Patent application title:

Recombinant gelatins

Publication number:

US20120107372A1

Publication date:
Application number:

13/309,833

Filed date:

2011-12-02

✅ Patent granted

Patent number:

US 8,173,776 B1

Grant date:

2012-05-08

PCT filing:

-

PCT publication:

-

Examiner:

Suzanne M Noakes

Adjusted expiration:

2031-12-02

Abstract:

The invention concerns a recombinant CBE gelatin and recombinant gelatins having multimers of the CBEmonomersequence that are of particular use in several applications involving cell attachment such as in cell culture work and applications involving cell cultures of anchor dependent cells and also in a variety of medical applications.

Inventors:

Assignee:

Interested in similar patents?

Get notified when new applications in this technology area are published.

Classification:

A61P7/00 »  CPC further

Drugs for disorders of the blood or the extracellular fluid

C12P21/00 IPC

Preparation of peptides or proteins

A61K9/00 IPC

Medicinal preparations characterised by special physical form

C07K14/46 IPC

Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates

C12N5/00 IPC

Undifferentiated human, animal or plant cells, e.g. cell lines; Tissues; Cultivation or maintenance thereof; Culture media therefor

C07K14/78 »  CPC main

Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans Connective tissue peptides, e.g. collagen, elastin, laminin, fibronectin, vitronectin, cold insoluble globulin [CIG]

A61P7/02 »  CPC further

Drugs for disorders of the blood or the extracellular fluid Antithrombotic agents; Anticoagulants; Platelet aggregation inhibitors

A61P9/00 »  CPC further

Drugs for disorders of the cardiovascular system

A61P17/00 »  CPC further

Drugs for dermatological disorders

A61P17/02 »  CPC further

Drugs for dermatological disorders for treating wounds, ulcers, burns, scars, keloids, or the like

A61P19/00 »  CPC further

Drugs for skeletal disorders

A61P25/00 »  CPC further

Drugs for disorders of the nervous system

A61P35/00 »  CPC further

Antineoplastic agents

A61P35/04 »  CPC further

Antineoplastic agents specific for metastasis

A61P37/02 »  CPC further

Drugs for immunological or allergic disorders Immunomodulators

A61P41/00 »  CPC further

Drugs used in surgical methods, e.g. surgery adjuvants for preventing adhesion or for vitreum substitution

A61K38/00 »  CPC further

Medicinal preparations containing peptides

C12N2531/00 »  CPC further

Microcarriers

C12N2533/50 »  CPC further

Supports or coatings for cell culture, characterised by material Proteins

A61K38/39 IPC

Medicinal preparations containing peptides; Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans Connective tissue peptides, e.g. collagen, elastin, laminin, fibronectin, vitronectin, cold insoluble globulin [CIG]

A61K38/17 IPC

Medicinal preparations containing peptides; Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans

A23J1/00 IPC

Obtaining protein compositions for foodstuffs; Bulk opening of eggs and separation of yolks from whites

C07H21/02 IPC

Compounds containing two or more mononucleotide units having separate phosphate or polyphosphate groups linked by saccharide radicals of nucleoside groups, e.g. nucleic acids with ribosyl as saccharide radical

C12P1/00 IPC

Preparation of compounds or compositions, not provided for in groups  - , by using microorganisms or enzymes

Description

FIELD OF THE INVENTION

The invention is in the field of recombinantly produced gelatins. The gelatins of the present invention are of particular use in several applications involving cell attachment such as in cell culture work and applications involving cell cultures of anchor dependent cells and also in a variety of medical applications.

BACKGROUND OF THE INVENTION

Cell culture systems of animal cells, in particular mammalian cells (including human cells), is important for the production of many important (genetically engineered) biological materials such as vaccines, enzymes, hormones and antibodies. The majority of animal cells are anchorage-dependent and require attachment to a surface or cell culture support for their survival and growth.

Cell attachment also plays an important role in medical applications such as wound treatment (including artificial skin materials), bone and cartilage (re)growth and implantations and artificial blood vessel materials. Thus in medical applications often the demand is that a material, such as an implant or transplant material, comprises a biocompatible coating in terms of cell attachment.

Another area of interest in relation to cell attachment is the blocking of attachment receptors of cells. For instance by blocking the attachment receptors cancer metastasis may be influenced or inhibited, platelet aggregation may be influenced in antithrombotic compositions and tissues adhesion may be prevented, e.g. after surgery, or may be promoted, e.g. for dental products or other medical products.

In US 2006/0241032 RGD-enriched gelatin-like proteins with a minimum (increased) level of RGD motifs and with a certain distribution of said RGD motifs are disclosed that were found to be highly suitable for cell adhesion and cell binding in medical and biotechnological applications. The cell binding peptides described therein have good cell attachment properties.

There is however always the need for further improvements of materials for use in applications involving cell attachment. The instant invention provides improved gelatine-like polypeptides, which are particularly useful for cell attachment.

SUMMARY OF THE INVENTION

In the search for further improvements of gelatins that are enriched in RGD motifs that are suitable for cell adhesion and cell attachment, the present inventors identified a particularly advantageous gelatin. It is a recombinant gelatin comprising or consisting of a sequence with at least 75%, preferably at least 95%, sequence identity to SEQ ID NO: 1. This SEQ ID NO: 1 is also identified as “CBE monomer” or “CBE1” and comprises 4 RGD motifs. Also multimers could be made comprising mentioned monomer which multimers are referred to“CBEx” (wherein x=2-10), having very good polypeptide stability and cell adhesive properties. The multimers have the advantage that they are typically produced in significantly higher yields than the monomer. For instance, yields obtained for the CBE monomer are typically 3-5 gram per litre clarified broth, whereas CBE multimers were produced in amounts exceeding 10 g/l. Thus, in one embodiment of the invention, the recombinant gelatins arc provided, as well as cell supports coated therewith and controlled release compositions comprising the recombinant gelatins. Also methods for using the recombinant gelatins and/or the cell supports or controlled release compositions for cell adhesion related medical applications are provided.

GENERAL DEFINITIONS

Whereas often the terms ‘collagen’, ‘collagen-related’, ‘collagen-derived’ or the like are also used in the art, the term ‘gelatin’ or ‘gelatin-like’ protein will be used throughout the rest of this description. Natural gelatin is a mixture of individual polymers with MW's ranging from 5,000 up to more than 400,000 daltons.

The terms “cell adhesion” and “cell attachment” are used interchangeably.

Also the terms “RGD sequence” and “RGD motif” are used interchangeably.

The terms “protein” or “polypeptide” or “peptide” are used interchangeably and refer to molecules consisting of a chain of amino acids, without reference to a specific mode of action, size, 3-dimensional structure or origin.

The term “support” or “cell attachment support” refers herein to any support which can be used to facilitate cell attachment and/or growth, such as culture dishes, microcarriers (e.g. microcarrier beads), stents, implants, etc.

The term “substantially identical”, “substantial identity” or “essentially similar” or “essential similarity” means that two polypeptide, when aligned pairwise using the Smith-Waterman algorithm with default parameters, comprise at least 76%, 77% or 78%, preferably at least 80%, more preferably at least 85%, 90%, 95%, 98%, 99% or more amino acid sequence identity. More preferably, the polypeptides comprise said amino acid sequence identity while having no more than 3 gaps, preferably no more than 2 gaps, even more preferably no more than 1 gap and most preferably 0 gaps in the alignment. Sequence alignments and scores for percentage sequence identity may be determined using computer programs, such as the GCG Wisconsin Package, Version 10.3, available from Accelrys Inc., 9685 Scranton Road, San Diego, Calif. 92121-3752 USA or using in EmbossWIN (e.g. version 2.10.0). For comparing sequence identity between two sequences, it is preferred that local alignment algorithms are used, such as the Smith Waterman algorithm (Smith T F, Waterman M S (1981) J. Mol. Biol. 147(1); 195-7), used e.g. in the EmbossWIN program “water”. Default parameters are gap opening penalty 10.0 and gap extension penalty 0.5, using the Blosum62 substitution matrix for proteins (Henikoff & Henikoff, 1992, PNAS 89, 915-919).

The term “comprising” is to be interpreted as specifying the presence of the stated parts, steps or components, but does not exclude the presence of one or more additional parts, steps or components.

In addition, reference to an element by the indefinite article “a” or “an” does not exclude the possibility that more than one of the element is present, unless the context clearly requires that there be one and only one of the elements. The indefinite article “a” or “an” thus usually means “at least one”.

“Monomer” refers to a polypeptide unit which can be used to generate a “multimer” by repeating the unit in a linear fashion to generate a longer polypeptide. The monomer units are preferably repeated without intervening amino acids, although optionally 1, 2, 3, 4 or 5 linking amino acids may be present between monomer units.

DETAILED DESCRIPTION OF THE INVENTION

The present invention is directed to peptides, polypeptides or proteins, in particular to gelatines or gelatine-like proteins, which are highly suitable for cell adhesion and can be used in medical or biotechnological applications. More specifically the invention is directed to cell binding peptides or polypeptides that have improved properties compared to known recombinant gelatine-like RGD-comprising polypeptides, such as described in US 2006/0241032, in particular the sequence designated as SEQ ID NO: 2 therein.

It was found, surprisingly, that it is possible to obtain improved peptides or polypeptides with excellent cell attachment properties and high production yield, which comprise advantages such as improved stability, improved cell attachment properties (probably due to the improved stability) and/or result in a more homogenous distribution of particle size of carriers coated with the recombinant polypeptides (such as core microcarrier beads).

The polypeptides also do not display any health related risks, as they have a low antigenicity and that they can be used without the risk of transferring pathological factors such as viruses, prions and the like.

Without limiting the invention, it is thought that not only the distribution and amount of RGD motifs is important in determining the properties of the polypeptides, For example, in addition to the cell attachment properties, the stability and/or 3-dimensional folding of the polypeptides is an important factor which determines the usefulness of the polypeptide. In this aspect, it was found that not only the number of RGD motifs and their distribution, but that also the intervening amino acid sequences may contribute to the improved properties. Although the monomer CBE polypeptide according to the invention has some sequence similarity to e.g. SEQ TD NO: 2 of US2006/0241032, and also comprises 4 RGD motifs, it is still substantially different from that sequence. When aligned, the two polypeptides have only 72.8% sequence identity and also contain a large number of gaps in the alignment (54 gaps, i.e. 54 unmatched amino acids). Especially one of the amino acids next to each of the RGD sequences is E in the polypeptides according to the invention (i.e. ERGD), while it is D in the polypeptide described in the US patent application (DRGD). Also, the spacing between the RGD motifs is shorter in the monomer (and multimers) according to the invention, with at most 54 amino acids between RGDs (33, 39 and 54 amino acids between the first and second, second and third, and third and fourth RGD, respectively), while the prior art sequence comprises 60 amino acids between RGDs. These features are believed to contribute to the improved properties of the instant polypeptides.

Gelatin Like Polypeptide Monomers According to the Invention

Thus, in one embodiment a recombinant gelatine like protein is provided comprising or consisting of an amino acid sequence having at least 75% amino acid sequence identity to SEQ ID NO: 1, more preferably at least 76%, 78%, 80%, 85%, 90%, 95%, 96%, 98%, 99% sequence identity. Preferably said sequence comprises at least 4 RGD motifs, in particular, at least 1, 2, 3 or 4 ERGD motifs. Preferably, the RGD and/or ERGD motifs are distributed relatively evenly within the sequence, with at least about 30, 35, 40, 45 or 50 amino acids between, but preferably there are not more than about 100 amino acids, more preferably less than 60, more preferably not more than 55 amino acids between two RGD and/or ERGD motifs. In one embodiment the recombinant gelatine like protein comprises at least three RGD and/or ERGD motifs wherein the number of amino acids between sequentially a first and second RGD and/or ERGD motif is different from the number of amino acids between said second and sequentially a third RGD and/or ERGD motif. In one embodiment the polypeptide comprises preferably at least 4 RGD and/or ERGD motifs per 100, 150, 200 or 212 amino acids. Optionally more RGD and/or ERGD motifs may be present, such as 5, 6 or 7.

In one embodiment the recombinant gelatine like protein comprises or consists of the monomer of SEQ ID NO: 1 (CBE1) or a variant thereof, such as an amino acid sequence comprising the above % amino acid sequence identity to SEQ ID NO: 1.

The gelatine like protein monomer preferably comprises a substantial number, or consists of GXY triads, wherein G is Glycine and X and Y are any amino acid. A substantial number of GXY triads refers to at least about 50%, more preferably at least 60%, 70%, 80%, 90% or most preferably 100% of amino acid triplets being GXY.

Also, the molecular weight is preferably at least about 15 kDa (calculated molecular weight), more preferably at least about 16, 17, 18, 19 or 20 kDa, or more.

Natural gelatines are known to comprise RGD sequences. It is important however that a gelatine molecule does not contain too large parts without RGD motifs. Too large parts of gelatines without RGD sequence reduce the possibility of cell attachment when such a gelatine is used for instance as a coating on a microcarrier. Apparently not all RGD sequences in a gelatine are under all circumstances available for cell attachment. It was found that cell attachment was remarkably improved in gelatines according to the invention compared to gelatines having a stretch of 60 amino acids between RGD morifs.

In a preferred embodiment the RGD-enriched gelatine is prepared by recombinant DNA technology. Recombinant gelatines of this invention are preferably derived, or selected (e.g. “copied”), from natural collageneous sequences, preferably with further modification to fulfil the amino acid sequence criteria described elsewhere herein. Nucleic acid sequences encoding collagens have been generally described in the art. (See, e.g., Fuller and Boedtker (1981) Biochemistry 20: 996-1006; Sandell et al. (1984) J Biol Chem 259: 7826-34; Kohno et al. (1984) J Biol Chem 259: 13668-13673; French et al. (1985) Gene 39: 311-312; Metsaranta et al. (1991) J Biol Chem 266: 16862-16869; Metsaranta et al. (1991) Biochim Biophys Acta 1089: 241-243; Wood et al. (1987) Gene 61: 225-230; Glumoff et al. (1994) Biochim Biophys Acta 1217: 41-48; Shirai et al. (1998) Matrix Biology 17: 85-88; Tromp et al. (1988) Biochem J 253: 919-912; Kuivaniemi et al. (1988) Biochem J 252: 633640; and Ala-Kokko et al. (1989) Biochem J 260: 509-516.).

Gelatin-Like Polypeptide Multimers According to the Invention

In a further embodiment multimers of the above monomers are provided. Such multimers thus comprise or consist of at least 2, 3, 4, 5, 6, 7, 8, 9 or 10 repeats of the monomer sequence. Thus, in a further embodiment a recombinant gelatin polypeptide is provided comprising or consisting of a multimer of a monomer sequence described above. Preferably, the monomer repeats are repeats of the same monomer unit (having identical amino acid sequences), although optionally also combinations of different monomer units (having different amino acid sequences, each falling under the criteria above) may be used.

Preferably the monomer units are not separated by spacing amino acids, although short linking amino acids, such as 1, 2, 3, 4 or 5 amino acids, may also be inserted between one or more of the monomers.

In one embodiment the multimers comprise or consist of at least 2, 3, 4, 5, 6, 7, 8, 9 or 10 repeats of SEQ ID NO: 1, and/or a sequence substantially identical to SEQ ID NO: 1. In one embodiment the multimer comprises or consists of SEQ ID NO: 2, 3, 4, 5, 6, 7, 8, 9 or 10 (CBE2-10, respectively).

The (calculated) molecular weight of the multimers may thus range from about 30 kDa to about 200 kDa.

Multimers can be generated using known standard molecular biology methods. An example can be found in Werten et al. in Protein Engineering vol 14, pp 447-454, 2001. When using this method, the multimer protein can be preceded and followed by a few extra amino acids, owing to the use of restriction enzymes sites for the construction of the multimer.

Material and Compositions Comprising the RGD-Enriched Monomers and/or Multimers

It was found that recombinant gelatines according to the invention are very suitable for coating cell culture supports which can be used in biotechnological processes or in medical applications. RGD sequences in gelatines can adhere to specific receptors on the cell wall called integrins. These integrins differ in their specificity in recognising cell binding amino acid sequences.

Recombinantly produced gelatine does not suffer from the disadvantage of contamination with pathogens originating from the animal from which the gelatine was derived.

When used as or in combination with a cell culture support, the gelatine-like polypeptides according to the invention functions as a cell binding polypeptide. It has the advantage over other polypeptides that it can also be metabolised by the cells growing on it. A further advantage is that it can be easily digested enzymatically so that cells can be harvested with almost 100% yield.

A further advantage of recombinantly produced gelatines is that the molecular weight (MW) can be kept uniform. Natural gelatines unavoidably have a broad molecular weight distribution with peptides smaller than 5,000 kD up to large polymers with a molecular weight larger than 400,000 kD, resulting from the production method. In particular in combination with microcarrier core beads as cell culture support, a disadvantage of smaller peptides is that they will adhere inside finer pores of the microcarrier which cannot be reached by the cells so that part of the added gelatine is not used. With recombinant production methods the gelatine can be designed with the desired molecular weight, preventing this undesired loss of material.

A cell support comprising a recombinant gelatine according to the invention is provided. Such a cell support may be selected from the group consisting of

1) a cell-culture support, such as a core bead (e.g. a microcarrier bead) or a Petri dish or the like, coated with one or more gelatine-like polypeptides according to the invention;
2) an implant or transplant device (such as hip-, dental-, or other implants, stents, etc.) coated with one or more of the recombinant gelatins according to the invention,
3) a scaffold or matrix for tissue engineering, such as artificial skin matrix material, coated with one or more recombinant gelatine like polypeptides;
4) a wound healing product coated with one or more recombinant gelatine like polypeptides;
5) a tissue adhesive comprising or consisting of one or more recombinant gelatine like polypeptides;
6) a dermal filler.

The recombinant gelatine like proteins offers advantages in that the cell supports, such as microcarriers coated with the polypeptides, have advantageous properties. A key problem in the process of coating microcarrier core beads is the clumping together of beads. In particular such clumping reduces the available surface area for cell attachment and disturbs the size distribution of the microcarriers rendering them unusable. It was found that the use of the polypeptides according to the invention resulted in a more homogenous distribution of coated particle sizes. Also cell adhesion properties of the supports was improved, possibly due to the enhanced protein stability found.

In one embodiment the cell supports provided herein comprise only one recombinant gelatine according to the invention, i.e. selected from one of the polypeptides provided. The product is thus uniform in amino acid sequence, molecular weight, etc. Optionally the peptides may be cross-linked by e.g. chemical cross-linking.

In a different embodiment mixtures of polypeptides according to the invention may be used, such as 2, 3, 4, 5, or more different amino acid sequences according to the invention. The ratios of mixtures may vary, such as 1:1, or 10:1, 50:1, 100:1, 1:100, 1:50, 1:10, and ratios in between these. Optionally also these mixtures may be crosslinked by e.g. chemical cross linking.

When using the recombinant gelatine monomer(s) and/or multimers for coating porous microcarrier beads, preferably polypeptides with a molecular weight of at least about 30 kDa are used, e.g. at least about 30 kDa, 40 kDa, 50 kDa, 60 kDa or 70 kDa or more. The reason for this is that smaller polypeptides enter the pores, thereby not contributing to the cell attachment properties of the coated beads and the coating process may be inefficient, especially if low concentrations of polypeptides are used in the process.

By selecting a molecular weight, within the above specified range, in a coating process the viscosity of the gelatine or gelatine-like protein coating solution can be accurately controlled. Complete or, more important, partial gelling of such a gelatine solution can be prevented while being able to select a high as possible concentration of the gelatine. The uniform gelatine ensures a process of identically coated microcarriers. The uniform coating process allows the use of a minimum amount of gelatine and the use of a minimum volume of gelatine coating solution. All this results in a far more efficient coating process than that is known in the art.

In one embodiment of the invention non-porous core beads are coated with gelatine of the invention. Suitably non-porous core beads are made of polystyrene or glass. Other suitable non-porous materials are known to those skilled in the art.

A particular advantageous embodiment is the process of the invention wherein porous core beads, such as beads from modified dextran or cross-linked cellulose, or (porous) polystyrene, in particular DEAE-dextran, are coated with gelatine of the invention. Other suitable porous materials are known to those skilled in the art, and include e.g. other chemically modified or non-modified polysaccharides.

The size of the beads may vary from 50 μm to 500 μm. Typical mean microcarrier bead sizes are about 100, about 150 or about 200 μm in physiological saline. Size ranges with at least 90% of the beads lying within the range may vary from 80-120 μm, 100-150 μm, 125-175 μm or 150-200 μm.

A wide range of cells may be cultured on microcarriers. For instance, cells from invertebrates, from fish, birds and cells of mammalian origin may be cultivated on microcarriers. Transformed and normal cell lines, fibroblastic and epithelial cells and even genetically engineered cells may be cultivated on microcarriers for various biological applications such as for the production of immunologicals like interferons, interleukins, growth factors etc. Cells cultured on microcarriers also serve as hosts for a variety of viruses that are used as vaccines like foot and mouth disease or rabies.

Microcarrier cultures have a wide number of applications other than mass cultivation as well. Cells growing on microcarriers serve as an excellent tool for studying different aspects of cell biology such as cell-to-cell or cell-to-substratum interactions. Cell differentiation and maturation, metabolic studies may also be carried out using microcarriers. Such cells can also be used for electron microscopic studies or for the isolation of cell organelles such as the cell membrane. Also, this system is essentially a three-dimensional system and serves as a good 3-D model. Similarly, co-cultivation of cells can be done using this system. Thus applications include the production of large quantities of cells, viruses and cell products (e.g. interferon, enzymes, nucleic acids, hormones), studies on cell adhesion, differentiation and cell function, perfusion column culture systems, microscopy studies, harvesting mitotic cells, isolation of cells, membrane studies, storage and transport of cells, assays involving cell transfer and studies on uptake of labelled compounds.

Microcarriers may also be used for the depletion of macrophages from a population of spleen cells. DEAE-dextran microcarriers can potentiate stimulation of lymphocytes by concanavalin A (con A). Microcarrier beads confluent with allogenic tumour cells can be injected in mice to increase humoral and cell-mediated immunity. Plant protoplasts can be immobilised on DEAE-dextran microcarriers.

As a result of the large surface area to volume ratio provided by microcarriers, they can successfully be used for a variety of biological productions on a laboratory scale as well as an industrial scale of for instance even 4000 litres or more.

Large scale production of expressed products can be accomplished with gelatine-coated microcarriers. Loading of microcarriers in production scale bioreactors is generally 20 g/l, but may be increased up to 40 g/l. Microcarriers may be used in batch and perfusion systems, in stirred cultures, and wave bioreactors, as well as to increase the surface area of traditional stationary monolayers and roller cultures.

In a further preferred embodiment the gelatine or gelatine-like protein is in essence free of hydroxyproline residues. Hydroxylation is a requirement for the formation of triple helices in collagen and plays a role in gelation of gelatine. In particular less than 10%, more preferably less than 5% of the amino acid residues of the recombinant gelatines are hydroxyprolines, preferably the recombinant gelatine is free from hydroxyprolines in applications where the gelling capability of the recombinant gelatine is unfavourable. The hydroxyproline-free recombinant gelatines can be used in higher concentrations, and the solutions will be less viscous requiring less vigorous agitation, resulting in less shear forces on the cultured cells. As described in WO 02/070000 A1, recombinant gelatines which are is essence free from hydroxyprolines do not show immune reactions involving IgE in contrast to natural gelatine.

A process for the preparation of collagen coated microcarriers is described in U.S. Pat. No. 4,994,388. In short providing a core bead with a collagen coating is performed in two steps: coating and fixing. The core beads are suspended in an acidic, aqueous collagen solution (0.01-0.1N acetic acid), and the solution is evaporated to dryness. The dry, collagen-coated beads are then suspended in a solution which contains a protein cross-linking agent such as glutaraldehyde, thus cross-linking the collagen coating. Alternatively, the core beads wetted with the collagen solution are not dried entirely before the start of the fixing step. Variations in coating conditions and alternative coating processes are well within the competence of those skilled in the art.

Recombinant structures can also be designed to incorporate additional positively charged groups, as in U.S. Pat. No. 5,512,474, by building in additional arginines, lysines or histidines. Recombinant production of gelatines allows easy manipulation of the number of positively charged amino acids, meaning positively charged at the pH of the cell culture, in the produced protein. In particular arginine, lysine and histidine carry positive charges. It is well within the reach of the skilled person to design a gelatine with a net positive charge at the pH of the particular cell culture of interest. Cells are normally cultured at a pH of 7-7.5. Thus in a further embodiment of the invention a gelatine or gelatine-like protein is used that has a net positive charge at pH 7-7.5. Preferably the net positive charge is +2, +3, +4, +5, +10 or higher. Thus in a further embodiment the invention relates to a gelatine that has a net positive charge at pH 7-7.5. Preferably the net positive charge is +2, +3, +4, +5, +10 or higher

In a further embodiment the invention relates to the use of RGD-enriched gelatines according to the invention to block surface receptors on cells and to make compositions for blocking such receptors. Blocking of receptors of cells is applied in for example inhibiting angiogenesis or in blocking integrins on cardiac fibroblasts.

Cell supports coated with recombinant gelatine according to the invention, on which cells have been grown can be applied during, for example, transplantation of skin or wound treatment or to enhance bone or cartilage (re)growth. It is also possible to coat implant materials with recombinant gelatine of the invention to adhere cells which promote implantation.

In yet another embodiment of the invention a controlled release composition comprising one or more recombinant gelatins according to the invention is provided. The composition may, thus further comprise one or more drugs. The controlled release composition can be administered by injection (subcutaneous, intravenous or intramuscular) or orally or via inhalation. However, the used controlled release composition can also be implanted via surgery. Yet another suitable route of administering is via an external wound dressing or even transdermally.

The controlled release composition preferably comprises the recombinant gelatine in a cross-linked form, e.g. chemically crosslinked. The invention further provides use of a controlled release composition as described herein for the preparation of a medicament for the treatment of pain, cancer therapy, cardiovascular diseases, myocardial repair, angiogenesis, bone repair and regeneration, wound treatment, neural stimulation/therapy or diabetics

In a further embodiment the invention relates to RGD-enriched gelatines which are not glycosylated. Glycosylation takes place at the amino acids Asn (N-glycosydic structures), or Ser or Thr (O-glycosydic structures). Glycosylation should be preferably prevented for applications where no immune response is desired. The absence of Asn, Ser and Thr amino acids in the primary sequence is an effective way to prevent the glycosylation in biotechnological production systems using for instance yeast cell cultures.

Furthermore, characteristic for gelatine is the unusual high content of proline residues. Even more characteristic is that in natural gelatine a number of the proline residues is hydroxylated. Most prominent site of hydroxylation is the 4-position resulting in the presence in the gelatine molecule of the unusual amino acid 4-hydroxyproline. In a triplet 4-hydroxyproline is always found in the Y position. The presence of the hydroxyproline residues is responsible for the fact that a gelatine molecule in its secondary structure can adopt a helical conformation. Thus, it is preferred that the gelatines to be used according to the invention in applications in which the gelling property is unfavourable contain less than 5%, preferably less than 3%, most preferably less than 1% of hydroxyproline residues.

The RGD-enriched gelatines according to the invention can be produced by recombinant methods as disclosed in EP-A-0926543, EP-A-1014176 or WO01/34646. Also for enablement of the production and purification of gelatines of the invention reference is made to the examples in EP-A-0926543 and EP-A-1014176.

Starting from a natural nucleic acid sequence encoding (part of) a collagen, also point mutations can be applied so as to yield a sequence encoding an RGD enriched gelatine according to the invention. Based on the known codons a point mutation can be performed so that an RGX sequence after mutation will yield an RGD sequence, alternatively also an YGD sequence can be mutated to yield an RGD sequence. Also it is possible to carry out two mutations so that an YGX sequence will give an RGD sequence. Also it may be possible to insert one or more nucleotides or delete one or more nucleotides giving rise to a desired RGD sequence.

Thus the gelatine-like proteins can be produced by expression of nucleic acid sequence encoding such polypeptide by a suitable micro-organism. The process can suitably be carried out with a fungal cell or a yeast cell. Suitably the host cell is a high expression host cells like Hansenula, Trichoderma, Aspergillus, Penicillium, Saccharomyces, Kluyveromyces, Neurospora or Pichia. Fungal and yeast cells are preferred to bacteria as they are less susceptible to improper expression of repetitive sequences. Most preferably the host will not have a high level of proteases that attack the collagen structure expressed. In this respect Pichia or Hansenula offers an example of a very suitable expression system. Use of Pichia pastoris as an expression system is disclosed in EP-A-0926543 and EP-A-1014176. In one embodiment the micro-organism is free of active post-translational processing mechanism such as in particular hydroxylation of proline and also hydroxylation of lysine. In another embodiment the host system has an endogenic proline hydroxylation activity by which the recombinant gelatine is hydroxylated in a highly effective way. The selection of a suitable host cell from known industrial enzyme producing fungal host cells specifically yeast cells on the basis of the required parameters described herein rendering the host cell suitable for expression of recombinant gelatine-like proteins suitable in compositions according to the invention in combination with knowledge regarding the host cells and the sequence to be expressed will be possible by a person skilled in the art.

Thus in one aspect the invention also concerns a method for producing a recombinant gelatine according to the present invention, said method comprising

    • preparing an expression vector comprising a nucleic acid sequence encoding a polypeptide according to claims 1-4 operably linked to a suitable promoter,
    • expressing said nucleic acid sequence in a methylotrophic yeast,
    • culturing said yeast under suitable fermentation conditions to allow expression of said nucleic acid sequence;
    • optionally purifying said polypeptide from the culture

SEQUENCES

SEQ ID NO 1: CBE monomer (CBE1)

SEQ ID NO 2: CBE2

SEQ ID NO 3: CBE3

SEQ ID NO 4: CBE4

SEQ ID NO 5: CBE5

SEQ ID NO 6: CBE6

SEQ ID NO 7: CBE7

SEQ ID NO 8: CBE8

SEQ ID NO 9: CBE9

SEQ ID NO 10: CBE10

SEQ ID NO 11: CBE

In one embodiment a gelatin according to the present invention comprises or consists of SEQ ID NO: 2, 3, 4, 5, 6, 7, 8, 9 or 10. In one embodiment the multimer recombinant gelatins according to the present invention, e.g. SEQ ID NO 2-10 are extended with a glycine (G) at the carboxy-terminus. Thus recombinant gelatins according to the present invention include (SEQ ID NO 1)xG, wherein x is an integer selected form 2-10. In one embodiment the multimer recombinant gelatins according to the present invention, e.g. SEQ ID NO 2-10 are preceded by a glycine-alanine-proline triplet (GAP) at the amino-terminus. Thus recombinant gelatins according to the present invention include GAP(SEQ ID NO 1)x, wherein x is an integer selected form 2-10. In one embodiment the multimer recombinant gelatins according to the present invention, e.g. SEQ ID NO 2-10 are preceded by a glycine-alanine-proline triplet (GAP) at the amino-terminus and extended with a glycine (G) at the carboxy-terminus. Thus recombinant gelatins according to the present invention include GAP(SEQ ID NO 1)xG.

EXAMPLES

Example 1

An RGD-enriched gelatine was produced based on a nucleic acid sequence that encodes for a part of the gelatine amino acid sequence of human COL1A1-1 and modifying this nucleic acid sequence. The methods as disclosed in EP-A-0926543, EP-A-1014176 and WO01/34646 were used. This RGD-enriched gelatine is named CBE and the sequence of this RGD-enriched gelatine according to the invention is given in SEQ ID NO: 11.

Amino acid sequence of CBE (SEQ ID NO: 11):

GAPGAPGLQGAPGLQGMPGERGAAGLPGPKGERGDAGPKGADGAPGAPGLQGMPGERGAAG
LPGPKGERGDAGPKGADGAPGKDGVRGLAGPIGPPGERGAAGLPGPKGERGDAGPKGADGAP
GKDGVRGLAGPIGPPGPAGAPGAPGLQGMPGERGAAGLPGPKGERGDAGPKGADGAPGKDGV
RGLAGPI

192 amino acids in length; comprising 4 RGD motifs

From the sequence of CBE, the sequence of CBE monomer (SEQ ID NO: 1) has been derived.

Amino acid sequence of CBE monomer (SEQ ID NO: 1):

GAPGLQGAPGLQGMPGERGAAGLPGPKGERGDAGPKGADGAPGAPGLQGMPGERGAAGLPG
PKGERGDAGPKGADGAPGKDGVRGLAGPIGPPGERGAAGLPGPKGERGDAGPKGADGAPGKD
GVRGLAGPIGPPGPAGAPGAPGLQGMPGERGAAGLPGPKGERGDAGPKGADGAPGKDGVRGL
AGPP

189 amino acids in length; comprising 4 RGD motifs

Via standard subcloning methods multimers comprising the CBE monomer have been prepared, e.g. SEQ ID NO: 2 to SEQ ID NO: 10.

Amino acid sequence CBE trimer used in the Examples below which is based on CBE3 (SEQ ID NO: 3), preceded by GAP and extended with a glycine (G):

GAP(GAPGLQGAPGLQGMPGERGAAGLPGPKGERGDAGPKGADGAPGAPGLQGMPGERGAAG
LPGPKGERGDAGPKGADGAPGKDGVRGLAGPIGPPGERGAAGLPGPKGERGDAGPKGADGAP
GKDGVRGLAGPIGPPGPAGAPGAPGLQGMPGERGAAGLPGPKGERGDAGPKGADGAPGKDGV
RGLAGPX)3G

571 amino acids in length; comprising 12 RGD motifs

Amino acid sequence CBE pentamer used in the Examples below which is based on CBEs (SEQ ID NO: 5) preceded by GAP and extended with a glycine (G):

GAP(GAPGLQGAPGLQGMPGERGAAGLPGPKGERGDAGPKGADGAPGAPGLQGMPGERGAAG
LPGPKGERGDAGPKGADGAPGKDGVRGLAGPIGPPGERGAAGLPGPKGERGDAGPKGADGAP
GKDGVRGLAGPIGPPGPAGAPGAPGLQGMPGERGAAGLPGPKGERGDAGPKGADGAPGKDGV
RGLAGPP)5G

949 amino acids in length; comprising 20 RGD motifs

Example 2

Preparation of Microcarriers Beads

Polystyrene beads with an average diameter of 100 micrometers arc used. The heterobifunctional cross-linking agent, BBA-EAC-NOS, is used to covalently immobilise gelatin onto polystyrene beads. The BBA-EAC-NOS is added to the polystyrene beads and allowed to adsorb. Next, gelatin is added and is allowed to react with the NOS synthetic polymer to produce covalent coupling to the spacer. Then the beads are photoactivated (at 320 nm) to covalently immobilise the spacer (and covalently coupled gelatin) to the polystyrene beads. Finally, loosely adherent gelatine is removed by overnight washing with the mild detergent Tween 20 in phosphate buffered saline (pH 7.2).

Cell Types and Culture Conditions

Green monkey kidney (Vero) cells, Chinese hamster ovary (CHO) cells, normal rat kidney fibroblast (NRK-49F) cells, and Madin Darby canine kidney (MDCK) cells were purchased from ATCC. All four cell types were passaged and maintained in 75 cm2 flasks at 37 DEG C. in a 5% CO2 environment. Vero and NRK-49F cells were cultured in Dulbecco's Modified Eagles's Medium (DMEM), CHO cells were cultured in Ham's F-12 Nutrient Mixture, and MDCK cells were cultured in Minimum Essential Medium (MEM) with Earle's salts.

With the Vero and CHO cells, the medium was supplemented with 10% fetal bovine serum (FBS), 2 mM L-glutamine, 20 mM HEPES buffer, 1 mM sodium pyruvate, 100 ug/ml streptomycin, and 100 units/ml penicillin (final pH 7.1). With the NRK-49F cells, the DMEM was supplemented with 5% FBS, 2 mM L-glutamine, 1 mM sodium pyruvate, non-essential amino acids (0.1 mM each), 100 μg/ml streptomycin, 100 units/ml penicillin, and 0.25 μg/ml of amphotericin B (final pH 7.1). With the MDCK cells, the MEM was supplemented with 10% FBS, 2 mM L-glutamine, non-essential amino acids (0.1 mM each), and 100 μg/ml streptomycin, 100 units/ml penicillin, and 0.25 μg/ml of amphotericin B (final pH 7.1).

In order to standardise the physiology of cells prior to each experiment, cells were passed into 150 cm2 flasks 2 to 3 days prior to inoculation of microcarrier beads. Cells were trypsinised (0.05% trypsin, 0.53 mM EDTA in PBS) for removal from the flasks. For the microcarrier experiments, the cells were centrifuged to remove the trypsin medium and resuspended to about 1.times.106 cells/ml in culture medium. The viable cell concentration was determined by Trypan dye exclusion (0.4% Trypan blue in 0.9% saline).

Cell Culture and Assays in Spinner Flasks

For the cell attachment assay, 20 mg/ml of coated polystyrene beads were used and the cell concentration was 1.5.times.105 cells/ml for each cell type.

Microcarriers were cultured with 100 ml cultures being maintained in 250 ml spinner vessels and stirred with suspended magnetic impellers (50 rpm).

The kinetics of cell attachment were assayed as a decrease in supernatant cell concentration. For sample removal the agitation was stopped briefly (about 30 seconds) at which time the microcarriers settled and a supernatant sample was removed for cell quantitation as described below.

For the cell counts, the cells were stained by mixing with an equal volume of crystal violet (0.1% w/w) in 0.1 M citric acid, and then counted with a hemocytometer. Cell depletion from the medium was used as an indicator of cells attached to beads.

To verify that cells removed from the medium were indeed attached to microcarriers (and not lysed), cells attached to microcarriers were quantitated at the end of each cell attachment assay. One ml aliquots of well-agitated carrier medium were removed, the microcarriers were allowed to settle, and the settled microcarriers were resuspended in crystal violet/citric acid as described above. After incubating 1 hour at 37 DEG C., the suspension was sheared by sucking into and out of a Pasteur pipette to release nuclei, which were quantitated with a haemocytometer.

Gelatin CBE (SEQ ID NO: 11) was used as a microcarrier coating according to the foregoing procedure and compared with a reference RGD-enriched gelatin with sequence identifier number 2 having four RGD sequences as disclosed in US 2006/0241032. CBE gave improved results in terms of numbers of cell depletion from the starting culture medium and also in terms of cell attachment to microcarriers. This improvement may be due to improved stability of the CBE gelatine compared to the sequence with identifier number 2 as disclosed in US 2006/0241032.

Also CBE trimer and CBE pentamer are used as a microcarrier coating according to the foregoing procedure and compared with a trimer, a tetramer and a quintamer of RGD-enriched gelatin with sequence identifier number 2 as disclosed in US 2006/0241032. Probably due to their improved stability, CBE trimer and CBE pentamer show improved cell attachment to microcarriers compared to the multimeric gelatins based on the sequence with identifier number 2 as disclosed in US 2006/0241032. Also particle size measurements of CBE trimer and CBE pentamer coated microcarriers after keeping the coated microcarriers for 24 hours and immediately after the cell attachment assay show a more homogeneous distribution of particle sizes compared to the multimeric gelatins based on the sequence with identifier number 2 as disclosed in US 2006/0241032.

Claims

1-11. (canceled)

12. A recombinant gelatin comprising or consisting of a polypeptide with an amino acid sequence of at least 90% sequence identity to SEQ ID NO: 1.

13. The recombinant gelatin comprising a multimer of a sequence according to claim 12.

14. The recombinant gelatin according to claim 13, wherein the multimer comprises at least 3, 4 or 5 sequences, each of at least 90% sequence identity to SEQ ID NO: 1.

15. The recombinant gelatin according to claim 12, wherein the gelatin comprises SEQ ID NO: 2, 3, 4, 5, 6, 7, 8, 9 or 10.

16. The recombinant gelatin according to claim 13, wherein the gelatin comprises SEQ ID NO: 2, 3, 4, 5, 6, 7, 8, 9 or 10.

17. The recombinant gelatin according to claim 14, wherein the gelatin comprises SEQ ID NO: 3, 4, 5, 6, 7, 8, 9 or 10.

18. A recombinant gelatin according to claim 12 which comprises at least 3, 4 or 5 sequences, each with at least 90% sequence identity to SEQ ID NO: 1, wherein the gelatin comprises SEQ ID NO: 3, 4, 5, 6, 7, 8, 9 or 10.

19. A cell support comprising a recombinant gelatin according to claim 12.

20. A cell support comprising a recombinant gelatin according to claim 18.

21. The cell support according to claim 19, said cell support being selected from the group consisting of a recombinant gelatin coated implant or transplant material, a recombinant gelatin coated scaffold for tissue engineering, a dental product, a wound healing product, artificial skin matrix material and a tissue adhesive.

22. A controlled release composition comprising a recombinant gelatin according to claim 12.

23. A controlled release composition comprising a recombinant gelatin according to claim 18.

24. The controlled release composition according to claim 22, wherein the recombinant gelatin is crosslinked.

25. The controlled release composition according to claim 23, wherein the recombinant gelatin is crosslinked.

26. A method for prevention of platelet aggregation or to prevent tissue adhesion after surgery of a patient comprising administering to the patient the cell support as described in claim 19.

27. A method for prevention of platelet aggregation or to prevent tissue adhesion after surgery of a patient comprising administering to the patient the cell support as described in claim 20.

28. A method for producing a recombinant gelatin, said method comprising:

a) preparing an expression vector comprising a nucleic acid sequence encoding a polypeptide according to claim 12 operably linked to a suitable promoter;

b) expressing said nucleic acid sequence in a methylotrophic yeast;

c) culturing said yeast under suitable fermentation conditions to allow expression of said nucleic acid sequence; and

optionally purifying said polypeptide from the culture.

29. A recombinant gelatin according to claim 12 comprising a polypeptide with an amino acid sequence of at least 90% sequence identity to SEQ ID NO: 1 wherein sequence identity is an alignment having no more than 3 gaps.

30. The recombinant gelatin according to claim 12, wherein the gelatin consists of SEQ ID NO: 2, 3, 4, 5, 6, 7, 8, 9 or 10.

31. The recombinant gelatin according to claim 13, wherein the gelatin consists of SEQ ID NO: 2, 3, 4, 5, 6, 7, 8, 9 or 10.

32. The recombinant gelatin according to claim 14, wherein the gelatin consists of SEQ ID NO: 3, 4, 5, 6, 7, 8, 9 or 10.

33. The recombinant gelatin according to claim 12, wherein the polypeptide consists of an amino acid sequence with at least 90% sequence identity to SEQ ID NO: 1

Resources

Sources:

Similar patent applications:

Recent applications in this class:

Recent applications for this Assignee: