US20130280273A1
2013-10-24
13/716,783
2012-12-17
This invention relates to the finding that collagen peptides bind to the osteoclast-associated receptor (OSCAR) and stimulate the activation and/or differentiation of OSCAR expressing cells, such as osteoclasts and osteoclast precursor cells. Collagen peptides are described which may be useful in the modulation of the differentiation and/or activation of OSCAR expressing cells, for example in the treatment of bone defects and disorders characterized by altered differentiation and/or activation of OSCAR expressing cells.
Get notified when new applications in this technology area are published.
C07K16/28 » CPC main
Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
This application is a divisional of U.S. application Ser. No. 13/122,637, filed Apr. 5, 2011, which is a 371 National Stage Filing of International Application No. PCT/GB2009/002382, filed Oct. 6, 2009, which claims priority to British Application No. 0818273.5, filed Oct. 6, 2008; the contents of all above-named applications are incorporated herein by reference.
This invention relates to collagen peptides, in particular collagen peptides which modulate the activity and/or differentiation of osteoclast-associated receptor (OSCAR) expressing cells, such as osteoclasts.
Bone is a dynamic tissue which is constantly being remodelled by osteoblasts and osteoclasts. New bone is built by osteoblasts and old bone resorbed by osteoclasts, and the development and homeostasis of skeletal systems depends on this balance between bone formation and resorption.
Insufficient osteoclast activity leads to insufficient amounts of old bone being resorbed and can cause osteoporosis, a disease in which the bones of the sufferer become denser and harden. Similarly, increased osteoclast activity leads to increased amounts of old bone being resorbed and can also cause disease. Diseases which are associated with increased osteoclast activity include primary and secondary bone cancer, as well as osteoporosis and rheumatoid arthritis.
Osteoclasts express the osteoclast-associated receptor (OSCAR) on their cell surface (WO0220718). This receptor can modulate osteoclast activity (WO0220718) and is also expressed on osteoclast precursor cells (Kim et al., 2002) as well as on the surface of monocytes, macrophages, dendritic cells and neutrophils in humans (Merck, E. et al, 2004; Merck, E. et al, 2005; Merck, E. et al, 2006)).
The present inventors have discovered that collagen is the ligand of the osteoclast-associated receptor (OSCAR), and that OSCAR binding by collagen peptides stimulates the activation and/or differentiation of OSCAR expressing cells. In particular, the present inventors have shown that collagen peptides can stimulate OSCAR-mediated signalling, as well as differentiation of osteoclast precursor cells.
An aspect of the invention provides a collagen peptide which modulates the differentiation and/or activation of an osteoclast-associated receptor (OSCAR) expressing cell.
Another aspect of the invention provides a collagen peptide for use in a method of treating a bone defect or a disorder characterized by altered differentiation and/or activation of an osteoclast-associated receptor (OSCAR) expressing cell.
Another aspect of the invention provides a method of treating a bone defect or a disorder characterized by altered differentiation and/or activation of an osteoclast-associated receptor (OSCAR) expressing cell comprising;
Another aspect of the invention provides the use of a collagen peptide in the manufacture of a medicament for the treatment of a bone defect or a disorder characterized by altered differentiation and/or activation of an osteoclast-associated receptor (OSCAR) expressing cell.
Another aspect of the invention provides methods of screening for modulators of differentiation and/or activation of an osteoclast-associated receptor (OSCAR) expressing cell comprising;
Another aspect of the invention relates to the use of a collagen peptide for modulating differentiation and/or activation of an osteoclast-associated receptor (OSCAR) expressing cell in vitro.
Another aspect of the invention provides an in vitro method of modulating differentiation and/or activation of an osteoclast-associated receptor (OSCAR) expressing cell comprising;
Another aspect of the invention provides a pharmaceutical composition comprising a collagen peptide and a pharmaceutical agent capable of altering activation and/or differentiation of an osteoclast-associated receptor (OSCAR) expressing cell, and a pharmaceutically acceptable excipient.
Other aspects of the invention provide a culture vessel for culturing an osteoclast-associated receptor (OSCAR) expressing cell comprising a surface coated with a collagen peptide, and a kit comprising such a culture vessel for example for use in characterizing an osteoclast-associated receptor (OSCAR) expressing cell. Such culture vessels and kits may be used e.g. in a screen for modulators of osteoclast-associated receptor (OSCAR) expressing cell differentiation and/or activity.
FIG. 1 shows that OSCAR is a receptor for collagen. Fc-fusion proteins of human Ig-like receptors OSCAR (OSCAR-Fc), OSCAR-like transcript-2 (OLT2-Fc), TREM-like transcript-1 (TLT1-Fc), and Siglec-15 (Siglec15-Fc) were used in ELISA to assess binding to plates coated with: type I-V collagens (x-axis), Ethicon, Devro-Ethicon (Dev-Eth), Horm and ProColl CS are all different preparations of collagen-1, the integrin α2β1 homotrimeric peptide ligand ‘GFOGER’ and monomeric collagen-related peptide (mCRP) were also included. Bovine serum albumin (BSA) was used as negative control protein coat (x-axis). An Fc-fusion of the platelet collagen receptor, glycoprotein VI (gpVI), was used as a positive control and purified human IgG (IgG) was used as negative control. Primary Fc-fusions were detected using HRP-conjugated rabbit anti-human secondary antibodies and absorption at an optical density of 450 nm (OD) was recorded (y-axis).
FIG. 2 shows that OSCAR-Fc does not bind appreciably to other α2β1 integrin peptide ligands. The triple-helical peptide, (GPP)10, was used as negative control for triple-helical peptides bound by N- and C-terminal (GPP)5 repeats to form the triple-helical peptide structures
FIG. 3 shows that OSCAR-Fc does not bind appreciably to the extracellular matrix proteins, vitronectin and fibronectin. The triple-helical peptide, (GPP)10, was used as negative control for triple-helical peptides bound by N- and C-terminal (GPP)5 repeats to form the triple-helical peptide structures
FIG. 4 shows that anti-human OSCAR mAb 11.1CN5 blocks OSCAR-Fc binding to type-I, -II and -III collagen, whereas an isotype control mAb has no effect.
FIG. 5 shows that FITC-conjugated type-I collagen (type-I Collagen-FITC, 5 μg/ml) binds to an RBL-2H3 stable cell-line expressing OSCAR-FLAG (open histograms) but not untransfected cells (grey-shaded). This interaction is blocked with 2 μg/ml of anti-human OSCAR mAb 11.1CN5.
FIG. 6 shows that collagenase treatment (open histograms) removes the putative OSCAR ligand from prostaglandin-E2 and vitamin D3 stimulated murine bone marrow stromal cells (BMSC) and murine calvarial osteoblasts (OB) (grey-shaded histograms).
FIG. 7 shows the results of an ELISA assay of OSCAR-Fc binding to plates coated with III-36 homotrimeric peptide derivatives conforming to, the corresponding halves of III-36 containing a putative OSCAR binding sequence conforming to the predicted motif (underlined), a trimmed peptide containing only this motif, and peptides in which an alanine scan (bold) run was run through the trimmed sequence along non-helix breaking residues (Gxx′).
FIG. 8 shows the effect of various amino-acid substitutions on human OSCAR-Fc binding activity by ELISA.
FIG. 9 shows dotplots showing GFP expression (y-axis) versus forward scatter (x-axis) of a human OSCAR-CD3ξ NFAT-GFP reporter cell-line in response to overnight culture on tissue culture plates coated with BSA, collagens type-I (ProColl CS), -II (Bovine II), -III (Human III), -IV (Human IV) and -V (Human V) and peptides, (GPP)10, and the N- and C-terminal bound (GPP)5 triple-helical peptides: (GPP)5-'GLOGPSGEO'-(GPP)5, (GPP)5-GPOGPAGFOGAO-(GPP)5 or (GPP)5-GAOGPAGFA-(GPP)5. 2000 events are displayed in each dotplot.
FIG. 10 shows a graph of mean fluorescent intensity (MFI) of GFP expression of the hOSCAR-CD3ξ NFAT-GFP reporter cell-line in response to Ala-scan and amino acid substitution peptides coated on tissue culture plates. Peptide sequences shown were all bound by N- and C-terminal (GPP)5 repeats.
FIG. 11 shows the identification of a human OSCAR collagen binding motif. Human OSCAR-Fc was used to screen a plate-bound overlapping type-II triple-helical collagen peptide library (type-II collagen toolkit) by ELISA. Peptide sequences (peptides #1-56) from this library are shown in Table 1.
FIG. 12 shows the identification of a human OSCAR collagen binding motif. Human OSCAR-Fc was used to screen a plate-bound overlapping type-III triple-helical collagen peptide libraries (type-III collagen toolkit) by ELISA. Peptide sequences (peptides #1-57) from this library are shown in Table 2.
FIG. 13 shows that tissue culture plates coated with OSCAR-binding collagen peptides promote osteoclastogenesis. Human peripheral blood monocytes were cultured in flat-bottomed 96-well tissue plates coated with either BSA; control ovalbumin peptide (OVA), (GPP)10, (GPP)5-GLOGPSGEO-(GPP)5, (GPP)5-GPOGPAGFOGAO-(GPP)5 or (GPP)5-GAOGPAGFA-(GPP)5 (x-axis). Cultures were stained for Tartrate-resistant acid phosphatase (TRAP) (dark red/purple staining) Giant multinuclear TRAP+ osteoclasts (OC) were enumerated after 7 days culture with 100 ng/ml recombinant RANK-L and 30 ng/mlM-CSF (y-axis). The OSCAR-binding collagen peptides (GPP)5-GPOGPAGFOGAO-(GPP)5 and (GPP)5-GAOGPAGFA-(GPP)5 enhance osteoclastogenesis, whereas BSA, OVA, (GPP)10 and (GPP)5-GLOGPSGEO-(GPP)5, which bind human OSCAR-Fc, did not.
FIG. 14 shows the number of TRAP+ giant multinuclear cells enumerated after 7 days in culture (y-axis) of human peripheral blood monocytes in flat-bottomed 96-well tissue plates coated with (GPP)5-GPOGPAGFOGAO-(GPP)5 in the presence of 2.5 μg/ml of either the mouse anti-human OSCAR mAb 11.1CN5 or the anti-MHC class I mAb (x-axis).
FIG. 15 shows examples of the TRAP+ cells generated under the culture conditions of FIG. 14. After 7d days culture, giant TRAP+ multinuclear cells are present at higher cell densities in plates coated with either (GPP)5-GPOGPAGFOGAO-(GPP)5 or (GPP)5-GAOGPAGFA-(GPP)5, but BSA, OVA or (GPP)5-GLOGPSGEO-(GPP)5.
FIG. 16 shows that BMM from wild-type C57BL/6 mice also exhibit enhanced osteoclastogenesis (y-axis) in tissue culture plates coated with (GPP)5-GPOGPAGFOGAO-(GPP)5, but not BSA, OVA or (GPP)10 (x-axis) (upper left panel). BMM from either OSCAR-deficient (OSCAR−/−) (upper right) or FcRγ-deficient (FcRγ−/−) (lower left) mice do not show enhanced osteoclastogenesis in plates coated with (GPP)5-GPOGPAGFOGAO-(GPP)5, compared to BSA, OVA or (GPP)10. The in vitro osteoclastogeneic defect of DAP12-deficient (DAP12−/−) BMM (lower right) is rescued upon culture in plates coated with (GPP)5-GPOGPAGFOGAO-(GPP)5, but not BSA, OVA or (GPP)10 at concentrations of either 30 ng/ml RANK-L+10 ng/ml M-CSF or 100 ng/ml RANK-L+10 ng/ml M-CSF).
FIG. 17A shows examples of the rescued DAP12−/− giant TRAP+(red/purple histological stain) multinucleated cells formed on plates coated with (GPP)5-GPOGPAGFOGAO-(GPP)5 (×20 objective). FIG. 17B shows examples of TRAP+ mononuclear DAP12−/− cells cultured on (GPP)10-coated plates for comparison. By immunofluorescence, the rescued DAP12−/− giant multinuclear (DAPI, blue staining) formed actin rings as revealed by Phalloidin-Alex 488 (green staining).
FIG. 18 shows OSCAR ligand-binding rescues the osteoclastogenesis defect in DAP12- and TREM2-deficient Nasu-Hakola patients. (RH panel) Retroviral transduction of DAP12 rescues the in vitro osteoclastogeneic defect of OSCAR−/−DAP12−/− BMM (y-axis) in plates coated with either BSA, OVA, (GPP)10 or (GPP)5-GPOGPAGFOGAO-(GPP)5, whereas (LH panel) Retroviral transduction of OSCAR (long signal peptide isoform (SP-L) rescues the in vitro osteoclastogenic defect of OSCAR−/−DAP12−/− BMM only in plates coated with (GPP)5-GPOGPAGFOGAO-(GPP)5, but not plates coated with BSA or OVA. (GPP)10-coated plates also developed giant TRAP+ multinucleated cells to lesser extent.
FIG. 19 shows examples of TRAP+ (red/purple histological stain) cells formed on plates coated with either BSA or (GPP)5-GPOGPAGFOGAO-(GPP)5 upon retroviral transduction of either empty pMx vector, DAP12 or the OSCAR SP-L (x20 objective). Giant TRAP+ multinuclear cells did not form upon retroviral transduction of OSCAR−/−DAP12−/− BMM using empty pMx retroviral vector under any of the conditions tested.
FIG. 20 shows the in vitro osteoclastogeneic defect of human peripheral blood monocytes from TREM2-deficient (LHS) or DAP12-deificient Nasu-Hakola patients (RHS) is rescued upon culture on tissue culture plates coated with (GPP)5-GPOGPAGFOGAO-(GPP)5, but not plates coated with BSA or (GPP)10.
FIG. 21 shows examples of the giant TRAP+ multinuclear cells rescued from TREM2-deficient (NH2) or DAP12-deficient (NH6) Nasu-Hakola patients in wells coated with (GPP)5-GPOGPAGFOGAO-(GPP)5 but not BSA or (GPP)10 (x20 objective).
FIG. 22 shows expression of osteoclast-specific genes from DAP12-deficient BMM osteoclasts cultured on BSA-, (GPP)5-GPOGPAGFOGAO-(GPP)5- and (GPP)5-GAOGPAGFA-(GPP)5-coated tissue culture plates by RT-PCR. BMM from DAP12-deficient mice were cultured on BSA-, GPP)5-GPOGPAGFOGAO-(GPP)5— and (GPP)5-GAOGPAGFA-(GPP)5-coated tissue culture plates. 24 h after osteoclasts developed, total RNA was extracted and reverse-transcribed. The resulting cDNA was used to detect expression of the osteoclast-specific genes Cathepsin-K, calcitonin receptor, integrin αV, ADAMS, MMP-9 and OSCAR by RT-PCR. GAPDH was used as a positive control. Total RNA from BMM precursors (grown in 100 ng/ml M-CSF for 3 days preceding differentiation with 100 ng/mlRANK-L+10 ng/ml M-CSF) were used as a negative control population for expression of these genes.
FIG. 23 shows the effect of N-glycosylation on OSCAR-Fc binding to collagen. Fc-fusions of human Ig-like receptors OSCAR(OSC-Fc), OSCAR-like transcript-2 (OLT2) were used in ELISA to assess binding to collagens type I-V in the presence and absence of Peptide-N-glycosidase F (PNGase F), which releases asparagine-linked (N-linked) oligosaccharides from glycoproteins and glycopeptides. Ethicon, Devro-Ethicon (Dev-Eth), Horm and ProColl CS are all different preparations of type-I collagen. Binding to bovine serum albumin (BSA) was used as a negative control.
Black bars indicate OSCAR-Fc binding in the absence, and light grey bars in the presence, of PNGase F. Open bars indicate OSCAR-like transcript-2 binding in the absence, and dark grey bars in the presence, of PNGase F.
FIG. 24 shows that soluble triple-helical OSCAR-binding peptides block human OSCAR-Fc binding to immobilised triple-helical peptides. (A) The triple-helical peptides: DB99, (GPP)5-GAOGPAGSA-(GPP)5; NR325, (GPP)5-GAOGPAGFA-(GPP)5; NR338, (GPP)5-GAOGASGDR-(GPP)5 and NR340, (GPP)5-GAOGPAGYA-(GPP)5 were immobilised on 96-well Nunc immunosorp plates. Human OSCAR-Fc (2.5 μg/ml) was incubated for 30 min at room temperature with soluble versions of each peptide at the indicated doubling concentration range (0-200 μM, x-axis). The OSCAR-Fc:peptide complexes were then assayed for binding to their respective immobilised peptides by solid-phase assay and absorbance at an optical density at 450 nM recorded (y-axis). Whilst each peptide clearly has a separate affinity for OSCAR-Fc, the increasing concentrations of each soluble peptide, clearly inhibit binding of OSCAR-Fc to the immobilised version of the same peptide. (B) Control experiment for soluble peptide blocking activity on human OSCAR-Fc. The triple-helical peptides: DB99, (GPP)5-GAOGPAGSA-(GPP)5; NR325, (GPP)5-GAOGPAGFA-(GPP)5; NR338, (GPP)5-GAOGASGDR-(GPP)5 and NR340, (GPP)5-GAOGPAGYA-(GPP)5 were immobilised on 96-well Nunc immunosorp plates. Human OSCAR-Fc (2.5 μg/ml) was incubated for 30 mins at room temperature with soluble (GPP)10 at the indicated doubling concentration range (0-200 μM, x-axis) before assay for OSCAR-Fc binding to immobilised DB99, NR325, NR338 or NR340 by solid-phase assay and the absorbance at an optical density at 450 nM recorded (y-axis). The analagous concentrations of the soluble control triple-helical peptide, (GPP)10, do not block human OSCAR-Fc binding to the immobilised DB99, NR325, NR338 or NR340 peptides, showing the blocking effect is due to the soluble ‘non-immobilised’ state of OSCAR-binding triple-helical peptide ligands containing an OSCAR-binding motif.
FIG. 25 shows dotplots (10,000 events) displaying the responses of the human (h) and murine (m) OSCAR-CD3Zeta NFAT-GFP reporter cell-lines to:
immobilised BSA; a linear peptide containing the minimal OSCAR-binding sequence ‘GPOGPAGFO’ and a triple-helical peptide designed to the
minimal OSCAR-binding sequence ‘(GPP)5-GPOGPAGFO-(GPP)5’. GFP-expression, y-axis; Forward-scatter, x-axis.
Table 1 shows the sequences of the overlapping homotrimeric type-II collagen peptide library (collagen II toolkit) which encompasses the entire type-II collagen sequence. The mass of the peptides in Daltons (Da) is also shown.
Table 2 shows the sequences of the overlapping homotrimeric type-III collagen peptide library (collagen III toolkit) which encompasses the entire type-II collagen sequence. The mass of the peptides in Daltons (Da) is also shown.
Table 3 shows the amino acid sequences of the 111-36 peptide derivatives, including their mass in Daltons (Da).
Table 4 shows an alignment of the homotrimeric collagen-based peptides sequences which bound the strongest to OSCAR-Fc
Table 5 shows a prediction of the putative OSCAR binding site.
This invention relates to collagen peptides which interact with the osteoclast-associated receptor (OSCAR) and modulate differentiation and/or activation of OSCAR expressing cells
Osteoclast-associated receptor (OSCAR) is a cell-surface receptor which is expressed on the surface of mammalian osteoclasts and other cell types. Examples of osteoclast-associated receptors include the human osteoclast-associated receptor (GenelD: 126014; reference amino acid sequence AAH35023.1 GI: 23273932), the mouse osteoclast-associated receptor (GeneID: 232790; reference amino acid sequence AAI37777.1 GI: 187950779) and the rat osteoclast-associated receptor (GenelD: 292537; sequence herein).
Suitable osteoclast-associated receptors (OSCAR) may comprise the amino acid sequence of a reference sequence identified above or an allelic variant thereof. The amino acid sequence of an allelic variant may, for example, have at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% sequence identity to the reference sequence.
Osteoclast-associated receptors may be identified using standard methods in the art, such as immunological techniques. Antibodies specific for OSCAR are commercially available and include, for example, mAb 11.1CN5 (Beckman coulter), mAb 18D440.1 (Abcam), goat OSCAR polyclonal Ab (Novus Biologicals); and OSCAR (M−17), (N-16) and (D-19) goat polyclonal IgGs (Santa Cruz Biotechnology).
Osteoclast-associated receptor (OSCAR) may be expressed by mammalian cells, for example, human cells or murine cells, such as mouse and rat cells. Cells which express osteoclast-associated receptor (OSCAR) include osteoclasts, osteoclast precursors, monocytes, macrophages, dendritic cells and neutrophils.
Any collagen peptide which forms hetero- or homo-trimers under appropriate conditions and binds OSCAR may be used as described herein.
For example, collagen peptide suitable for use as described herein may comprise the amino acid sequence;
| GX1OGX2X3GX4X5, |
In some embodiments, a collagen peptide suitable for use as described herein may comprise the amino acid sequence;
| GX1OGX2X3GX4X5, |
In some preferred embodiments, a collagen peptide may comprise the amino acid sequence GX1OGPX3GFO,
For example, a collagen peptide may comprise the amino acid sequence GX1OGPX3GFOGX6O,
A collagen peptide may comprise an amino acid sequence having at least 50%, at least 60%, at least 70%, at least 90% or at least 95% sequence identity to a sequence selected from the group of GPOGPAGFOGAO, GAOGPAGFA, GERGETGPOGPAGFOGAOGQN, GPOGPAGFOGAOGQNGEOGGK, GAOGPAGFOGAO, GPOGAAGFOGAO, GPOGPAGFAGAO, GPOGPAGFOGAA, GAOGPAGSA, GAOGVMGFA, GAOGPAGFAGEA, GAOGAAGFA, GAOGPPGFA, GAOGPOGFA, GAOGPQGFA, GAOGASGDR, GAOGPAGYA, GPOGPAGAOGAO, GAOGPAGEA, GAOGPAGFD, and GAOGPQGPA, wherein 0 is a hydroxyproline residue.
Sequence identity is commonly defined with reference to the algorithm GAP (Genetics Computer Group, Madison, Wis.). GAP uses the Needleman and Wunsch algorithm to align two complete sequences that maximizes the number of matches and minimizes the number of gaps. Generally, default parameters are used, with a gap creation penalty=12 and gap extension penalty=4. Use of GAP may be preferred but other algorithms may be used, e.g. BLAST (McGinnis S et al. (2004) 32:W20-W25; Altschul et al. (1990)), FASTA (which uses the method of Pearson and Lipman 1988), or the Smith-Waterman algorithm (Smith and Waterman 1981), or the TBLASTN program, of Altschul et al. (1990) supra, generally employing default parameters. In particular, the psi-Blast algorithm may be used (Altschul et al. 1997). BLAST algorithms are available via an interface at the NCBI website (Johnson et al 2008). Sequence identity and similarity may also be determined using Genomequest™ software (Gene-IT, Worcester Mass. USA).
Sequence comparisons are preferably made over the full-length of the relevant sequence described herein.
A suitable collagen peptide may comprise an amino acid sequence selected from the group of: GPOGPAGFOGAO, GAOGPAGFA, GERGETGPOGPAGFOGAOGQN, GPOGPAGFOGAOGQNGEOGGK, GAOGPAGFOGAO, GPOGAAGFOGAO, GPOGPAGFAGAO, GPOGPAGFOGAA, GAOGPAGSA, GAOGVMGFA, GAOGPAGFAGEA, GAOGAAGFA, GAOGPPGFA, GAOGPOGFA, GAOGPQGFA, GAOGASGDR, GAOGPAGYA, GPOGPAGAOGAO, GAOGPAGEA, GAOGPAGFD, and GAOGPQGPA, wherein O is a hydroxyproline residue.
In some embodiments, a collagen peptide may comprise two or more repeats of a collagen sequence set out above.
A collagen peptide may be at least 10, at least 15, at least 20, at least 25, at least 30, at least 35, at least 40, at least 45, at least 50, at least 55, at least 60, at least 65, at least 70, at least 75, at least 80, at least 85, at least 90, at least 95, or at least 100 amino acids in length.
Alternatively, a collagen peptide may be up to 10, up to 15, up to 20, up to 25, up to 30, up to 35, up to 40, up to 45, up to 50, up to 55, up to 60, up to 65, up to 70, up to 75, up to 80, up to 85, up to 90, up to 95, up to 100, up to 200 or up to 300 amino acids in length.
The sequence of a collagen peptide may be a naturally occurring collagen sequence (i.e. a collagen sequence which exists in nature), for example a collagen sequence found in collagen-I, -II or -III, or a non-naturally occurring collagen sequence (i.e. an artificial collagen sequence which does not exist in nature).
A collagen peptide may be comprised within a non-naturally occurring peptide and polypeptide fusions, for example wherein the collagen peptide is fused to one or more sequences which are not naturally fused to the peptide. Sequences which are not naturally fused to the collagen peptide may include artificial collagen sequences, non-collagen sequences or additional copies of the peptide sequence itself.
In some embodiments, one or more heterologous amino acids may be joined or fused to the N- and/or C-terminal end of a collagen peptide set out herein and a polypeptide or peptide may comprise a peptide as described above linked or fused to one or more heterologous amino acids.
A heterologous amino acid sequence is an amino acid sequence which is not naturally found in collagens, e.g. a non-collagen sequence. Heterologous amino acid sequences include artificial sequences, i.e. sequences not found in nature.
A heterologous amino acid sequence is a sequence not occurring in any natural collagen (e.g. collagen-I, -II or -III) joined by a peptide bond without intervening amino acids to a peptide described herein, that is to say usually a chain of amino acids which is not found naturally joined to a collagen peptide described herein at the position of fusion in the peptide. Usually, where heterologous amino acids are fused to the N or C terminal of the collagen peptide, the whole contiguous sequence of amino acids does not occur within collagen.
In some preferred embodiments, collagen peptides as described above are fused to heterologous N and C terminal amino acid sequences which support the triple-helical polyproline II helix structure, for example GXaXb repeat sequences, where Xa and Xb are any amino acid other than G, preferably Xa is independently any amino acid except glycine or O. Suitable triple-helical sequences include GPP and/or GPO repeats. For example, (GPP)a, wherein n is 2-6 or more and (GPO)n1 where n1 is 2-6 or more.
Preferably a collagen peptide comprises multiple repeats, e.g. 2, 3, 4, 5 or 6, of the sequence ‘GPP’ at its N-terminal and C-terminal ends. For example, a collagen peptide may comprise the sequence (GPP)5 at its N-terminal and C-terminal ends. In some embodiments, a collagen peptide may comprise one or m ore copies of the sequence ‘GPC’ to facilitate disulphide cross-linking. For example, a peptide may comprise the sequence GPC(GPP)5 at its N-terminal and the sequence (GPP)5GPC at its C-terminal ends.
For example, suitable collagen peptides may comprise the sequence (GPP)5-GPOGPAGFOGAO-(GPP)5 or (GPP)5-GAOGPAGFA-(GPP)5 or, more preferably, GPC(GPP)5-GPOGPAGFOGAO-(GPP)5GPC or GPC(GPP)5-GAOGPAGFA-(GPP)5GPC.
Heterologous amino acids at the N or C terminal of a collagen peptide or polypeptide described herein may form an additional sequence or motif. Indeed, any desired additional amino acid sequence may be included in a fusion with a peptide described herein, including non-triple helical extensions of the triple helix formed by trimerising of the peptides. Suitable heterologous amino acid sequences include the sequences of bioactive peptides and polypeptides, including chemokines and cytokines, such as RANKL and osteoprotegrin (OPG).
Collagen peptides and polypeptides described herein preferably form trimers under appropriate conditions.
A peptidyl trimer may be a homotrimer or a heterotrimer of a collagen peptide described herein. For example, a collagen peptidyl trimer which binds OSCAR may comprise three peptides comprising the amino acid sequence;
| GX1OGX2X3GX4X5, |
In some embodiments, a collagen peptidyl trimer may comprise three peptides comprising the amino acid sequence;
| GX1OGX2X3GX4X5, |
For example;
The production of collagen heterotrimers is described, for example, in Slatter D A et al J Mol. Biol. (2006) 2; 359(2):289-98.
A peptide which forms a peptidyl trimer may be fused to one or more sequences which are not naturally fused to the peptide, for example one or more heterologous amino acids, to form non-naturally occurring peptide and polypeptide fusions, as described above.
In some embodiments, peptides may be cross-linked within the trimer, for example using covalent bonds e.g. hexanoic acid cross-linking (such as the lysyl-lysyl amino hexanoate cross-linking). Alternatively, a disulphide knot may be produced and selectively protected and deprotected to link three chains successively and in register.
In other embodiments, peptides may trimerise without any cross-linking, and trimers consisting of peptides as described herein may be provided without cross-linking A peptidyl trimer may be produced by providing peptides as described herein and causing or allowing (under appropriate conditions) the peptides to associate to form a trimer.
Triple helical structure may be determined by any convenient technique, for example polarimetry or circular dichroism. Trimerization may be followed by isolation of trimers, e.g. for subsequent use and/or manipulation.
Collagen peptides as described herein and trimers thereof may be useful in modulating the activation and/or differentiation of osteoclast-associated receptor expressing cells, e.g. by activating OSCAR-mediated signalling. For example, a collagen peptide may stimulate the differentiation and/or activation of the osteoclast-associated receptor (OSCAR) expressing cell for example by specific binding to OSCAR. Alternatively, a collagen peptide may inhibit the differentiation and/or activation of the osteoclast-associated receptor (OSCAR) expressing cell, for example by blocking the binding of OSCAR to collagen ligands.
Suitable collagen peptides and trimers thereof bind to an osteoclast-associated receptor. For example, a collagen peptide may bind to an osteoclast-associated receptor with the same or better affinity than a collagen peptide comprising a sequence selected from the group of: GPOGPAGFOGAO, GAOGPAGFA, GERGETGPOGPAGFOGAOGQN, GPOGPAGFOGAOGQNGEOGGK, GAOGPAGFOGAO, GPOGAAGFOGAO, GPOGPAGFAGAO, GPOGPAGFOGAA, GAOGPAGSA, GAOGVMGFA, GAOGPAGFAGEA, GAOGAAGFA, GAOGPPGFA, GAOGPOGFA, GAOGPQGFA, GAOGASGDR, GAOGPAGYA, GPOGPAGAOGAO, GAOGPAGEA, GAOGPAGFD, and GAOGPQGPA.
Preferably, a collagen peptide binds to an osteoclast-associated receptor with the same or better affinity than a collagen peptide comprising an amino acid sequence selected from the group of: GPOGPAGFOGAO and GAOGPAGFA. For example, a collagen peptide may bind to an osteoclast-associated receptor with the same or better affinity than collagen peptides GPC(GPP)5-GPOGPAGFOGAO-(GPP)5GPC or GPC(GPP)5-GAOGPAGFA-(GPP)5GPC.
A collagen peptide or trimer as described herein may show no binding or substantially no binding to known collagen receptors, such as integrin α2β1, the discoidin domain receptors DDR1 and DDR2 or platelet glycoprotein VI.
Methods for determining the affinity of a collagen peptide for an osteoclast-associated receptor are well-known in the art and are also described elsewhere herein.
A collagen peptide or trimer as described herein may be provided in an isolated and/or purified form i.e. devoid of other collagen peptides or fragments or other biological molecules which are naturally found in association with collagen.
Collagen peptides for use as described herein are preferably synthetic i.e. produced by a synthetic or recombinant process.
For example, collagen peptides described herein may be generated wholly or partly by chemical synthesis. The peptides can be readily prepared, for example, according to well-established, standard liquid or, preferably, solid-phase peptide synthesis methods, general descriptions of which are broadly available (see, for example, in J. M. Stewart and J. D. Young, Solid Phase Peptide Synthesis, 2nd edition, Pierce Chemical Company, Rockford, Ill. (1984), in M. Bodanzsky and A. Bodanzsky, The Practice of Peptide Synthesis, Springer Verlag, New York (1984); in J. H. Jones, The Chemical Synthesis of Peptides. Oxford University Press, Oxford 1991; in Applied Biosystems 430A Users Manual, ABI Inc., Foster City, Calif., in G. A. Grant, (Ed.) Synthetic Peptides, A User's Guide. W. H. Freeman & Co., New York 1992, E. Atherton and R. C. Sheppard, Solid Phase Peptide Synthesis, A Practical Approach. IRL Press 1989 and in G. B. Fields, (Ed.) Solid-Phase Peptide Synthesis (Methods in Enzymology Vol. 289). Academic Press, New York and London 1997), or they may be prepared in solution, by the liquid phase method or by any combination of solid-phase, liquid phase and solution chemistry, e.g. by first completing the respective peptide portion and then, if desired and appropriate, after removal of any protecting groups being present, by introduction of the residue X by reaction of the respective carbonic or sulfonic acid or a reactive derivative thereof. For example, peptides may be synthesized by Fmoc (N-(9-fluorenyl)methoxycarbonyl) chemistry as C-terminal amides on TentaGel R RAM resin in an automated synthesizer (e.g. Applied Biosystems Pioneer™)
Another convenient way of producing the collagen peptides described herein is to express nucleic acid encoding a precursor wherein proline appears in place of the desired hydroxyproline, by use of nucleic acid in an expression system. Production of GPO-containing peptides may be achieved for example by co-expression of an appropriate hydroxylase, as has been done with lysyl residues (Nokelainen et al. 1998 Matrix Biol. 16(6):329-38). For peptides containing Pro residues to be post-translationally converted by hydroxylation to Hyp (O), prolyl-hydroxylase may be co-expressed. Myllyharju, J. et al. Biochem Soc trans 2000, 4 353-7 describes an efficient expression system for recombinant human collagens which may be useful in providing peptides as described herein. This system uses the methylotrophic yeast Pichia pastoris, with co-expression of the desired peptides chains with the alpha- and beta-subunits of prolyl 4-hydroxylase.
In some embodiments, a collagen peptide or polypeptide as described herein may be chemically modified, for example, by addition of one or more polyethylene glycol molecules, sugars, phosphates, and/or other such molecules, where the molecule or molecules are not naturally attached to wild-type collagen proteins. Suitable chemical modifications are well known to those of skill in the art. The same type of modification may be present in the same or varying degree at several sites in the peptide or polypeptide. Also, a given the peptide or polypeptide may contain many types of modifications.
Modifications can occur anywhere in the peptide sequence, including the peptide backbone, the amino acid side-chains, and the amino or carboxyl termini. Modifications include, for example, acetylation, acylation, ADP-ribosylation, amidation, covalent attachment of flavin, covalent attachment of a haem moiety, covalent attachment of a nucleotide or nucleotide derivative, covalent attachment of a lipid or lipid derivative, covalent attachment of phosphatidylinositol, cross-linking, cyclization, disulfide bond formation, demethylation, formation of covalent cross-links, formation of cysteine, formation of pyroglutamate, formylation, gamma-carboxylation, glycosylation, GPI anchor formation, hydroxylation, iodination, methylation, myristoylation, oxidation, proteolytic processing, phosphorylation, prenylation, racemization, glycosylation, lipid attachment, sulfation, gamma-carboxylation of glutamic acid residues, hydroxylation and ADP-ribosylation, selenoylation, sulfation, transfer-RNA mediated addition of amino acids to proteins, such as arginylation, and ubiquitination. See, for instance, Proteins-Structure And Molecular Properties, 2nd Ed., T. E. Creighton, W. H. Freeman and Company, New York (1993) and Wold, F., “Posttranslational Protein Modifications: Perspectives and Prospects,” pgs. 1-12 in Posttranslational Covalent Modification Of Proteins, B. C. Johnson, Ed., Academic Press, New York (1983); Seifter et al., Meth. Enzymol. 182:626-646 (1990) and Rattan et al., “Protein Synthesis: Posttranslational Modifications and Aging,” Ann. N.Y. Acad. Sci. 663: 48-62 (1992).
In some embodiments, a protecting group may be coupled to the N- and/or C-terminal end of a collagen peptide to protect the collagen peptide from enzymatic digestion. Suitable protecting groups are well-known in the art.
Collagen peptides or polypeptides as described herein may be structurally modified. A structurally modified peptide is substantially similar in both three-dimensional shape and biological activity to a collagen peptide described herein and preferably comprises a spatial arrangement of reactive chemical moieties that closely resembles the three-dimensional arrangement of active groups in the peptide sequence. Examples of structurally modified peptides include pseudo-peptides, semi-peptides and peptoids.
Collagen peptides or polypeptides as described herein may be structurally modified to include one or more non-peptidyl bonds, for example pseudopeptide bonds. A number of suitable pseudopeptide bonds are known in the art, including retro-inverso pseudopeptide bonds (“Biologically active retroinverso analogues of thymopentin”, Sisto A. et al in Rivier, J. E. and Marshall, G. R. (eds) “Peptides, Chemistry, Structure and Biology”, Escom, Leiden (1990), pp. 722-773) and Dalpozzo, et al. (1993), Int. J. Peptide Protein Res., 41:561-566), reduced isostere pseudopeptide bonds (Couder, et al. (1993), Int. J. Peptide Protein Res., 41:181-184), ketomethylene and methylsulfide bonds.
Collagen peptides or polypeptides comprising pseudopeptide bonds may have an identical amino acid sequence to the sequence described above, except that one or more of the peptide bonds are replaced by a pseudopeptide bond. In some embodiments, the most N-terminal peptide bond is substituted, since such a substitution will confer resistance to proteolysis by exopeptidases acting on the N-terminus. Further modifications also can be made by replacing chemical groups of the amino acids with other chemical groups of similar structure.
Collagen peptides or polypeptides as described herein may be structurally modified to eliminate peptide bonds. Suitable structurally modified peptides include peptoids (Simon, et al., 1992, Proc. Natl. Acad. Sci. USA, 89:9367-9371), which are oligomers of N-substituted glycines. The N-alkyl group of each glycine residue corresponds to the side chain of a natural amino acid. Some or all of the amino acids of a peptide may be replaced with the N-substituted glycine corresponding to the replaced amino acid.
Collagen peptides or polypeptides as described herein may be structurally modified to comprise one or more D-amino acids. For example, a peptide may be an enantiomer in which one or more L-amino acid residues in the amino acid sequence of the peptide is replaced with the corresponding D-amino acid residue or a reverse-D peptide, which is a peptide consisting of D-amino acids arranged in a reverse order as compared to the L-amino acid sequence described above. (Smith C. S. et al., Drug Development Res., 15, pp. 371-379 (1988).
Methods of producing suitable structurally modified peptides are well known in the art.
A collagen peptide or polypeptide as described herein may be linked to a coupling partner, e.g. an effector molecule, a label, a marker, a drug, a toxin and/or a carrier or transport molecule, and/or a targeting molecule such as an antibody or binding fragment thereof or other ligand. Techniques for coupling peptides to both peptidyl and non-peptidyl coupling partners are well-known in the art.
For example, a collagen peptide or polypeptide may be conjugated to an active agent which exerts a biological effect, such as a pharmaceutical agent. A suitable pharmaceutical agent may produce a therapeutic effect on a disease condition. For example, a collagen peptide may be conjugated to a pharmaceutical agent which alters the activation and/or differentiation of an osteoclast-associated receptor (OSCAR) expressing cell. Exemplary pharmaceutical agents capable of altering the activation and/or differentiation of an OSCAR expressing cell include adjuvants, chemokines, cytokines e.g. RANKL, osteoprotegrin (OPG), fluorescent dyes, recombinant enzymes and proteins or protein fusions.
In some embodiments, a collagen peptide or peptidyl trimer may be attached or coated on to a solid surface or insoluble support. Methods for fixing peptides or polypeptides to insoluble supports are known to those skilled in the art. For example, collagen peptides or peptidyl trimers may be immobilised on the surface of a culture vessel. A culture vessel with a collagen peptide or trimer immobilised on its surface may be useful for culturing cells which express osteoclast-associated receptors (OSCAR).
Suitable culture vessels are well known in the art and include tissue culture plates, for example multi-well tissue culture plates such as 48- or 96-well plates.
A culture vessel with immobilised collagen peptides or peptidyl trimers may, for example, be useful in a method of screening for modulators of osteoclast-associated receptor (OSCAR) expressing cell differentiation and/or activity.
Culture vessels with immobilised collagen peptides or peptidyl trimers may be provided as part of a kit. In addition to culture vessels, such kits may comprise reagents for characterizing OSCAR expressing cells. For example, osteoclasts can be characterised by reagents suitable for detection of tartrate resistant acid phosphatase (TRAP). Reagents suitable for detecting tartrate resistant acid phosphatase (TRAP) are well known in the art and are commercially available (e.g. TRAP-staining kit #386A-1KT Sigma-Aldrich).
Collagen peptides and peptidyl trimers as described herein may also be useful in a method of treatment. For example, a collagen peptide may be used in a method of treating a bone defect or a disorder characterized by altered differentiation and/or activation of an osteoclast-associated receptor (OSCAR) expressing cell.
A collagen peptide or peptidyl trimer may also be useful in the manufacture of a medicament for the treatment of a bone defect or a disorder characterized by altered differentiation and/or activation of an osteoclast-associated receptor (OSCAR) expressing cell.
A method of treating a disorder characterized by altered differentiation and/or activation of an OSCAR expressing cell may comprise administering a collagen peptide or peptidyl trimer to an individual in need thereof.
Disorders characterized by altered differentiation and/or activation of an osteoclast-associated receptor (OSCAR) expressing cell include: osteopetrosis, primary bone cancer, secondary bone cancer, osteoporosis, rheumatoid arthritis, acute myeloid leukaemia, multiple myeloma, osteoarthritis and other osteolytic diseases.
In some preferred embodiments, collagen peptides or peptidyl trimers described herein may be useful in the treatment of disorders characterized by altered differentiation and/or activation of osteoclasts or osteoclast precursor cells, such as osteopetrosis, primary bone cancer, secondary bone cancer, osteoporosis, and rheumatoid arthritis.
For example, collagen peptides or peptidyl trimers described herein may be useful in the treatment of disorders characterized by decreased differentiation and/or activation of osteoclasts or osteoclast precursor cells, such as osteopetrosis, by increasing the differentiation of osteoclast precursor cells and/or increasing the activation of osteoclasts.
Collagen peptides or peptidyl trimers described herein may also be useful in the treatment of disorders characterized by increased differentiation and/or activation of osteoclasts or osteoclast precursor cells, such as primary bone cancer, secondary bone cancer, osteoporosis, and rheumatoid arthritis. Collagen peptides or peptidyl trimers described herein may, for example, decrease the differentiation of osteoclast precursor cells and/or decrease the activation of (mature) osteoclasts by blocking the binding of OSCAR to collagen ligands and reducing OSCAR-mediated cell signalling.
In other embodiments, collagen peptides described herein may be useful in the treatment of disorders characterized by altered differentiation and/or activation of myeloid cells, monocytes, and/or macrophages, such as acute myeloid leukaemia and multiple myeloma. Collagen peptides described herein may, for example, modulate the differentiation and/or activation of these cells.
Collagen peptides or peptidyl trimers described herein may also be useful in the treatment of bone defects. For example, a method of treating a bone defect in an individual may comprise administering a collagen peptide or peptidyl trimer to an individual in need thereof.
The peptide or peptidyl trimer may for example be administered locally at the site of the bone defect by any convenient technique. The peptide or peptidyl trimer increases the recruitment of osteoclasts to the site of bone defect. This recruitment may improve bone turnover and coupling between bone resorption and formation thereby facilitating the repair of bone tissue at the site of bone defect.
A bone defect may be any site at which the structure of the bone is disrupted or damaged. Defects may include cracks, discontinuities, fractures, non-unions or sites of bone implants.
Bone implants are commonly used for a range of medical applications and may include autologous or allopathic bone tissue or implants from artificial materials, such as stainless steel, titanium or ceramic.
In some embodiments, a bone implant may be coated with a peptide or peptidyl trimer as described herein to facilitate bone repair at the site of implantation.
Collagen peptides or peptidyl trimers, as referred to herein, may also be used for modulating differentiation and/or activation of an osteoclast-associated receptor (OSCAR) expressing cell in vitro. For example, a method of modulating differentiation and/or activation of an osteoclast-associated receptor (OSCAR) expressing cell in vitro may comprise:
The collagen peptide or peptidyl trimer modulates differentiation and/or activation of the OSCAR expressing cell.
In some embodiments, the differentiation and/or activation of the OSCAR expressing cell may be increased in the presence of a collagen peptide, compared with the level of differentiation and/or activation in the absence of the collagen peptide.
In other embodiments, the differentiation and/or activation of the OSCAR expressing cell may be decreased in the presence of a collagen peptide or peptidyl trimer, compared with the level of differentiation and/or activation in the absence of the collagen peptide.
The collagen peptide may be immobilized on a solid support. Conveniently, the solid support may be within a culture vessel for example, a multi-well tissue culture plate, as described above. The differentiation of the OSCAR expressing cell, e.g. an osteoclast precursor cell, may be determined by any convenient technique, for example by staining for tartrate resistant acid phosphatase (TRAP), e.g. using a TRAP-staining kit (SIGMA), as described herein.
The activation of an OSCAR expressing cell may be determined by any convenient technique, for example by determining the level or amount of OSCAR signalling using a suitable reporter cell line. Conveniently, the OSCAR-CD3ξ NFAT-GFP reporter cell line described herein may be used to determine the effect of the collagen peptide on OSCAR signalling in osteoclasts.
Other suitable approaches for determining the differentiation and/or activation of OSCAR expressing cells include: western blotting for the post-translational activation of signalling pathways e.g. phosphorylation, assays for production of proteins induced or downregulated e.g. chemokines or cytokine production by ELISA or flow cytometry (Merck et al 2004, 2005 & 2006), calcium flux experiments (see for example, Merck et al 2004, 2005 & 2006); cellular activation as defined by respiratory burst and production of free oxygen radicals (Merck et al 2006); cell trafficking during receptor-mediated endocytosis or phagocytosis and antigen presentation assays in monocytes, macrophages, neutrophils, dendritic cells or osteoclasts (Merck et al., 2004 & 2005); cell trafficking of collagens in osteoclasts during bone resorption (Nesbitt & Horton, 1997; Stenbeck & Horton 2004); microscopical determination of multinucleation and protein expression in OSCAR expressing cells; RT-PCR for genes induced or down-regulated through activation or differentiation; western blotting determination of proteins induced or down-regulated through activation or differentiation; and northern blotting determination of RNA molecules induced or down-regulated e.g. mRNA, micro RNA induced after activation or differentiation.
Other aspects of the invention relate to methods of screening for modulators, e.g. activators or inhibitors, of collagen-mediated differentiation and/or activation of cells which express osteoclast-associated receptors (OSCAR). Such modulators may, for example, be useful in the development of treatments for disorders characterized by altered differentiation and/or activation of OSCAR expressing cells, as described herein.
Methods of screening for modulators of collagen-mediated differentiation and/or activation of an OSCAR expressing cell may comprise contacting the OSCAR expressing cell with a collagen peptide as described herein in the presence or absence of a test compound and determining the differentiation and/or activation of the cell.
In some embodiments, the collagen peptide may have a positive effect on differentiation and/or activation of the OSCAR expressing cell, in the absence of test compound.
A change in the differentiation and/or activation of the OSCAR expressing cell which is mediated by the collagen peptide in the presence relative to the absence of the test compound is indicative that the test compound is a modulator of differentiation and/or activation.
An increase in collagen-mediated differentiation and/or activation of the OSCAR expressing cell in the presence of the test compound relative to its absence may be indicative that the test compound is an activator of collagen-mediated differentiation and/or activation of the OSCAR expressing cell.
A decreased in collagen-mediated differentiation and/or activation of the OSCAR expressing cell in the presence of the test compound relative to its absence may be indicative that the test compound inhibits or blocks collagen-mediated differentiation and/or activation of the OSCAR expressing cell. For example, a inhibitory compound may inhibit or block the binding of the collagen peptide to OSCAR.
The differentiation and/or activation of an OSCAR expressing cell may be determine as described above.
Suitable test compounds which may be screened using the methods described herein may be natural or synthetic chemical compounds used in drug screening programmes. Extracts of plants, microbes or other organisms which contain several characterised or uncharacterised components may also be used.
Combinatorial library technology provides an efficient way of testing a potentially vast number of different compounds for ability to modulate an interaction. Such libraries and their use are known in the art, for all manner of natural products, small molecules and peptides, among others. The use of peptide libraries may be preferred in certain circumstances.
The amount of test compound or compounds which may be added to a method of the invention will normally be determined by trial and error depending upon the type of compound used. Typically, from about 0.001 nM to 1 mM or more of putative inhibitor compound may be used, for example from 0.01 nM to 10004, e.g. 0.1 to 5004, such as about 1004.
Suitable test compounds for screening include compounds known to modulate differentiation and/or activation of OSCAR expressing cells. Such compounds include collagen peptides as described herein, TNF-family members (e.g. TNF, TRAIL etc.), RANKL, osteoprotegrin (OPG), M-CSF, GM-CSF, Interleukins: IL-1, IL-4, IL-6 family (e.g. IL-6, IL-11, Leukaemia inhibitory factor, oncostatin M etc.), IL-7, IL-8, IL-10, IL-12, IL-15, IL-17, IL-23 (Lorenzo and Choi, 2008), toll-like receptor (TLR) ligands and other inflammatory mediators e.g. LPS and anti-inflammatory mediators e.g. TGF-Beta and IL-10.
Suitable test compounds also include analogues, derivatives, variants and mimetics of any of the compounds listed above, for example compounds produced using rational drug design to provide test candidate compounds with particular molecular shape, size and charge characteristics suitable for modulating differentiation and/or activation of OSCAR expressing cells.
A test compound may be isolated and/or purified or alternatively, it may be synthesised using conventional techniques of recombinant expression or chemical synthesis. Furthermore, it may be manufactured and/or used in preparation, i.e. manufacture or formulation, of a composition such as a medicament, pharmaceutical composition or drug. These may be administered to individuals for the treatment of a disorder characterized by altered osteoclast differentiation and/or activation, as described herein, or for preventing or delaying the onset of such a disorder. Methods described herein may thus comprise formulating the test compound in a pharmaceutical composition with a pharmaceutically acceptable excipient, vehicle or carrier for therapeutic application, as discussed further below.
Following identification of a compound which modulates the collagen-mediated differentiation and/or activation of an osteoclast-associated receptor (OSCAR) expressing cell, a method may further comprise modifying the compound to optimise its pharmaceutical properties.
The modification of a ‘lead’ compound identified as biologically active is a known approach to the development of pharmaceuticals and may be desirable where the active compound is difficult or expensive to synthesise or where it is unsuitable for a particular method of administration, e.g. peptides are not well suited as active agents for oral compositions as they tend to be quickly degraded by proteases in the alimentary canal. Modification of a known active compound (for example, to produce a mimetic) may be used to avoid randomly screening large number of molecules for a target property.
Modification of a ‘lead’ compound to optimise its pharmaceutical properties commonly comprises several steps. Firstly, the particular parts of the compound that are critical and/or important in determining the target property are determined. In the case of a peptide, this can be done by systematically varying the amino acid residues in the peptide, e.g. by substituting each residue in turn. These parts or residues constituting the active region of the compound are known as its “pharmacophore”.
Once the pharmacophore has been found, its structure is modelled according to its physical properties, e.g. stereochemistry, bonding, size and/or charge, using data from a range of sources, e.g. spectroscopic techniques, X-ray diffraction data and NMR.
Computational analysis, similarity mapping (which models the charge, hydrophobicity/hydrophilicity and/or volume of a pharmacophore, rather than the bonding between atoms) and other techniques can be used in this modelling process.
In a variant of this approach, the three-dimensional structure of the compound which modulates differentiation and/or activation of an osteoclast-associated receptor (OSCAR) expressing cell is modelled. This can be especially useful where the compound changes conformation, allowing the model to take account of this in the optimisation of the lead compound.
A template molecule is then selected, onto which chemical groups that mimic the pharmacophore can be grafted. The template molecule and the chemical groups grafted on to it can conveniently be selected so that the modified compound is easy to synthesise, is likely to be pharmacologically acceptable, and does not degrade in vivo, while retaining the biological activity of the lead compound. The modified compounds found by this approach can then be screened to see whether they have the target property, or to what extent they exhibit it. Modified compounds include mimetics of the lead compound.
Further optimisation or modification can then be carried out to arrive at one or more final compounds for in vivo or clinical testing.
A compound identified and/or obtained using the present methods may be formulated into a pharmaceutical composition as described elsewhere herein.
While it is possible for an active compound such as a collagen peptide to be administered alone, it is preferable to present it as a pharmaceutical composition (e.g. formulation) comprising a collagen peptide, together with one or more pharmaceutically acceptable carriers, adjuvants, excipients, diluents, fillers, buffers, stabilisers, preservatives, lubricants, or other materials well known to those skilled in the art.
For example, a pharmaceutical composition may comprise a collagen peptide and a pharmaceutically acceptable excipient.
In addition, a pharmaceutical composition may comprise one or more additional active agents, including for example a pharmaceutical agent capable of modulating activation and/or differentiation of an OSCAR expressing cell.
For example, a pharmaceutical composition may comprise a collagen peptide, a pharmaceutical agent capable of activation and/or differentiation of an osteoclast-associated receptor (OSCAR) expressing cell, and a pharmaceutically acceptable excipient.
Pharmaceutical compositions comprising a collagen peptide or trimer as described herein, for example, admixed or formulated together with one or more pharmaceutically acceptable carriers, excipients, buffers, adjuvants, stabilisers, or other materials, as described herein, may be used in the methods described herein.
The term “pharmaceutically acceptable” as used herein pertains to compounds, materials, compositions, and/or dosage forms which are, within the scope of sound medical judgement, suitable for use in contact with the tissues of a subject (e.g., human) without excessive toxicity, irritation, allergic response, or other problem or complication, commensurate with a reasonable benefit/risk ratio (an acceptably high chemotherapeutic index). Each carrier, excipient, etc. must also be “acceptable” in the sense of being compatible with the other ingredients of the formulation.
Suitable carriers, excipients, etc. can be found in standard pharmaceutical texts, for example, Remington's Pharmaceutical Sciences, 21st edition, Mack Publishing Company, Easton, Pa., 2005.
The formulations may conveniently be presented in unit dosage form and may be prepared by any methods well-known in the art of pharmacy. Such methods include the step of bringing the active compound into association with a carrier which may constitute one or more accessory ingredients. In general, the formulations are prepared by uniformly and intimately bringing into association the active compound with liquid carriers or finely divided solid carriers or both, and then if necessary shaping the product.
Formulations may be in the form of liquids, solutions, suspensions, emulsions, elixirs, syrups, tablets, lozenges, granules, powders, capsules, cachets, pills, ampoules, suppositories, pessaries, ointments, gels, pastes, creams, sprays, mists, foams, lotions, oils, boluses, electuaries, or aerosols.
The collagen peptide or trimer or pharmaceutical composition comprising the collagen peptide or trimer may be administered to a subject by any convenient route of administration, whether systemically/peripherally or at the site of desired action, including but not limited to, oral (e.g. by ingestion); topical (including e.g. transdermal, intranasal, ocular, buccal, and sublingual); pulmonary (e.g. by inhalation or insufflation therapy using, e.g. an aerosol, e.g. through mouth or nose); parenteral, for example, by injection, including subcutaneous, intradermal, intramuscular, intravenous, intraarterial, intracardiac, intrathecal, intraspinal, intracapsular, subcapsular, intraorbital, intraperitoneal, intratracheal, subcuticular, intraarticular, subarachnoid, and intrasternal; by implant of a depot, for example, subcutaneously or intramuscularly; or by non-absorbable enteric slow release.
Pharmaceutical compositions suitable for oral administration may be in tablet, powder liquid, solution, suspension, emulsion, syrup, or capsule form. A tablet may include a solid carrier such as gelatin or an adjuvant. Liquid pharmaceutical compositions generally include a liquid carrier such as water, petroleum, animal or vegetable oils, mineral oil or synthetic oil. Physiological saline solution, dextrose or other saccharide solution or glycols such as ethylene glycol, propylene glycol or polyethylene glycol may be included.
Formulations suitable for parenteral administration include aqueous and non-aqueous isotonic, pyrogen-free, sterile injection solutions which may contain anti-oxidants, buffers, preservatives, stabilisers, bacteriostats, and solutes which render the formulation isotonic with the blood of the intended recipient; and aqueous and non-aqueous sterile suspensions which may include suspending agents and thickening agents, and liposomes or other microparticulate systems which are designed to target the compound to blood components or one or more organs. Examples of suitable isotonic vehicles for use in such formulations include Sodium Chloride Injection, Ringer's Solution, or Lactated Ringer's Injection. Typically, the concentration of the active compound in the solution is from about 1 ng/ml to about 10 μg/ml, for example, from about 10 ng/ml to about 1 μg/ml. The formulations may be presented in unit-dose or multi-dose sealed containers, for example, ampoules and vials, and may be stored in a freeze-dried (lyophilised) condition requiring only the addition of the sterile liquid carrier, for example water for injections, immediately prior to use.
Examples of techniques and protocols mentioned above can be found in Remington's Pharmaceutical Sciences, 21st edition, Mack Publishing Company, Easton, Pa., 2005.
It will be appreciated that appropriate dosages of the collagen peptide or trimer can vary from patient to patient. Determining the optimal dosage will generally involve the balancing of the level of diagnostic benefit against any risk or deleterious side effects of the administration. The selected dosage level will depend on a variety of factors including, but not limited to, the route of administration, the time of administration, the rate of excretion of the collagen peptide, other drugs, compounds, and/or materials used in combination, and the age, sex, weight, condition, general health, and prior medical history of the patient. The amount of synthetic collagen peptide or trimer and route of administration will ultimately be at the discretion of the physician, although generally the dosage will be to achieve concentrations of the collagen peptide or trimer at a lesion site without causing substantial harmful or deleterious side-effects.
Administration in vivo can be effected in one dose, continuously or intermittently (e.g., in divided doses at appropriate intervals). Methods of determining the most effective means and dosage of administration are well known to those of skill in the art and will vary with the formulation used for therapy, the purpose of the therapy, the target cell being treated, and the subject being treated. Single or multiple administrations can be carried out with the dose level and pattern being selected by the physician.
The collagen peptide, trimer or composition comprising a collagen peptide or trimer may be administered in a localised manner to a desired site or may be delivered in a manner in which it targets particular cells or tissues. For example, it may be administered directly to a tissue comprising OSCAR expressing cells.
Various further aspects and embodiments of the present invention will be apparent to those skilled in the art in view of the present disclosure. All documents and database entries mentioned in this specification are incorporated herein by reference in their entirety.
In the amino acid sequences set out herein, O denotes a hydroxyproline residue.
“and/or” where used herein is to be taken as specific disclosure of each of the two specified features or components with or without the other. For example “A and/or B” is to be taken as specific disclosure of each of (i) A, (ii) B and (iii) A and B, just as if each is set out individually herein.
Unless context dictates otherwise, the descriptions and definitions of the features set out above are not limited to any particular aspect or embodiment of the invention and apply equally to all aspects and embodiments which are described.
Certain aspects and embodiments of the invention will now be illustrated by way of example and with reference to the figures and tables described above.
The sequences of peptides used in this study are shown in Tables 1, 2 and 3. Peptides were synthesized by Fmoc (N-(9-fluorenyl)methoxycarbonyl) chemistry as C-terminal amides on TentaGel R RAM resin in an Applied Biosystems Pioneer automated synthesizer and purified as described (Merck et al 2004). All peptides were verified by mass spectrometry and shown to adopt triple-helical conformation by polarimetry. Briefly, The host-guest strategy (Arase H et al Science. 2002. 296(5571):1323-6) was applied, as in our previous studies (Raynal N, et al J Biol. Chem. 2006. 281(7):3821-31), where the guest (primary) sequence of interest is placed between (GPP)5 hosts, inert flanking sequences, that impart triple-helical conformation on the whole peptide. Each Toolkit peptide contains a guest sequence of 27 amino acids, the C-terminal 9 amino acids of which form the first 9 guest amino acids of the next peptide. Thus, the guest sequence of the Toolkit advances 18 amino acids along the triple-helical domains of type-II and -III collagen with each successive peptide, and a 9-amino-acid overlap is included between adjacent peptides.
Solid Phase Binding Assays 10 ug/ml of different collagens, proteins and peptides were resuspended in 0.01M Acetic-acid and immobilised overnight in Maxisorp 96-well ELISA plates (Nunc) at 4 degrees. Excess protein was then washed off and wells were blocked in 5% BSA in Tyrodes buffer+0.05% Tween (Ty-T) for 1 hour at room temperature (RT). The block was then removed and 100 μl purified Fc-fusion proteins (5 μg/ml) were incubated for 1 hour at RT. Fc-fusions were washed 5 times with 200 μl Ty-T, before detection with 100 μl goat anti-human-HRP conjugate (Sigma) diluted 1:10,000 in Ty-T for 1 hour at RT. Wells were then washed a further 5 times before development with peroxidise substrate+H2O2 (Pierce). Reactions were stopped with 2M H2SO4 before being read by a plate reader at 450 nm.
Fc-fusion proteins were pre-incubated with either 2.5 μg/ml anti-OSCAR mAb 11.1CN5 (Beckman coulter) or an IgG1 isotype-matched control mAb (Dako) for 1 hour at RT prior assessment of collagen-binding activity by ELISA. RBL-2H3 cells were incubated with 2.5 μg/ml anti-OSCAR mAb 11.1CN5 or an IgG1 isotype-matched control mAb before binding to 5 μg/ml type-I collagen-FITC before analysis by flow cytometry.
Bone marrow was flushed from the femur and tibia of C57/B6 mice and adherent bone marrow stromal cells (BMS) were cultured in α-MEM supplemented with 10% foetal calf serum (FCS) and 100 U/ml Penicillin and streptomycin. Calvarial osteoblasts (OB) were isolated from the calvariae of neonatal pups using standard procedures and cultured in DMEM supplemented with 10% foetal calf serum (FCS), 100 U/ml Penicillin and streptomycin, 100n/ml ascorbate, 10−8M vitamin 1,25-(OH)2D3 and 10−6M prostaglandin E2 (ref). mOSCAR-Fc and hOSCAR-Fc binding to CD45-BMS and OB was assessed before and after collagenase treatment (30 minutes at 37° C.) by flow cytometry. Fc-fusion proteins were detected using goat-anti human IgG-PE (Southern biotechnologies).
2B4 NFAT-GFP reporter cells were a kind gift from Lewis Lanier (Arase et al., Science. 2002. 296(5571):1323-6). The extracellular domain of human OSCAR was cloned into pDISPLAY, a construct which encodes an N-terminal HA tag and the transmembrane domain of the PDGF receptor (Invitrogen). The N-terminal tagged OSCAR and PDGFR transmembrane domain were then subcloned in frame with the cytoplasmic tail of the human CD3ξ chain encoded in the pMx puro retroviral vector. Phoenix cells were transfected with the resulting pMx puro OSCAR-CD3ξ construct and resulting virus was used to infect 2B4 NFAT-GFP reporter cells before selection single clones with 2.5 μg/mlpuromycin. In OSCAR-CD3ξ reporter cell assays, tissue culture plates were coated overnight with different proteins and peptides in 0.01M acetic acid at 4° C. Excess proteins and peptides were washed 3 times with PBS and blocked for 1 hour in RPMI-1640 supplemented with 100 U/ml penicillin and streptomycin and 10% FCS before addition of OSCAR-CD3ξ reporter cells.
48-well or 96-well tissue culture plates were coated with 10 μg/ml of different proteins and peptides in 0.01M acetic-acid overnight at 4° C. Excess protein and peptides were washed with three times with PBS before blocking in complete medium. Murine bone marrow was flushed from the tibias and fibias of 2-3 week old mice. Bone marrow was incubated overnight to removed adherent stromal cells and the non-adherent fraction (free of stromal cells and osteoblasts) was removed and cultured as bone marrow macrophages (BMM) for 3 days in 100 ng/mlmurine M-CSF prior to osteoclast differentiation with 10 ng/ml M-CSF and either 30 ng/ml or 100 ng/ml murine RANK-L in coated tissue culture plates. Human osteoclasts were derived from healthy donors or from frozen PBMC from Nasu-Hakola (NH) patients deficient in TREM2 (patient ‘NH2’) or DAP12-deficient (patient ‘NH6’). Peripheral blood monocytes were initially cultured as monocyte-derived dendritic cells in IL-4 and GM-CSF before differentiating into osteoclasts with 30 ng/ml human M-CSF and 100 ng/ml human RANK-L (Peprotech). Giant multi-nucleated osteoclasts were fixed with 4% paraformaldehyde before staining for tartrate resistant acid phosphatase (TRAP) with a TRAP-staining kit (Sigma).
Total RNA was isolated from murine osteoclast cultures incubated in the presence of BSA or OSCAR-binding triple-helical collagen peptides and reverse-transcribed into cDNA using superscript-III (Invitrogen). The following primers were used in RT-PCR to assess expression of murine osteoclast-specific genes; Cathepsin-K, 5′-GCAGTATAACAGCAAGGTGG-3′ and 5′-TTCATCCTGGCCCACATATG-3′; Matrix metalloproteinase-9,5′-TATCTGTATGGTCGTGGCTC-3′ and 5′-CAAGTCGAATCTCCAGACAC-3′; Calcitonin receptor, 5′-AGGAGGTCCAGAGTGAAAAG-3′ and 5′-TCTGGCAGCTAAGGTTCTTG-3′; Integrin αV, 5′-CAACGAAGCCTTAGCAA-GAC-3′ and 5′-ATTCCACAGCCCAAAGTGTG-3′; A disintegrin and metalloproteinase domain 8,5′-TGAATGCAAGGTGAAGCCAG-3′ and 5′-GTAGACGCTGCTTGTTCATC-3′; Glyceraldehyde-3-phosphate dehydrogenase, 5′-AAGGGCTCATGACCACAGTC-3′ and 5′-GGCCCCTCCTGTTATTATGG-3′; and OSCAR, 5′-ACTGCTGGTAACGGATCAGC-3′ and 5′-TCCAAGGAGCCAGAA-CCTTC-3′.
To search for an OSCAR ligand, we initially screened the ability of different extracellular matrix proteins to bind human OSCAR-Fc fusion protein by ELISA (FIGS. 1-6). Human OSCAR-Fc bound strongly to plates coated with collagens I, II and III, weakly to collagen IV and not at all to collagen V (FIGS. 1 & 2) or to the extracellular matrix proteins vitronectin or fibronectin (FIG. 3). Human OSCAR-Fc did not bind appreciably to triple-helical peptide ligands for known collagen receptors, such as integrin α2β1 (‘GFOGER’ and peptide derivatives) or the ligand for GpVI, monomeric collagen related peptide (mCRP), providing indication that OSCAR has a distinct and specific collagen-binding motif (FIGS. 1 & 2). In contrast to gpVI, N-glycosylation had no effect on the collagen binding activity of human OSCAR-Fc (FIG. 20). Pre-incubation of OSCAR-Fc with the anti-human OSCAR mAb 11.1CN5 abolished binding of human OSCAR-Fc to collagens I, II and III, whereas an isotype matched control antibody had no effect (FIG. 4).
In addition, type-I Collagen-FITC bound to RBL-2H3 cells stably expressing human OSCAR, but not to untransfected RBL-2H3 (FIG. 5). Type-I collagen-FITC binding was inhibited by pre-incubation of human OSCAR expressing RBL-2H3 cell with blocking anti-human OSCAR mAb 11.1 CN5 (FIG. 5). Collagenase treatment removed the putative OSCAR ligand from murine bone marrow stromal cells and from murine calvarial osteoblasts activated with prostaglandin-E2 and Vitamin D3 (FIG. 6).
To establish a sequence-specific binding site for human OSCAR, the human OSCAR-Fc protein was screened against a library of overlapping triple-helical peptides encompassing the entire type-II and type-III collagen sequences (Tables 1 and 2).
OSCAR-Fc specifically bound to several peptides from the Toolkits II and -III. Alignment of the six Toolkit peptides that bound most strongly to OSCAR-Fc is shown in Table 4, from which a consensus OSCAR-binding motif was deduced (Table 5). To test the specificity of this interaction, we synthesized derivatives of peptide 111-36 encompassing the two halves of 111-36 containing the amino-acid sequence ‘GPOGPAGFOGAO’ (underlined) which conforms to the predicted OSCAR-binding motif. We also synthesized peptides trimmed to this putative minimal OSCAR binding motif, and performed an Alanine scan through the x and x′ position of the Gxx′ polymer (sequences of III-36 peptide and these derivatives are shown in Table 3). These peptides were used to assess the specificity of human OSCAR-Fc binding, and demonstrated a crucial role for the side chains of hydroxyproline at position (P) 3 and phenylalanine at P8 (FIG. 7). Additional amino-acid substitutions allowed us to explore the determinants of binding of this motif to human OSCAR-Fc (FIG. 8). We found that truncation of the C-terminal triplet (GAO) from the putative motif did not impair binding, leading the establishment of GxOGPx'GFO as a minimal OCP sequence. It is interesting that Phe is a determinant of OSCAR-binding, as also occurs with integrins, DDR2 and SPARC (osteonectin), but not GpVI or LAIR-1. This bulky, aromatic sidechain appears to offer a generic means of attachment to other proteins, but it can be substituted with Tyr, Asp or Ser (but not Pro or Glu) without loss of OSCAR-binding capacity. This might be explained if OSCAR interacted with collagen through an Arg-Phe or Arg-Tyr cation-π bond, so that alternatively, OSCAR Arg might interact with Asp or Ser by electrostatic or hydrogen bonding. Replacement of the N-terminal x residue with polar amino acids, Lys, Glu or Gln impairs binding, as does the insertion of the charged Asp (but not Arg) adjacent to F in the C-terminal triplet. These data, shown in FIG. 8, are consistent with a largely non-polar binding trench on OSCAR, from which triple-helices are excluded if they contain bulky or polar sidechains at their N-terminus.
A human OSCAR-CD3ξ NFAT-GFP reporter cell-line was used to assess whether the OSCAR-binding collagen peptides (OCPs) identified above could transduce intracellular signals. GFP was expressed when OSCAR-CD3ξ NFAT-GFP reporter cells were plated onto tissue culture plates coated with collagens-I, -II, -III and -IV and to plates coated with the majority of OCPs recognised by human OSCAR-Fc, but not plates coated with BSA or (GPP)10 (FIGS. 9 and 10). Weak GFP expression was observed when OSCAR-CD3ξ NFAT-GFP reporter cells were cultured on plates coated collagen-V or with triple-helical peptides that did not bind appreciably to human OSCAR-Fc by ELISA (FIGS. 9 and 10).
The hOSCAR-CD3ξ NFAT-GFP reporter cell-line was also screened against the collagen-II and collagen-III overlapping homotrimeric collagen peptide libraries (FIGS. 11 and 12). Signalling generally paralleled that of OSCAR-Fc binding, although there were some exceptions to this. The reasons for the imprecise fit between binding and activation signalling are not known. They may relate to threshold or sensitivity differences between the two assays e.g. addition of 0.05% Tween-20 in ELISA or the dimeric nature of OSCAR-Fc. Although repeatable, the differences are not substantive. These results show that OSCAR binds to a sequence-specific collagen motif and OSCAR recognition of this motif can induce intracellular signalling.
Given the costimulatory effect of OSCAR and FcRγ on osteoclastogenesis, it was tested whether OCPs that induces OSCAR signalling would also enhance osteoclastogenesis.
OCPs enhanced in vitro osteoclastogenesis of human peripheral blood monocytes after 7 days culture with RANKL in wells coated with the OCPs, (GPP)5-GPOGPAGFOGAO-(GPP)5 and (GPP)5-GAOGPAGFA-(GPP)5, compared to wells coated with BSA-, (GPP)10-, or the control triple-helical peptide (GPP)5-GLOGPSGEO-(GPP)5 (FIG. 13).
This enhanced osteoclastogenesis was inhibited when the same OC cultures were treated with blocking mAb 11.1 CN5 but not an isotype control mAb to MHC class I, showing that this effect was specific to the OSCAR/OCP interaction (FIG. 14). Examples of the giant TRAP+ multinuclear cells generated under these conditions are shown in FIG. 15
The costimulatory effect of plate-bound OCP also promoted the in vitro osteoclastogenesis of wild-type mouse BMMs (FIG. 16), but was not observed with cultures from OSCAR-deficient (OSCAR−/−) BMM or with cultures from FcRγ−/− BMMs (FIG. 15), the adaptor through which OSCAR is known to signal.
Remarkably, OCPs rescued the in vitro osteoclastogenic defect in OC cultures from murine DAP12−/− BMMs (FIG. 16) but not BMM from FcRγ−/−DAP12−/− mice, which did not develop OCs under any of the culture conditions analysed. The giant multinuclear DAP12−/− cells rescued by OCP stained for TRAP (FIG. 17A), formed actin rings (FIG. 17B), and expressed OC-specific genes, such as cathepsin K, calcitonin receptor, integrin αV, a disintegrin and metalloproteinase domain 8 (ADAMS), matrix metalloproteinase 9 (MMP9) and OSCAR by RT-PCR, compared to BM cells treated with M-CSF for 3 days in the absence of RANK-L.
To show definitively that the OCP-mediated rescue of DAP 12-deficient cells was specifically due to OSCAR, and not another collagen binding receptor, we generated OSCAR−/−DAP 12−/− mice and compared the rate of osteoclastogenesis to OSCAR+/+DAP12−/− littermates in the presence or absence of OCP. OSCAR+/+DAP12+/+ littermates displayed enhanced osteoclastogenesis in a similar fashion to wild-type CSBL/6 and 129 mice. Similarly to DAP12−/− cells, OSCAR+/+DAP12−/− precursors developed giant TRAP+ multinuclear cells in the presence of OCP, whereas OSCAR−/−DAP12−/− did not develop OC, similar to FcRγ−/−DAP12−/− cells.
To show that this effect was OSCAR-specific and not due to an unidentified collagen binding receptor, we retrovirally transduced OSCAR−/−DAP12−/− BMM with OSCAR and included DAP12, as a positive control, and backbone empty pMx vector, as a negative control. Retroviral transduction of DAP12 restored osteoclastogenesis in all conditions tested, as expected (FIGS. 18 & 19), whereas control transduction with the backbone pMx retroviral vector did not (FIG. 19). Retroviral transduction with mouse OSCAR rescued osteoclastogenesis in OCP-coated wells, but not OVA- or BSA-coated wells (FIGS. 18 & 19), showing the rescue of DAP12−/− cells was due to the OSCAR/OCP interaction. Giant TRAP+ multinuclear cells also developed in (GPP)10-coated wells but to a lesser extent. These results occurred because of retroviral overexpression of murine OSCAR, since NFAT-GFP reporter cells retrovirally transduced with mouse OSCAR express GFP after incubation in wells coated with (GPP)10. This also occurred upon retroviral transduction of both the ‘long’ signal peptide (SP-L) isoform of mouse OSCAR (FIG. 18) or the ‘short’ signal peptide isoform (SP—S), showing this effect was due to retroviral overexpression and not the differences present in the murine OSCAR isoforms expressed. It is notable that neither DAP12−/− (FIG. 16) or OSCAR+/+DAP12−/− cells, which express endogenous RANKL-induced OSCAR, do not form giant TRAP+ multinucleated cells in plates coated with (GPP)10 and that this was only exhibited after retroviral transduction of OSCAR in OC and 2B4 NFAT-GFP reporter cells.
We assessed whether OSCAR OCPs could rescue the in vitro osteoclastogenic defect in cultures of peripheral blood monocytes from Nasu-Hakola (NH) patients supplemented with M-CSF and RANKL from either TREM2-(FIG. 20 RHS) and DAP12-deficient (FIG. 20 LHS)NH patients. Giant TRAP+ multinuclear cells developed from monocytes isolated from both TREM2-deficient (NH2) and DAP12-deficient (NH6) NH patients in OCP-coated wells, but not in wells coated with BSA or (GPP)10 (FIG. 21).
We also assessed whether soluble triple-helical OSCAR-binding peptides would block the binding of human OSCAR-Fc binding to immobilised triple-helical peptides. FIG. 24 shows that soluble triple-helical peptides can block OSCAR-Fc binding to the same immobilised peptide. This shows soluble triple-helical peptides can be used to block OSCAR binding, and therefore signalling, in vitro or in vivo.
Triple-helical conformation of the OSCAR-binding motif was shown to be essential for signalling by determining the responses of the human and murine OSCAR-CD3Zeta NFAT-GFP reporter cell-lines to: immobilised BSA; a linear peptide containing the minimal OSCAR-binding sequence ‘GPOGPAGFO’ (GPCGPOGPAGFOGPC-NH2, Mass=1,341.54 Da); and a triple-helical peptide designed to the minimal OSCAR-binding sequence ‘(GPP)5-GPOGPAGFO-(GPP)5’ (GPC(GPP)5-GPOGPAGFO-(GPP)5GPC-NH2, Mass=3,854.42 Da). The linear and triple-helical status of these peptides was confirmed by polarimetry.
The results are shown in FIG. 25. Both the human and murine OSCARCD3Zeta NFAT-GFP reporter cell-lines were found to express GFP only in response to the triple-helical conformation of the minimal OSCAR-binding sequence. This confirms that, like the triple-helical conformation of native collagen, only triple-helical peptides containing an OSCAR-binding motif are recognised by OSCAR and not a linear motif.
The above data demonstrate that OSCAR binds to a specific collagen signature to promote osteoclastogenesis by a DAP12-independent pathway. Elucidation of the OSCAR:collagen pathway has important implications, not just for the alternative pathways of osteoclastogenesis that may be operating in TREM2- and DAP12-deficient osteoporotic pathologies, such as Nasu-Hakola disease, but also for understanding the molecular signals promoting osteoclastogenesis, and hence bone resorption, operating within the Bone Remodelling Compartment (BRC). The OSCAR:collagen axis, in conjunction with RANKL, may deliver costimulatory extracellular matrix signals that would drive osteoclastogenesis specifically on remodelling bone surfaces as defined by the expression of these ligands within the BRC. We show above that OSCAR can specifically bind to collagen II and induce signalling. OSCAR may therefore be a versatile collagen receptor that can recognise different types of collagens to sense the nature of the extracellular matrix environment to promote osteoclastogenesis.
Human OSCAR is widely expressed amongst haematopoietic cells, where it may serve other roles. OSCAR may also contribute to altered leukocyte function when collagens are exposed to the circulation, for example in the recruitment of macrophages to atherosclerotic lesions, or in other inflammatory compartments.
| TABLE 1 | |||
| SEQ | |||
| Mass | ID | ||
| # | Peptide Sequence | (Da) | NO: |
| 1 | GPC-(GPP)5- | 5558 | 40 |
| GPMGPMGPRGPOGPAGAOGPQGFQGNO-(GPP)5- | |||
| GPC-NH2 | |||
| 2 | GPC-(GPP)5- | 5648 | 41 |
| GPQGFQGNOGEOGEOGVSGPMGPRGPO-(GPP)5- | |||
| GPC-NH2 | |||
| 3 | GPC-(GPP)5- | 5572 | 42 |
| GPMGPRGPOGPOGKOGDDGEAGKOGKA-(GPP)5- | |||
| GPC-NH2 | |||
| 4 | GPC-(GPP)5- | 5621 | 43 |
| GEAGKOGKAGERGPOGPQGARGFOGTO-(GPP)5- | |||
| GPC-NH2 | |||
| 5 | GPC-(GPP)5- | 5710 | 44 |
| GARGFOGTOGLOGVKGHRGYOGLDGAK-(GPP)5- | |||
| GPC-NH2 | |||
| 6 | GPC-(GPP)5- | 5533 | 45 |
| GYOGLDGAKGEAGAOGVKGESGSOGEN-(GPP)5- | |||
| GPC-NH2 | |||
| 7 | GPC-(GPP)5- | 5668 | 46 |
| GESGSOGENGSOGPMGPRGLOGERGRT-(GPP)5- | |||
| GPC-NH2 | |||
| 8 | GPC-(GPP)5- | 5503 | 47 |
| GLOGERGRTGPAGAAGARGNDGQOGPA-(GPP)5- | |||
| GPC-NH2 | |||
| 9 | GPC-(GPP)5- | 5385 | 48 |
| GNDGQOGPAGPOGPVGPAGGOGFOGAO-(GPP)5- | |||
| GPC-NH2 | |||
| 10 | GPC-(GPP)5- | 5423 | 49 |
| GGOGFOGAOGAKGEAGPTGARGPEGAQ-(GPP)5- | |||
| GPC-NH2 | |||
| 11 | GPC-(GPP)5- | 5447 | 50 |
| GARGPEGAQGPRGEOGTOGSOGPAGAS-(GPP)5- | |||
| GPC-NH2 | |||
| 12 | GPC-(GPP)5- | 5295 | 51 |
| GSOGPAGASGNOGTDGIOGAKGSAGAO-(GPP)5- | |||
| GPC-NH2 | |||
| 13 | GPC-(GPP)5- | 5417 | 52 |
| GAKGSAGAOGIAGAOGFOGPRGPOGPQ-(GPP)5- | |||
| GPC-NH2 | |||
| 14 | GPC-(GPP)5- | 5510 | 53 |
| GPRGPOGPQGATGPLGPKGQTGEOGIA-(GPP)5- | |||
| GPC-NH2 | |||
| 15 | GPC-(GPP)5- | 5607 | 54 |
| GQTGEOGIAGFKGEQGPKGEOGPAGPQ-(GPP)5- | |||
| GPC-NH2 | |||
| 16 | GPC-(GPP)5- | 5558 | 55 |
| GEOGPAGPQGAOGPAGEEGKRGARGEO-(GPP)5- | |||
| GPC-NH2 | |||
| 17 | GPC-(GPP)5- | 5628 | 56 |
| GKRGARGEOGGVGPIGPOGERGAOGNR-(GPP)5- | |||
| GPC-NH2 | |||
| 18 | GPC-(GPP)5- | 5680 | 57 |
| GERGAOGNRGFOGQDGLAGPKGAOGER-(GPP)5- | |||
| GPC-NH2 | |||
| 19 | GPC-(GPP)5- | 5529 | 58 |
| GPKGAOGERGPSGLAGPKGANGDOGRO-(GPP)5- | |||
| GPC-NH2 | |||
| 20 | GPC-(GPP)5- | 5606 | 59 |
| GANGDOGROGEOGLOGARGLTGROGDA-(GPP)5- | |||
| GPC-NH2 | |||
| 21 | GPC-(GPP)5- | 5562 | 60 |
| GLTGROGDAGPQGKVGPSGAOGEDGRO-(GPP)5- | |||
| GPC-NH2 | |||
| 22 | GPC-(GPP)5- | 5650 | 61 |
| GAOGEDGROGPOGPQGARGQOGVMGFO-(GPP)5- | |||
| GPC-NH2 | |||
| 23 | GPC-(GPP)5- | 5625 | 62 |
| GQOGVMGFOGPKGANGEOGKAGEKGLO-(GPP)5- | |||
| GPC-NH2 | |||
| 24 | GPC-(GPP)5- | 5536 | 63 |
| GKAGEKGLOGAOGLRGLOGKDGETGAA-(GPP)5- | |||
| GPC-NH2 | |||
| 25 | GPC-(GPP)5- | 5447 | 64 |
| GKDGETGAAGPOGPAGPAGERGEQGAO-(GPP)5- | |||
| GPC-NH2 | |||
| 26 | GPC-(GPP)5- | 5577 | 65 |
| GERGEQGAOGPSGFQGLOGPOGPOGEG-(GPP)5- | |||
| GPC-NH2 | |||
| 27 | GPC-(GPP)5- | 5458 | 66 |
| GPOGPOGEGGKOGDQGVOGEAGAOGLV-(GPP)5- | |||
| GPC-NH2 | |||
| 28 | GPC-(GPP)5- | 5638 | 67 |
| GEAGAOGLVGPRGERGFOGERGSOGAQ-(GPP)5- | |||
| GPC-NH2 | |||
| 29 | GPC-(GPP)5- | 5917 | 68 |
| GERGSOGAQGLQGPRGLOGTOGTDGPK-(GPP)5- | |||
| GPC-NH2 | |||
| 30 | GPC-(GPP)5- | 5401 | 69 |
| GTOGTDGPKGASGPAGPOGAQGPOGLQ-(GPP)5- | |||
| GPC-NH2 | |||
| 31 | GPC-(GPP)5- | 5561 | 70 |
| GAQGPOGLQGMOGERGAAGIAGPKGDR-(GPP)5- | |||
| GPC-NH2 | |||
| 32 | GPC-(GPP)5- | 5525 | 71 |
| GIAGPKGDRGDVGEKGPEGAOGKDGGR-(GPP)5- | |||
| GPC-NH2 | |||
| 33 | GPC-(GPP)5- | 5444 | 72 |
| GAOGKDGGRGLTGPIGPOGPAGANGEK-(GPP)5- | |||
| GPC-NH2 | |||
| 34 | GPC-(GPP)5- | 5344 | 73 |
| GPAGANGEKGEVGPOGPAGSAGARGAO-(GPP)5- | |||
| GPC-NH2 | |||
| 35 | GPC-(GPP)5- | 5450 | 74 |
| GSAGARGAOGERGETGPOGPAGFAGPO-(GPP)5- | |||
| GPC-NH2 | |||
| 36 | GPC-(GPP)5- | 5495 | 75 |
| GPAGFAGPOGADGQOGAKGEQGEAGQK-(GPP)5- | |||
| GPC-NH2 | |||
| 37 | GPC-(GPP)5- | 76 | |
| GEQGEAGQKGDAGAOGPQGPSGAOGPQ-(GPP)5- | |||
| GPC-NH2 | |||
| D | GPC-(GPP)5- | 5475 | 77 |
| 37 | GEQGEAGQKGEAGAOGPQGPSGAOGPQ-(GPP)5- | ||
| E | GPC-NH2 | ||
| 38 | GPC-(GPP)5- | 5412 | 78 |
| GPSGAOGPQGPTGVTGPKGARGAQGPO-(GPP)5- | |||
| GPC-NH2 | |||
| 39 | GPC-(GPP)5- | 5436 | 79 |
| GARGAQGPOGATGFOGAAGRVGPOGSN-(GPP)5- | |||
| GPC-NH2 | |||
| 40 | GPC-(GPP)5- | 5525 | 80 |
| GRVGPOGSNGNOGPOGPOGPSGKDGPK-(GPP)5- | |||
| GPC-NH2 | |||
| 41 | GPC-(GPP)5- | 5561 | 81 |
| GPSGKDGPKGARGDSGPOGRAGEOGLQ-(GPP)5- | |||
| GPC-NH2 | |||
| 42 | GPC-(GPP)5- | 5561 | 82 |
| GRAGEOGLQGPAGPOGEKGEOGDDGPS-(GPP)5- | |||
| GPC-NH2 | |||
| 43 | GPC-(GPP)5- | 5531 | 83 |
| GEOGDDGPSGAEGPOGPQGLAGQRGIV-(GPP)5- | |||
| GPC-NH2 | |||
| 44 | GPC-(GPP)5- | 5705 | 84 |
| GLAGQRGIVGLOGQRGERGFOGLOGPS-(GPP)5- | |||
| GPC-NH2 | |||
| 45 | GPC-(GPP)5- | 5551 | 85 |
| GFOGLOGPSGEOGKQGAOGASGDRGPO-(GPP)5- | |||
| GPC-NH2 | |||
| 46 | GPC-(GPP)5- | 5514 | 86 |
| GASGDRGPOGPVGPOGLTGPAGEOGRE-(GPP)5- | |||
| GPC-NH2 | |||
| 47 | GPC-(GPP)5- | 5491 | 87 |
| GPAGEOGREGSOGADGPOGRDGAAGVK-(GPP)5- | |||
| GPC-NH2 | |||
| 48 | GPC-(GPP)5- | 5449 | 88 |
| GRDGAAGVKGDRGETGAVGAOGAOGPO-(GPP)5- | |||
| GPC-NH2 | |||
| 49 | GPC-(GPP)5- | 5431 | 89 |
| GAOGAOGPOGSOGPAGPTGKQGDRGEA-(GPP)5- | |||
| GPC-NH2 | |||
| 50 | GPC-(GPP)5- | 5534 | 90 |
| GKQGDRGEAGAQGPMGPSGPAGARGIQ-(GPP)5- | |||
| GPC-NH2 | |||
| 51 | GPC-(GPP)5- | 5644 | 91 |
| GPAGARGIQGPQGPRGDKGEAGEOGER-(GPP)5- | |||
| GPC-NH2 | |||
| 52 | GPC-(GPP)5- | 5746 | 92 |
| GEAGEOGERGLKGHRGFTGLQGLOGPO-(GPP)5- | |||
| GPC-NH2 | |||
| 53 | GPC-(GPP)5- | 5427 | 93 |
| GLQGLOGPOGPSGDQGASGPAGPSGPR-(GPP)5- | |||
| GPC-NH2 | |||
| 54 | GPC-(GPP)5-GPAGPSGPRGPOGPVGPSGKDGAN | 5409 | 94 |
| GIO-(GPP)5-GPC-NH2 | |||
| 55 | GPC-(GPP)5-GKDGANGIOGPIGPOGPRGRSGET | 5528 | 95 |
| GPA-(GPP)5-GPC-NH2 | |||
| 56 | GPC-(GPP)5- | 5521 | 96 |
| GPRGRSGETGPAGPOGNOGPOGPOGPO-(GPP)5- | |||
| GPC-NH2 | |||
| TABLE 2 | ||||
| Mass | Melting | |||
| # | Peptide Sequence | (Da) | Temp(° C.) | SEQ ID NO: |
| 1 | GPC(GPP)5- | 5456 | 41.90 | 97 |
| GLAGYOGPAGPOGPOGPOGTSGHOGSO- | ||||
| (GPP)5GPC-NH2 | ||||
| 2 | GPC(GPP)5- | 5524 | 35.20 | 98 |
| GTSGHOGSOGSOGYQGPOGEOGQAGPS- | ||||
| (GPP)5GPC-NH2 | ||||
| 3 | GPC(GPP)5- | 5383 | 45.80 | 99 |
| GEOGQAGPSGPOGPOGAIGPSGPAGKD- | ||||
| (GPP)5GPC-NH2 | ||||
| 4 | GPC(GPP)5- | 5634 | 43.50 | 100 |
| GPSGPAGKDGESGROGROGERGLOGPO- | ||||
| (GPP)5GPC-NH2 | ||||
| 5 | GPC(GPP)5- | 5728 | 36.50 | 101 |
| GERGLOGPOGIKGPAGIOGFOGMKGHR- | ||||
| (GPP)5GPC-NH2 | ||||
| 6 | GPC(GPP)5- | 5816 | / | 102 |
| GFOGMKGHRGFDGRNGEKGETGAOGLK- | ||||
| (GPP)5GPC-NH2 | ||||
| 7 | GPC(GPP)5- | 5592 | 43.00 | 103 |
| GETGAOGLKGENGLOGENGAOGPMGPR- | ||||
| (GPP)5GPC-NH2 | ||||
| 8 | GPC(GPP)5- | 5558 | 48.60 | 104 |
| GAOGPMGPRGAOGERGROGLOGAAGAR- | ||||
| (GPP)5GPC-NH2 | ||||
| 9 | GPC(GPP)5- | 5474 | 38.80 | 105 |
| GLOGAAGARGNDGARGSDGQOGPOGPO- | ||||
| (GPP)5GPC-NH2 | ||||
| 10 | GPC(GPP)5- | 5448 | 45.70 | 106 |
| GQOGPOGPOGTAGFOGSOGAKGEVGPA- | ||||
| (GPP)5GPC-NH2 | ||||
| 11 | GPC(GPP)5- | 5491 | 35.50 | 107 |
| GAKGEVGPAGSOGSNGAOGQRGEOGPQ- | ||||
| (GPP)5GPC-NH2 | ||||
| 12 | GPC(GPP)5- | 5565 | 45.50 | 108 |
| GQRGEOGPQGHAGAQGPOGPOGINGSO- | ||||
| (GPP)5GPC-NH2 | ||||
| 13 | GPC(GPP)5- | 5464 | 41.50 | 109 |
| GPOGINGSOGGKGEMGPAGIOGAOGLM- | ||||
| (GPP)5GPC-NH2 | ||||
| 14 | GPC(GPP)5- | 5457 | 44.50 | 110 |
| GIOGAOGLMGARGPOGPAGANGAOGLR- | ||||
| (GPP)5GPC-NH2 | ||||
| 15 | GPC(GPP)5- | 5504 | 38.57 | 111 |
| GANGAOGLRGGAGEOGKNGAKGEOGPR- | ||||
| (GPP)5GPC-NH2 | ||||
| 16 | GPC(GPP)5- | 5620 | 39.00 | 112 |
| GAKGEOGPRGERGEAGIOGVOGAKGED- | ||||
| (GPP)5GPC-NH2 | ||||
| 17 | GPC(GPP)5- | 5453 | 38.50 | 113 |
| GVOGAKGEDGKDGSOGEOGANGLOGAA- | ||||
| (GPP)5GPC-NH2 | ||||
| 18 | GPC(GPP)5- | 5490 | 37.00 | 114 |
| GANGLOGAAGERGAOGFRGPAGPNGIO- | ||||
| (GPP)5GPC-NH2 | ||||
| 19 | GPC(GPP)5- | 5480 | 45.00 | 115 |
| GPAGPNGIOGEKGPAGERGAOGPAGPR- | ||||
| (GPP)5GPC-NH2 | ||||
| 20 | GPC(GPP)5- | 5489 | 43.00 | 116 |
| GAOGPAGPRGAAGEOGRDGVOGGOGMR- | ||||
| (GPP)5GPC-NH2 | ||||
| 21 | GPC(GPP)5- | 5496 | 41.00 | 117 |
| GVOGGOGMRGMOGSOGGOGSDGKOGPO- | ||||
| (GPP)5GPC-NH2 | ||||
| 22 | GPC(GPP)5- | 5560 | 41.00 | 118 |
| GSDGKOGPOGSQGESGROGPOGPSGPR- | ||||
| (GPP)5GPC-NH2 | ||||
| 23 | GPC(GPP)5- | 5576 | 46.10 | 119 |
| GPOGPSGPRGQOGVMGFOGPKGNDGAO- | ||||
| (GPP)5GPC-NH2 | ||||
| 24 | GPC(GPP)5- | 5500 | 38.80 | 120 |
| GPKGNDGAOGKNGERGGOGGOGPQGPO- | ||||
| (GPP)5GPC-NH2 | ||||
| 25 | GPC(GPP)5- | 5424 | 49.00 | 121 |
| GGOGPQGPOGKNGETGPQGPOGPTGPG- | ||||
| (GPP)5GPC-NH2 | ||||
| 26 | GPC(GPP)5- | 5483 | 39.00 | 122 |
| GPOGPTGPGGDKGDTGPOGPQGLQGLO- | ||||
| (GPP)5GPC-NH2 | ||||
| 27 | GPC(GPP)5- | 5571 | 44.00 | 123 |
| GPQGLQGLOGTGGPOGENGKOGEOGPK- | ||||
| (GPP)5GPC-NH2 | ||||
| 28 | GPC(GPP)5- | 5376 | 44.49 | 124 |
| GKOGEOGPKGDAGAOGAOGGKGDAGAO- | ||||
| (GPP)5GPC-NH2 | ||||
| 29 | GPC(GPP)5- | 5375 | 45.40 | 125 |
| GGKGDAGAOGERGPOGLAGAOGLRGGA- | ||||
| (GPP)5GPC-NH2 | ||||
| 30 | GPC(GPP)5- | 5324 | 42.90 | 126 |
| GAOGLRGGAGPOGPEGGKGAAGPOGPO- | ||||
| (GPP)5GPC-NH2 | ||||
| 31 | GPC(GPP)5- | 5418 | 46.30 | 127 |
| GAAGPOGPOGAAGTOGLQGMOGERGGL- | ||||
| (GPP)5GPC-NH2 | ||||
| 32 | GPC(GPP)5- | 5525 | 43.20 | 128 |
| GMOGERGGLGSOGPKGDKGEOGGOGAD- | ||||
| (GPP)5GPC-NH2 | ||||
| 33 | GPC(GPP)5- | 5484 | 38.83 | 129 |
| GEOGGOGADGVOGKDGPRGPTGPIGPO- | ||||
| (GPP)5GPC-NH2 | ||||
| 34 | GPC(GPP)5- | 5426 | 46.27 | 130 |
| GPTGPIGPOGPAGQOGDKGEGGAOGLO- | ||||
| (GPP)5GPC-NH2 | ||||
| 35 | GPC(GPP)5- | 5518 | 41.00 | 131 |
| GEGGAOGLOGIAGPRGSOGERGETGPO- | ||||
| (GPP)5GPC-NH2 | ||||
| 36 | GPC(GPP)5- | 5566 | 40.93 | 132 |
| GERGETGPOGPAGFOGAOGQNGEOGGK- | ||||
| (GPP)5GPC-NH2 | ||||
| 37 | GPC(GPP)5- | 5521 | 30.79 | 133 |
| GQNGEOGGKGERGAOGEKGEGGPOGVA- | ||||
| (GPP)5GPC-NH2 | ||||
| 38 | GPC(GPP)5- | 5310 | 42.00 | 134 |
| GEGGPOGVAGPOGGSGPAGPOGPQGVK- | ||||
| (GPP)5GPC-NH2 | ||||
| 39 | GPC(GPP)5- | 5506 | 41.70 | 135 |
| GPOGPQGVKGERGSOGGOGAAGFOGAR- | ||||
| (GPP)5GPC -NH2 | ||||
| 40 | GPC(GPP)5- | 5447 | 42.70 | 136 |
| GAAGFOGARGLOGPOGSNGNOGPOGPS- | ||||
| (GPP)5GPC-NH2 | ||||
| 41 | GPC(GPP)5- | 5400 | 46.00 | 137 |
| GNOGPOGPSGSOGKDGPOGPAGNTGAO- | ||||
| (GPP)5GPC-NH2 | ||||
| 42 | GPC(GPP)5- | 5422 | 37.00 | 138 |
| GPAGNTGAOGSOGVSGPKGDAGQOGEK- | ||||
| (GPP)5GPC-NH2 | ||||
| 43 | GPC(GPP)5- | 5431 | 35.80 | 139 |
| GDAGQOGEKGSOGAQGPOGAOGPLGIA- | ||||
| (GPP)5GPC-NH2 | ||||
| 44 | GPC(GPP)5- | 5470 | 35.90 | 140 |
| GAOGPLGIAGITGARGLAGPOGMOGPR- | ||||
| (GPP)5GPC-NH2 | ||||
| 45 | GPC(GPP)5- | 5561 | 46.70 | 141 |
| GPOGMOGPRGSOGPQGVKGESGKOGAN- | ||||
| (GPP)5GPC-NH2 | ||||
| 46 | GPC(GPP)5- | 5532 | 34.90 | 142 |
| GESGKOGANGLSGERGPOGPQGLOGLA- | ||||
| (GPP)5GPC-NH2 | ||||
| 47 | GPC(GPP)5- | 5535 | 35.92 | 143 |
| GPQGLOGLAGTAGEOGRDGNOGSDGLO- | ||||
| (GPP)5GPC-NH2 | ||||
| 48 | GPC(GPP)5- | 5585 | 33.09 | 144 |
| GNOGSDGLOGRDGSOGGKGDRGENGSO- | ||||
| (GPP)5GPC-NH2 | ||||
| 49 | GPC(GPP)5- | 5466 | 43.50 | 145 |
| GDRGENGSOGAOGAOGHOGPOGPVGPA- | ||||
| (GPP)5GPC-NH2 | ||||
| 50 | GPC(GPP)5- | 5356 | 43.45 | 146 |
| GPOGPVGPAGKSGDRGESGPAGPAGAO- | ||||
| (GPP)5GPC-NH2 | ||||
| 51 | GPC(GPP)5- | 5396 | 49.10 | 147 |
| GPAGPAGAOGPAGSRGAOGPQGPRGDK- | ||||
| (GPP)5GPC-NH2 | ||||
| 52 | GPC(GPP)5- | 5732 | / | 148 |
| GPQGPRGDKGETGERGAAGIKGHRGFO- | ||||
| (GPP)5GPC-NH2 | ||||
| 53 | GPC(GPP)5- | 5573 | 30.47 | 149 |
| GIKGHRGFOGNOGAOGSOGPAGQQGAI- | ||||
| (GPP)5GPC-NH2 | ||||
| 54 | GPC(GPP)5- | 5379 | 47.50 | 150 |
| GPAGQQGAIGSOGPAGPRGPVGPSGPO- | ||||
| (GPP)5GPC-NH2 | ||||
| 55 | GPC(GPP)5- | 5504 | 49.10 | 151 |
| GPVGPSGPOGKDGTSGHOGPIGPOGPR- | ||||
| (GPP)5GPC-NH2 | ||||
| 56 | GPC(GPP)5- | 5695 | 44.10 | 152 |
| GPIGPOGPRGNRGERGSEGSOGHOGQO- | ||||
| (GPP)5GPC-NH2 | ||||
| 57 | GPC(GPP)5- | 5556 | 44.10 | 153 |
| GERGSEGSOGHOGQOGPOGPOGAOGPC- | ||||
| (GPP)5GPC-NH2 | ||||
| GPP10 | GPC(GPP)10GPC-NH2 | 3044 | 48.2 | 154 |
| TABLE 3 | |||
| Mass | SEQ ID | ||
| Code | Peptide Sequence | (Da) | NO: |
| GAOGPAGEAinGPP | GPC(GPP)5GAOGPAGEA(GPP)5GPC-NH2 | 3768 | 155 |
| GKOGPAGFAinGPP | GPC(GPP)5GKOGPAGFA(GPP)5GPC-NH2 | 3843 | 156 |
| GAOGVMGFAinGPP | GPC(GPP)5GAOGVMGFA(GPP)5GPC-NH2 | 3848 | 157 |
| GLOGPSGEOinGPP | GPC(GPP)5GLOGPSGEO(GPP)5GPC-NH2 | 3868 | 158 |
| GFOGLOGPSinGPP | GPC(GPP)5GFOGLOGPS(GPP)5GPC-NH2 | 3886 | 159 |
| GAOGPAGFAGEAin | GPC(GPP)5GAOGPAGFAGEA(GPP)5GPC- | 4043 | 160 |
| GPP | NH2 | ||
| GFOGPAGFAinGPP | GPC(GPP)5GFOGPAGFA(GPP)5GPC-NH2 | 3862 | 161 |
| ColIII-36GPOtoGAO | GPC(GPP)5-GPOGPAGFOGAO-(GPP)5GPC- | 4095.67 | 162 |
| NH2 | |||
| ColIII-36GPOtoGAO- | GPC(GPP)5-GAOGPAGFOGAO-(GPP)5GPC- | 4069.63 | 163 |
| A2 | NH2 | ||
| ColIII-36GPOtoGAO- | GPC(GPP)5-GPOGPAGFAGAO-(GPP)5GPC- | 4053.63 | 164 |
| A9 | NH2 | ||
| GAOGPAGSAinGPP | GPC(GPP)5GAOGPAGSA(GPP)5GPC-NH2 | 3726 | 165 |
| ColIII-36GERtoGQN | GPC(GPP)5- | 5024 | 166 |
| GERGETGPOGPAGFOGAOGQN- | |||
| (GPP)5GPC-NH2 | |||
| ColIII-36GPOtoGGk | GPC(GPP)5- | 4936 | 167 |
| GPOGPAGFOGAOGQNGEOGGK- | |||
| (GPP)5GPC-NH2 | |||
| ColIII-36GPOtoGAO- | GPC(GPP)5-GPOGAAGFOGAO-(GPP)5GPC- | 4069 | 168 |
| A5 | NH2 | ||
| ColIII-36GPOtoGAO- | GPC(GPP)5-GPOGPAGAOGAO-(GPP)5GPC- | 4019 | 169 |
| A8 | NH2 | ||
| ColIII-36GPOtoGAO- | GPC(GPP)5-GPOGPAGFOGAA-(GPP)5GPC- | 4053 | 170 |
| A12 | NH2 | ||
| GAOGPAGFAinGPP | GPC(GPP)-5GAOGPAGFA-(GPP)5GPC-NH2 | 3786 | 171 |
| GAOGAAGFAinGPP | GPC(GPP)5GAOGAAGFA(GPP)5GPC-NH2 | 3760 | 172 |
| GAOGPPGFAinGPP | GPC(GPP)5GAOGPPGFA(GPP)5GPC-NH2 | 3812 | 173 |
| GAOGPOGFAinGPP | GPC(GPP)5GAOGPOGFA(GPP)5GPC-NH2 | 3828 | 174 |
| GAOGPAGFDinGPP | GPC(GPP)5GAOGPAGFD(GPP)5GPC-NH2 | 3754 | 175 |
| GQOGPAGFAinGPP | GPC(GPP)5GQOGPAGFA(GPP)5GPC-NH2 | 3843 | 176 |
| GEOGPAGFAinGPP | GPC(GPP)5GEOGPAGFA(GPP)5GPC-NH2 | 3844 | 177 |
| GAOGPQGFAinGPP | GPC(GPP)5GAOGPQGFA(GPP)5GPC-NH2 | 3843 | 178 |
| GAOGPQGPAinGPP | GPC(GPP)5GAOGQAGPA(GPP)5GPC-NH2 | 3793 | 179 |
| GAOGASGDRinGPP | GPC(GPP)5GAOGASGDR(GPP)5GPC-NH2 | 3829 | 180 |
| GAOGPAGYAinGPP | GPC(GPP)5GAOGPAGYA(GPP)5GPC-NH2 | 3802 | 181 |
| GPP10 | GPC-(GPP)10-GPCG-NH2 | 3044 | 154 |
| TABLE 4 |
| Highest affinity Toolkit peptides: |
| II-1 | GPMGPMGPRGPOGPAGAOGPQGFQGNO | |
| II-26 | GERGEQGAOGPSGFQGLOGPOGPOGEG | |
| II-35 | GSAGARGAOGERGETGPOGPAGFAGPO | |
| II-45 | GFOGLOGPSGEOGKQGAOGASGDRGPO | |
| III-36 | GERGETGPOGPAGFOGAOGQNGEOGGK | |
| III-39 | GPOGPQGVKGERGSOGGOGAAGFOGAR | |
| Consensus: | GxOGPxGFOGxO | |
| TABLE 5 |
| Minimum motif and |
| OSCAR-binding variants: |
| GAOGPAGFA | |
| P AS DR | |
| G SO | |
| YQ | |
| MVLLLILQLSTLCELSLPWPVCHADFTSPVPLASYPKPWLGAHPAAIVTP |
| GINVTLICRAPQPAWGFGLFKTGLATPLLLRNVSIGLAEFFLEKVTSVQE |
| GSYHCRYRKTDWGPGVWSQP |
| SNALELLVTDQLPRPSLVAIPGPVVAPETTVSLRCAGRIPGMSFALYRAD |
| VATPLQYIDSVQPWADFLLNSANAPGTYYCYYHTPSSPYVLSERSQPLVI |
| SSESSGSLDYTQGNLVRLGL |
| AGLVLICLGIIVTFDWHSRRSAFVRLLPQQNWV |
From Rat Genome database (http://rgd.mcw.edu/) weblink to Rat OSCAR (predicted): http://rgd.mcw.edu/tools/genes/genes view.cgi?id=1559897 Ensembl (www.ensembl.org) Gene ID: ENSRNOG00000038776.
1. A method of treating a disorder characterized by altered osteoclast differentiation and/or activation comprising administering an antibody that binds to an osteoclast-associated receptor (OSCAR) to an individual in need thereof.
2. The method of claim 1, wherein the disorder is selected from the group consisting of osteoporosis, primary bone cancer, secondary bone cancer, osteoporosis, rheumatoid arthritis, acute myeloid leukaemia, multiple myeloma, osteoarthritis, and other osteolytic diseases.
3. The method of claim 1, wherein the disorder is rheumatoid arthritis.
4. The method of claim 1, wherein the osteoclast-associated receptor (OSCAR) is a human osteoclast-associated receptor (OSCAR).
5. The method of claim 1, wherein the antibody reduces binding of the osteoclast-associated receptor (OSCAR) to a collagen.
6. The method of claim 5, wherein the collagen is selected from the group consisting of type-I collagen, type-II collagen, and type III collagen.
7. A method of treating rheumatoid arthritis comprising administering an antibody that binds to a human osteoclast-associated receptor (OSCAR) to an individual in need thereof.
8. The method of treating rheumatoid arthritis of claim 7, wherein the antibody reduces binding of the osteoclast-associated receptor (OSCAR) to a collagen.
9. The method of claim 8, wherein the collagen is selected from the group consisting of type-I collagen, type-II collagen, and type III collagen.
10. A method for reducing a binding of an osteoclast-associated receptor (OSCAR) to a collagen comprising:
administering to a subject an antibody that binds to a human osteoclast-associated receptor (OSCAR), and
reducing the binding of the human osteoclast-associated receptor (OSCAR) to a collagen.
11. The method of claim 10, wherein the collagen is selected from the group consisting of type-I collagen, type-II collagen, and type III collagen.