Patent application title:

COX-2 function and wound healing

Publication number:

US20110053860A1

Publication date:
Application number:

12/553,275

Filed date:

2009-09-03

Abstract:

The invention relates to compositions and methods for enhancing bone healing, bone formation and wound healing. More specifically, it relates to the use of cyclooxygenase 2 (COX-2) following bone fracture, orthopaedic procedure or wound infliction to enhance healing.

Inventors:

Interested in similar patents?

Get notified when new applications in this technology area are published.

Classification:

C12N9/0083 »  CPC main

Enzymes; Proenzymes; Compositions thereof ; Processes for preparing, activating, inhibiting, separating or purifying enzymes; Oxidoreductases (1.) acting on paired donors with incorporation of molecular oxygen (1.14) Miscellaneous (1.14.99)

A61K31/415 »  CPC further

Medicinal preparations containing organic active ingredients; Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins having five-membered rings with two or more ring hetero atoms, at least one of which being nitrogen, e.g. tetrazole 1,2-Diazoles

A61K31/635 »  CPC further

Medicinal preparations containing organic active ingredients; Compounds containing para-N-benzenesulfonyl-N-groups, e.g. sulfanilamide, p-nitrobenzenesulfonyl hydrazide having a heterocyclic ring, e.g. sulfadiazine

A61K38/00 »  CPC further

Medicinal preparations containing peptides

A61K48/00 »  CPC further

Medicinal preparations containing genetic material which is inserted into cells of the living body to treat genetic diseases; Gene therapy

A61K38/16 IPC

Medicinal preparations containing peptides Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof

A61K31/713 IPC

Medicinal preparations containing organic active ingredients; Carbohydrates; Sugars; Derivatives thereof; Compounds having three or more nucleosides or nucleotides Double-stranded nucleic acids or oligonucleotides

A61K31/365 IPC

Medicinal preparations containing organic active ingredients; Heterocyclic compounds having oxygen as the only ring hetero atom, e.g. fungichromin Lactones

A61P17/02 »  CPC further

Drugs for dermatological disorders for treating wounds, ulcers, burns, scars, keloids, or the like

Description

INTRODUCTION

This application is a continuation of U.S. Ser. No. 09/953,067 filed Sep. 11, 2001, which is herein incorporated by reference in its entirety.

FIELD OF THE INVENTION

This invention relates to the field of cyclooxygenase activity and wound healing.

BACKGROUND OF THE INVENTION

Bones, along with a small number of cartilages, comprise the skeletal system that serves as the rigid supporting framework of the body in adult humans. Certain parts of the supporting framework form chambers, such as the skull and the thoracic cage, that are important for protecting the soft parts contained in the chambers. Bones also serve as attachments for muscles and act as levers in the joint system of the body.

Mature bone is comprised of an organic framework of fibrous tissue and inorganic salts known as crystalline hydroxyapatite (HA). HA is composed of calcium and phosphorous, which are derived from the blood plasma and ultimately from nutritional sources. HA represents about 60 percent of the weight of compact bone and is deposited on a fibrous structure of collagenous connective tissue. Without HA, bone loses most its weight and rigidity and is susceptible to damage.

The process of bone formation, also known as osteogenesis, involves three main steps: production of the extracellular organic matrix (osteoid); mineralization of the matrix to form bone; and bone remodeling by resorption and reformation. The cellular activities of osteoblasts, osteocytes, and osteoclasts are essential to the process.

Osteoblasts synthesize the collagenous precursors of bone matrix and also regulate its mineralization. During bone formation, osteoblasts line tiny spaces known as lacunae within the surrounding mineralized matrix. Osteoblasts that line the lacunae are called osteocytes. Osteocytes occupy minute canals (canaliculi) which permit the circulation of tissue fluids. Hormones, growth factors, physical activity, and other stimuli act mainly through osteoblasts to bring about effects on bone. Osteoclasts are derived from hematopoietic stem cells that also give rise to monocytes and macrophages. Osteoclasts adhere to the surface of bone undergoing resorption and lie in depressions referred to as resorption bays. Osteoclasts are apparently activated by signals from osteoblasts. Osteoclastic bone resorption does not occur in the absence of osteoblasts. To meet the requirements of skeletal growth and mechanical function, bone undergoes dynamic remodeling by a coupled process of bone resorption by osteoclasts and reformation by osteoblasts.

Bone is formed through one of two pathways, by replacement of cartilage or by direct elaboration from periosteum. These processes are known, respectively, as endochondral ossification and intramembraneous ossification. During endochondral ossification, a cartilaginous bone model is first formed. Then, a layer of bone on the surface of the cartilaginous shaft is formed by osteoblasts. Succeeding layers of bone follow. At the same time, the matrix of cartilage cells is calcified into a trabecular network of cartilage while the interstitial cartilage is degenerated. The combined processes of calcification and degeneration of the cartilage advance from the center toward the ends of the cartilage model. The osteoblasts penetrate the cartilage along with capillaries to produce bone on the cartilaginous trabeculae and advance from the center to the ends to progressively form bone on the cartilaginous trabeculae. Ultimately, the calcified cartilage is completely replaced by spongy bone.

In contrast, the process of intramembraneous ossification does not involve a cartilaginous template. Instead, mesenchymal cells become osteoblasts which begin to form the branching trabeculae of bone. The initial thin trabeculae are some times referred to as spicules. The trabecular bone becomes denser by widening of the trabeculae, and is then remodeled externally and internally. The mandibles, clavicles and certain bones of the skull are produced through intramembraneous ossification.

There are a number of diseases related to bone formation, deterioration and healing, including osteoporosis, osteogenesis imperfecta (OI) and fibrodysplasia ossificans progressiva (FOP). Osteoporosis, or porous bone, is a disease characterized by low bone mass and structural deterioration of bone tissue, leading to bone fragility and an increased susceptibility to fractures of the hip, spine, and wrist. Osteoporosis is a major public health threat for more than 28 million Americans, 80 percent of whom are women. The strength of bone depends on its mass and density. Bone density depends in part on the amount of calcium, phosphorus and other minerals bones contain. Bones that contain less mineral are weakened and lose internal supporting structure. A full cycle of bone remodeling takes about 2 to 3 months. Children tend to make new bone faster than old bone is broken down. As a result, bone mass increases. Peak bone mass is reached in an individual's mid-30s. Although bone remodeling continues, old bone is broken down faster than new bone is formed. As a result, adults lose slightly more bone than is gained—about 0.3 percent to 0.5 percent a year. Lack of vitamin D and calcium in an individual's diet can accelerate the process. In addition, for women at menopause, estrogen levels drop and bone loss accelerates to about 1 percent to 3 percent a year. Bone loss slows but doesn't stop at around age 60. Women may lose between 35 percent and 50 percent of their bone mass, while men may lose 20 percent to 35 percent of their bone mass. Development of osteoporosis depends on the bone mass attained between ages 25 and 35 (peak bone mass) and how rapidly it is lost as an individual get older. The higher an individual's peak bone mass, the less likely that individual will develop osteoporosis. Calcium, vitamin D and exercising regularly are important for maintaining bone strength. Nonetheless, methods for effectively treating osteoporosis are still desired.

Osteogenesis Imperfecta (OI) is a genetic disorder characterized by bones that break easily, often from little or no apparent cause. There are at least four distinct forms of the disorder, representing extreme variation in severity from one individual to another. For example, a person may have as few as ten or as many as several hundred fractures in a lifetime. While the number of persons affected with OI in the United States is unknown, the best estimate suggests a minimum of 20,000 and possibly as many as 50,000. OI can be dominantly or recessively inherited and can also occur as a mutation. A cure for OI has not yet been discovered. As a result, methods for treatment focus on preventing and controlling symptoms, strengthening bone mass and ensuring proper healing.

In addition, both osteoporosis and OI leave patients vulnerable to bone fractures. If these bone fractures do not heal properly, these patients may continue to suffer from pain and may be at increased risk for further fractures as well as other related complications. Methods or treatments that enhance and/or ensure proper fracture healing are important for patients with osteoporosis or brittle bone disease. Another group that will benefit from methods for enhanced wound healing are the elderly and patients who have undergone orthopaedic procedures.

Fracture healing is the culmination of a highly orchestrated series of physiological and cellular pathways to restore the function of broken bones. Fracture healing generally involves the following steps: the formation of a hematoma (collection of blood at the fracture site), development of a soft callus due to cell multiplication in the lining of the injured bone, growth of blood vessels and fibrocartilege in the middle of the fracture, formation of osteoblasts that migrate into the callus and deposit calcium to form a hard callus, and remodeling and strengthening of the bone through osteoblast and osteoclast formation.

Osteogenesis during fracture healing occurs by intramembraneous and endochondral ossification that histologically resembles fetal skeletogenesis (Einhorn 1998; Vortkamp et al. 1998; Ferguson et al. 1999). However, the localized tissue hypoxia, the fracture hematoma, subsequent inflammation at the fracture site, and the frank remodeling of the fracture callus at the later stages of healing are unique physiological and cellular responses to bone fractures that have no known corresponding counterpart during fetal development of the skeleton.

It has been hypothesized that the early physiological responses to a bone fracture, namely hypoxia and inflammation, induce gene expression pathways and promote cell proliferation and migration into the fracture site in order to promote healing (Brighton et al. 1991; Bolander 1992). Production or release of specific growth factors, cytokines, and local hormones at the fracture site by these physiological processes would create the appropriate microenvironment to (1) stimulate periosteal osteoblast proliferation and intramembraneous ossification to form the hard fracture callus, (2) stimulate cell proliferation and migration into the fracture site to form the soft callus, and (3) stimulate chondrocyte differentiation in the soft callus with subsequent endochondral ossification. Remodeling of the fracture callus by osteoclastic resorption and subsequent osteogenesis converts the fracture callus woven bone into cortical bone and thereby restores the shape and mechanical integrity of the fractured bone.

One potential class of factors that would mediate certain events of fracture healing is the prostaglandins. The effects of prostaglandins on bone metabolism are complex since prostaglandins can stimulate bone formation as well as bone resorption (Kawaguchi et al. 1995). However, because the in vivo half-life of purified or synthetic prostaglandins is very short, prostaglandins per se have a limited therapeutic value.

Prostaglandins are synthesized by osteoblasts and different cell stimuli can alter the amount and possibly the spectrum of prostaglandins produced by osteoblasts (Feyen et al. 1984; Klein-Nulend et al. 1997; Wadleigh and Herschman 1999). Therefore, signal transduction, mechanical perturbations, or other physiological signals can affect bone metabolism through altercation of prostaglandin production.

Prostaglandin synthesis begins with the release of arachidonic acid from membrane phospholipids by phospholipase activity. Arachidonic acid is subsequently converted into prostaglandin H2 (PGH2) by cyclooxygenase (COX) via two independent catalytic steps (Needleman et al. 1986). Synthase enzymes then convert PGH2 into the specific prostaglandins produced by that cell such as PGD2, PGE2, PGF2α, prostacyclin, and thromboxane. Thus, cyclooxygenase activity is essential for normal prostaglandin production and cyclooxygenase is believed to be the rate-limiting enzyme in the prostaglandin synthetic pathway.

There are two known forms of cyclooxygenase, COX-1 and COX-2, which are encoded by two genes (Xie et al. 1991; O'Banion et al. 1992). COX-1 is constitutively expressed by many tissues and provides a homeostatic level of prostaglandins for the body and specific organs, such as the stomach and kidneys (Vane et al. 1998). In contrast, COX-2 is inductively expressed in vitro by a diverse array of cell stimuli such as exposure to lipopolysaccharide (O'Sullivan et al. 1992a; O'Sullivan et al. 1992b), certain cytokines and growth factors (O'Banion et al. 1992; Wadleigh and Herschman 1999), or mechanical stress (Topper et al. 1996; Klein-Nulend et al. 1997). COX-2 expression can be stimulated in vivo by wounding and inflammation (Masferrer et al. 1994; Shigeta et al. 1998; Muscaret al. 2000).

Inhibiting the cyclooxygenase activity of COX-1 and COX-2 can reduce prostaglandin synthesis by preventing the conversion of arachidonic acid into PGG2, the precursor of PGH2. This is commonly done to reduce inflammation and pain with aspirin and non-steroidal anti-inflammatory drugs (NSAIDs), such as indomethacin. Most NSAIDs inhibit the cyclooxygenase activity of COX-1 and COX-2 with near equal potency, which often leads to detrimental gastro-intestinal or kidney side effects (Raskin 1999; Whelton 1999). Use of COX-2-selective NSAIDs has become very popular since these drugs, such as celecoxib (Celebrex) and rofecoxib (Vioxx) preferentially inhibit the cyclooxygenase activity of COX-2 with selectivity relative to COX-1 of approximately 8-fold for celecoxib and 35-fold for rofecoxib (Riendeau et al. 2001).

Prostaglandins are produced during fracture healing. Prostaglandin levels in and around the healing callus of rabbit tibia that had been severed by osteotomy showed that PGE and PGF levels were elevated between 1 and 14 and 7 and 14 days post-osteotomy, respectively (Dekel et al. 1981). No survey of the temporal pattern or variety of prostaglandins produced during fracture healing has been reported for other rodents or man. Non-specific NSAIDs have been shown to delay but not stop fracture healing in experimental animal models (Rø et al. 1976; Allen et al. 1980; Altman et al. 1995). In addition, non-specific NSAIDs have been shown to reduce the incidence and severity of heterotopic (abnormal or deviating from the natural position) bone formation in humans following certain fractures or orthopaedic surgical procedures (Pritchett 1995; Moore et al. 1998). These observation suggest that prostaglandins are necessary for bone formation but given the limitations of non-specific NSAID use, it is unknown whether prostaglandins produced by COX-1, COX-2 or both enzymes are essential for fracture healing.

SUMMARY OF THE INVENTION

The present invention relates to compositions and methods for use in wound healing and for use in enhancing fracture healing, bone formation and wound healing. The present invention further provides for methods for treating diseases related to bones, including osteoporosis, osteogenesis imperfecta and fibrodysplasia ossificans progressiva.

One embodiment of the present invention involves a vector for use in wound healing comprising a promoter linked to a cyclooxygenase expression cassette. In a further embodiment, the vectors of this invention may be used in gene therapy approaches to enhance wound healing. The wound conditions of this invention can include, bone fractures and skin lesions. The methods of this invention are particularly useful for wound healing in the elderly, patients with osteoporosis and OI, and patients that suffer from delayed wound healing.

In another embodiment, cyclooxygenase proteins, including COX-1, COX-2 or a combination of the two, are formulated as pharmaceutical compositions for use in wound healing. In a further embodiment of the invention, the pharmaceutical compositions are combined with a carrier for applications in wound healing.

Another embodiment of the invention provides for the use of the vectors of this invention in gene therapy approaches and/or the pharmaceutical compositions to treat osteoporosis, OI and other related brittle bone conditions. In a further embodiment, the vectors and compositions are used therapeutically to counteract conditions associated with osteoporosis, OI and brittle bones conditions. In a further embodiment, the vectors and compositions are used for wound healing and/or to enhance wound healing in patients with osteoporosis, OI or brittle bone conditions.

In another embodiment of the invention, COX-2 selective NSAIDs are used in the treatment of heterotopic ossification conditions. Such conditions can include fibrodysplasia ossificans progressiva. In addition, heterotopic ossification can occur following hip replacement procedures and after acetabular fractures. COX-2 selective NSAIDs can be used to treat heterotopic ossification under these circumstances as well.

BRIEF DESCRIPTION OF THE DRAWINGS

FIG. 1. Radiographic Analysis of Fracture Healing in NSAID Treated Rats

High resolution radiographs were made immediately post-fracture and then every week till the endpoint of the experiment (8 weeks) using a Hewlett-Packard Faxitron. Shown are radiographs of the fractured right femurs from the same rats taken at 2 (top), 4 (middle), and 8 weeks (bottom) post-fracture (dorsal-ventral view). As indicated, panels A-D shows radiographs from a no drug rat, an indomethacin treated rat, a celecoxib treated rat, and a rofecoxib treated rat, respectively. Note that the fracture is still clearly evident in the 8-week post-fracture radiographs of the celecoxib and rofecoxib treated rats.

FIG. 2. COX-2-Selective NSAIDs Alter the Mechanical Properties of Fractured Femurs

Mechanical testing data was obtained or derived as described in the Experimental Procedures. The data for each fractured femur was normalized as a percentage of the value obtained from that animal's contralateral, unfractured femur, except for shear modulus panel D). Shown are the mean normalized values at each time point and for each treatment group or the mean shear modulus values in panel D. The error bars represent standard errors of the mean. Pairwise t-test were made between the no drug and experimental treatments within a time point. Statistical significance differences (P<0.05) are noted with asterisks.

FIG. 3. COX-2-Selective NSAIDs Disrupt Endochondral Ossification During Fracture Healing

Shown are fracture calluses from no drug, indomethacin, celecoxib, and rofecoxib treated rats at 2, 3, and 4 weeks post-fracture as indicated. The specimens were embedded in polymethylmethacrylate (PMMA), sectioned, and stained with van Gieson's picrofuchsin and Stevenel's blue so that bone is red, calcified cartilage is orange to red, cartilage is deep blue to purple, and fibrous tissue and muscle is pale blue. Each section is oriented with the cortical bone on the bottom, fracture callus on top, and fracture site in the middle. Note the abnormal cartilage morphology in the calluses of the NSAID treated rats (panels D, G, and J) and the lack of cartilage in the celecoxib (panels H and I) and rofecoxib treated (panels K and L) rats at 3 and 4 weeks post-fracture.

FIG. 4. Abnormal Bone Resorption during Fracture Healing in COX-2-Selective NSAID Treated Animals

Shown are fracture calluses from rofecoxib treated rats at 3 (panels A and B) and 4 weeks (panel C) post-fracture. The orientation of panels A and B are the same with external callus on top and fracture site to the immediate left of the panel. In panel C, the external callus is to the left and the fracture site is at the immediate bottom of the panel. The specimens were embedded in PMMA, sectioned, and stained with van Gieson's picrofuchsin and Stevenel's blue so that bone is red, calcified cartilage is orange to red, cartilage is deep blue to purple, and other cell types are shades of blue. Original photographic magnification is indicated. CB: cortical bone; WB: woven bone; CC: calcified cartilage; Ca: cartilage; F: fracture site; ab: air bubble; M: area of magnification shown in panel B; and Oc: osteoclasts. The NSAID treated rats often developed areas of high bone resorption at the cortical bone, fracture site, external callus junction (M) as seen in panel A. The air bubble (ab) seen in panel A is an artifact of the PMMA embedding. At higher magnification, osteoclasts (Oc) can be seen lining the cortical bone surface of area M in the 3 week fracture callus as denoted by the arrows. Shown in panel C is an identical area of a 4 week post-fracture callus as shown in panel B. The extent and area of bone resorption appears to be greater at 4 weeks post-fracture and also often encompassed all surfaces of the cortical bone at the fracture site. Similar bone resorption patterns were seen in celecoxib treated rats and to a lesser extent in the indomethacin treated rats.

FIG. 5. Experimental Complications Associated with NSAID Treatment during Fracture Healing

Complications that necessitated the pre-mature euthanization or resulted in the pre-mature death of a rat during the course of these experiments were compiled and used to determine the effects of NSAID treatment on anesthetic death, infection, and pin slippage. Experimental treatment group values were compared to the no drug values using a χ2 analysis. Significant differences are noted with an asterisk (P<0.01). As can be seen, pin slippage was by far the most common complication and was significantly different for each treatment group relative to the no drug rats with P-values of less than 1E−4, 1E−7, and 1E−24 for the indomethacin, celecoxib, and rofecoxib treated rats respectively. The rofecoxib treated rats were also found to have a statistically significant higher infection rate as compared to the no drug rats (P<0.0001). Death from anesthesia was not different between groups.

FIG. 6. Cox2 but not Cox1 is Essential for Normal Bone Fracture Healing

The right femora of Cox1−/− and Cox2−/− mice were fractured and examined radiographically and histologically at 2 weeks post-fracture. Panels A and D. Radiographs of fractured femurs from a Cox1−/− and a Cox2−/− mouse, respectively. Note the lack of mineralized tissue (X-ray dense) in the fracture callus region of the Cox2−/− mouse. Panels B and C. Sagital section through the fractured femur of a Cox1−/− stained with Masson's trichrome stain (cell nuclei−purple; muscle and cytoplasm=red; collagen and bone=blue). Panels E and F. Sagital section through the fractured femur of a Cox2−/− stained with Masson's trichrome stain. Note the presence of chondrocytes within the Cox2−/− callus but the lack of endochondral ossification relative to the Cox1−/− mouse fracture callus. Original photographic magnification is indicated. The Cox2−/− mouse fracture callus specimens are shown at higher magnification because the callus was smaller. B: bone; C: chondrocytes and cartilage; E: area of endochondral ossification; M: area of intramembraneous bone formation; F: fracture site.

DETAILED DESCRIPTION OF THE INVENTION

The present invention involves methods for enhancing wound healing and treating conditions of the bone with the use of cyclooxygenase (COX). COX is an enzyme that converts arachidonic acid into prostaglandin H2 (PGH2). PGH2 is then converted into specific prostaglandins, which affect bone metabolism and formation. There are two forms of cyclooxygenase, COX-1 and COX-2. COX-1 is constitutively expressed, while COX-2 is inductively expressed by various stimuli. Examples of such stimuli are wounding and inflammation. The subsequent expression of COX-2 in response to these stimuli results in the production of pro-inflammatory prostaglandins. The pain and inflammation associated with a wound are commonly treated with non-steroidal anti-inflammatory drugs (NSAIDs). Most NSAIDs inhibit the cyclooxygenase activity of both COX-1 and COX-2. However, due to the inhibition of COX-1 activity, gastro-intestinal and kidney side effects result from NSAIDs use. COX-2 selective NSAIDs have also been developed which preferentially inhibit COX-2 activity relative to COX-1 activity and thereby avoid the side effects associated with non-specific NSAIDs.

In addition to its inflammatory function, one aspect of the invention relates to the necessity of COX-2 activity in wound healing. As described in more detail below, COX-2 is essential for normal wound healing. In another aspect of the invention, treatment systems and methods employ COX-2 to enhance wound healing.

In a preferred embodiment of the invention, gene therapy techniques are employed to increase cyclooxygenase activity at the site of the wound to enhance wound healing. Gene therapy techniques allow an absent or faulty gene to be replaced with a working gene. They also allow for the delivery and controlled expression of therapeutic gene products. One embodiment of the invention provides for a vector containing a cyclooxygenase expression cassette. In a further embodiment, the vector containing the cyclooxygenase expression cassette is delivered to the wound using gene therapy techniques. The gene therapy techniques may use adenoviral vectors, adeno-associated viral vectors, recombination-defective retrovirus vectors or DNA vectors to deliver the cyclooxygenase expression cassette to the wound.

The vectors of this invention may be used to increase cyclooxygenase levels at the site of the wound and thereby enhance would healing. For example, these vectors may be used to enhance wound healing following bone fractures or orthopaedic procedures. The vectors may also be of particular use to the elderly and other patient groups that have delayed bone healing, including smokers, diabetics, and steroid users. In addition, the vectors may be used in the treatment of osteoporosis and osteogenesis imperfecta using gene therapy techniques for gene replacement and to enhance healing for wounds resulting from these diseases.

One aspect of the invention involves a vector that contains a cyclooxygenase expression cassette that encodes a cyclooxygenase gene product. The vector includes all necessary sequences for the expression of the cyclooxygenase expression cassette and any sequences that may be included to control the expression of the cassette. These sequences may include, but are not limited to, a promoter or initiation sequence, an enhancer sequence, termination sequence, RNA processing signals, and/or a polyadenylation signal sequence.

The term “vector” refers to a nucleic acid construct that encodes for a particular gene product. The vectors of the present invention are preferably adenoviral, adeno-associated viral, recombination-defective retrovirus, plasmid or DNA vectors.

The term “cyclooxygenase expression cassette” refers to nucleic acid which codes for cyclooxygenase enzyme, preferably COX-1 or COX-2. The expression cassette is positioned within the vector such that it can be transcribed into RNA and translated into the cyclooxygenase protein product. Table 3 provides for the human cDNA sequences for COX-1 (SEQ. ID. No. 1) and COX-2 (SEQ. ID. No. 2).

The term “necessary sequences for the expression of cyclooxygenase” refers to sequences necessary to ensure the transcription and translation of the expression cassette. The term “promoter” refers to a DNA sequence that is bound by RNA polymerase and is required to initiate transcription of a gene. There are a number of promoters that are known in the art, including those that can enhance or control expression of the gene or expression cassette. For example, cytomegalovirus promoter may be fused to the cyclooxygenase expression cassette to obtain constitutive expression of cassette or a COX-2 promoter may be linked to a cyclooxygenase cDNA to allow for expression of cyclooxygenase in a more normal fashion. For example, a COX-2 promoter may be linked to a COX-1 cDNA. This may allow a patient to remain on COX-2 selective NSAIDs but still have the ability to heal. In another aspect of the invention, the promoter may be induced in response to inflammation. Preferably, the inducible promoter employs promoter, or the complement system gene promoters. Other inflammatory gene promoters include promoters for TNF-.alpha., or the NF-.kappa.B response element.

In another aspect of the invention, the vectors are delivered directly to the location of the wound by injection or direct application in order to enhance wound healing. The vectors of this invention may also be administered by electroporation or delivered as an aerosol. The vectors may be administered or delivered in saline solutions, encapsulated in liposomes, in polymer solutions, in gels or lyophilized. In an alternative aspect, targeted transfection may be used to deliver the vectors in vivo. The term “wound” refers to a bone fracture, the site of a surgical orthopaedic procedure, or a skin lesion. In another aspect of the invention, the vectors may be delivered ex vivo, wherein a patient's cells are transfected ex vivo with the vectors of this invention and the transfected cells are then returned to the patient.

A further aspect of this invention provides for pharmaceutical compositions and methods of their use in wound healing. These pharmaceutical compositions include cyclooxygenase protein formulations and/or pharmaceutically acceptable carriers. The cyclooxygenase protein formulations comprise COX-1 protein, COX-2 protein or a combination of the two that are formulated such that the proteins remain stable, retain their function, including their enzymatic activity, and are physiologically acceptable. The human amino acid sequences for COX-1 (SEQ. ID. NO. 3) and COX-2 (SEQ. ID. NO. 4) proteins are provided in Table 3. There are a variety of pharmaceutically acceptable carriers that are known in the art, including, but not limited to, saline, liposomes, gels and polymers. The formulation and/or carrier may also be lyophilized for aerosol delivery. In a further embodiment of the invention, these pharmaceutical compositions are administered topically, orally, intravenously, nasally or via inhalation, or locally for use in wound healing. Preferably, these composition are administered to enhance wound healing.

In another aspect of the invention, methods of enhancing wound healing in the elderly are provided. COX-2 gene expression is reduced with age as are wound healing and bone formation. In one embodiment, vectors containing cyclooxygenase expression cassettes are administered to elderly to enhance would healing by increasing COX-2 expression during wound healing. A further aspect of this invention provides for methods for enhancing wound healing in patient groups that have delayed wound healing by delivering the vectors of this invention to these patients during wound healing.

In another embodiment of the invention, the vectors of this invention are used to enhance wound healing in patients suffering from osteoporosis or OI by employing gene therapy techniques to deliver cyclooxygenase expression cassettes to the wound to enhance healing.

In another aspect of the invention, a method for treating pathological heterotopic ossification conditions is provided. Pathological heterotopic ossification conditions are diseases characterized by abnormal bone formation at locations of inflammation. An example of a pathological heterotopic ossification condition is fibrodysplasia ossificans progressiva (FOP). In one embodiment of the invention, COX-2 selective NSAIDs are administered to locations of inflammation that lack a wound. The COX-2 selective NSAIDs inhibit COX-2 activity thereby preventing abnormal bone formation.

Our experimental approach was to assess fracture healing using a standard rat closed femur fracture model in which COX-2 function was inhibited in vivo with the COX-2-selective NSAIDs, celecoxib and rofecoxib. The results were striking in that femur fracture healing in rats treated with celecoxib or rofecoxib was dramatically impaired. These observations were confirmed by examining fracture healing in Cox1 and Cox2 null mice. Histological observations indicated that the defect in fracture healing caused by the COX-2-selective NSAIDs or by lack of Cox2 occurred in the endochondral ossification pathway.

Using a standard rat closed femur fracture model, we have demonstrated that COX-2-selective NSAID treatment can stop normal fracture healing and induce the formation of mal-unions and non-unions. Non-unions refer to fractures that show no visible sign of healing. Mal-unions refer to bones that do not heal properly and result in misalignment of bones. These observations are in grim contrast to those observations we, and others have obtained by treating rats with non-selective NSAIDs such as indomethacin when it was observed that fracture healing was delayed but not prevented (Rø et al. 1976; Rø et al. 1978). Our observations suggest that COX-2 has an essential function during normal fracture healing and that COX-2-selective NSAID inhibition of prostaglandin synthesis stops normal fracture healing. This also suggests that the inflammatory phase is critical for normal fracture healing.

Consistent with the effects of COX-2-selective NSAIDS on rat femur fracture healing, mice homozygous for a targeted mutation in Cox2, but not Cox1, also showed inhibited fracture healing (FIG. 6). The cDNA sequences (SEQ. ID. No. 5 for COX-1 and SEQ. ID. No. 6 for COX-2) and corresponding amino acid sequences (SEQ. ID. NO. 7 for COX-1 and SEQ. ID. No. 8 for COX-2) for mouse COX-1 and COX-2 gene and protein are provided in Table 4. This excludes the possibility that any additional inhibitory activity against other cellular processes or proteins by celecoxib or rofecoxib (Jones et al. 1999; Hsu et al. 2000; Rossi et al. 2000) is primarily responsible for negatively affecting fracture healing.

The amount of rofecoxib used to treat the rats (3 mg/kg) in this study was approximately 4 times the nominal, maximum human daily dose of 50 mg (0.7 mg/kg) that is used to manage acute pain. In contrast, the celecoxib dose used to treat rats in this study was in the recommended dose range for humans. The rats received 280 mg/70 kg body weight of celecoxib once per day whereas the recommended human maximum daily dose of celecoxib is 200 mg twice a day. Additionally, the rats in this study received daily doses of each drug till the endpoint of the experiment, which is unlike common clinical scenarios when COX-2-selective NSAIDs are used to acutely manage pain, inflammation, and swelling following a fracture. In contrast, arthritis patients, in particular, do use COX-2-selective NSAIDs on a daily basis for extended periods. Based simply upon animal body weight and drug dose, and without accounting for pharmacokinetic variables, the indomethacin dose used (1 mg/kg) would be predicted to inhibit most COX-1 activity but to only partially inhibit COX-2 activity; the celecoxib dose used should inhibit most if not all COX-2 activity and possibly inhibit some COX-1 activity; and the rofecoxib dose used should completely inhibit COX-2 activity but not affect COX-1 (Warner et al. 1999). The estimated plasma half-lives for celecoxib and rofecoxib in male rats following a single drug dose are approximately 4 and 5 hours respectively (Halpin et al. 2000; Paulson et al. 2000). In humans, however, the estimated elimination half-life for celecoxib is 11 hours (Davies et al. 2000) and the plasma half-life for rofecoxib is approximately 10-17 hours depending upon drug dose (Depr et al. 2000). Unfortunately, these data were unknown to us when this study was initiated and consequently our rat drug dosing regime may actually be an under representation of the COX-2 inhibition level over a 24 hour cycle as that for humans receiving similar drug doses. Additionally, celecoxib and rofecoxib may have different inhibitory concentrations for rat versus human COX-2. Despite the pharmacokinetic variations between rats and humans receiving COX-2-selective NSAIDs, our data clearly indicate that these drugs have a dramatic negative effect on fracture healing in mammals, and thus caution in the use of these COX-2-selective NSAIDs in humans is warranted.

The fractured femurs of the celecoxib treated rats had increased mechanical properties and healed as mal-unions, rather than non-unions, in approximately 50% of the rats tested (Tables 1 and 2). Had the experimental endpoint been extended, some of the celecoxib treated rats may have gone on to heal their femur fractures. However, the delay in any such healing among the celecoxib treated rats would have been significantly longer than in no drug or indomethacin treated rats.

After mechanically testing the celecoxib and rofecoxib treated fractured femurs, we observed that the fracture callus had a shell-like morphology. The periphery of the fracture callus was bone that sometimes partly bridged the fracture gap and thus formed a mal-union in the celecoxib treated rats. However, little or no bone was present between the peripheral bone of the callus and the original femoral cortical bone ends. Often this space appeared to be filled with fatty marrow. Also strikingly apparent was the lack of new bone or primary bone healing at the cortical bone ends.

The indomethacin dose used in this study (1 mg/kg) was previously shown to delay fracture healing in rats and was used principally as a positive control (Altman et al. 1995). Increasing indomethacin doses to levels that which would completely inhibit COX-2 (and COX-1 activity) causes a steep increase in rat mortality from gastrointestinal bleeding (Allen et al. 1980; Wallace et al. 1998). Consequently, it would be difficult to directly compare the effects of COX-2-selective and traditional NSAIDs on fracture healing based solely upon COX-2 inhibition levels. An alternative approach would be to measure prostaglandin levels within and around the fracture callus during healing in control and drug treated rats and to then correlate those observations with different healing parameters.

The abnormal osteoclastic response observed at the fracture site in the NSAID treated rats is counter to experimental observations in which prostaglandins stimulate bone resorption (Klein and Raisz 1970) and COX-2 function promotes osteoclast formation (Okada et al. 2000). Lack of prostaglandins in the fracture callus could induce osteoclastic activity through an undescribed mechanism, or perhaps through an indirect mechanism such as increased mechanical instability at the fracture site. An additional possibility is that the amount and/or repertoire of prostaglandins produced at the fracture site in the NSAID treated rats is competent for inducing osteoclastic activity but insufficient for osteogenesis to proceed normally. The second possibility is favored since the relative short half-life of celecoxib and rofecoxib in rats should produce daily periods in which COX-2-dependent prostaglandin synthesis could occur and because a similar osteoclastic response was not observed in the Cox2−/− mouse fracture callus (FIG. 6). In addition, this large osteoclastic activity may be the causative factor involved in fracture destabilization by pin slippage, which was the major morbidity complicating these experiments (FIG. 5).

Chondrocyte differentiation and persistence in the fracture callus appears to be altered by COX-2-selective NSAID treatment and by lack of Cox2 (FIG. 6). Cartilage that is evident in the 2-week fracture calluses of COX-2-selective NSAID treated rats either disappears or is dramatically reduced in the 3 and 4-week fracture calluses (FIG. 3). In control rats, the fracture has bridged or is almost bridged by 4 weeks post-fracture as the cartilage present at early times had undergone normal endochondral ossification and is no longer evident. In contrast, cartilage within the indomethacin treated fracture callus does persist at 4 weeks post-fracture indicating a reduced rate of endochondral ossification. These observations suggest that the chondrocytes within the COX-2-selective NSAID treated rats deteriorated without forming a cartilage matrix in which endochondral ossification could occur. This phenomenon then leads to the development of fracture non-unions and mal-unions. Similar histological observations were seen in the Cox2−/− mouse fracture where chondrocytes present in the callus failed to form a mineralized matrix (FIG. 6). In support of this hypothesis, teratocarcinoma chondrocytes developed from Cox2−/− embryonic stem cells were found to be deteriorating, hypotrophic, and undergoing apoptosis (Zhang et al. 2000). Additionally, the Cox2−/− mouse fracture callus was much smaller than that from the Cox1−/− mouse suggesting that mesenchymal cell proliferation and migration into the Cox2−/− mouse fracture site is reduced or that the mesenchymal cells proportionately differentiate into fewer chondrocytes. Thus, COX-2 function is essential for normal progression of endochondral ossification during fracture healing.

There are several steps during endochondral ossification at which COX-2 could exert an essential regulatory function. Endochondral ossification is a complicated process that begins when chondrocytes mature to produce a cartilage matrix. Eventually the chondrocytes become hypertrophic and undergo apoptosis as the cartilage matrix matures and becomes calcified. Osteoclasts partially resorb the calcified cartilage with concurrent angiogenesis at the site of endochondral ossification. Osteoblasts proliferate and differentiate on the calcified cartilage and begin forming new bone. Remodeling of the new bone subsequently occurs to increase the mechanical properties of the bone and restore its normal architecture. Prostaglandins produced by COX-2 could be used to enhance osteoblast proliferation and differentiation (Kawaguchi et al. 1995). Prostaglandins may also be necessary to promote terminal differentiation of chondrocytes and formation of the cartilage matrix. Such an effect on chondrocytes could occur through a direct effect on differentiation or indirectly by preventing pre-mature apoptosis since inhibition of COX-2 function by COX-2-selective NSAIDs has been shown to induce apoptosis in cancer cell lines (Hsu et al. 2000). The potential effects of prostaglandins on osteoblasts and chondrocytes during endochondral ossification are not mutually exclusive. An additional possibility is that COX-2 dependent signaling occurs between osteoblasts and chondrocytes to initiate and maintain endochondral ossification. Prostaglandins are also known to promote osteoclast activity, which may be essential for the normal endochondral ossification process. However, our histological observations indicate an exuberant osteoclast response at the fracture site in the NSAID treated rats thus we do not favor this potential mechanism. Angiogenesis is also inhibited by COX-2-selective NSAIDs, at least in certain experimental models (Jones et al. 1999), and we failed to detect neovascularization of the Cox2−/− mouse fracture callus. Thus an additional possibility is that lack of angiogenesis precludes proper delivery of osteoclasts and osteoblasts to the cartilage matrix interface for continued endochondral ossification.

Our observations suggest that COX-2-selective NSAIDs may be effective in reducing or preventing pathological heterotopic ossification. One particular genetic disease for which COX-2-selective NSAIDs may be efficacious is fibrodysplasia ossificans progressiva (FOP) (Cohen et al. 1993). Children afflicted with FOP develop debilitating heterotopic bone through an endochondral ossification pathway that appears to initiate at sites of inflammation (Kaplan et al. 1993). Thus the COX-2-selective NSAIDs may be useful in reducing inflammation and stopping endochondral ossification at presumptive heterotopic ossification sites in children with FOP.

To determine if COX-2 functions in fracture healing, rats were treated with COX-2-selective non-steroidal anti-inflammatory drugs (NSAIDs) to stop COX-2-dependent prostaglandin production. Radiographic, histological, and mechanical testing demonstrated that fracture healing failed in rats treated with COX-2 selective NSAIDs. Normal fracture healing also failed in mice homozygous for a null mutation in the COX-2 gene. These results demonstrate that COX-2 activity is necessary for normal fracture healing and confirms that the effects of COX-2-selective NSAIDs on fracture healing is due to inhibition of COX-2 activity and not from a drug side effect. Furthermore, histological observations suggest that COX-2 is required for normal endochondral ossification during fracture healing. Since mice lacking Cox2 form normal skeletons, our observations indicate that fetal bone development and fracture healing are different and that COX-2 function is specifically essential for fracture healing.

Experimental Procedures

Animals, Drug Dosage, and Administration

A total of 253 male Sprague-Dawley rats (584.+−0.62 g) were fed a standard diet and kept caged separately in a constant temperature and humidity environment. All rats were 6-9 months old at the beginning of the experiment. Drugs were administered daily by gavage beginning two days prior to fracture. Animals were randomly selected for each treatment group. The rats were gavaged with aqueous suspensions of indomethacin (1 mg/kg), celecoxib (4 mg/kg), or rofecoxib (3 mg/kg). No drug (control) rats were not initially gavaged but later rats were gavaged with water and no difference was noted between the no drug rats that had been gavaged and those that had not. No statistically significant differences were found in animal weight changes during the experiments.

Retired breeder female Cox1−/− (B6; 129P2-Ptgs1tm1) and Cox2−/− (B6; 129P2-Ptgs2tm1) mice were obtained from Taconic Farms. Closed femur fracture production was done using a method similar to that described below.

Closed Femur Fracture Production

The rats were anesthetized by intraperitoneal injection of ketamine (40 mg/kg) and xylazine (5 mg/kg). Under aseptic conditions, a medial parapatellar incision (0.4-0.5 cm) was made in the right hindlimb and the patella was dislocated laterally. The medullary canal was entered through the intercondylar notch and reamed with an 18-gauge needle. A 1.1 mm stainless steel pin (Small Parts Inc., Miami Lakes, Fla.) was then inserted into the canal and secured in the proximal part of the greater trochanter by tamping. The distal portion of the pin was then cut flush with the femoral condyles and the patella dislocation was reduced. The soft tissue and skin were closed with 4-0 vicryl sutures. After closing, the diaphysis of the pinned femur was fractured by means of a three-point bending device as described by Bonnarens and Einhorn (Bonnarens and Einhorn 1984).

Radiography

Radiographs were made post-fracture to confirm the position and quality of each fracture and at sacrifice to determine the degree of healing. In addition several rats were selected randomly to produce serial radiographs (at least 2 rats per treatment group). Radiographs were made of these rats weekly under anesthesia until the experimental endpoint (8 weeks). Radiographs of mice were also made under anesthesia. All radiographs were made using a 43805N Faxitron (Hewlett-Packard, McMinnville, Oreg.) and Kodak MinR-2000 mammography film.

Mechanical Testing

Animals within each treatment group were sacrificed at 4, 6, and 8 weeks post-fracture by CO2 asphyxiation. Animals with oblique, comminuted, or infected fractures were not used for mechanical testing. Both femora were removed and cleaned of all soft tissue leaving the fracture callus undisturbed and then immediately processed for mechanical testing. The samples were wrapped in saline soaked gauze to prevent dehydration between steps. Measurements of the femora were taken using digital calipers to determine femur length and external callus dimensions. The intramedullary pin was removed from the fractured femur and a 1 mm-diameter stainless steel pin (˜0.8 cm length) was inserted at the proximal and distal end perpendicular to the long axis of the bone to prevent slipping in the potting material. The intact femur was also pinned as described above. The femoral ends were potted in 1-inch hexnuts using a low melt temperature metal (Wood's metal, Alfa Aesar, Ward Mill, Mass.). Once potted, the gage length (L) of each femur was measured. Torsional testing was conducted using a servohydraulic testing machine (MTS, Eden, Praire, Minn.) with a 20 Nm reaction torque cell (Interface, Scottsdale, Ariz.). The testing was carried out to failure at a rate of 2°/sec and a data recording rate of 20 Hz. Both the fractured and intact femora were tested in internal rotation in proper anatomic orientation. The peak torque and angle at failure were calculated from the load-deformation curves. Internal fracture callus dimensions were measured after mechanical testing. From the callus dimensions, the polar moment of inertia (J) was calculated based upon a hollow ellipse model (Bell et al. 1941; Engesaeter et al. 1978). The equations used to derive torsional rigidity, shear stress, shear modulus, and J were as follows (Popov 1968): (1) Torsional Rigidity: (Tmax·L)/φ where Tmax is the peak torque value in Nmm, L is the gage length in mm, and φ is the angle at failure in radians. (2) Shear Stress: (Tmax·Rmax)/J where Rmax is the largest radial dimension of the fracture callus in mm (ao) and J is the polar moment of inertia. (3) Shear Modulus (G): (Tmax·L)/J. (4) Polar Moment of Inertia (J): [π(ab3+a3b−(a−t)(b−t)3(−(a−t)3(b−t)/]4 where ai is [ai+[(ao−ai)/2]; b is [bi+[(bo−bi)/2]; t is the average bone thickness at the site of failure and is calculated as [(ao−ai)+(bo−bi)]/2 where ao is the callus maximum outside radius, a; is the maximum interior radius, bo is the least outside radius, and bi is the least interior radius in mm. Only torsional testing data for which the fractured and control femur tested without incident were used.

Histology

Rats were sacrificed at 2, 3, 4, 6, and 8 weeks post-fracture by CO2 asphyxiation. Both femora were resected and the stainless steel pin was removed from the medullary canal. The harvested femora were fixed in 10% buffered formalin and embedded in polymethylmethacrylate following standard histological techniques for calcified tissue. The samples were sectioned sagitally through the fracture callus using an Isomet diamond saw (Buehler Ltd., Lake Bluff, Ill.), mounted on plexiglass slides, and polished to a thickness of 100 μ.m. The slides were then stained with van Gieson's picrofuchsin and Stevenel's blue in order to identify new bone growth and cartilage formation (Maniatopoulos et al. 1986). Mice femora were fixed, decalcified, paraffin embedded, sectioned, and stained with Masson's trichrome stain. The samples were viewed and photomicrographs were taken using an Olympus BH2-RFCA microscope or an Olympus SZ40 microscope.

Treatment with COX-2-Selective NSAIDs Leads to Fracture Non-Unions and Mal-Unions

Femur fracture healing was followed by serial radiographic analysis of rats treated with celecoxib, rofecoxib, indomethacin, or gavaged daily with water (no drugs group). Radiographs were made immediately following fracture production and then every week till the end point of the experiments (8 weeks post-fracture). Representative results are shown in FIG. 1.

We found that femur fracture healing proceeded normally in the no drug rats as expected. At 1 week post-fracture, formation of the hard callus could be detected radiographically but was more evident at 2 weeks (FIG. 1A). By 4 weeks post-fracture, calcification of the soft callus was clearly evident indicating that endochondral ossification had occurred. Additionally, by 4 weeks post-fracture, the new bone formed during fracture repair had almost bridged the fracture gap. Bridging of the fracture and remodeling of the fracture callus were evident at 6 weeks post-fracture. Continued remodeling of the callus as well as remodeling of the original femoral cortical bone at the fracture site is clearly evident by 8 weeks post-fracture. These radiographic observations are typical of normal fracture healing.

Indomethacin treatment appeared to delay but not prevent fracture healing consistent with previous reports (Rø et al. 1976; Allen et al. 1980; Altman et al. 1995). By 2 weeks post-fracture, an X-ray dense hard callus is clearly evident in the indomethacin treated rats (FIG. 1B). However, bridging of the fracture gap did not appear to occur until 5-6 weeks post fracture as compared to approximately 4-5 weeks post-fracture in the untreated rats (compare FIGS. 1A and B). Bridging and remodeling were evident in the 8 week post-fracture radiographs of the indomethacin treated rats.

Celecoxib or rofecoxib treatment did not prevent formation of an X-ray dense hard callus as can be seen in the 2 and 4 week post-fracture radiographs (FIGS. 1C and D). However, the original fracture was still plainly evident in the celecoxib (FIG. 1C) and rofecoxib (FIG. 1D) treated rats even after 8 weeks. No rofecoxib treated rat was observed to have a normally bridged callus by radiography. However, non-unions, mal-unions, and unions of the fractured femurs were observed by radiography in the celecoxib treated rats. The mal-unions were typified by the radiograph seen in FIG. 1C in which one cortex of the fracture callus was bridged but in which the original cortical bone ends of the fractured femur had not joined and the fracture was still clearly evident.

In addition to the serial radiographs made for certain rats, all animals in this study were examined radiographically immediately post-fracture and when euthanized. A random, blinded sample of the 8-week post-fracture radiographs were independently examined by 7 observers and scored as a union (1 point), mal-union (0.5 points), or non-union (0 points). Control rats had an average score of 0.71. In contrast, the indomethacin, celecoxib and rofecoxib treated rats had average scores of 0.54, 0.49, and 0.32, respectively. Despite the known difficulties associated with judging fracture healing from radiographs (Nicholls et al. 1979; Panjabi et al. 1989), a statistical comparison between treatment groups showed that the no drug and rofecoxib groups were significantly different (P<0.007 using a Fisher's PLSD test at a 5% significance level).

These observations clearly indicate that rofecoxib treatment inhibits fracture healing in rats leading to non-unions. It would also appear that at least by radiographic examination, celecoxib treatment negatively affects fracture healing to an extent similar to, if not worse than, indomethacin treatment.

The Mechanical Properties of the Healing Femur Fracture Callus are Diminished by NSAID Treatment

In conjunction with the radiographic analysis, torsional mechanical testing of fractured femurs was also performed. The fractured femur and contralateral control femur from rats at 4, 6, and 8 weeks post-fracture were tested to failure in torsion for each treatment group (no drugs, indomethacin, celecoxib, and rofecoxib). The data from these tests is summarized in FIG. 2 and Table 1. Peak torque is the maximum twisting force generated during torsional testing of the femur. Torsional rigidity is a measure of a structure's resistance to torque. Thus a bone with high torsional rigidity would fail after only a few degrees of rotation, but soft tissue would not reach its peak torque until after a large angular deflection. Maximum shear stress is a measure of the ultimate shearing force withstood by the femur prior to failure and is a function of the applied torque and polar moment of inertia, which is dictated by callus geometry. Shear modulus measures the elastic resistance to deformation by a shearing stress for a given material and is constant for a given material.

We found in the no drug rats that the normalized peak torque (101%) and torsional rigidity (88%) of the fractured femur was restored by 8-weeks post-fracture as compared to the contralateral control femurs from each animal (FIG. 2). However, the shear modulus (1.3 GPa) and normalized shear stress (48%) of the fractured femurs at 8 weeks post-fracture were still less than the contralateral control femurs (FIG. 2, Table 1). This is the expected result because during fracture healing, the ultimate mechanical integrity of the fractured bone, that is peak torque, is maintained at a high level by increasing bone diameter via the fracture callus. Since the mechanical properties of the initially soft tissue within the callus and later the newly formed bone are much weaker than the mechanical properties of mature cortical bone; shear stress and shear modulus were, as expected, less than the contralateral control femurs. As the newly formed bone within the fracture callus matures by remodeling, the mechanical properties of the fractured bone increase. This is evident in our results as increases in shear stress and shear modulus with time (FIG. 2). The high normalized torsional rigidity found for the fractured femurs in the no drug rats at 6 (89%) and 8 (88%) weeks post-fracture indicates that the fracture had been bridged by new bone as would be expected.

We also observed that all of the 6 and 8 week post-fracture no drug femurs and all the contralateral control femurs failed as predicted, mid-diaphyseal spiral fractures during the torsional mechanical testing.

Indomethacin treatment reduced the mechanical properties of the healing femur fractures at earlier time points (FIG. 2). However by 8 weeks post-fracture, the normalized peak torque, torsional rigidity, and shear stress values obtained from the indomethacin treated rats were not significantly different from the no drug rats. In contrast, at 6 weeks post-fracture, the normalized peak torque, torsional rigidity, and shear stress values (46, 34, and 15%, respectively) obtained from the indomethacin treated rats were less than the no drug rats at 6 weeks post-fracture (77, 89, and 36%, respectively). Pointedly, the significantly low torsional rigidity of the fractured femurs from the indomethacin treated rats at 6 weeks post-fracture indicates that the fracture had not been bridged by bone. Of the eight fractured femurs tested at 8 weeks post-fracture, 6 failed as unions, 1 failed as a mal-union, and 1 failed as a non-union (Table 2). These observations indicate that the non-selective NSAID, indomethacin, delays, but does not prevent fracture healing, which is consistent with previous studies and demonstrates the validity of our assay methods (Rø et al. 1976; Allen et al. 1980; Altman et al. 1995).

Rofecoxib treatment had a drastic effect on the mechanical properties of the fractured femurs. At 8 weeks post-fracture, for all values measured or derived, the mechanical properties of the fractured femurs from the rofecoxib treated rats were significantly less than the no drug rat fractured femurs (FIG. 2, Table 1). At 8 weeks post-fracture, the fractured femurs of the rofecoxib treated rats had only obtained 50%, 31%, and 18% of peak torque, torsional rigidity, or maximum shear stress of the contralateral unfractured femurs, respectively. The low torsional rigidity and shear modulus (0.5 GPa) values obtained from the fractured femurs of the rofecoxib treated rats are consistent with healing failure and the formation of non-unions. In addition, whereas all of the contralateral control femurs from the rofecoxib treated rats failed as mid-diaphyseal spiral fractures, 4 of the 5 fractured femurs at 8 weeks post-fracture failed as non-unions and the other failed as a malunion (Table 2). These observations demonstrate that, at the dose and treatment regime employed, the COX-2-selective NSAID rofecoxib stops fracture healing.

Unlike rofecoxib treatment, no significant differences were found in the mechanical properties of the healing fractured femurs from the celecoxib treated rats as compared to no drug rats. Despite the overall similarities in the mechanical values obtained between no drug rats and celecoxib treated rats, 3 of 6 fractured femurs from the celecoxib treated rats at 8 weeks post-fracture failed as non-unions during the mechanical testing procedure and the other 3 failed as mal-unions (Table 2). The relatively low normalized torsional rigidity (50%) and shear stress (22%) found for fractured femurs from the celecoxib treated rats at 6 weeks post-fracture indicates that the fracture site had not been bridged with bone (FIG. 2). Even though not statistically different from the no drug rat fractured femurs, the data obtained from the celecoxib treated rat fractured femurs parallels closely the patterns obtained from the femurs of the indomethacin treated rats. Together these observations suggest that, at the celecoxib dose and treatment regime used, fracture healing is delayed and to a lesser extent than that found for the rofecoxib treatment regime, inhibited.

A χ2 analysis was performed on visual inspection data obtained from the 8 week post-fracture femurs following mechanical testing (Table 2). The fractured femurs were considered to have failed as (a) unions if a spiral fracture developed through the diaphysis of the femur, (b) non-unions if the femur failed completely along the original fracture site, and (c) mal-unions if some new bone bridging of the fracture site was evident but that the femur still failed primarily along the original fracture site. The data from the no drug, celecoxib, and rofecoxib treatment groups were compared to that from the indomethacin treatment group. Our analysis indicates that no statistical difference exists between the no drug and the indomethacin treatment groups but that the celecoxib and rofecoxib treatment groups are significantly different from the indomethacin treatment group. Again, these observations strongly indicate that inhibition of COX-2 dramatically inhibits fracture healing.

No significant differences in the mechanical properties of the contralateral femurs were found between treatment groups. This indicates that the experimental treatment regimes did not alter the intrinsic properties of the rat bone by enhanced bone resorption or deposition at least for the time frame examined.

COX-2-Selective NSAID Treatment Alters Cartilage Formation During Fracture Healing

The radiographic and torsional mechanic testing analyses of the COX-2-selective NSAID treated rats demonstrated that these drugs dramatically inhibit fracture healing. However, hard callus formation appeared not to be impaired in the COX-2-selective NSAID treated rats. This suggests that COX-2-selective NSAIDs impair fracture healing in the soft callus where endochondral ossification occurs. Since radiography cannot assess the early stages of endochondral ossification in the soft callus, we undertook a histological analysis of fracture healing in the drug treated rats.

At 2 weeks post-fracture, gross abnormalities were present in the histology of the healing femur fractures of the indomethacin, celecoxib, or rofecoxib treated rats as compared to an untreated control rat (FIG. 3). In all four experimental groups, significant periosteal intramembraneous ossification was evident at the fracture site as expected from our radiographic data. Endochondral ossification also appeared to be proceeding normally in the no drug rat specimens. In contrast, the histological specimens from the indomethacin and COX-2-selective NSAID treated rats had abnormally formed cartilage elements within the callus. The positional extent of new bone formed in the callus of the NSAID treated rats also appeared to be abnormal in that it did not fully extend to the ends of the fractured bone. In the no drug rats, new bone in the callus extends to the very ends of the cortical bone fracture site. This is not so in the NSAID treated rats where this region of the callus is generally occupied by cartilage.

NSAID treatment grossly altered fracture callus morphology at 3 and 4 weeks post-fracture (FIG. 3). Fracture healing proceeded normally in the no drug rats with near bridging of the callus apparent by 4 weeks post-fracture in concurrence with our radiographic data (FIG. 1). However, healing was clearly delayed in the NSAID treated rats. The fracture calluses of the indomethacin treated rats were not bridged at 4 weeks but still appeared to be undergoing endochondral ossification based upon the presence of cartilage within the soft callus at 3 and 4 weeks post-fracture. In contrast, little or no cartilage was evident in the fracture calluses of the celecoxib or rofecoxib treated rats at 3 and 4 weeks post-fracture indicating that endochondral ossification had ceased. Additionally massive resorption of the woven bone in the hard callus of the NSAID treated rats appeared to leave a shell-like callus on the ends of the fractured bone.

Celecoxib and rofecoxib treatment often caused a massive bone resorption event at the distal ends of the fracture bones leaving what appear to be indentations into the hard callus (FIGS. 3 and 4). The magnitude of this bone resorption phase is indicated by the large number of osteoclasts that were found on the femur periosteal surface at the distal ends of the fractured bone near the apparent indentation (FIG. 4).

At 6 and 8 weeks post-fracture, the fractured femurs of the no drug rats appeared to be healing normally with active remodeling of the cortical bone ends and fracture callus. Fractured femurs from indomethacin treated rats also appeared to be healing at 6 and 8 weeks post-fracture with evident bridging and active remodeling. In contrast, no further healing was evident in the celecoxib or rofecoxib treated rat fractured femurs. The callus in the COX-2-selective NSAID treated rats was smaller at 6 and 8 weeks post-fracture but the fracture gap was still clearly evident and often filled with fibrous tissue. These observations are consistent with our radiographic and torsional mechanical testing data demonstrating that celecoxib and rofecoxib inhibit fracture healing.

Complications Associated with Use of COX-2-Selective NSAIDs

As can be seen in FIG. 5, pin slippage was a severe complication with as many as 30% of the rofecoxib treated rats having to be euthanized prior to the endpoint. Pin slippage is dislodgement of the intramedullary stainless steel rod used to stabilize the fracture and permit the rat to weight-bear on the fractured femur. Once fracture stability was lost, the rat was euthanized since the rat could no longer weight-bear on the femur and since the callus would be re-injured and thus alter healing. The etiology of the pin slippage is unknown. Animals with these complications were excluded. As such, final data may be skewed in favor of rats that had healed. Other complications included anesthesia death during weekly radiographs and infections that excluded specimens from further analysis. It was found using a χ2 analysis to compare each experimental group value to the no drug rat value that the pin slippage rate was significant for all NSAID treatment groups (P<0.0001) and that the infection rate for the rofecoxib treated rats was also significant (P<0.0001).

Normal Fracture Healing Fails in Cox2 Null Mice

Our data clearly demonstrate that COX-2-selective NSAIDs are detrimental to fracture healing. Unfortunately, these observations do not distinguish between a specific effect on COX-2 and a non-specific effect of the NSAIDs on fracture healing. Therefore to specifically address whether fracture healing requires Cox1 or Cox2 gene function, femur fracture healing was assessed in Cox1 and Cox2 knock-out mice (Langenbach et al. 1995; Morham et al. 1995). Using a modified method, closed femur fractures were produced in three female Cox1−/− (Cox1 knock-out) and three female Cox2−/− (Cox2 knock-out) mice. The animals were examined radiographically immediately post-fracture and then at 7, 10, 14, 21, 28, and 42 days post-fracture. Fracture healing appeared to proceed normally in the Cox1−/− mice relative to our previous observations in outbred and inbred strains of mice (Manigrasso and O'Connor, unpublished). In contrast, only a slight periosteal hard callus was detected in any of the Cox2−/− mice, which is indicative of healing failure. As can be seen in FIG. 6, the apparent difference in fracture callus size was most obvious at 2 weeks post-fracture when the Cox1−/− mice had formed a large fracture callus but little or no callus was evident in the Cox2−/− mice.

One mouse of each genotype was euthanized at 2 weeks post-fracture and the fractured femur examined histologically (FIG. 6). New bone and differentiating chondrocytes were abundant within the Cox1−/− callus indicating that COX-1 activity is not essential for fracture healing. In contrast, there was a plainly evident lack of new bone formation in the Cox2−/− fracture callus with only some apparent intramembraneous bone formation occurring at the edges of the callus (hard callus). Chondrocytes at different stages of differentiation were observed throughout the Cox2−/− soft fracture callus. However, the Cox2−/− chondrocytes failed to form a mineralized matrix as evident by the radiolucency and histological appearance of the soft callus. The amount of endochondral ossification at the hard callus-soft callus boundary appeared greatly reduced in the Cox2−/− specimen. In addition, neovascularization of the Cox2−/− fracture callus was not observed. These observations clearly indicate that normal fracture healing and endochondral ossification are stopped or dramatically reduced in the Cox2−/− mice and confirms our observations made in the COX-2-selective NSAID treated rats.

Our data indicate that COX-2 function is essential for fracture healing. In contrast, adult mice homozygous for targeted mutation of Cox2 appear to have normal skeletons. Together these observations demonstrate that fetal osteogenesis and fracture healing, though similar in many ways, are different and are probably initiated and maintained through different molecular mechanisms. Cox2 is the first gene to be identified that is specifically essential for fracture healing but not fetal osteogenesis. Targeted mutation of other mouse genes involved in prostaglandin synthesis and signaling should enable further analysis of the prostaglandin pathway(s) involved in fracture healing and skeletal biology in general.

One skilled in the art will readily appreciate that the present invention is well adapted to carry out the objects and obtain the ends and advantages mentioned as well as those inherent therein. The cyclooxygenase vectors along with the methods, procedures and treatments described herein are presently representative of preferred embodiments and are exemplary and not intended as limitations on the scope of the invention. Changes therein and other uses will occur to those skilled in the art which are encompassed within the spirit of the invention or defined by this scope with the claims.

It will be readily apparent to one skilled in the art that varying substitutions and modifications may be made to the invention disclosed herein without departing from the scope and spirit of the invention.

All patents and publications referenced herein are incorporated by reference to the same extent as if each individual publication was specifically and individually indicated to be incorporated by reference. The following references are likewise incorporated by reference in order to more fully describe the state of the art.

REFERENCES

  • Allen, H. L., A. Wase, and W. T. Bear. 1980. Indomethacin and aspirin: effect of nonsteroidal anti-inflammatory agents on the rate of fracture repair in the rat. Acta. Orthop. Scand. 51: 595-600.
  • Altman, R. D., L. L. Latta, R. Keer, K. Renfree, F. J. Hornicek, and K. Banovac. 1995. Effect of nonsteroidal antiinflammatory drugs on fracture healing a laboratory study in rats. J. Orthop. Trauma 9: 392-400.
  • Bell, G. H., D. P. Cuthbertson, and J. On. 1941. Strength and size of bone in relation to calcium intake. Journal of Physiology 100: 299-317.
  • Bolander, M. E. 1992. Regulation of fracture repair by growth factors. Proc. Soc. Exp. Biol. Med. 200: 165-170.
  • Bonnarens, F. and T. A. Einhorn. 1984. Production of a standard closed fracture in laboratory animal bone. J. Orthop. Res. 2: 97-101.
  • Brighton, C. T., J. L. Schaffer, D. B. Shapiro, J. J. S. Tang, and C. C. Clark. 1991. Proliferation and macromolecular synthesis by rat calvarial bone cells grown in various oxygen tensions. J. Orthop. Res. 9: 847-854.
  • Cohen, R. B., G. V. Hahn, J. A. Tabas, J. Peeper, C. L. Levitz, A. Sando, N. Sando, M. Zasloff, and F. S. Kaplan. 1993. The natural history of heterotopic ossification in patients who have fibrodysplasia ossificans progressive. J. Bone and Joint Surg. 75-A: 215-219.
  • Davies, N. M., A. J. McLachlan, R. O. Day, and K. M. Williams. 2000. Clinical pharmacokinetics and pharmacodynamics of celecoxib: a selective cyclo-oxygenase-2 inhibitor. Clinical Pharmacokinetics 38: 225-242.
  • Dekel, S., G. Lenthall, and M. J. O. Francis. 1981. Release of prostaglandins from bone and muscle after tibial fracture. J. Bone and Joint Surg. 63-B: 185-189.
  • Depr, M., E. Ehrich, A. van Hecken, I. De Lepeleire, A. Dallob, P. Wong, A. Porras, B. J. Gertz, and P. J. De Schepper. 2000. Pharmacokinetics, COX-2 specificity, and tolerability of supratherapeutic doses of rofecoxib in humans European Journal of Pharmacology 56: 167-174.
  • Einhorn, T. A. 1998. The cell and molecular biology of fracture healing. Clin Orthop: S7-21.
  • Engesaeter, L. B., A. Ekeland, and N. Langeland. 1978. Methods for testing the mechanical properties of the rat femur. Acta. Orthop. Scand. 49: 512-518.
  • Ferguson, C., E. Alpern, T. Miclau, and J. A. Helms. 1999. Does adult fracture repair recapitulate embryonic skeletal formation? Mech. Dev. 87: 57-66.
  • Feyen, J. H., G. van der Wilt, P. Moonen, A. Di Bon, and P. J. Nijweide. 1984. Stimulation of arachidonic acid metabolism in primary cultures of osteoblast-like cells by hormones and drugs. Prostaglandins 28: 769-781.
  • Halpin, R. A., L. A. Geer, K. E. Zhang, T. M. Marks, D. C. Dean, A. N. Jones, D. Melillo, G. Doss, and K. P. Vyas. 2000. The absorption, distribution, metabolism and excretion of rofecoxib, a potent and selective cyclooxygenase-2 inhibitor, in rats and dogs. Drug Metabolism and Disposition 28: 1244-1254.
  • Hsu, A.-L., T.-T. Ching, D.-S. Wang, X. Song, V. M. Rangnekar, and C.-S. Chen. 2000. The cyclooxygenase-2 inhibitor celecoxib induces apoptosis by blocking Akt activation in human prostate cancer cells independently of Bc1-2. J. Biol. Chem. 275: 11397-11403.
  • Jones, M. K., H. Wang, B. M. Peskar, E. Levin, R. M. Itani, I. J. Sarfeh, and A. S. Tamawski. 1999. Inhibition of angiogenesis by nonsteroidal anti-inflammatory drugs: insight into the mechanisms and implications for cancer growth and ulcer healing. Nat. Med. 5: 1418-1423.
  • Kaplan, F. S., J. A. Tabas, F. H. Gannon, G. Finkel, G. V. Hahn, and M. A. Zasloff. 1993. The histopathology of fibrodysplasia ossificans progressiva: an endochondral process. J. Bone and Joint Surg. 75-A: 220-230.
  • Kawaguchi, H., C. C. Pilbeam, J. R. Harrison, and L. G. Raisz. 1995. The role of prostaglandins in the regulation of bone metabolism. Clin. Orth. Rel. Res. 313: 36-46.
  • Klein, D. C. and L. G. Raisz. 1970. Prostaglandins: stimulation of bone resorption in tissue culture. Endocrinol 86: 1436-1440.
  • Klein-Nulend, J., E. H. Burger, C. M. Semeins, L. G. Raisz, and C. C. Pilbeam. 1997. Pulsating fluid flow stimulates prostaglandin release and inducible prostaglandin G/H synthase mRNA expression in primary mouse bone cells. J. Bone Miner. Res. 12: 45-51.
  • Langenbach, R., S. G. Morham, H. F. Tiano, C. D. Loftin, B. I. Ghanayem, P. C. Chulada, J. F. Mahler, C. A. Lee, E. H. Goulding, K. D. Kluckman, H. S. Kim, and O, Smithies. 1995. Prostaglandin synthase 1 gene disruption in mice reduces arachidonic acid-induced inflammation and indomethacin-induced gastric ulceration. Cell 83: 483-492.
  • Maniatopoulos, C., A. Rodriguez, D. A. Deporter, and A. H. Melcher. 1986. An improved method for preparing histological sections of metallic implants. International Journal of Oral and Maxillofacial Implants 1: 31-37.
  • Masferrer, J. L., B. S. Zweifel, P. T. Manning, S. D. Hauser, K. M. Leahy, W. G. Smith, P. C. Isakson, and K. Seibert. 1994. Selective inhibition of inducible cyclooxygenase 2 in vivo is antiinflammatory and nonulcerogenic. Proc. Natl. Acad. Sci. USA 91: 3228-3232.
  • Moore, K. D., K. Goss, and J. O. Anglen. 1998. Indomethacin versus radiation therapy for prophylaxis against heterotopic ossification in acetabular fractures. J. Bone and Joint Surg. 80-B: 259-263.
  • Morham, S. G., R. Langenbach, C. D. Loftin, H. F. Tiano, N. Vouloumanos, J. C. Jennette, J. F. Mahler, K. D. Kluckman, A. Ledford, C. A. Lee, and O, Smithies. 1995. Prostaglandin synthase 2 gene disruption causes severe renal pathology in the mouse. Cell 83: 473-482.
  • Muscar, M. N., W. McKnight, S. Asfaha, and J. L. Wallace. 2000. Wound collagen deposition in rats: effects of an NO-NSAID and a selective COX-2 inhibitor. British Journal of Pharmacology 129: 681-686.
  • Needleman, P., J. Turk, B. A. Jakschik, A. R. Morrison, and J. B. Lefkowith. 1986. Arachidonic acid metabolism. Ann. Rev. Biochem. 55: 69-102.
  • Nicholls, P. J., E. Berg, F. E. Bliven, Jr., and J. M. Kling. 1979. X-ray diagnosis of healing fractures in rabbits. Clin. Orth. Rel. Res. 142: 234-236.
  • O'Banion, M. K., V. D. Winn, and D. A. Young. 1992. cDNA cloning and functional activity of a glucocorticoid-regulated inflammatory cyclooxygenase. Proc. Natl. Acad. Sci. USA 89: 4888-4892.
  • Okada, Y., J. A. Lorenzo, A. M. Freeman, M. Tomita, S. G. Morham, L. G. Raisz, and C. C. Pilbeam. 2000. Prostaglandin G/H synthase-2 is required for maximal formation of osteoclast-like cells in culture. J. Clin. Invest. 105: 823-832.
  • O'Sullivan, M. G., F. H. Chilton, E. M. Huggins, Jr., and C. E. McCall. 1992a. Lipopolysaccharide priming of alveolar macrophages for enhanced synthesis of prostanoids involves induction of a novel prostaglandin H synthase. J. Biol. Chem. 267: 14547-14550.
  • O'Sullivan, M. G., E. M. Huggins, Jr., E. A. Meade, D. L. DeWitt, and C. E. McCall. 1992b. Lipopolysaccharide induces prostaglandin H synthase-2 in alveolar macrophages. Biochem. Biophys. Res. Comm. 187: 1123-1127.
  • Panjabi, M. M., R. W. Lindsey, S. D. Walter, and A. A. White, 3rd. 1989. The clinician's ability to evaluate the strength of healing fractures from plain radiographs. J. Orthop. Trauma 3: 29-32.
  • Paulson, S. K., J. Y. Zhang, A. P. Breau, J. D. Hribar, N. W. K. Liu, S. M. Jessen, Y. M. Lawal, J. N. Cogburn, C. J. Gresk, C. S. Markos, T. J. Maziasz, G. L. Schoenhard, and E. G. Burton. 2000. Pharmacokinetics, tissue distribution, metabolism, and excretion of celecoxib in rats. Drug Metabolism and Disposition 28: 514-521.
  • Popov, E. P. 1968. Introduction to mechanics of solids. Prentice-Hall, Inc., Englewood Cliffs, N.J.
  • Pritchett, J. W. 1995. Ketorolac prophylaxis against heterotopic ossification after hip replacement. Clin. Orth. Rel. Res. 314: 162-165.
  • Raskin, J. B. 1999. Gastrointestinal effects of nonsteroidal anti-inflammatory therapy. Am. J. Med. 106 (5B): 3S-12S.
  • Riendeau, D., M. D. Percival, C. Brideau, S. Charleson, D. Dube, D. Ethier, J.-P. Falgueyret, R. W. Friesen, R. Gordon, G. Greig, J. Guay, J. Mancini, M. Ouellet, E. Wong, L. Xu, S. Boyce, D. Visco, Y. Girard, P. Prasit, R. Zamboni, I. W. Rodger, M. Gresser, A. W. Ford-Hutchinson, R. N. Young, and C.-C. Chan. 2001. Etoricoxib (MK-0663): preclinical profile and comparison with other agents that selectively inhibit cyclooxygenase-2. Journal of Pharmacology and Experimental Therapeutics 296: 558-566.
  • Rø, J., N. Langeland, and J. Sander. 1978. Effect of indomethacin on collagen metabolism of rat fracture callus in vitro. Acta. Orthop. Scand. 49: 323-328.
  • Rø, J., E. Sudmann, and P. F. Marton. 1976. Effect of indomethacin on fracture healing in rats. Acta. Orthop. Scand. 47: 588-599.
  • Rossi, A., P. Kapahi, G. Natoli, T. Takahashi, Y. Chen, M. Karin, and M. G. Santoro. 2000. Anti-inflammatory cylopentenone prostaglandins are direct inhibitors of I.kappa.B kinase. Nature 403: 103-108.
  • Shigeta, J.-I., S. Takahashi, and S. Okabe. 1998. Role of cyclooxygenase-2 in the healing of gastric ulcers in rats. Journal of Pharmacology and Experimental Therapeutics 286: 1383-1390.
  • Topper, J. N., J. Cai, D. Falb, and M. A. Gimbrone, Jr. 1996. Identification of vascular endothelial genes differentially responsive to fluid mechanical stimuli: cyclooxygenase-2, manganese superoxide dismutase, and endothelial cell nitric oxide synthase are selectively up-regulated by steady laminar shear stress. Proc. Natl. Acad. Sci. USA 93: 10417-10422.
  • Vane, J. R., Y. S. Bakhle, and R. M. Botting. 1998. Cyclooxygenase 1 and 2. Annual Review of Pharmacology and Toxicology 38: 97-120.
  • Vortkamp, A., S. Pathi, G. M. Peretti, E. M. Caruso, D. J. Zaleske, and C. J. Tabin. 1998. Recapitulation of signals regulating embryonic bone formation during postnatal growth and fracture repair. Mech. Dev. 71: 65-76.
  • Wadleigh, D. J. and H. R. Herschman. 1999. Transcriptional regulation of the cyclooxygenase-2 gene by diverse ligands in murine osteoblasts. Biochem. Biophys. Res. Comm. 264: 865-870.
  • Wallace, J. L., A. Bak, W. McKnight, S. Asfaha, K. A. Sharkey, and W. K. MacNaughton. 1998. Cyclooxygenase 1 contributes to inflammatory responses in rats and mice: implications for gastrointestinal toxicity. Gastroenterology 115: 101-109.
  • Warner, T. D., F. Giuliano, I. Vojnovic, A. Bukasa, J. A. Mitchell, and J. R. Vane. 1999. Nonsteroid drug selectivities for cyclo-oxygenase-1 rather than cyclo-oxygenase-2 are associated with human gastrointestinal toxicity: a full in vitro analysis. Proc. Natl. Acad. Sci. USA 96: 7563-7568.
  • Whelton, A. 1999. Nephrotoxicity of nonsteroidal anti-inflammatory drugs: physiological foundations and clinical implications. Am. J. Med. 106 (5B): 13S-24S.
  • White, A. A., III, M. M. Panjabi, and W. O. Southwick. 1977. The four biomechanical stages of fracture repair. J. Bone and Joint Surg. 59-A: 188-192.
  • Xie, W., J. G. Chipman, D. L. Robertson, R. L. Erikson, and D. L. Simmons. 1991. Expression of a mitogen-responsive gene encoding prostaglandin synthase is regulated by mRNA splicing. Proc. Natl. Acad. Sci. USA 88: 2692-2696.
  • Zhang, X., S. G. Morham, R. Langenbach, R. B. Baggs, and D. A. Young. 2000. Lack of cyclooxygenase-2 inhibits growth of teratocarcinomas in mice. Exp. Cell Res. 254: 232-240.

TABLE 1
Torsional Mechanical Testing Data
Fractured Femur Data (not normalized to contralateral control femur)
All Contralateral No Drug Indomethacin
Control Femurs 4 wks 6 wks 8 wks 4 wks 6 wks 8 wks
Peak Torque (Tmax) in Nmm
Mean 716 452 430 643 417 357 469
CV 28 21 29 28 52 37 56
Significance 0.69 0.36 0.16
Torsional Rigidity [(Tmax · L )/φ]
Mean 83,050 27,200 66,068 56,506 21,913 28,658 57,630
CV 35 48 17 20 46 57 55
Significance 0.43 <0.01 0.93
Shear Stress [(Tmax · φ)/J]
mean 145 33 35 56 25 22 47
CV 38 42 34 27 85 47 66
Significance 0.42 0.08 0.48
Shear Modulus (GPa)
Mean 6.9 0.4 1.5 1.3 0.3 0.4 1.8
CV 54 58 71 38 78 73 99
Significance 0.33 0.08 0.46
Sample Size 81 6 5 7 8 7 8
Fractured Femur Data (not normalized to contralateral control femur)
All Contralateral Celecoxib Rofecoxib
Control Femurs 4 wks 6 wks 8 wks 4 wks 6 wks 8 wks
Peak Torque (Tmax) in Nmm
Mean 302 567 620 250 383 338
CV 44 34 49 53 33 36
Significance 0.03 0.15 0.88 0.01 0.54 0.01
Torsional Rigidity [(Tmax · L )/φ]
Mean 13,866 43,189 59,256 12,338 21,231 25,026
CV 53 77 22 59 51 69
Significance 0.06 0.11 0.69 0.04 <0.01 0.01
Shear Stress [(Tmax · φ)/J]
mean 25 44 67 15 24 25
CV 73 73 41 58 41 48
Significance 0.37 0.47 0.40 0.03 0.13 <0.01
Shear Modulus (GPa)
Mean 0.3 0.9 1.7 0.2 0.3 0.5
CV 77 116 27 49 56 9.1
Significance 0.26 0.40 0.16 0.04 0.07 0.01
Sample Size 8 8 6 6 7 5
CV: Coefficient of Variation (standard deviation as a percentage).
Significance: Comparisons were made using a standard two-tailed T-test between the no drug fractured femur values and the experimental fractured femur values within a time point. These comparisons were not made between data normalized with the contralateral control femur as shown in FIG. 3.

TABLE 2
Frequency of Unions, Mal-Unions, and Non-Unions in the Mechanically
Tested Fractured Femurs at 8 weeks Post-Fracture
Union Mal-Union Non-Union χ2
(Stage IV)* (Stage III) (Stage I/II) P-value**
No Drugs 7 0 0 0.338
Indomethacin 6 1 1
Celecoxib 0 3 3 <0.001
Rofecoxib 0 1 4 <0.001
*Classification scheme as described by White et al. (1977)
**Comparisons were made to the indomethacin treatment group data.

TABLE 3
I. HUMAN COX-1 cDNA SEQUENCE (SEQ. ID. NO. 1)
GCGCCATGAGCCGGAGTCTCTTGCTCCGGTTCTTGCTGTTCCTGCTCCTG
CTCCCGCCGCTCCCCGTCCTGCTCGCGGACCCAGGGGCGCCCACGCCAGT
GAATCCCTGTTGTTACTATCCATGCCAGCACCAGGGCATCTGTGTCCGCT
TCGGCCTTGACCGCTACCAGTGTGACTGCACCCGCACGGGCTATTCCGGC
CCCAACTGCACCATCCCTGGCCTGTGGACCTGGCTCCGGAATTCACTGCG
GCCCAGCCCCTCTTTCACCCACTTCCTGCTCACTCACGGGCGCTGGTTCT
GGGAGTTTGTCAATGCCACCTTCATCCGAGAGATGCTCATGCGCCTGGTA
CTCACAGTGCGCTCCAACCTTATCCCCAGTCCCCCCACCTACAACTCAGC
ACATGACTACATCAGCTGGGAGTCTTTCTCCAACGTGAGCTATTACACTC
GTATTCTGCCCTCTGTGCCTAAAGATTGCCCCACACCCATGGGAACCAAA
GGGAAGAAGCAGTTGCCAGATGCCCAGCTCCTGGCCCGCCGCTTCCTGCT
CAGGAGGAAGTTCATACCTGACCCCCAAGGCACCAACCTCATGTTTGCCT
TCTTTGCACAACACTTCACCCACCAGTTCTTCAAAACTTCTGGCAAGATG
GGTCCTGGCTTCACCAAGGCCTTGGGCCATGGGGTAGACCTCGGCCACAT
TTATGGAGACAATCTGGAGCGTCAGTATCAACTGCGGCTCTTTAAGGATG
GGAAACTCAAGTACCAGGTGCTGGATGGAGAAATGTACCCGCCCTCGGTA
GAAGAGGCGCCTGTGTTGATGCACTACCCCCGAGGCATCCCGCCCCAGAG
CCAGATGGCTGTGGGCCAGGAGGTGTTTGGGCTGCTTCCTGGGCTCATGC
TGTATGCCACGCTCTGGCTACGTGAGCACAACCGTGTGTGTGACCTGCTG
AAGGCTGAGCACCCCACCTGGGGCGATGAGCAGCTTTTCCAGACGACCCG
CCTCATCCTCATAGGGGAGACCATCAAGATTGTCATCGAGGAGTACGTGC
AGCAGCTGAGTGGCTATTTCCTGCAGCTGAAATTTGACCCAGAGCTGCTG
TTCGGTGTCCAGTTCCAATACCGCAACCGCATTGCCATGGAGTTCAACCA
TCTCTACCACTGGCACCCCCTCATGCCTGACTCCTTCAAGGTGGGCTCCC
AGGAGTACAGCTACGAGCAGTTCTTGTTCAACACCTCCATGTTGGTGGAC
TATGGGGTTGAGGCCCTGGTGGATGCCTTCTCTCGCCAGATTGCTGGCCG
GATCGGTGGGGGCAGGAACATGGACCACCACATCCTGCATGTGGCTGTGG
ATGTCATCAGGGAGTCTCGGGAGATGCGGCTGCAGCCCTTCAATGAGTAC
CGCAAGAGGTTTGGCATGAAACCCTACACCTCCTTCCAGGAGCTCGTAGG
AGAGAAGGAGATGGCAGCAGAGTTGGAGGAATTGTATGGAGACATTGATG
CGTTGGAGTTCTACCCTGGACTGCTTCTTGAAAAGTGCCATCCAAACTCT
ATCTTTGGGGAGAGTATGATAGAGATTGGGGCTCCCTTTTCCCTCAAGGG
TCTCCTAGGGAATCCCATCTGTTCTCCGGAGTACTGGAAGCCGAGCACAT
TTGGCGGCGAGGTGGGCTTTAACATTGTCAAGACGGCCACACTGAAGAAG
CTGGTCTGCCTCAACACCAAGACCTGTCCCTACGTTTCCTTCCGTGTGCC
GGATGCCAGTCAGGATGATGGGCCTGCTGTGGAGCGACCATCCACAGAGC
TCTGAGGGGCAGGAAAGCAGCATTCTGGAGGGGAGAGCTTTGTGCTTGTC
ATTCCAGAGTGCTGAGGCCAGGGCTGATGGTCTTAAATGCTCATTTTCTG
GTTTGGCATGGTGAGTGTTGGGGTTGACATTTAGAACTTTAAGTCTCACC
CATTATCTGGAATATTGTGATTCTGTTTATTCTTCCAGAATGCTGAACTC
CTTGTTAGCCCTTCAGATTGTTAGGAGTGGTTCTCATTTGGTCTGCCAGA
ATACTGGGTTCTTAGTTGACAACCTAGAATGTCAGATTTCTGGTTGATTT
GTAACACAGTCATTCTAGGATGTGGAGCTACTGATGAAATCTGCTAGAAA
GTTAGGGGGTTCTTATTTTGCATTCCAGAATCTTGACTTTCTGATTGGTG
ATTCAAAGTGTTGTGTTCCCTGGCTGATGATCCAGAACAGTGGCTCGTAT
CCCAAATCTGTCAGCATCTGGCTGTCTAGAATGTGGATTTGATTCATTTT
CCTGTTCAGTGAGATATCATAGAGACGGAGATCCTAAGGTCCAACAAGAA
TGCATTCCCTGAATCTGTGCCTGCACTGAGAGGGCAAGGAAGTGGGGTGT
TCTTCTTGGGACCCCCACTAAGACCCTGGTCTGAGGATGTAGAGAGAACA
GGTGGGCTGTATTCACGCCATTGGTTGGAAGCTACCAGAGCTCTATCCCC
ATCCAGGTCTTGACTCATGGCAGCTGTTTCTCATGAAGCTAATAAAATTC
GCCC
II. HUMAN COX-2 cDNA SEQUENCE (SEQ. ID. NO. 2)
CAATTGTCATACGACTTGCAGTGAGCGTCAGGAGCACGTCCAGGAACTCC
TCAGCAGCGCCTCCTTCAGCTCCACAGCCAGACGCCCTCAGACAGCAAAG
CCTACCCCCGCGCCGCGCCCTGCCCGCCGCTCGGATGCTCGCCCGCGCCC
TGCTGCTGTGCGCGGTCCTGGCGCTCAGCCATACAGCAAATCCTTGCTGT
TCCCACCCATGTCAAAACCGAGGTGTATGTATGAGTGTGGGATTTGACCA
GTATAAGTGCGATTGTACCCGGACAGGATTCTATGGAGAAAACTGCTCAA
CACCGGAATTTTTGACAAGAATAAAATTATTTCTGAAACCCACTCCAAAC
ACAGTGCACTACATACTTACCCACTTCAAGGGATTTTGGAACGTTGTGAA
TAACATTCCCTTCCTTCGAAATGCAATTATGAGTTATGTCTTGACATCCA
GATCACATTTGATTGACAGTCCACCAACTTACAATGCTGACTATGGCTAC
AAAAGCTGGGAAGCCTTCTCTAACCTCTCCTATTATACTAGAGCCCTTCC
TCCTGTGCCTGATGATTGCCCGACTCCCTTGGGTGTCAAAGGTAAAAAGC
AGCTTCCTGATTCAAATGAGATTGTGGAAAAATTGCTTCTAAGAAGAAAG
TTCATCCCTGATCCCCAGGGCTCAAACATGATGTTTGCATTCTTTGCCCA
GCACTTCACGCATCAGTTTTTCAAGACAGATCATAAGCGAGGGCCAGCTT
TCACCAACGGGCTGGGCCATGGGGTGGACTTAAATCATATTTACGGTGAA
ACTCTGGCTAGACAGCGTAAACTGCGCCTTTTCAAGGATGGAAAAATGAA
ATATCAGATAATTGATGGAGAGATGTATCCTCCCACAGTCAAAGATACTC
AGGCAGAGATGATCTACCCTCCTCAAGTCCCTGAGCATCTACGGTTTGCT
GTGGGGCAGGAGGTCTTTGGTCTGGTGCCTGGTCTGATGATGTATGCCAC
AATCTGGCTGCGGGAACACAACAGAGTATGCGATGTGCTTAAACAGGAGC
ATCCTGAATGGGGTGATGAGCAGTTGTTCCAGACAAGCAGGCTAATACTG
ATAGGAGAGACTATTAAGATTGTGATTGAAGATTATGTGCAACACTTGAG
TGGCTATCACTTCAAACTGAAATTTGACCCAGAACTACTTTTCAACAAAC
AATTCCAGTACCAAAATCGTATTGCTGCTGAATTTAACACCCTCTATCAC
TGGCATCCCCTTCTGCCTGACACCTTTCAAATTCATGACCAGAAATACAA
CTATCAACAGTTTATCTACAACAACTCTATATTGCTGGAACATGGAATTA
CCCAGTTTGTTGAATCATTCACCAGGCAAATTGCTGGCAGGGTTGCTGGT
GGTAGGAATGTTCCACCCGCAGTACAGAAAGTATCACAGGCTTCCATTGA
CCAGAGCAGGCAGATGAAATACCAGTCTTTTAATGAGTACCGCAAACGCT
TTATGCTGAAGCCCTATGAATCATTTGAAGAACTTACAGGAGAAAAGGAA
ATGTCTGCAGAGTTGGAAGCACTCTATGGTGACATCGATGCTGTGGAGCT
GTATCCTGCCCTTCTGGTAGAAAAGCCTCGGCCAGATGCCATCTTTGGTG
AAACCATGGTAGAAGTTGGAGCACCATTCTCCTTGAAAGGACTTATGGGT
AATGTTATATGTTCTCCTGCCTACTGGAAGCCAAGCACTTTTGGTGGAGA
AGTGGGTTTTCAAATCATCAACACTGCCTCAATTCAGTCTCTCATCTGCA
ATAACGTGAAGGGCTGTCCCTTTACTTCATTCAGTGTTCCAGATCCAGAG
CTCATTAAAACAGTCACCATCAATGCAAGTTCTTCCCGCTCCGGACTAGA
TGATATCAATCCCACAGTACTACTAAAAGAACGTTCGACTGAACTGTAGA
AGTCTAATGATCATATTTATTTATTTATATGAACCATGTCTATTAATTTA
ATTATTTAATAATATTTATATTAAACTCCTTATGTTACTTAACATCTTCT
GTAACAGAAGTCAGTACTCCTGTTGCGGAGAAAGGAGTCATACTTGTGAA
GACTTTTATGTCACTACTCTAAAGATTTTGCTGTTGCTGTTAAGTTTGGA
AAACAGTTTTTATTCTGTTTTATAAACCAGAGAGAAATGAGTTTTGACGT
CTTTTTACTTGAATTACTATCACAAGATGGCAAAATGCTGAAAGTTTTTA
CACTGTCGATGTTTCCAATGCATCTTCCATGATGCATTAGAAGTAACTAA
TGTTTGAAATTTTAAAGTACTTTTGGTTATTTTTCTGTCATCAAACAAAA
ACAGGTATCAGTGCATTATTAAATGAATATTTAAATTAGACATTACCAGT
AATTTCATGTCTACTTTTTAAAATCAGCAATGAAACAATAATTTGAAATT
TCTAAATTCATAGGGTAGAATCACCTGTAAAAGCTTGTTTGATTTCTTAA
AGTTATTAAACTTGTACATATACCAAAAAGAAGCTGTCTTGGATTTAAAT
CTGTAAAATCAGATGAAATTTTACTACAATTGCTTGTTAAAATATTTTAT
AAGTGATGTTCCTTTTTCACCAAGAGTATAAACCTTTTTAGTGTGACTGT
TAAAACTTCCTTTTAAATCAAAATGCCAAATTTATTAAGGTGGTGGAGCC
ACTGCAGTGTTATCTCAAAATAAGAATATTTTGTTGAGATATTCCAGAAT
TTGTTTATATGGCTGGTAACATGTAAAATCTATATCAGCAAAAGGGTCTA
CCTTTAAAATAAGCAATAACAAAGAAGAAAACCAAATTATTGTTCAAATT
TAGGTTTAAACTTTTGAAGCAAACTTTTTTTTATCCTTGTGCACTGCAGG
CCTGGTACTCAGATTTTGCTATGAGGTTAATGAAGTACCAAGCTGTGCTT
GAATAACGATATGTTTTCTCAGATTTTCTGTTGTACAGTTTAATTTAGCA
GTCCATATCACATTGCAAAAGTAGCAATGACCTCATAAAATACCTCTTCA
AAATGCTTAAATTCATTTCACACATTAATTTTATCTCAGTCTTGAAGCCA
ATTCAGTAGGTGCATTGGAATCAAGCCTGGCTACCTGCATGCTGTTCCTT
TTCTTTTCTTCTTTTAGCCATTTTGCTAAGAGACACAGTCTTCTCATCAC
TTCGTTTCTCCTATTTTGTTTTACTAGTTTTAAGATCAGAGTTCACTTTC
TTTGGACTCTGCCTATATTTTCTTACCTGAACTTTTGCAAGTTTTCAGGT
AAACCTCAGCTCAGGACTGCTATTTAGCTCCTCTTAAGAAGATTAAAAGA
GAAAAAAAAAGGCCCTTTTAAAAATAGTATACACTTATTTTAAGTGAAAA
GCAGAGAATTTTATTTATAGCTAATTTTAGCTATCTGTAACCAAGATGGA
TGCAAAGAGGCTAGTGCCTCAGAGAGAACGCCCTTTCTTATTTAAAAACA
AAACCAAATGATATCTAAGTAGTTCTCAGCAATAATAATAATGACGATAA
TACTTCTTTTCCACATCTCATTGTCACTGACATTTAATGGTACTGTATAT
TACTTAATTTATTGAAGATTATTATTTATGTCTTATTAGGACACTATGGT
TATAAACTGTGTTTAAGCCTACAATCATTGATTTTTTTTTGTTATGTCAC
AATCAGTATATTTTCTTTGGGGTTACCTCTCTGAATATTATGTAAACAAT
CCAAAGAAATGATTGTATTAAGATTTGTGAATAAATTTTTAGAAATCTGA
TTGGCATATTGAGATATTTAAGGTTGAATGTTTGTCCTTAGGATAGGCCT
ATGTGCTAGCCCACAAAGAATATTGTCTCATTAGCCTGAATGTGCCATAA
GACTGACCTTTTAAAATGTTTTGAGGGATCTGTGGATGCTTCGTTAATTT
GTTCAGCCACAATTTATTGAGAAAATATTCTGTGTCAAGCACTGTGGGTT
TTAATATTTTTAAATCAAACGCTGATTACAGATAATAGTATTTATATAAA
TAATTGAAAAAATTTTCTTTTGGGAAGAGGGAGAAAATGAAATAAATATC
ATTAAAGATAACTCAGGAGAATCTTCTTTACAATTTTACGTTTAGAATGT
TTAAGGTTAAGAAAGAAATAGTCAATATGCTTGTATAAAACACTGTTCAC
TGTTTTTTTTAAAAAAAAAACTTGATTTGTTATTAACATTGATCTGCTGA
CAAAACCTGGGAATTTGGGTTGTGTATGCGAATGTTTCAGTGCCTCAGAC
AAATGTGTATTTAACTTATGTAAAAGATAAGTCTGGAAATAAATGTCTGT
TTATTTTTGTACTATTTA
III. HUMAN COX-1 AMINO ACID SEQUENCE
(SEQ. ID. NO. 3)
MSRSLLLRFLLFLLLLPPLPVLLADPGAPTPVNPCCYYPCQHQGICVRFG
LDRYQCDCTRTGYSGPNCTIPGLWTWLRNSLRPSPSFTHFLLTFGRWFWE
FVNATFIREMLMRLVLTVRSNLIPSPPTYNSAHDYISWESFSNVSYYTRI
LPSVPKDCPTPMGTKGKKQLPDAQLLARRFLLRRKFIPDPQGTNLMFAFF
AQHFTHQFFKTSGKMGPGFTKALGHGVDLGHIYGDNLERQYQLRLFKDGK
LKYQVLDGEMYPPSVEEAPVLMHYPRGIPPQSQMAVGQEVFGLLPGLMLY
ATLWLREHNRVCDLLKAEHPTWGDEQLFQTTRLILIGETIKIVIEEYVQQ
LSGYFLQLKFDPELLFGVQFQYRNRIAMEFNHLYHWHPLMPDSFKVGSQE
YSYEQFLFNTSMLVDYGVEALVDAFSRQIAGRIGGGRNMDHHILHVAVDV
IRESREMRLQPFNEYRKRFGMKPYTSFQELVGEKEMAAELEELYGDIDAL
EFYPGLLLEKCHPNSIFGESMIEIGAPFSLKGLLGNPICSPEYWKPSTFG
GEVGFNIVKTATLKKLVCLNTKTCPYVSFRVPDASQDDGPAVERPSTEL
IV. HUMAN COX-2 AMINO ACID SEQUENCE
(SEQ. ID. NO. 4)
MLARALLLCAVLALSHTANPCCSHPCQNRGVCMSVGFDQYKCDCTRTGFY
GENCSTPEFLTRIKLFLKPTPNTVHYILTHFKGFWNVVNNIPFLRNAIMS
YVLTSRSHLIDSPPTYNADYGYKSWEAFSNLSYYTRALPPVPDDCPTPLG
VKGKKQLPDSNEIVEKLLLRRKFIPDPQGSNMMFAFFAQHFTHQFFKTDH
KRGPAFTNGLGHGVDLNHIYGETLARQRKLRLFKDGKMKYQIIDGEMYPP
TVKDTQAEMIYPPQVPEHLRFAVGQEVFGLVPGLMMYATIWLREHNRVCD
VLKQEHPEWGDEQLFQTSRLILIGETIKIVIEDYVQHLSGYHFKLKFDPE
LLFNKQFQYQNRIAAEFNTLYHWHPLLPDTFQIHDQKYNYQQFIYNNSIL
LEHGITQFVESFTRQIAGRVAGGRNVPPAVQKVSQASIDQSRQMKYQSFN
EYRKRFMLKPYESFEELTGEKEMSAELEALYGDIDAVELYPALLVEKPRP
DAIFGETMVEVGAPFSLKGLMGNVICSPAYWKPSTFGGEVGFQIINTASI
QSLICNNVKGCPFTSFSVPDPELIKTVTINASSSRSGLDDINPTVLLKER
STEL

TABLE 4
I. MOUSE COX-1 cDNA SEQUENCE (SEQ. ID. NO. 5)
GCCGTTGGCATTGCACATCCATCCACTCCCAGAGTCATGAGTCGAAGGAG
TCTCTCGCTCTGGTTTCCCCTGCTGCTGCTCCTGCTGCTGCCGCCGACAC
CCTCGGTCCTGCTCGCAGATCCTGGGGTGCCCTCACCAGTCAATCCCTGT
TGTTACTATCCGTGCCAGAACCAGGGTGTCTGTGTCCGCTTTGGCCTCGA
CAACTACCAGTGTGATTGTACTCGCACGGGCTACTCAGGCCCCAACTGTA
CCATCCCTGAGATCTGGACCTGGCTTCGGAATTCTCTGCGGCCCAGCCCC
TCGTTCACCCATTTCCTGCTGACACATGGATACTGGCTCTGGGAATTTGT
GAATGCCACCTTCATCCGAGAAGTACTCATGCGCCTGGTACTCACAGTGC
GGTCCAACCTTATCCCCAGCCCTCCGACCTACAACTCAGCGCATGACTAC
ATCAGCTGGGAGTCCTTCTCCAATGTGAGCTACTATACTCGCATTCTGCC
CTCTGTACCCAAAGACTGCCCCACACCCATGGGGACCAAAGGGAAGAAAC
AGTTACCAGATGTTCAGCTTCTGGCCCAACAGCTGCTGCTGAGAAGGGAG
TTCATTCCTGCCCCCCAGGGCACCAACATCCTGTTTGCCTTCTTTGCACA
ACACTTCACCCACCAGTTCTTCAAGACCTCTGGAAAGATGGGTCCTGGCT
TTACCAAGGCCTTAGGCCACGGGGTAGACCTTGGCCACATTTATGGAGAT
AATCTGGAACGACAGTATCACCTGCGGCTCTTCAAGGATGGGAAACTTAA
GTACCAGGTGCTGGACGGAGAGGTGTACCCACCTTCCGTGGAACAGGCGT
CCGTGTTGATGCGCTACCCACCAGGTGTCCCGCCTGAAAGGCAGATGGCT
GTGGGCCAGGAGGTGTTTGGGTTGCTTCCGGGGCTGATGCTCTTCTCCAC
GATCTGGCTTCGTGAACATAACCGCGTGTGCGACCTGCTGAAGGAGGAGC
ATCCCACGTGGGATGATGAGCAGCTCTTCCAGACCACTCGCCTCATCCTT
ATAGGAGAAACCATCAAAATTGTCATTGAGGAGTATGTGCAGCACTTGAG
TGGCTATTTCCTGCAGCTCAAGTTTGACCCGGAGCTGCTGTTCCGAGCCC
AGTTCCAATATCGAAACCGCATCGCCATGGAATTTAACCATCTCTATCAC
TGGCATCCACTCATGCCCAACTCCTTCCAAGTGGGCTCACAAGAGTACAG
CTACGAGCAGTTTTTATTTAACACTTCTATGCTGGTGGACTATGGGGTTG
AGGCACTGGTGGATGCCTTCTCTCGCCAGAGGGCTGGCCGGATTGGTGGA
GGTAGGAACTTTGACTATCATGTTCTGCATGTGGCTGTGGATGTCATCAA
GGAGTCCCGAGAGATGCGCCTACAGCCCTTCAATGAATACCGAAAGAGGT
TTGGCTTGAAGCCTTACACCTCTTTCCAGGAGCTCACAGGAGAGAAGGAG
ATGGCTGCTGAGTTGGAGGAGCTGTACGGTGACATCGATGCTTTAGAGTT
CTACCCGGGGTTGCTGCTGGAGAAGTGCCAGCCCAACTCCATCTTTGGAG
AAAGTATGATAGAGATGGGGGCTCCCTTTTCCCTCAAGGGCCTCCTAGGG
AATCCCATCTGTTCCCCAGAGTACTGGAAACCCAGCACGTTCGGTGGTGA
CGTGGGCTTCAACCTTGTCAACACAGCCTCACTGAAGAAACTGGTCTGCC
TCAACACCAAGACCTGCCCCTATGTTTCCTTCCGTGTGCCAGATTACCCT
GGAGATGACGGGTCTGTCTTAGTGAGACGCTCCACTGAGCTCTGAGGGAG
CTGGAAAGCAGCCTCTGGAGGGAGGAGTTTTGTTCCTGATGAAGACAAGT
CCTTGATGTGGGTTTTCGTGGCTTGGCATTGTGAGAGCTGATGCTCACAT
TTGAAACTTTGGGTCTTACCCTTGCCTAGAAAATTGTGATTTTGCCACTT
TCGGATGTTGAATTCTTTGTTAACTAAGAAAGTTAGAAGTGGTTTTGTCT
GCCTCCTCAGAACTTGGCTCTTTGTTGGCAACTCAGAAAGTCAGATTTCT
GGTTGATTTGGAATATAGGCTTAAAACTTTATATTATAGGGTAGGGTGTG
GTTGCACACACCTTAATCCCAGCACTTGGAAGGCAGAGGCAGTTGGATCT
CTGGGAGTTTGAGGCCAGTTTGGCCTATATAGTGAGTTCTAGGCCAGCCA
TGGATGCATAGTGAGACTCTTTCTCAAAACAAACAAACAAACAAACAAAC
AAACAACTTTTAGAATGTAGAATTCCGTAAAAAAAAAAAATCCCTTGAAA
GTTAATGGGGTCCTCAATTTTCTTCCTAGAATTTGGAGGCCTCTTCAGAA
TGTTGACTATCTGACAGGTGACTCAGAAGGTCCTGTTCCTGGTCAATGAT
CTATAACATGGGCCAAAACATTCCCAACTTGAATGTCTAGAATGTGGAAT
TGGTTCATTTTCCTGTTCAGTGAAATGGACACAGAACAAAAGAACCCAGT
GTCCAGCAAGAATTGCCTTGCCCAAACCTACGTCTACGCCAAAGGTCAAG
GCAGTAAGGTGTTCTTGGGAGCCACACTTAGACTCTTTCCAAAGATGTGG
AGGGAACAGATGGACTCATCTATGATCTTGGTTGGAAACCACCACAGTTC
TATCCCCATCCAGATCTTTGCTTGTGGCAGCTGTTTCTCATGAAGCTAAT
AAAATTC
II. MOUSE COX-2 cDNA SEQUENCE (SEQ. ID. NO. 6)
AGTTGTCAAACTGCGAGCTAAGAGCTTCAGGAGTCAGTCAGGACTCTGCT
CACGAAGAATCTCAGCACTGCATCCTGCCAGCTCCACCGCCACCACCACT
GCCACCTCCGCTGCCACCTCTGCGATGCTCTTCCGAGCTGTGCTGCTCTG
CGCTGCCCTGGGGCTCAGCCAGGCAGCAAATCCTTGCTGTTCCAATCCAT
GTCAAAACCGTGGGGAATGTATGAGCACAGGATTTGACCAGTATAAGTGT
GACTGTACCCGGACTGGATTCTATGGTGAAAACTGTACTACACCTGAATT
TCTGACAAGAATCAAATTACTGCTGAAGCCCACCCCAAACACAGTGCACT
ACATCCTGACCCACTTCAAGGGAGTCTGGAACATTGTGAACAACATCCCC
TTCCTGCGAAGTTTAACTATGAAATATGTGCTGACATCCAGATCATATTT
GATTGACAGTCCACCTACTTACAATGTGCACTATGGTTACAAAAGCTGGG
AAGCCTTCTCCAACCTCTCCTACTACACCAGGGCCCTTCCTCCAGTAGCA
GATGACTGCCCAACTCCCATGGGTGTGAAGGGAAATAAGGAGCTTCCTGA
TTCAAAAGAAGTGCTGGAAAAGGTTCTTCTACGGAGAGAGTTCATCCCTG
ACCCCCAAGGCTCAAATATGATGTTTGCATTCTTTGCCCAGCACTTCACC
CATCAGTTTTTCAAGACAGATCATAAGCGAGGACCTGGGTTCACCCGAGG
ACTGGGCCATGGAGTGGACTTAAATCACATTTATGGTGAAACTCTGGACA
GACAACATAAACTGCGCCTTTTCAAGGATGGAAAATTGAAATATCAGGTC
ATTGGTGGAGAGGTGTATCCCCCCACAGTCAAAGACACTCAGGTAGAGAT
GATCTACCCTCCTCACATCCCTGAGAACCTGCAGTTTGCTGTGGGGCAGG
AAGTCTTTGGTCTGGTGCCTGGTCTGATGATGTATGCCACCATCTGGCTT
CGGGAGCACAACAGAGTGTGCGACATACTCAAGCAGGAGCATCCTGAGTG
GGGTGATGAGCAACTATTCCAAACCAGCAGACTCATACTCATAGGAGAGA
CTATCAAGATAGTGATCGAAGACTACGTGCAACACCTGAGCGGTTACCAC
TTCAAACTCAAGTTTGACCCAGAGCTCCTTTTCAACCAGCAGTTCCAGTA
TCAGAACCGCATTGCCTCTGAATTCAACACACTCTATCACTGGCACCCCC
TGCTGCCCGACACCTTCAACATTGAAGACCAGGAGTACAGCTTCAAACAG
TTTCTCTACAACAACTCCATCCTCCTGGAACATGGACTCACTCAGTTTGT
TGAGTCATTCACCAGACAGATTGCTGGCCGGGTTGCTGGGGGAAGAAATG
TGCCAATTGCTGTACAAGCAGTGGCAAAGGCCTCCATTGACCAGAGCAGA
GAGATGAAATACCAGTCTCTCAATGAGTACCGCAAACGCTTCTCCCTGAA
GCCGTACACATCATTTGAAGAACTTACAGGAGAGAAGGAAATGGCTGCAG
AATTGAAAGCCCTCTACAGTGACATCGATGTCATGGAACTGTACCCTGCC
CTGCTGGTGGAAAAACCTCGTCCAGATGCTATCTTTGGGGAGACCATGGT
AGAGCTTGGAGCACCATTCTCCTTGAAAGGACTTATGGGAAATCCCATCT
GTTCTCCTCAATACTGGAAGCCGAGCACCTTTGGAGGCGAAGTGGGTTTT
AAGATCATCAATACTGCCTCAATTCAGTCTCTCATCTGCAATAATGTGAA
GGGGTGTCCCTTCACTTCTTTCAATGTGCAAGATCCACAGCCTACCAAAA
CAGCCACCATCAATGCAAGTGCCTCCCACTCCAGACTAGATGACATTAAC
CCTACAGTACTAATCAAAAGGCGTTCAACTGAGCTGTAAAAGTCTACTGA
CCATATTTATTTATTTATGTGAAGGAATTTAATTTAATTATTTAATATTT
ATACTGAATTTTTTTTCATGTAACATCTTCCATAACAGAAGGCAATGTTC
TTGAACAATGTTACATTTGTGAAGATTCCTCCGGTGTTTGTCCTTTAAAT
ATGTGTTACCTGAAACTGAAAGGAAATCAGCATTCATTCCTCTACATAAG
CCAGTGAGAAGGGAAATGAATTTTGATATCTTTATACTTGAATTTCAGAT
CATGAATTAGCTTAACAAGAACCAAGGAAAAATGTATGAATATGTGAGTG
TTGTTACAAGATGAAAAATGCTGCAGGTATCAACACTGTTGGTTACACTG
TGTCTTCTTTACCTATGATAGGAGCATGTAATGTGGAATTCGTCTTAAAT
CCTTGCATATCTTTATCTCATCAAACAAAGGGGTCCAAGTTCAGTTTTAA
ATAAGCATTTAAGGCAGATACTGACAACAATCTCATTTTTTTAAAATGTT
GTCTTGAGACAAATAATTTGAAATTTCTAAATTGGGACGTTTGAATCACT
TTTGAAAGCTCTTACTTTCTTAAGCTGTCAGGTTTGTACCGACATGGAGT
AAACAGCTATCATAAACGTAAATCTCCAAAACTAGTAGAAATTATGTCAT
GATTGATGGTTAAGATACCATGTCAGGGATTGTCTTTTCTTAGAAGTAGT
GAAAGCTACTTACTATGACAATCAGACCTTCCTTGTATGTCAAAATGCTG
GTGTGGAAGGTGGTGGAGCCCGTGCTGCTCTGTCTTAACTATGAGTGTGA
GCTTTAAAGCTCGTTGATGAGTGGTAGCCAGCAAAGCCTAGAGCAACAAA
AGCGTTCTACAAAGGAACTAACCAAGAACAAAGAAGGGTTCCCAATTAAA
GATCACATTCAGGGTTAAACTTCCAAAGGAGACATCCTGATCCTGGTTTT
GTGCTGGCCTGGTACTCAGTAGGTTTTTGCTGTGAGGTTAAAGACTTGCC
AGGGCTGAACTTCGAAACAGTTTTTCTGTTGCACAGTATGATGTAACAGT
CCATCTCTCAATGCAATAGGTATCAGTGGCCTCGTGAGCTTCTTCACAAT
ATTTGATATGTCTTCCAGCCCATTGAACCTGGACTGCAGAAGGCCCCATG
TCATGTGTGAGCTCAGCCTGGATGCCAGCATTTGCTGCTCCTCTTAGTTC
CGTTTCTCGTGGTCACTTTACTACGAGAAACGCTGATTGGGTTTTCGTAG
CTGTGTTACCAGGTTTTTAGTATCAGAACTATTCTTTCTTTAACCTCTAT
TCATATTTTCTCTACTTGAAGTTTTACATTCAGGAAAACCTCAGCGCTCA
GGACTACTATGTACCTCCCCTTTGGAGGGAAAAATTCATTTTTAGGTAAA
AGGCAAAAATTTTTTAAAAATATTTTTTATTTATAATTATATGGAAGGGC
CCTACCAAGATGCTAGAAATATAGGGAGTTCCTGACAAGAAATTTCCATT
CTTATTCTGAAGAATTGCTTTCTTACTTAAAAACAAAGACAGTTTGTGAG
TAGTTCTGGGCAATAGGGATAAATATAAAACAATAATGATGATCATTTTC
TACATCTCATTATCAGCTGAGGTACTGTATATTACTGAATTTATTGAAGA
TAGTTATGTCTTTTAGACATTGTTGTTATAAACTATGTTTAAGCCTACTA
CAAGTGTTTCTTTTTTGCATTATGTTGGAATTGATGTACCTTTTTTATGA
TTACCTCTCTGAACTATGGTGTGAACAATCAAACAAAATGATGAGATTAA
CGTTCATGGATAAATTCTAAGAAAACTAGTGTATTTTTTTGAAAAGTTTG
AAGTTAGAACTTAGGCTGTTGGAATTTACGCATAAAGCAGACTGCATAGG
ATCCAATATTGACTGACCCAAGCATGTTATAAAGACTGACATTTTAGACA
TTTTGAAGGCCCTGTAAGTGTTTATTAATTAGTTAGAACTTAATTGATTA
AAAAATATATCCAAAGCACTATAGGCATTAGAATTC
III. MOUSE COX-1 AMINO ACID SEQUENCE
(SEQ. ID. NO. 7)
MSRRSLSLWFPLLLLLLLPPTPSVLLADPGVPSPVNPCCYYPCQNQGVCV
RFGLDNYQCDCTRTGYSGPNCTIPEIWTWLRNSLRPSPSFTHFLLTHGYW
LWEFVNATFIREVLMRLVLTVRSNLIPSPPTYNSAHDYISWESFSNVSYY
TRILPSVPKDCPTPMGTKGKKQLPDVQLLAQQLLLRREFIPAPQGTNI-
LFAFFAQHFTHQFFKTSGKMGPGFTKALGHGVDLGHIYGDNLERQYHLRL
FKDGKLKYQVLDGEVYPPSVEQASVLMRYPPGVPPERQMAVGQEVFGLLP
GLMLFSTIWLREHNRVCDLLKEEHPTWDDEQLFQTTRLILIGETIKIVIE
EYVQHLSGYFLQLKFDPELLFRAQFQYRNRIAMEFNHLYHWHPLMPNSFQ
VGSQEYSYEQFLFNTSMLVDYGVEALVDAFSRQRAGRIGGGRNFDYHVLH
VAVDVIKESREMRLQPFNEYRKRFGLKPYTSFQELTGEKEMAAELEELYG
DIDALEFYPGLLLEKCQPNSIFGESMIEMGAPFSLKGLLGNPICSPEYWK
PSTFGGDVGFNLVNTASLKKLVCLNTKTCPYVSFRVPDYPGDDGSVLVRR
STEL
IV. MOUSE COX-2 AMINO ACID SEQUENCE
(SEQ. ID. NO. 8)
MLFRAVLLCAALGLSQAANPCCSNPCQNRGECMSTGFDQYKCDCTRTGFY
GENCTTPEFLTRIKLLLKPTPNTVHYILTHFKGVWNIVNNIPFLRSLTMK
YVLTSRSYLIDSPPTYNVHYGYKSWEAFSNLSYYTRALPPVADDCPTPMG
VKGNKELPDSKEVLEKVLLRREFIPDPQGSNMMFAFFAQHFTHQFFKTDH
KRGPGFTRGLGHGVDLNHIYGETLDRQHKLRLFKDGKLKYQVIGGEVYPP
TVKDTQVEMIYPPHIPENLQFAVGQEVFGLVPGLMMYATIWLREHNRVCD
ILKQEHPEWGDEQLFQTSRLILIGETIKIVIEDYVQHLSGYHFKLKFDPE
LLFNQQFQYQNRIASEFNTLYHWHPLLPDTFNIEDQEYSFKQFLYNNSIL
LEHGLTQFVESFTRQIAGRVAGGRNVPIAVQAVAKASIDQSREMKYQSLN
EYRKRFSLKPYTSFEELTGEKEMAAELKALYSDIDVMELYPALLVEKPRP
DAIFGETMVELGAPFSLKGLMGNPICSPQYWKPSTFGGEVGFKIINTASI
QSLICNNVKGCPFTSFNVQDPQPT

Claims

1. A vector for use in enhancing wound healing comprising a promoter linked to a cyclooxygenase expression cassette.

2. The vector of claim 1, wherein the promoter is constitutively induced.

3. The vector of claim 2, wherein the promoter is a cytomegalovirus promoter.

4. The vector of claim 1, wherein the cyclooxygenase expression cassette encodes a COX-2 gene product.

5. A method for enhancing wound healing comprising the step of delivering the vector of claim 1 to the location of the wound; wherein the cyclooxygenase expression cassette is expressed, thereby enhancing wound healing.

6. The method of claim 5, wherein the vector is a adenoviral vector, adeno-associated viral vector, a recombination-defective retrovirus or a plasmid.

7. The method of claim 5, wherein the vector is delivered by injection, electroporation, or inhalation of an aerosol.

8. The method of claim 5, wherein the vector is in a saline solution, encapsulated in liposomes, in a polymer solution, in a gel, or lyophilized.

9. The method of claim 5, wherein the promoter is cytomegalovirus.

10. The method of claim 5, wherein the cyclooxygenase expression cassette encodes for a COX-2 gene product.

11. The method of claim 5, wherein the wound is a bone fracture or a skin wound.

12. A method for enhancing wound healing following orthopaedic procedures comprising the step of administering the vector of claim 1 to the location of the procedure; wherein the cyclooxygenase expression cassette encodes for COX-2 gene product and wherein the cyclooxygenase expression cassette is expressed thereby enhancing wound healing.

13. A method for treating pathological heterotopic ossification conditions comprising the steps of: identifying locations of heterotopic ossification in a patient with a heterotopic ossification condition, and administering COX-2 selective NSAIDs to the patient.

14. The method of claim 13, wherein the heterotopic ossification condition is fibrodysplasia ossificans progressiva, occurs following a hip replacement procedure or after an acetabular fracture.

15. A method for inhibiting wound healing comprising the step of administering an effective amount of NSAIDs to the location of the wound, wherein the NSAIDs inhibit normal wound healing.

16. The method of claim 15, wherein the NSAIDs are COX-2 specific NSAIDs.

17. A method for treating osteoporosis, OI and brittle bone conditions comprising the step of administering the vector of claim 1, wherein expression of the vector enhances wound healing and bone formation.

18. A composition for use in wound healing comprising a formulated cyclooxygenase protein.

19. The composition of claim 18, further comprising a pharmaceutically acceptable carrier.

20. The composition of claim 18, wherein the cyclooxygenase protein is COX-1, COX-2 or a combination of the two.

21-22. (canceled)