.25 nm (2.5 Å) resolution. One data set was collected and processed to give a 98.6% complete set of amplitudes that were reasonable to around 0.27 nm (2.7 Å), but usable up to 0.25 nm (2.5 Å). The merging R-factor, i.e. the agreement between multiple measurements of crystallographically equivalent reflections, was 10.8% for all the data. This is marginal at the highest resolution shell. The space group was P21, with cell dimensions a=4.25 nm (42.5 Å), b=5.95 nm (59.5 Å), c=8.17 nm (81.7 Å), β=91.5°. The cell dimensions and symmetry meant there were two copies in the cell. The asymmetric unit, au or the minimum volume that needs to be studied, has only 1 molecule, and the other molecule in the cell is generated by the 21 symmetry operation. The positioning of the molecule in the au is arbitrary in the y-direction. As long as it is in the correct position in the x-z plane, it can be translated at will in the y-direction. This is referred to as a free parameter, in this ‘polar’ space group.
The PDB data base has only one entry containing an A/B heterodimeric TCR, 1BD2. This entry also has co-ordinates of the HLA-cognate peptide in complex with the TCR. The TCR chain B was the same in NY-ESO, but chain A had small differences in the C-domain and significant differences in the N-domain. Using the 1BD2 A/B model for molecular replacement, MR, gave an incorrect solution, as shown by extensive overlap with symmetry equivalent molecules. Using the B chain alone gave a better solution, which did not have significant clashes with neighbours. The correlation coefficient was 49%, the crystallographic R-factor 50%, and the nearest approach (centre-of-gravity to c-o-g) was 0.49 nm (49 Å). The rotation and translation operation needed to transform the starting chain B model to the MR equivalent, was applied to chain A. The hybrid MR solution thus generated, packed well in the cell, with minimal clashes.
Electron density maps generally agreed with the model, and allowed its adjustment to match the sequence of the NY-ESO TCR. But the starting model had many gaps, specifically missing side-chains, that are characteristic of poorly ordered portions of the model. Many of the hair-pin loops in between strands had very low density, and were difficult to model. The crystallographic R-factor of the model is 30%. The R-factor is a residual, i.e. it is the difference between the calculated and observed amplitudes.
As FIGS. 83a and 83b demonstrate, the input sequence from 1BD2 do not match up with the density very well. Changing the model for Cys at positions 164 in chain A, and 174 in chain B, followed by further refinement, showed clearly that this sequence assignment is much better fitted to the density. But the differences in terms of size of the side chain are minimal, so there was little perturbation in the model. The electron density in that region is little changed.
The most important aspect of this work is that the new TCR is very similar in structure to the published model (1BD2). The comparison could include all of the TCR, the constant domains, or the small part near the mutation point.
The r.m.s deviation values are listed in the table below. The comparison of structures is shown in FIG. 84.
| Chain A | Chain B | Chain A | Chain B | Short | |
| Complete | Complete | Constant | Constant | Stretch | |
| r.m.s | 2.831 | 1.285 | 1.658 | 1.098 | 0.613 |
| Displacement | |||||
| Mean | 2.178 | 1.001 | 1.235 | 0.833 | 0.546 |
| Displacement | |||||
| Max | 9.885 | 6.209 | 6.830 | 4.490 | 1.330 |
| Displacement | |||||
| (All units are in Å) |
The short stretch refers to the single strand from Chain A (A157 to A169) and the single strand from Chain B (B170 to B183) that are now joined by the disulphide bridge. The deviations were calculated for only the main chain atoms.
These results show that the introduction of the disulphide bond has minimal effect on the local structure of the TCR around the bond. Some larger effects are observed when comparing the TCR to the published structure (1BD2) of the A6 TCR, but the increase in RMS displacement is largely due to differences in loop conformations (see FIG. 84). These loops do not form part of the core structure of the TCR, which is formed by a series of β-sheets which form a characteristic Ig fold. The RMS deviation for the whole α-chain is particularly large because of the difference in the sequence of the variable domains between the A6 (1BD2) and the NY-ESO TCRs. However, the A6 and NY-ESO TCRs have the same variable β-domain and the RMS deviations for the whole β-chain show that the structure of this variable domain is also maintained in the TCR with the new disulphide bond. These data therefore indicate that the core structure of the TCR is maintained in the crystal structure of the TCR with the new disulphide bond.
In order to produce a soluble NY-ESO TCR incorporating a novel disulphide bond, A6 TCR plasmids containing the α chain BamHI and β chain BglII restriction sites were used as frameworks as described in Example 4.
NY-ESO TCR β-chain constructs were obtained by PCR cloning as follows. PCR reactions were performed using the primers as shown below, and templates containing the NY-ESO TCR chains.
| | NdeI | | ||
| Fwd5′-GGAGATATACATATGGGTGTCACTCAGAAC-3′ | (SEQ ID NO:83) | |
| Rev5′-CCACCGGATCCGTCTGCTCTACCCCAGGC-3′ | ||
| | BamHI| | ||
| (nucleotides 1-29 of SEQ ID NO:84) |
The PCR products were restriction digested with the relevant restriction enzymes, and cloned into pGMT7 containing the biotin recognition sequence to obtain expression plasmids. The sequence of the plasmid inserts were confirmed by automated DNA sequencing. FIG. 85a shows the DNA sequence of the β chain of the NY-ESO TCR incorporating the biotin recognition site, and FIG. 85b shows the resulting amino acid sequence.
The α chain construct was produced as described in Example 5. The respective TCR chains were expressed, co-refolded and purified as described in Example 5.
In order to produce a soluble NY-ESO TCR containing a non-native disulphide inter-chain bond and a hexa-histidine tag on the C-terminus of the β chain, the same primers and NY-ESO template were used as above. The PCR products were restriction digested with the relevant restriction enzymes, and cloned into pGMT7 containing the hexa-histidine sequence to obtain expression plasmids. FIG. 86a shows the DNA sequence of the β chain of the NY-ESO TCR incorporating the hexa-histidine tag, and FIG. 86b shows the resulting amino acid sequence.
FIG. 87 illustrates the elution of soluble NY-ESO TCR containing a novel disulphide bond and the biotin recognition sequence from a POROS 50HQ anion exchange column using a 0-500 mM NaCl gradient, as indicated by the dotted line. FIG. 88 illustrates the elution of soluble NY-ESO TCR containing a novel disulphide bond and the hexa-histidine tag from a POROS 50HQ anion exchange columns using a 0-500 mM NaCl gradient, as indicated by the dotted line.
FIGS. 89 and 90 are protein elution profiles from gel filtration chromatography of pooled fractions from the NY-ESO-biotin and NY-ESO-hexa-histidine tagged anion exchange column runs illustrated by FIGS. 87 and 88 respectively. The protein elutes as a single major peak, corresponding to the TCR heterodimer.
A BIAcore analysis of sTCR binding to pMHC was carried out as described in Example 3. The NY-ESO-biotin TCR had a Kd of 7.5 μM, The NY-ESO-hexa-histidine tagged TCR had a Kd of 9.6 μM
The NY-ESO soluble TCRs containing a novel disulphide bond and a biotin recognition sequence prepared as in Example 10 were utilised to form the soluble TCR tetramers using required for cell staining. 2.5 ml of purified soluble TCR solution (˜0.2 mg/ml) was buffer exchanged into biotinylation reaction buffer (50 mM Tris pH 8.0, 10 mM MgCl2) using a PD-10 column (Pharmacia). The eluate (3.5 ml) was concentrated to 1 ml using a centricon concentrator (Amicon) with a 10 kDa molecular weight cut-off. This was made up to 10 mM with ATP added from stock (0.1 g/ml adjusted to pH 7.0). A volume of a cocktail of protease inhibitors was then added (protease inhibitor cocktail Set 1, Calbiochem Biochemicals), sufficient to give a final protease cocktail concentration of 1/100th of the stock solution as supplied, followed by 1 mM biotin (added from 0.2M stock) and 20 μg/ml enzyme (from 0.5 mg/ml stock). The mixture was then incubated overnight at room temperature. Excess biotin was removed from the solution by size exclusion chromatography on a S75 HR column. The level of biotinylation present on the NY-ESO TCR was determined via a size exclusion HPLC-based method as follows. A 50 ul aliquot of the biotinylated NY-ESO TCR (2 mg/ml) was incubated with 50 ul of streptavidin coated agarose beads (Sigma) for 1 hour. The beads were then spun down, and 50 μl of the unbound sample was run on a TSK 2000 SW column (Tosoohaas) using a 0.5 ml/min flowrate (200 mM Phosphate Buffer pH 7.0) over 30 minutes. The presence of the biotinylated NY-ESO TCR was detected by a UV spectrometer at both 214 nm and 280 nm. The biotinylated NY-ESO was run against a non-bioninylated NY-ESO TCR control. The percentage of biotinylation was calculated by subtracting the peak-area of the biotinylated protein from that of the non-biotinylated protein.
Tetramerisation of the biotinylated soluble TCR was achieved using neutravidin-phycoerythrin conjugate (Cambridge Biosciences, UK). The concentration of biotinylated soluble TCR was measured using a Coomassie protein assay (Pierce), and a ratio of soluble TCR 0.8 mg/mg neutravidin-phycoerthrin conjugate was calculated to achieve saturation of the neutravidin-PE by biotinylated TCR at a ratio of 1:4. 19.5 μl of a 6.15 mg/ml biotinylated NY-ESO soluble TCR solution in phosphate buffered saline (PBS) was added slowly to 150 μl of a 1 mg/ml neutravidin-PE soluble over ice with gentle agitation. 100.5 μl of PBS was then added to this solution to provide a final NY-ESO TCR tetramer concentration of 1 mg/ml.
Four aliquots of 0.3×106 HLA-A2 positive EBV transformed B cell line (PP LCL) in 0.5 ml of PBS were incubated with varying concentrations (0, 10−4, 10−5 and 10−6 M) of HLA-A2 NYESO peptide (SLLMWITQC) (SEQ ID NO:106) for 2 h at 37° C. These PP LCL cells were then washed twice in Hanks buffered Saline solution (HBSS) (Gibco, UK).
Each of the four aliquots were divided equally and stained with biotinylated NY-ESO disulphide linked TCR freshly tetramerised with neutravidin-phycoerythrin. Cells were incubated with either 5 or 10 μg of phycoerythrin labelled tetrameric dsTCR complexes on ice for 30 minutes and washed with HBSS. Cells were washed again, re-suspended in HBSS and analysed by FACSVantage. 25,000 events were collected and data analysed using WinMIDI software.
FIGS. 91a-h illustrate as histograms the FACSVantage data generated for each of the samples prepared as described above. The following table lists the percentage of positively stained cells observed for each of the samples:
| Sample | Positive stained Cells (%) |
| 0 NY-ESO peptide, 5 μg TCR | 0.75 |
| 10−4 M NY-ESO peptide, 5 μg TCR | 84.39 |
| 10−5 M NY-ESO peptide, 5 μg TCR | 35.29 |
| 10−6 M NY-ESO peptide, 5 μg TCR | 7.98 |
| 0 NY-ESO peptide, 10 μg TCR | 0.94 |
| 10−4 M NY-ESO peptide, 10 μg TCR | 88.51 |
| 10−5 M NY-ESO peptide, 10 μg TCR | 8.25 |
| 10−6 M NY-ESO peptide, 10 μg TCR | 3.45 |
These data clearly indicate that the proportion of the cells labelled by the NY-ESO TCR tetramers increases in a manner correlated to the concentration of the peptide (SLLMWITQC) in which they had been incubated. Therefore, these NY-ESO TCR tetramers are moieties suitable for specific cell labelling based on the expression of the HLA-A2 NY-ESO complex.
In the present example, a fluorescent conjugated NY-ESO TCR tetramer has been used. However, similar levels of cell binding would be expected if this label were replaced by a suitable therapeutic moiety.
All of the previous examples describe the production of soluble TCRs with a novel disulphide bond incorporating the Cβ2 constant region. The present example demonstrates that soluble TCRs incorporating the Cβ1 constant region can be produced successfully.
For PCR construct of A6 TCR β-chain V-domain, the following primers were designed:
| 5′-GGAGATATACATATGAACGCTGGTGTCACT-3′ | ||
| (nucleotides 30-59 of SEQ ID NO:84) | ||
| (SEQ ID NO:85) |
| 5′-CCTTGTTCAGGTCCTCTGTGACCGTGAG-3′ |
For PCR construct of Cβ1, the following primers were designed:
| (SEQ ID NO:86) |
| 5′-CTCACGGTCACAGAGGACCTGAACAAGG-3′ | ||
| (SEQ ID NO:87) |
| 5′-CCCAAGCTTAGTCTGCTCTACCCCAGGCCTCGGC-3′ |
Beta VTCR construct and Cβ1 construct were separately amplified using standard PCR technology. They were connected to each other using a stitching PCR. Plasmid DNA was purified on a Qiagen mini-prep column according to the manufacturer's instructions and the sequence was verified by automated sequencing at the sequencing facility of Department of Biochemistry, Oxford University. The sequence for A6+Cβ1 is shown in FIG. 92.
Consequently, the A6+Cβ1 chain was paired to A6 alpha TCR by inter-chain disulphide bond after introducing cysteine in C-domain of both chains.
The soluble TCR was expressed and refolded as described in Example 2.
sTCR was separated from degradation products and impurities by loading the dialysed refold onto a POROS 50HQ anion exchange column and eluting bound protein with a gradient of 0-500 mM NaCl over 50 column volumes using an Akta purifier (Pharmacia) as in FIG. 93. Peak fractions were stored at 4° C. and analysed by Coomassie-stained SDS-PAGE (FIG. 94) before being pooled and concentrated. Finally, the sTCR was purified and characterised using a Superdex 200HR gel filtration column (FIG. 95) pre-equilibrated in HBS-EP buffer (10 mM HEPES pH 7.4, 150 mM NaCl, 3.5 mM EDTA, 0.05% nonidet p40). The peak eluting at a relative molecular weight of approximately 50 kDa was pooled and concentrated prior to characterisation by BIAcore surface plasmon resonance analysis.
A BIAcore analysis of the binding of the disulphide-linked A6 TCR to pMHC was carried out as described in Example 3. FIG. 96 shows BIAcore analysis of the specific binding of disulphide-linked A6 soluble TCR to its cognate pMHC.
The soluble A6 TCR with a novel disulphide bond incorporating the Cβ1 constant region had a Kd of 2.42±0.55 μM for its cognate pMHC. This value is very similar to the Kd of 1.8 μM determined for the soluble A6 TCR with a novel disulphide bond incorporating the Cβ2 constant region as determined in Example 3.
The β chain constant regions of TCRs include a cysteine residue (residue 75 in exon 1 of TRBC1*01 and TRBC2*01) which is not involved in either inter-chain or intra-chain disulphide bond formation. All of the previous examples describe the production of soluble TCRs with a novel disulphide bond in which this “free” cysteine has been mutated to alanine in order to avoid the possible formation of any “inappropriate” disulphide bonds which could result in a reduced yield of functional TCR. The present example demonstrates that soluble TCRs incorporating this “free” cysteine can be produced.
For mutating TCR β-chain alanine (residue 75 in exon 1 of TRBC1*01 and TRBC2*01) to cysteine, the following primers were designed (mutation shown in lower case):
| (SEQ ID NO:88) |
| 5′-T GAC TCC AGA TAC tgT CTG AGC AGC CG | ||
| (SEQ ID NO:89) |
| 5′-CG GCT GCT CAG Aca GTA TCT GGA GTC A |
PCR mutagenesis, expression and refolding of the soluble TCR was carried out as described in Example 2.
sTCR was separated from degradation products and impurities by loading the dialysed refold onto a POROS 50HQ anion exchange column and eluting bound protein with a gradient of 0-500 mM NaCl over 50 column volumes using an Akta purifier (Pharmacia) as in FIG. 98. Peak fractions were stored at 4° C. and analysed by Coomassie-stained SDS-PAGE (FIG. 99) before being pooled and concentrated. Finally, the sTCR was purified and characterised using a Superdex 200HR gel filtration column (FIG. 100) pre-equilibrated in HBS-EP buffer (10 mM HEPES pH 7.4, 150 mM NaCl, 3.5 mM EDTA, 0.05% nonidet p40). The peak eluting at a relative molecular weight of approximately 50 kDa was pooled and concentrated prior to characterisation by BIAcore surface plasmon resonance analysis.
A BIAcore analysis of the binding of the disulphide-linked A6 TCR to pMHC was carried out as described in Example 3. FIG. 101 shows BIAcore analysis of the specific binding of disulphide-linked A6 soluble TCR to its cognate pMHC.
The soluble A6 TCR with a novel disulphide bond incorporating the “free” cysteine in the β chain had a Kd of 21.39±3.55 μM for its cognate pMHC.
The present example demonstrates that soluble TCRs with a novel disulphide bond in which the “free” cysteine in the P chain (residue 75 in exon 1 of TRBC1*01 and TRBC2*01) is mutated to serine can be successfully produced.
For mutating TCR β-chain alanine that had previously been substituted for the native cysteine (residue 75 in exon 1 of TRBC1*01 and TRBC2*01) to serine, the following primers were designed (mutation shown in lower case):
| (SEQ ID NO:90) |
| 5′-T GAC TCC AGA TAC tCT CTG AGC AGC CG | ||
| (SEQ ID NO:91) |
| 5′-CG GCT GCT CAG AGa GTA TCT GGA GTC A |
PCR mutagenesis (resulting in a mutated beta chain as shown in FIG. 102), expression and refolding of soluble TCR was carried out as described in Example 2.
sTCR was separated from degradation products and impurities by loading the dialysed refold onto a POROS 50HQ anion exchange column and eluting bound protein with a gradient of 0-500 mM NaCl over 50 column volumes using an Akta purifier (Pharmacia) as shown in FIG. 103. Peak fractions were stored at 4° C. and analysed by Coomassie-stained SDS-PAGE (FIG. 104) before being pooled and concentrated. Finally, the sTCR was purified and characterised using a Superdex 200HR gel filtration column (FIG. 105) pre-equilibrated in HBS-EP buffer (10 mM HEPES pH 7.4, 150 mM NaCl, 3.5 mM EDTA, 0.05% nonidet p40). The peak eluting at a relative molecular weight of approximately 50 kDa was pooled and concentrated prior to characterisation by BIAcore surface plasmon resonance analysis.
A BIAcore analysis of the binding of the disulphide-linked A6 TCR to pMHC was carried out as described in Example 3. FIG. 106 shows BIAcore analysis of the specific binding of disulphide-linked A6 soluble TCR to its cognate pMHC.
The soluble A6 TCR with a novel disulphide bond in which the “free” cysteine in the β chain was mutated to serine had a Kd of 2.98±0.27 μM for its cognate pMHC. This value is very similar to the Kd of 1.8 μM determined for the soluble A6 TCR with a novel disulphide bond in which the “free” cysteine in the β chain was mutated to alanine as determined in Example 3.
NY-ESO TCR α and β chains were fused to the C-terminus of the pre-pro mating factor alpha sequence from Saccharomyces cerevisiae and cloned into yeast expression vectors pYX122 and pYX112 respectively (see FIGS. 107 and 108).
The following primers were designed to PCR amplify pre-pro mating factor alpha sequence from S. cerevisiae strain SEY6210 (Robinson et al. (1991), Mol Cell Biol. 11(12):5813-24) for fusing to the TCR α chain.
| (SEQ ID NO:94) |
| 5′-TCT GAA TTC ATG AGA TTT CCT TCA ATT TTT AC-3′ | |
| (SEQ ID NO:95) |
| 5′-TCA CCT CCT GGG CTT CAG CCT CTC TTT TAT C-3′ |
The following primers were designed to PCR amplify pre-pro mating factor alpha sequence from S. cerevisiae strain SEY6210 for fusing to the TCR β chain.
| 5′-TCT GAA TTC ATG AGA TTT CCT TCA ATT TTT AC-3′ | |
| 5′-GTG TCT CGA GTT AGT CTG CTC TAC CCC AGG C-3′ |
Yeast DNA was prepared by re-suspending a colony of S. cerevisiae strain SEY6210 in 30 μl of 0.25% SDS in water and heating for 3 minutes at 90° C. The pre-pro mating factor alpha sequences for fusing to the TCR α and β chains were generated by PCR amplifying 0.25 μl of yeast DNA with the respective primer pairs mentioned above using the following PCR conditions. 12.5 pmoles of each primer was mixed with 200 μM dNTP, 5 μl of 10×Pfu buffer and 1.25 units of Pfu polymerase (Stratagene) in a final volume of 50 μl. After an initial denaturation step of 30 seconds at 92° C., the reaction mixture was subjected to 30 rounds of denaturation (92° C., 30 sec.), annealing (46.9° C., 60 sec.), and elongation (72° C., 2 min.) in a Hybaid PCR express PCR machine.
The following primers were designed to PCR amplify the TCR α chain to be fused to the pre-pro mating factor alpha sequence mentioned above.
| (SEQ ID NO:96) |
| 5′-GGC TGA AGC CCA GGA GGT GAC ACA GAT TCC-3′ | |
| (SEQ ID NO:97) |
| 5′-CTC CTC TCG AGT TAG GAA CTT TCT GGG CTG GG-3′ |
The following primers were designed to PCR amplify the TCR β chain to be fused to the pre-pro mating factor alpha sequence mentioned above.
| (SEQ ID NO:98) |
| 5′-GGC TGA AGC CGG CGT CAC TCA GAC CCC AAA AT-3′ | |
| (SEQ ID NO:99) |
| 5′-GTG TCT CGA GTT AGT CTG CTC TAC CCC AGG C-3′ |
The PCR conditions for amplifying the TCR α and β chains were the same as mentioned above except for the following changes: the DNA template used for amplifying the TCR α and β chains were the NY-ESO TCR α and β chains respectively (as prepared in Example 5); and the annealing temperature used was 60.1° C.
The PCR products were then used in a PCR stitching reaction utilising the complementary overlapping sequences introduced into the initial PCR products to create a full length chimeric gene. The resulting PCR products were digested with the restriction enzymes EcoR I and Xho I and cloned into either pYX122 or pYX112 digested with the same enzymes. The resulting plasmids were purified on a Qiagen™ mini-prep column according to the manufacturer's instructions, and the sequences verified by automated sequencing at the sequencing facility of Genetics Ltd, Queensway, New Milton, Hampshire, United Kingdom. FIGS. 109 and 110 show the DNA and protein sequences of the cloned chimeric products.
The yeast expression plasmids containing the TCR α and β chains respectively produced as described in Example 15 were co-transformed into S. cerevisiae strain SEY6210 using the protocol by Agatep et al. (1998) (Technical Tips Online (http://tto.trends.com) 1:51:P01525). A single colony growing on synthetic dropout (SD) agar containing Histidine and Uracil (Qbiogene, Illkirch, France) was cultured overnight at 30° C. in 10 ml SD media containing Histidine and Uracil. The overnight culture was sub-cultured 1:10 in 10 ml of the fresh SD media containing Histidine and Uracil and grown for 4 hours at 30° C. The culture was centrifuged for 5 minutes at 3800 rpm in a Heraeus Megafuge 2.0R (Kendro Laboratory Products Ltd, Bishop's Stortford, Hertfordshire, UK) and the supernatant harvested. 5 μl StratClean Resin (Stratagene) was mixed with the supernatent and kept rotating in a blood wheel at 4° C. overnight. The StrataClean resin was spun down at 3800 rpm in a Heraeus Megafuge 2.0R and the media discarded. 2511 of reducing sample buffer (950 μl of Laemmli sample buffer (Biorad) containing 5011 of 2M DTT) was added to the resin and the samples heated at 95° C. for 5 minutes and then cooled on ice before 20 μl of the mix was loaded on a SDS-PAGE gel at 0.8 mA constant/cm2 of gel surface for 1 hour. The proteins in the gel were transferred to Immuno-Blot PVDF membranes (Bio-Rad) and probed with TCR anti α chain antibody as described in Example 17 below except for the following changes. The primary antibody (TCR anti α chain) and secondary antibodies were used at 1 in 200 and 1 in 1000 dilutions respectively. FIG. 111 shows a picture of the developed membrane. The result shows that there is a low level of TCR secretion by the yeast culture into the media.
The α and β chains of the disulphide A6 Tax TCR were cloned from pGMT7 into a pBlueScript KS2-based vector called the pEX172. This vector was designed for cloning different MHC class II β-chains, for insect cell expression, using the leader sequence from DRB1*0101, an AgeI site for insertion of different peptide-coding sequences, a linker region, and then MluI and SalI sites to clone the DRβ chains in front of the Jun Leucine zipper sequence. The sequence where pEX 172 differs from pBlueScript II KS-, located between the KpnI and EcoRI sites of pBlueScript II KS-, is shown in FIG. 112. For the purposes of cloning TCR chains in insect cells, this pEX172 was cut with AgeI and SalI to remove the linker region and MluI site, and the TCR chains go in where the peptide sequence would start. The TCR sequences were cloned from pGMT7 with a BspEI site at the 5′ end (this had AgeI compatible sticky ends) and a SalI site at the 3′ end. In order to provide the cleavage site for the removal of the DRβ leader sequence, the first three residues of the DRβ chain (GDT) were preserved. In order to prevent the Jun Leucine zipper sequence being transcribed, it was necessary to insert a stop codon before the SalI site. For a schematic of this construct, see FIG. 113. Once the TCR chains are in this plasmid, the BamHI fragment were cut out and subcloned into the pAcAB3 vector, which has homology recombination sites for Baculovirus. The pAcAB3 vector has two divergent promoters, one with a BamHI site and one with a BglII cloning site. There is a BglII site in the A6 TCR β-chain, so the A6 TCR α-chain was inserted into the BglII site, and the β-chain was then subcloned into the BamHI site.
In accordance with the above cloning strategy, the following primers were designed (homology to the vectors is in uppercase):
| A6α: |
| (SEQ ID NO:100) |
| F: 5′-gtagtccggagacaccggaCAGAAGGAAGTGGAGCAGAAC | |
| (SEQ ID NO:101) |
| R: 5′-gtaggtcgacTAGGAACTTTCTGGGCTGGG | |
| A6β: |
| (SEQ ID NO:102) |
| F: 5′-gtagtccggagacaccggaAACGCTGGTGTCACTCAGA | |
| (SEQ ID NO:103) |
| R: 5′-gtaggtcgacTAGTCTGCTCTACCCCAGG |
Expression plasmids containing the genes for the disulphide A6 Tax TCR α or β chain were used as templates in the following PCR reactions. 100 ng of α plasmid was mixed with 1 μl 10 mM dNTP, 5 μl 10×Pfu-buffer (Stratagene), 1.25 units Pfu polymerase (Stratagene), 50 μmol of the A6α primers above, and the final volume was adjusted to 50 μl with H2O. A similar reaction mixture was set up for the β chain, using the β plasmid and the pair of β primers. The reaction mixtures were subjected to 35 rounds of denaturation (95° C., 60 sec.), annealing (50° C., 60 sec.), and elongation (72° C., 8 min.) in a Hybaid PCR express PCR machine. The product was then digested for 2 hours at 37° C. with 10 units of BspEI restriction enzyme then for a further 2 hours with 10 units of SalI (New England Biolabs). These digested reactions were ligated into pEX172 that had been digested with AgeI and SalI, and these were transformed into competent XL1-Blue bacteria and grown for 18 hours at 37° C. A single colony was picked from each of the α and β preps and grown over night in 5 ml TYP+ampicillin (16 g/l Bacto-Tryptone, 16 g/l Yeast Extract, 5 g/l NaCl, 2.5 g/l K2HPO4, 100 mg/l Ampicillin). Plasmid DNA was purified on a QIAgen mini-prep column according to the manufacturer's instructions and the sequence was verified by automated sequencing at the sequencing facility of Genetix. The amino acid sequences of the BamHI inserts are shown in FIGS. 114 and 115 for the α chain and β chain, respectively.
These α and β disulphide A6 Tax TCR chain constructs in pEX172 were digested out for 2 hours at 37° C. with BamHI restriction enzyme (New England Biolabs). The α chain BamHI insert was ligated into pAcAB3 vector (Pharmingen-BD Biosciences: 21216P) that had been digested with BglII enzyme. This was transformed into competent XL1-Blue bacteria and grown for 18 hours at 37° C. A single colony was picked from this plate and grown overnight in 5 ml TYP+ampicillin and the plasmid DNA was purified as before. This plasmid was then digested with BamHI and the β chain BamHI insert was ligated in, transformed into competent XL1-Blue bacteria, grown overnight, picked to TYP-ampicillin, and grown before miniprepping as before using a QIAgen mini-prep column. The correct orientation of both the α and β chains were confirmed by sequencing using the following sequencing primers:
| pAcAB3 α forwards: |
| (SEQ ID NO:104) |
| 5′-gaaattatgcatttgaggatg | ||
| pAcAB3 β forwards: |
| (SEQ ID NO:105) |
| 5′-attaggcctctagagatccg |
The expression plasmid containing the α-chain and β-chain was transfected into sf9 cells (Pharmingen-BD Biosciences: 21300C) grown in serum free medium (Pharmingen-BD Biosciences: 551411), using the Baculogold transfection kit (Pharmingen-BD Biosciences: 21100K) as per the manufacturers instructions. After 5 days at 27° C., 200 μl of the medium these transfected cells had been growing in was added to 100 ml of High Five cells at 1×106 cells/ml in serum free medium. After a further 6 days at 27° C., 1 ml of this medium was removed and centrifuged at 13,000 RPM in a Hereus microfuge for 5 minutes to pellet cell debris. 10 μl of this insect A6 disulphide linked TCR supernatant was run alongside positive controls of bacterial A6 disulphide linked TCR 5 μg and 10 μg on a pre-cast 4-20% Tris/glycine gel (Invitrogen: EC60252). Reduced samples were prepared by adding 10 μp of Reducing sample buffer (950 μl of Laemmli sample buffer (Bio-Rad: 161-0737) 50 μl of 2M DTT) and heating at 95° C. for 5 minutes, cooling at room temperature for 10 minutes then loading 20 μl. Non-reduced samples were prepared by adding 10 μl of Laemmli sample buffer, and loading 20 μl.
The gel was run at 150 volts for 1 hour in a Novex-Xcell gel tank after which the gel was stained in 50 ml of Coomassie gel stain for 1 hour with gentle agitation (1.1 g Coomassie powder in 500 ml of methanol stir for 1 hour add 100 ml acetic acid make up to 1 litre with H2O and stir for 1 hour then filter through 0.45 μM filter). The gel was de-stained three times for 30 mins with gentle agitation in 50 ml of de-stain (as Coomassie gel stain but omitting the Coomassie powder).
Western Blots were performed by running SDS-PAGE gels as before but the proteins were transferred to Immuno-Blot PVDF membranes (Bio-Rad: 162-0174) rather than staining the gels with Coomassie. Six filter papers were cut to the size of the gel and soaked in transfer buffer (2.39 g Glycine, 5.81 g of Tris Base, 0.77 g DTT dissolved in 500 mls of H2O, 200 mls of methanol added then made up to 1000 mls with H2O). The PVDF membrane was prepared by soaking in methanol for 1 minute and then in transfer buffer for 2 minutes. Three filter papers were placed on the anode surface of the Immuno-blot apparatus (Pharmacia—Novablot) then the membrane was placed on top followed by the gel and then finally three more filter papers on the cathode side. The Immuno-blot was run for 1 hour at 0.8 mA constant/cm2 of gel surface.
After blotting, the membrane was blocked in 7.5 mls of blocking buffer (4 Tris-buffered saline tablets (Sigma: T5030), 3 g non-fat dried milk (Sigma: M7409), 30 μl of Tween 20 made up to 30 mls with H2O) for 60 mins with gentle agitation. The membrane was washed three times for 5 mins with TBS wash buffer (20 TBS tablets, 150 μl Tween 20 made up to 300 ml with H2O). The membrane was then incubated in primary antibody 1 in 50 dilution of anti TCR α chain clone 3A8 (Serotec: MCA987) or anti TCR β chain clone 8A3 (Serotec: MCA988) in 7.5 ml blocking buffer for 1 hour with gentle agitation. The membrane was washed as before in TBS wash buffer. Next, a secondary antibody incubation of HRP labelled goat anti-mouse antibody (Santa Cruz Biotech: Sc-2005) 1 in 1000 dilution in 7.5 ml of blocking buffer was carried out for 30 min with gentle agitation. The membrane was washed as before and then washed in 30 ml of H2O with 2 TBS tablets.
The antibody binding was detected by Opti-4CN colourmetric detection (Biorad: 170-8235) (1.4 ml Opt-4CN diluent, 12.6 ml H2O, 0.28 ml Opti-4CN substrate). The membranes were coloured for 30 minutes and then washed in H2O for 15 minutes. The membranes were dried at room temperature, and scanned images were aligned with an image of the coomassie stained gel (FIG. 116).
It can be seen from FIG. 116 that both disulphide TCRs are formed as a heterodimer that is stable in the SDS gel. They both break into the α and β chains upon reduction. The insect disulphide TCR heterodimer has a slightly higher molecular weight that the bacterially produced version, presumably because of the glycosylation from the insect cells. It can be seen that in this instance the insect cells are producing α chain in excess, and free α chain can be seen in the non-reduced lane of the anti-α western blot.
These data clearly demonstrate that the baculovirus expression system described above provides a viable alternative to prokaryotic expression of soluble TCRs containing novel disulphide bonds.
1. A soluble T cell receptor (sTCR), which comprises:
(i) all or part of a TCR α chain, except the transmembrane domain thereof, and
(ii) all or part of a TCR β chain, except the transmembrane domain thereof, wherein (i) and (ii) each comprise a functional variable domain and at least a part of the constant domain of the TCR chain, and are linked by a disulphide bond between constant domain residues which is not present in native TCR and wherein an interchain disulphide bond in native TCR is not present.
2. The sTCR of claim 1, wherein one or both of (i) and (ii) comprise all of the extracellular constant Ig domain of the TCR chain.
3. A soluble αβ-form T cell receptor (sTCR), wherein a covalent disulphide bond links a residue of the immunoglobulin region of the constant domain of the α chain to a residue of the immunoglobulin region of the constant domain of the β chain, wherein an interchain disulphide bond in native TCR is not present.
4. The sTCR of claim 1, wherein the disulphide bond which is not present in native TCR is between cysteine residues substituted for residues whose β carbon atoms are less than 0.6 nm apart in the native TCR structure.
5. The sTCR of claim 1, wherein native α and β TCR chains are truncated at the C-terminus such that the cysteine residues which form the native interchain disulphide bond are excluded.
6. The sTCR of claim 1, wherein cysteine residues which form the native interchain disulphide bond are substituted to another residue.
7. The sTCR of claim 6, wherein cysteine residues which form the native interchain disulphide bond are substituted to serine or alanine.
8. The sTCR of claim 1, wherein an unpaired cysteine residue present in native TCR chain is not present.
9. The sTCR of claim 1, wherein one or both of the chains are derivatised with, or fused to, a moiety at its C or N terminus.
10. The sTCR of claim 1, further comprising a detectable label.
11. The sTCR of claim 1, associated with a therapeutic agent.
12. The sTCR of claim 8, wherein one or both of the chains are derivatised with, or fused to, a moiety at its C or N terminus.
13. The sTCR of claim 8, further comprising a detectable label.
14. The sTCR of claim 8, associated with a therapeutic agent.
15. A multivalent T cell receptor (TCR) complex comprising a plurality of the sTCRs of 1.
16. A multivalent T cell receptor (TCR) complex comprising a plurality of the sTCRs of 8.
17. A pharmaceutical formulation comprising:
(a) at least one of:
(i) a soluble T cell receptor (sTCR), which comprises:
(1) all or part of a TCR α chain, except the transmembrane domain thereof, and
(2) all or part of a TCR β chain, except the transmembrane domain thereof,
wherein (i) and (ii) each comprise a functional variable domain and at least a part of the constant domain of the TCR chain, and are linked by a disulphide bond between constant domain residues which is not present in native TCR and wherein an interchain disulphide bond in native TCR is not present,
(ii) a multivalent T cell receptor (TCR) complex comprising a plurality of the sTCRs of (i);
(iii) the sTCR of (i), wherein an unpaired cysteine residue present in native TCR β chain is not present; and
(iv) a multivalent T cell receptor (TCR) complex comprising a plurality of the sTCRs of (iii); and
(b) a pharmaceutically acceptable carrier.