US20140154732A1
2014-06-05
14/173,678
2014-02-05
The invention provides method and compositions to minimize the chlorophyll antenna size of photosynthesis by decreasing TLA1 gene expression, thereby improving solar conversion efficiencies and photosynthetic productivity in plants, e.g., green microalgae, under bright sunlight conditions.
Get notified when new applications in this technology area are published.
C12N15/113 » CPC main
Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor; Recombinant DNA-technology; DNA or RNA fragments; Modified forms thereof Non-coding nucleic acids modulating the expression of genes, e.g. antisense oligonucleotides
C12N15/82 IPC
Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor; Recombinant DNA-technology; Introduction of foreign genetic material using vectors; Vectors; Use of hosts therefor; Regulation of expression; Vectors or expression systems specially adapted for eukaryotic hosts for plant cells, e.g. plant artificial chromosomes (PACs)
This application is a continuation application of U.S. application Ser. No. 12/782,124, filed May 18, 2010, which is a divisional application of U.S. application Ser. No. 11/423,620, filed Jun. 12, 2006, now U.S. Pat. No. 7,745,696, the content of which applications are hereby incorporated by reference in their entirety.
This invention was made with Government support under Grant (Contract) Nos. DE-FC36-00GO10536 and DE-FG36-05GO15041 awarded by the United States Department of Energy. The Government has certain rights in this invention.
This application includes a Sequence Listing as a text file named â79438-899342-SEQLISTING.TXTâ created Feb. 4, 2014, and containing 29,245 bytes, machine format IBM-PC, MS-Windows operating system, which is hereby incorporated by reference in its entirety for all purposes.
Oxygenic photosynthesis depends on the absorption of sunlight by auxiliary light-harvesting pigments, which are incorporated within the holocomplexes of photosystem-I and photosystem-II. In each photosystem (PS), sizable arrays of chlorophylls and other accessory pigments (e.g., carotenoids) act cooperatively as antennae for the collection of light energy and as a conducting medium for excitation migration toward a photochemical reaction center (see, e.g., Emerson & Arnold, J Gen Physiol 15: 391-420, 1932; Emerson & Arnold, J Gen Physiol 16: 191-205, 1933; Gaffron & Wohl, Naturwissenschaften 24: 81-90, 1936; Melis, In, Oxygenic Photosynthesis: The Light Reactionsâ (D R Ort, C F Yocum, eds), Kluwer Academic Publishers, Dordrecht, The Netherlands, pp. 523-538, 1996). Organized as distinct pigment-protein complexes and contained within PSI and PSII, these light-harvesting antennae perform the functions of light absorption and excitation energy transfer to a photochemical reaction center (see, e.g., Simpson and Knoetzel, In: Ort D R and Yocum C F (eds), Oxygenic Photosynthesis: The Light Reactions, pp. 493-506, Kluwer Academic Publishers, Dordrecht, The Netherlands, 1996; Pichersky and Jansson, In: Ort D R and Yocum C F (eds), Oxygenic Photosynthesis: The Light Reactions, pp. 507-521, Kluwer Academic Publishers, Dordrecht, The Netherlands, 1996). Up to 350 chlorophyll a (Chl a) and Chl b molecules can be found in association with PSII, whereas the Chl antenna size of PSI may contain up to 300 mainly Chl a molecules (Melis, Biochim. Biophys. Acta (Reviews on Bioenergetics) 1058: 87-106, 1991; Melis, In, Oxygenic Photosynthesis: The Light Reactionsâ (D R Ort, C F Yocum, eds), Kluwer Academic Publishers, Dordrecht, The Netherlands, pp. 523-538, 1996). Some of these Chl molecules are contained within the PS-core complexes, which are highly conserved in all organisms of oxygenic photosynthesis. The PSII-core complex contains about 37 Chl a molecules, whereas the PSI-core complex contains 95 Chl a molecules (Glick & Melis, Biochim Biophys Acta 934: 151-155, 1988; Jordan et al., Nature 411(6840): 909-917, 2001; Zouni et al., Nature 409: 739-743, 2001; Ruban et al., Nature 421: 648-652, 2003). In green plants and algae, the remaining Chl a and Chl b antenna molecules are organized within 10 peripheral subunits of the so-called auxiliary chlorophyll a-b light-harvesting complex. There are six such subunits for PSII (Lhc b1-b6) and four for PSI (Lhc a1-a4) (Jansson et al., Plant Mol Biol Rep, 10: 242-253, 1992). These peripheral Lhc subunits are not essential for the process of photosynthesis. Indeed, when the chloroplast development is limited, stable assembly of the PSII-core and PSI-core complexes takes place in the absence of any Lhc proteins (Glick & Melis, 1988, supra).
A genetic tendency of photosynthetic organisms to assemble large arrays of light absorbing Chl antenna molecules in their photosystems is a survival strategy and a competitive advantage in the wild, where light is often limiting (Kirk, Light and photosynthesis in aquatic ecosystems, 2nd edn. Cambridge University Press, Cambridge, England, 1994). However, the Chl antenna size of the photosystems is not fixed but can vary substantially depending on developmental, genetic, physiological and even environmental conditions (Melis, 1991, supra). It is recognized in the field that a genetic regulatory mechanism dynamically modulates the Chl antenna size of photosynthesis (Anderson, Annu Rev Plant Physiol 37: 93-136, 1986; Escoubas et al., Proc. Nat. Acad. Sci. 92: 10237-10241, 1995; Melis, 1991 and 1996, both supra; Melis, Intl. J. Hydrogen Energy 27: 1217-1228, 2002; Melis, Chapter 12 in Artificial Photosynthesis: From Basic Biology to Industrial Application, A F Collins and C Critchley (eds.), Wiley-Verlag & Co., pp. 229-240, 2005). For example, the Chl antenna size is adjusted and optimized in response to the light intensity during plant growth (Ley and Mauzerall, Biochim Biophys Acta 680: 95-106, 1982; Sukenik et al., Biochim Biophys Acta 932: 206-215, 1988; Smith et al., Plant Physiol. 93: 1433-1440, 1990; LaRoche et al., Plant Physiol 97: 147-153, 1991; Maxwell et al., Plant Physiol 107: 687-694, 1995; Falbel et al., Plant Physiol. 112: 821-832, 1996; Webb and Melis, Plant Physiol. 107: 885-893, 1995; Ohtsuka et al., Plant Physiol. 113: 137-147, 1997; Tanaka and Melis, Plant Cell Physiol. 38: 17-24, 1997; Masuda et al., Plant Physiol. 128: 603-614, 2002). Physiological and biochemical consequences of the function of this molecular regulatory mechanism for the Chl antenna size are well understood. However, little is known about the genes and proteins and their mode of action in this regulation. The Chl antenna size regulatory mechanism is highly conserved and functions in all organisms of oxygenic and anoxygenic photosynthesis (Anderson, Annu Rev Plant Physiol 37: 93-136, 1986; Nakada et al., J Ferment Bioengin 80: 53-57, 1995; Escoubas et al., Proc. Nat. Acad. Sci. 92: 10237-10241, 1995; Huner et al., Trends in Plant Science, 3: 224-230, 1998; Yakovlev et al., FEBS Lett 512: 129-132, 2002; Masuda et al., Plant Physiol. 128: 603-614, 2002; Masuda et al., Plant Mol. Biol. 51: 757-771, 2003). Thus, identification of the relevant genes and elucidation of the genetic mechanism for the regulation of the Chl antenna size in Chlamydomonas reinhardtii can apply to all photosynthetic organisms.
Although a smaller Chl antenna size may compromise the ability of a plant, e.g., algae, to survive in the wild, in a high-density cultivation environment, a smaller chlorophyll antenna size would help to diminish the over-absorption and wasteful dissipation of excitation energy by the first layer of leaves, cells or chloroplasts, and would also help diminish photoinhibition of photosynthesis at the surface while permitting greater transmittance of light deeper into the culture. Such altered optical properties of the cells would result in greater photosynthetic productivity and enhanced solar conversion efficiency by the high-density culture.
Previous work (Masuda et al. 2003, supra; Polle et al., Planta 217: 49-59, 2003, Melis, 2005, supra) described the isolation of tla1, a Chlamydomonas reinhardtii DNA insertional mutant having a truncated light-harvesting chlorophyll antenna size (Polle et al, 2003, supra). Although these studies identified a mutant that had reduced antenna size, there was no teaching of whether the phenotype was associated with increased or suppressed tla1 expression. Accordingly, there is a need for further elucidation of mechanism of Tla1-mediated changes in chlorophyll antenna size.
The current invention is based on the discovery that suppression of Tla1 expression results in reduced chlorophyll antenna size. Thus, in one aspect, the invention provides a method of decreasing chlorophyll antenna size in a plant, e.g., green algae, the method comprising: inhibiting expression of a Tla1 nucleic acid in the plant by introducing into the plant an expression cassette comprising a promoter operably linked to a polynucleotide, or a complement thereof, that specifically hybridizes to a nucleic acid that has at least 70% identity, often at least 80%, 90%, or 95% identity, to at least 200 contiguous nucleotides of a sequence encoding SEQ ID NO:2; and selecting a plant with decreased chlorophyll antenna size compared to a plant in which the expression cassette has not been introduced. The promoter may be inducible or constitutive. In some embodiments the polynucleotide is operably linked to the promoter in the antisense orientation; in other embodiments, the polynucleotide is operably linked to the promoter in the sense orientation.
In some embodiment, the polynucleotide introduced into the plant, e.g., green algae, is an siRNA. In other embodiments, the polynucleotide is an antisense RNA.
The nucleic acid to which the polynucleotide hybridizes can encode a polypeptide of SEQ ID NO:2. In particular embodiments, the nucleic acid is SEQ ID NO:3 or SEQ ID NO:1.
Often the plant, e.g., green algae, into which the nucleic acid is introduced, is selected from Chlamydomonas reinhardtii, Scenedesmus obliquus, Chlorella vulgaris, Botryococcus braunii, Botryococcus sudeticus, Dunaliella salina, or Haematococcus pluvialis.
The invention also provides a plant comprising an expression cassette comprising a polynucleotide, or a complement thereof, that specifically hybridizes to a nucleic acid that has at least 70% percent identity, often at least 80%, 90%, or 95% identity, to at least 200 contiguous nucleotides of a sequence encoding SEQ ID NO:2. In preferred embodiments, the plant is a green algae, e.g., Chlamydomonas reinhardtii, Scenedesmus obliquus, Chlorella vulgaris, Botryococcus braunii, Botryococcus sudeticus, Dunaliella salina, or Haematococcus pluvialis.
The invention additionally provides a method of enhancing yields of photosynthetic productivity under high-density growth conditions, the method comprising cultivating a Tla1-suppressed plant of the invention, e.g., green algae such as Chlamydomonas reinhardtii, Scenedesmus obliquus, Chlorella vulgaris, Botryococcus braunii, Botryococcus sudeticus, Dunaliella salina, or Haematococcus pluvialis, under bright sunlight and high density growth conditions.
Additionally, the invention provides a method of enhancing H2 production, the method comprising suppressing Tla1 gene expression in a green algae, e.g., Chlamydomonas reinhardtii, Scenedesmus obliquus, or Chlorella vulgaris, to be used for H2 production; and cultivating the algae under conditions in which H2 is produced.
The invention further provides a method of enhancing bio-oil or bio-diesel production, the method comprising suppressing Tla1 gene expression in a green algae, e.g., Botryococcus braunii or Botryococcus sudeticus to be used for bio-oil or bio-diesel production; and cultivating the algae under conditions in which bio-oil or bio-diesel is produced.
Further, the invention provides a method of enhancing beta-carotene, lutein or zeaxanthin production, the method comprising suppressing Tla1 gene expression in a green algae, e.g., Dunaliella salina, to be used for beta-carotene, lutein or zeaxanthin production; and cultivating the algae under conditions in which beta-carotene, lutein or zeaxanthin is produced.
In other embodiments, the invention provides a method of enhancing astaxanthin production, the method comprising suppressing Tla1 gene expression in a green algae, e.g., Haematococcus pluvialis, to be used for astaxanthin production; and cultivating the algae under conditions in which astaxanthin is produced.
In another aspect, the invention provides a method of screening for plants, preferably, green algae, that show enhanced yield of photosynthetic productivity, the method comprising: introducing a mutation into a population of plants, e.g., green algae; and screening for inhibition of Tla1 gene expression, wherein inhibition of Tla1 gene expression is determined by measuring the level of Tla1 mRNA or Tla1 protein. Preferably the plants, e.g., green algae, are selected from Chlamydomonas reinhardtii, Scenedesmus obliquus, Chlorella vulgaris, Botryococcus braunii, Botryococcus sudeticus, Dunaliella salina, or Haematococcus pluvialis.
FIG. 1. (A) Map of plasmid pJD67 insertion in the tla1 mutant genomic DNA. There is a single plasmid insert, containing the ARG7.8 gene. An approximately 2.3 kb segment of the 5Ⲡend and 9 base pairs at the 3Ⲡend of the pJD67 were deleted upon plasmid insertion. About 6 kb of C. reinhardtii genomic DNA in the tla1 mutant was also deleted from the site of plasmid insertion. Probes for screening tla1 partial genomic libraries to clone 5â˛- and 3â˛-insert flanking regions are shown by the SalI-SalI and NdeI-NdeI restriction sites on the map. (B) Gene structure of the tla1 mutant and wild type C. reinhardtii in the pJD67 plasmid insertion locus: 104 bp of 5ⲠUTR, a total coding region of 642 bp (coding region of exon 1 with 198 bp and coding region of exon 2 with 444 bp), a single intron of 116 bases and 1.26 kb of 3ⲠUTR, encoding a protein of 213 amino acids.
FIG. 2. Genomic DNA map showing the Tla1 gene structure in: (A) the host CC425 strain, (B) the tla1 mutant, and (C) the Tla1 complementing plasmid containing the ble gene. Note that the tla1-complements will have both the mutant gene shown in (B) and the wild type gene shown in (C). Dotted rectangles denote the promoter region of the Tla1 gene; Small hatched rectangles denote the 5â˛UTR of the Tla1 gene; Long-hatched rectangles denote the 3â˛UTR of the Tla1 gene. Thick black arrows and black lines denote the Tla1 exons and introns, respectively. Primers 1, 2, 3, 4, 5, 6, 7, 8 and 9 were used for PCR analysis and are denoted by small black arrows on the genomic DNA map (see Table 1).
FIG. 3. PCR analysis of wild type and tla1 mutant. The presence of transcripts of the Tla1 gene was tested by RT-PCR with primers from different regions of the Tla1 cDNA. Total RNA was isolated from TBP-grown Chlamydomonas reinhardtii wild type and tla1 mutant cultures. The down stream PCR primer, âprimer 5â was designed from the exon 2 region of the Tla1 gene and were the same for all lanes in this experiment. Lanes 1, 2: upstream primer âprimer 2â was designed from the 5ⲠUTR region (âprimer 2ââGCCTGCCACAACCTCAGACCAAGAGACG (SEQ ID NO:15)); expected product size of 454 bp). Lanes 4-6: upstream primers were designed from the exon 1 region of the Tla1 gene (âprimer 3ââGGGCCCTTCAGCTGCTCCGCTGACCAAACC (SEQ ID NO:10)). Lanes 4, 5: expected product size of 409 bp., Lane 6: genomic DNA was isolated from the tla1 mutant and used as a template for the PCR reaction; expected product size of 525 bp, i.e., larger than those of lanes 4, 5, due to the presence of a 116 bp intron, existing between exons 1 and 2. The 1.5% agarose gel was also loaded with M markers (Lane 3) containing a 1 kb DNA ladder (Promega, Madison, Wis.). The PCR products in lane 4 and 5 aligned at the 396 bp marker. The PCR products in lane 6 aligned at a position slightly higher than the 506-517 bp markers.
FIG. 4. 5ⲠRACE DNA sequence analysis of wild type (cw15) and tla1 mutant and sequence comparison with the 3Ⲡend of pJD67. Upper panel: DNA sequence obtained from the 5ⲠRACE of the wild type (SEQ ID NO:16). Unshaded nucleotides represent the 5ⲠUTR of the cDNA sequence amplified from the WT-Tla1 gene transcripts. The ATG start codon is denoted in bold characters. Exon 1 nucleotides are shown in shaded upper case characters. Middle panel: DNA sequence obtained from the 5ⲠRACE of the tla1 mutant (SEQ ID NO:17). The underlined lower case letters represent the apparent 5ⲠUTR sequence amplified from the tla1 mutant. Exon 1 nucleotide sequences are shown in shaded upper case characters. Lower panel: 3Ⲡend DNA sequence of plasmid pJD67 (SEQ ID NO:18). Shaded upper case characters correspond to the DNA sequence of the ARG7.8 gene, whereas lower case characters correspond to the 3Ⲡend of the vector sequence. Rearrangements in that portion of the plasmid are shown in bold characters, as follows: the last 9 plasmid bases âa t t a a a g c tâ were deleted during the plasmid insertion.
FIG. 5. Mapping of BAC clone 39e16 and subcloning of full length Tla1 gene for tla1 mutant complementation experiments. Southern blot analysis of the DNA from BAC clone 39e16 and subsequent DNA sequencing of subclones provided information on size and locus of a 3.7 kb Apa I-Apa I DNA fragment and a 3 kb Pst I-Pst I fragment. The 2 kb overlapping segment of the Pst I-Pst I fragment was removed. The remainder Pst I-Pst I piece was ligated onto the Apa I-Apa I DNA fragment and cloned in pBluescript to yield the 4.7 kb full length Tla1 gene on a single plasmid for use in complementation experiments.
FIG. 6. TAP-Agar plate showing wild type (WT), tla1 mutant and complemented strains of the latter. Mutant strains were complemented with a copy of the wild type Tla1 gene. The phenotype of the tla1 mutant showed a faint green coloration, indicative of the low-level chlorophyll concentration in the cells, whereas the WT and putative complements 1, 2 and 3 were of about the same dark green coloration, indicating a greater Chl/cell.
FIG. 7. PCR analysis using genomic DNA of wild type and tla1 complements. (A) PCR product of 593 bp obtained with âprimer 1â and âprimer 4â (Tla1 promoter/Exon-2) primers. (B) PCR product of 684 bp obtained with âprimer 7â and âprimer 4â (pJD67 3â˛end/Tla1 Exon-2) primers. (C) PCR product of 436 bp obtained with âprimer 8â and âprimer 9â (Ble gene) primers. (D) PCR product of 939 bp obtained with âprimer 1â and âprimer 6â (Tla1 promoter/3â˛UTR) primers. (E) RT-PCR analysis of tla1 complements. PCR product of 823 bp obtained when âprimer 1â and âprimer 6â (Tla1 5â˛UTR/3â˛UTR) specific primers were used. â0â, âWâ, âTâ, â1â, â2â and âSâ stand for zero DNA, wild type, tla1 mutant, tla1-comp1, tla1-comp2 and pSP124s plasmid containing the Ble gene, respectively.
FIG. 8. Overexpression and purification of recombinant Tla1 protein. A 12.5% SDS-PAGE gel stained with Coomassie blue showing: (A) Un-induced (lane 1) and induced (lane 2) E. coli cells expressing the recombinant 6*His-Tla1 protein. 20 Îźg of total E. coli cell protein extracts were loaded on each lane. âMâ denotes unstained Benchmark low molecular weight markers. (B) Purified 6*His-Tla1 protein fractions (lanes 1 and 2). 35 Îźg of purified recombinant protein was loaded in each lane. âMâ denotes the Benchmark pre-stained low molecular weight markers
FIG. 9. Immune serum titer and Tla1 protein immuno-detection in wild type and tla1 mutant. (A) A Western blot of isolated recombinant Tla1 protein (6*His-Tla1), probed with Tla1-specific antibodies. Lanes 1, 2 and 3 contain 20 ng, 20 pg and 2 pg of purified recombinant Tla1 protein, respectively. (B) SDS-PAGE stained with Coomassie blue showing the total protein profile of wild type (W) and tla1 mutant (T) of C. reinhardtii. Lanes were loaded on an equal-Chl basis (6 nmol Chl per lane). âMâ stands for the Benchmark pre-stained low molecular weight markers. (C) Western blot analysis of wild type (W) and tla1 (T) total cell protein extracts from C. reinhardtii, probed with Tla1-specific polyclonal antibodies. Lanes were loaded on an equal-Chl basis (6 nmol Chl per lane).
FIG. 10. SDS-PAGE and Western blot analysis of wild type, tla1 mutant and tla1 complemented strains. (A) SDS-PAGE of C. reinhardtii total cell protein extracts from wild type (W), tla1 mutant (T), and tla1 complements comp1 (lane 1) and comp2 (lane 2). Lanes were loaded on an equal-Chl basis (4 nmol Chl per lane). âMâ stands for the unstained Benchmark low molecular weight markers. (B) Western blot analysis of C. reinhardtii total cell protein extracts from wild type (W), tla1 mutant (T), and tla1 complements, tla1-comp1 (lane 1) and tla1-comp2 (lane 2), probed with Tla1-specific polyclonal antibodies.
FIG. 11. Hydropathy plot of the Tla1 deduced amino acid sequence. The X-axis plots the 213 amino acids of the Tla1 protein, whereas the Y-axis plots the respective amino acid hydropathy index. Positive hydropathy index corresponds to hydrophobic domains of the protein whereas a negative hydropathy index corresponds to hydrophilic polypeptide domains.
FIG. 12. (A) Alignment of Tla1-like proteins from different organisms. The alignment of the Tla1 deduced amino acid sequence of C. reinhardtii is compared to that of similar proteins from A. thaliana (SEQ ID NO:19), O. sativa (SEQ ID NO:20), H. sapiens CGI 112 protein (SEQ ID NO:21), and D. melanogaster (SEQ ID NO:22). Four polypeptide domains with high sequence conservation can be deduced from this comparison. The alignment was done on the basis of the ClustalW web-based software (http://www.ch.embnet.org/software/ClustalW.html). (B) Phylogenetic comparison of putative Tla1 homologue proteins encoded by genes from a variety of organisms. The phylogenetic tree of the above-shown proteins was based on the deduced amino acid sequences ((http://www.ebi.ac.uk/clustalw).
FIG. 13 shows an alignment of Tla1 protein sequences (SEQ ID NOs:20, 23, 19 and 2) in plants and algae. Conserved domains in C. reinhardtii Tla1 protein=SEQ ID NOs:24-28.
The terms ânucleic acidâ and âpolynucleotideâ are used synonymously and refer to a single or double-stranded polymer of deoxyribonucleotide or ribonucleotide bases read from the 5Ⲡto the 3Ⲡend. A nucleic acid of the present invention will generally contain phosphodiester bonds, although in some cases, nucleic acid analogs may be used that may have alternate backbones, comprising, e.g., phosphoramidate, phosphorothioate, phosphorodithioate, or O-methylphophoroamidite linkages (see Eckstein, Oligonucleotides and Analogues: A Practical Approach, Oxford University Press); and peptide nucleic acid backbones and linkages. Other analog nucleic acids include those with positive backbones; non-ionic backbones, and non-ribose backbones. Thus, nucleic acids or polynucleotides may also include modified nucleotides, that permit correct read through by a polymerase. âPolynucleotide sequenceâ or ânucleic acid sequenceâ may include both the sense and antisense strands of a nucleic acid as either individual single strands or in a duplex. As will be appreciated by those in the art, the depiction of a single strand also defines the sequence of the complementary strand; thus the sequences described herein also provide the complement of the sequence. Unless otherwise indicated, a particular nucleic acid sequence also implicitly encompasses conservatively modified variants thereof (e.g., degenerate codon substitutions) and complementary sequences, as well as the sequence explicitly indicated. The nucleic acid may be DNA, both genomic and cDNA, RNA or a hybrid, where the nucleic acid may contain combinations of deoxyribo- and ribo-nucleotides, and combinations of bases, including uracil, adenine, thymine, cytosine, guanine, inosine, xanthine hypoxanthine, isocytosine, isoguanine, etc
The phrase ânucleic acid sequence encodingâ refers to a nucleic acid that codes for an amino acid sequence of at least 5 contiguous amino acids within one reading frame. The amino acid need not necessarily be expressed when introduced into a cell or other expression system, but may merely be determinable based on the genetic code. For example, the sequence ATGATGGAGCATCAT (SEQ ID NO:29) encodes MMEHH (SEQ ID NO:30). Thus, a polynucleotide may encode a polypeptide sequence that comprises a stop codon or contains a changed frame so long as at least 5 contiguous amino acids within one reading frame. The nucleic acid sequences may include both the DNA strand sequence that is transcribed into RNA and the RNA sequence. The nucleic acid sequences include both the full length nucleic acid sequences as well as fragments from the full length sequences. It should be further understood that the sequence includes the degenerate codons of the native sequence or sequences which may be introduced to provide codon preference in a specific host cell.
The term âpromoterâ or âregulatory elementâ refers to a region or sequence determinants located upstream or downstream from the start of transcription that are involved in recognition and binding of RNA polymerase and other proteins to initiate transcription. A âplant promoterâ is a promoter capable of initiating transcription in plant cells. Such promoters need not be of plant origin, for example, promoters derived from plant viruses, such as the CaMV35S promoter, can be used in the present invention.
As used herein, the term âalgal regulatory elementâ or âalgae promoterâ refers to a nucleotide sequence that, when operatively linked to a nucleic acid molecule, confers e expression upon the operatively linked nucleic acid molecule in unicellular green algae. It is understood that limited modifications can be made without destroying the biological function of a regulatory element and that such limited modifications can result in algal regulatory elements that have substantially equivalent or enhanced function as compared to a wild type algal regulatory element. These modifications can be deliberate, as through site-directed mutagenesis, or can be accidental such as through mutation in hosts harboring the regulatory element. All such modified nucleotide sequences are included in the definition of an algal regulatory element as long as the ability to confer expression in unicellular green algae is substantially retained.
The term âsuppressedâ or âdecreasedâ encompasses the absence of Tla1 protein in a plant, e.g., algae, as well as protein expression that is present but reduced as compared to the level of Tla1 protein expression in a wild type plant, e.g., algae. The term âsuppressedâ also encompasses an amount of Tla1 protein that is equivalent to wild type levels, but where the protein has a reduced level of activity in comparison to wild type plants. Generally, at least a 20% decrease in Tla1 activity, amount, chlorophyll antenna size or the like is preferred, with at least about 50% or at least about 75% being particularly preferred.
A polynucleotide sequence is âheterologous toâ a second polynucleotide sequence if it originates from a foreign species, or, if from the same species, is modified by human action from its original form. For example, a promoter operably linked to a heterologous coding sequence refers to a coding sequence from a species different from that from which the promoter was derived, or, if from the same species, a coding sequence which is different from any naturally occurring allelic variants.
A âTla1 polynucleotideâ is a nucleic acid sequence substantially similar to SEQ ID NO:1 or SEQ ID NO:3, or that encodes a polypeptide that is substantially similar to SEQ ID NO:2. Tla1 polynucleotides may comprise (or consist of) a region of about 15 to about 3,000 or more nucleotides, sometimes from about 20, or about 50, to about 2,000 nucleotides and sometimes from about 200 to about 600 nucleotides, which hybridizes to SEQ ID NO:1 or SEQ ID NO:3, or the complements thereof, under stringent conditions, or which encodes a Tla1 polypeptide or fragment of at least 15 amino acids thereof. Tla1 polynucleotides can also be identified by their ability to hybridize under low stringency conditions (e.g., TmË40° C.) to nucleic acid probes having the sequence of SEQ ID NO:1 or SEQ ID NO:3. Such Tla1 nucleic acid sequence can have, e.g., about 25-30% base pair mismatches or less relative to the selected nucleic acid probe. SEQ ID NOs:1 and 3 are exemplary Tla1 polynucleotide sequences. The term âTla1 polynucleotideâ encompasses antisense as well as sense nucleic acids.
A âTla1 polypeptideâ is an amino acid sequence that is substantially similar to SEQ ID NO:2, or a fragment or domain thereof. A full-length Tla1 protein is 213 amino acids. The majority of the amino acid residues are hydrophilic, suggesting that it is a soluble cytosolic protein. A single hydrophobic domain is present. The domain comprises 27 amino acids between residues 42 and 69 (with reference to SEQ ID NO:2). The hydrophobic domain is highly conserved in diverse organisms.
As used herein, a homolog or ortholog of a particular Tla1 gene (e.g., SEQ ID NO:1) is a second gene in the same plant type or in a different plant type, which has a polynucleotide sequence of at least 50 contiguous nucleotides which are substantially identical (determined as described below) to a sequence in the first gene. It is believed that, in general, homologs or orthologs share a common evolutionary past.
An âexpression cassetteâ refers to a nucleic acid construct, which when introduced into a host cell, results in transcription and/or translation of a RNA or polypeptide, respectively. Antisense constructs or sense constructs that are not or cannot be translated are expressly included by this definition.
In the case of both expression of transgenes and inhibition of endogenous genes (e.g., by antisense, or sense suppression) one of skill will recognize that the inserted polynucleotide sequence need not be identical and may be âsubstantially identicalâ to a sequence of the gene from which it was derived. As explained below, these variants are specifically covered by this term.
In the case where the inserted polynucleotide sequence is transcribed and translated to produce a functional polypeptide, one of skill will recognize that because of codon degeneracy a number of polynucleotide sequences will encode the same polypeptide. These variants are specifically covered by the term âpolynucleotide sequence fromâ a Tla1 gene. In addition, the term specifically includes sequences (e.g., full length sequences) substantially identical (determined as described below) with a Tla1 gene sequence. A âpolynucleotide sequence fromâ a Tla1 gene can encode a protein that retains the function of a Tla1 polypeptide in contributing to chlorophyll antenna size.
In the case of polynucleotides used to inhibit expression of an endogenous gene, the introduced sequence need not be perfectly identical to a sequence of the target endogenous gene. The introduced polynucleotide sequence will typically be at least substantially identical (as determined below) to the target endogenous sequence. Thus, an introduced âpolynucleotide sequence fromâ a Tla1 gene may not be identical to the target Tla1 gene to be suppressed, but is functional in that it is capable of inhibiting expression of the target Tla1 gene.
Two nucleic acid sequences or polypeptides are said to be âidenticalâ if the sequence of nucleotides or amino acid residues, respectively, in the two sequences is the same when aligned for maximum correspondence as described below. The term âcomplementary toâ is used herein to mean that the sequence is complementary to all or a portion of a reference polynucleotide sequence.
Optimal alignment of sequences for comparison may be conducted by the local homology algorithm of Smith and Waterman Add. APL. Math. 2:482 (1981), by the homology alignment algorithm of Needle man and Wunsch J. Mol. Biol. 48:443 (1970), by the search for similarity method of Pearson and Lipman Proc. Natl. Acad. Sci. (U.S.A.) 85: 2444 (1988), by computerized implementations of these algorithms (GAP, BESTFIT, BLAST, FASTA, and TFASTA in the Wisconsin Genetics Software Package, Genetics Computer Group (GCG), 575 Science Dr., Madison, Wis.), or by inspection.
âPercentage of sequence identityâ is determined by comparing two optimally aligned sequences over a comparison window, wherein the portion of the polynucleotide sequence in the comparison window may comprise additions or deletions (i.e., gaps) as compared to the reference sequence (which does not comprise additions or deletions) for optimal alignment of the two sequences. The percentage is calculated by determining the number of positions at which the identical nucleic acid base or amino acid residue occurs in both sequences to yield the number of matched positions, dividing the number of matched positions by the total number of positions in the window of comparison and multiplying the result by 100 to yield the percentage of sequence identity.
The term âsubstantial identityâ in the context of polynucleotide sequences means that a polynucleotide comprises a sequence that has at least 50% sequence identity. Alternatively, percent identity can be any integer from 40% to 100%. Exemplary embodiments include at least: 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, or 99%. compared to a reference sequence using the programs described herein; preferably BLAST using standard parameters, as described below. Accordingly, Tla1 sequences of the invention include nucleic acid sequences that have substantial identity to SEQ ID NO:1, or a portion of SEQ ID NO:1 such as the coding region of SEQ ID NO:1, or SEQ ID NO:3.
Tla1 polypeptide sequences of the invention include polypeptide sequences having substantial identify to SEQ ID NO:2. One of skill will recognize that these values can be appropriately adjusted to determine corresponding identity of proteins encoded by two nucleotide sequences by taking into account codon degeneracy, amino acid similarity, reading frame positioning and the like. Substantial identity of amino acid sequences for these purposes normally means sequence identity of at least 50%. Preferred percent identity of polypeptides can be any integer from 50% to 100%, e.g., at least 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, or 99%, an sometimes at least 61%, 62%, 63%, 64%, 65%, 66%, 67%, 68%, 69%, 70%, 71%, 72%, 73%, 74% and 75%. Polypeptides which are âsubstantially similarâ share sequences as noted above except that residue positions which are not identical may differ by conservative amino acid changes. Conservative amino acid substitutions refer to the interchangeability of residues having similar side chains. For example, a group of amino acids having aliphatic side chains is glycine, alanine, valine, leucine, and isoleucine; a group of amino acids having aliphatic-hydroxyl side chains is serine and threonine; a group of amino acids having amide-containing side chains is asparagine and glutamine; a group of amino acids having aromatic side chains is phenylalanine, tyrosine, and tryptophan; a group of amino acids having basic side chains is lysine, arginine, and histidine; and a group of amino acids having sulfur-containing side chains is cysteine and methionine. Preferred conservative amino acids substitution groups are: valine-leucine-isoleucine, phenylalanine-tyrosine, lysine-arginine, alanine-valine, aspartic acid-glutamic acid, and asparagine-glutamine.
Another indication that nucleotide sequences are substantially identical is if two molecules hybridize to each other, or a third nucleic acid, under stringent conditions. Stringent conditions are sequence dependent and will be different in different circumstances. Generally, stringent conditions are selected to be about 5° C. lower than the thermal melting point (Tm) for the specific sequence at a defined ionic strength and pH. The Tm is the temperature (under defined ionic strength and pH) at which 50% of the target sequence hybridizes to a perfectly matched probe. Typically, stringent conditions will be those in which the salt concentration is about 0.02 molar at pH 7 and the temperature is at least about 60° C.
In the present invention, mRNA encoded by Tla1 genes of the invention can be identified in Northern blots under stringent conditions using cDNAs of the invention or fragments of at least about 100 nucleotides. For the purposes of this disclosure, stringent conditions for such RNA-DNA hybridizations are those which include at least one wash in 0.2ĂSSC at 63° C. for 20 minutes, or equivalent conditions. Genomic DNA or cDNA comprising genes of the invention can be identified using the same cDNAs (or fragments of at least about 100 nucleotides) under stringent conditions, which for purposes of this disclosure, include at least one wash (usually 2) in 0.2ĂSSC at a temperature of at least about 50° C., usually about 55° C., for 20 minutes, or equivalent conditions.
A Tla1 gene for use in the invention can also be amplified using PCR techniques. For example, a Tla1 gene of the invention may be amplifiable by the primer set: (5ⲠTACGGGAATTTGCGGAACCTC 3Ⲡ(SEQ ID NO:4)) andâ (5ⲠAACACACACCCCGCACT 3Ⲡ(SEQ ID NO:7)).
The term âisolatedâ, when applied to a nucleic acid or protein, denotes that the nucleic acid or protein is essentially free of other cellular components with which it is associated in the natural state. It is preferably in a homogeneous state and may be in either a dry or aqueous solution. Purity and homogeneity are typically determined using analytical chemistry techniques such as polyacrylamide gel electrophoresis or high performance liquid chromatography. A protein which is the predominant species present in a preparation is substantially purified. In particular, an isolated gene is separated from open reading frames which flank the gene and encode a protein other than the gene of interest.
The present invention provides methods of suppressing Tla1 gene expression in plants, e.g., green algae. Plants having suppressed Tla1 gene expression exhibit decreases in the size of chlorophyll antenna. Such plants are useful for many purposes. For example, Tla1 suppression can be used to enhance plant growth and photosynthetic productivity. In embodiments where the plant is a green algae, such Tla1-suppressed plants can be used, e.g., in mass culture for production of various nutrients or pharmaceuticals, for production of H2, for production of lipid/hydrocarbons, for carbon sequestration, for waste-water treatment and aquatic pollution amelioration, for flu gas treatment and atmospheric pollution amelioration, for biomass generation, and for other purposes.
A Tla1 nucleic acid that is targeted for suppression in this invention encodes a Tla1 protein that is substantially similar to SEQ ID NO:2, or a fragment thereof. For example, such Tla1 proteins have one or more conserved domains, designated with reference to SEQ ID NO2: amino acid positions 9-33, amino acid positions 41-70, amino acid positions 75-129, amino acid positions 135-163, or amino acid positions 177-200. Other exemplary plant Tla1-related polynucleotide sequences are from Oryza sativa (Accession No. CX102072), Zea mays (Accession No. EB673149), and Arabidopsis thaliana (Accession No. DR308999). Examples of conserved regions of these proteins are shown in FIG. 13. 1. Other exemplary Tla1-related sequences include those from Solanum tuberosum (potato) (Accession No. CV500710); Gossypium arboreum (Accession No. BG44500); Helianthus annuus (Accession No. BQ967999); Nicotiana tabacum (tobacco) (Accession No. EB678062); Triticum aestivum (wheat) (Accession No. CV065526); Hordeum vulgare (barley) (Accession No. AL504185); and Glycine max (soybean) (Accession No. BM107844).
The invention employs various routine recombinant nucleic acid techniques. Generally, the nomenclature and the laboratory procedures in recombinant DNA technology described below are those well known and commonly employed in the art. Many manuals that provide direction for performing recombinant DNA manipulations are available, e.g., Sambrook & Russell, Molecular Cloning, A Laboratory Manual (3rd Ed, 2001); and Current Protocols in Molecular Biology (Ausubel et al., eds., 1994-1999).
Isolation or generation of Tla1 polynucleotide sequence can be accomplished by a number of techniques. For instance, oligonucleotide probes based on the sequences disclosed here can be used to identify the desired polynucleotide in a cDNA or genomic DNA library from a desired plant species. Such a cDNA or genomic library can then be screened using a probe based upon the sequence of a cloned Tla1 gene, e.g., SEQ ID NO:1 or 3. Probes may be used to hybridize with genomic DNA or cDNA sequences to isolate homologous genes in the same or different plant species.
Alternatively, the nucleic acids of interest can be amplified from nucleic acid samples using amplification techniques. For instance, PCR may be used to amplify the sequences of the genes directly from mRNA, from cDNA, from genomic libraries or cDNA libraries. PCR and other in vitro amplification methods may also be useful, for example, to clone nucleic acid sequences that code for proteins to be expressed, to make nucleic acids to use as probes for detecting the presence of the desired mRNA in samples, for nucleic acid sequencing, or for other purposes.
Appropriate primers and probes for identifying a Tla1 gene from plant cells, e.g., algae, can be generated from comparisons of the sequences provided herein. For a general overview of PCR see PCR Protocols: A Guide to Methods and Applications. (Innis, M, Gelfand, D., Sninsky, J. and White, T., eds.), Academic Press, San Diego (1990). Exemplary primer pairs are: âprimer 1â (5ⲠTACGGGAATTTGCGGAACCTC 3Ⲡ(SEQ ID NO:4)) and âprimer 6â (5ⲠAACACACACCCCGCACT 3Ⲡ(SEQ ID NO:7)) set out in Table 1 hereinbelow. Exemplary amplification reaction conditions are: 20 mM Tris HCl, pH 8.4, 50 mM potassium chloride, 2.5 mM magnesium chloride, 0.25 mM dATP, 0.25 mM dCTP, 0.25 mM dGTP, 0.25 mM dTTP, 0.6 ÎźM primers, and 2.5 units Taq polymerase/PCR reaction. An exemplary thermal cycling program is 94° C. for 3 min., 35 cycles of 95° C. for 45 sec, 55° C.-59° C. for 30 sec, 72° C. for 130 sec, followed by 72° C. for 10 min.
The genus of Tla1 nucleic acid sequences for use in the invention includes genes and gene products identified and characterized by techniques such as hybridization and/or sequence analysis using exemplary nucleic acid sequences, e.g., SEQ ID NOs:1 and 3, and protein sequences, e.g., SEQ ID NO:2.
To use isolated sequences in the above techniques, recombinant DNA vectors suitable for transformation of plant cells, e.g., green algae cells, are prepared. Techniques for transforming a wide variety of higher plant species are well known and described in the technical and scientific literature. See, for example, Weising et al. Ann. Rev. Genet. 22:421-477 (1988). For example, a DNA sequence encoding a sequence to suppress Tla1 expression (described in further detail below), will preferably be combined with transcriptional and other regulatory sequences which will direct the transcription of the sequence from the gene in the intended cells of the transformed plant.
Regulatory sequences include promoters, which may be either constitutive or inducible, or where a higher plant is involved, tissue-specific. For example, a plant promoter fragment may be employed that is constitutive, i.e., it will direct expression of the gene under most environmental conditions and states of cell differentiation. Examples of constitutive promoters include the cauliflower mosaic virus (CaMV) 35S transcription initiation region, the 1â˛- or 2â˛-promoter derived from T-DNA of Agrobacterium tumafaciens, the CaMV 19S promoter; the Figwort mosaic virus promoter; actin promoters, and the nopaline synthase (nos) gene promoter. Other constitutive promoter include promoters such as the Arabidopsis actin gene promoter (see, e.g., Huang (1997) Plant Mol. Biol. 1997 33:125 139); alcohol dehydrogenase (Adh) gene promoters (see, e.g., Millar (1996) Plant Mol. Biol. 31:897 904); ACT11 from Arabidopsis (Huang et al. Plant Mol. Biol. 33:125-139 (1996)), Cat3 promoter from Arabidopsis (Zhong et al., Mol. Gen. Genet. 251:196-203 (1996)), the promoter from the gene encoding stearoyl-acyl carrier protein desaturase from Brassica napus (Solocombe et al. Plant Physiol. 104:1167-1176 (1994)), GPc1 promoter from maize (Martinez et al. J. Mol. Biol 208:551-565 (1989)), Gpc2 promoter from maize (Manjunath et al., Plant Mol. Biol. 33:97-112 (1997)), and other transcription initiation regions from various plant genes known to those of skill. Chimeric regulatory elements, which combine elements from different genes, also can be useful for e expressing a nucleic acid molecule encoding a Tla polynucleotide.
Alternatively, a plant promoter can be used to direct expression of Tla1 nucleic acid under the influence of changing environmental conditions. Examples of environmental conditions that may effect transcription by inducible promoters include anaerobic conditions, elevated temperature, or the presence of light. Plant promoters that are inducible upon exposure to chemicals reagents, such as herbicides or antibiotics, are also used to express Tla1 nucleic acids. For example, the maize In2 2 promoter, activated by benzenesulfonamide herbicide safeners, can be used (De Veylder (1997) Plant Cell Physiol. 38:568 577). Other useful inducible regulatory elements include copper-inducible regulatory elements (Mett et al., Proc. Natl. Acad. Sci. USA 90:4567-4571 (1993); Furst et al., Cell 55:705-717 (1988)); tetracycline and chlor-tetracycline-inducible regulatory elements (Gatz et al., Plant J. 2:397-404 (1992); RĂśder et al., Mol. Gen. Genet. 243:32-38 (1994); Gatz, Meth. Cell Biol. 50:411-424 (1995)); ecdysone inducible regulatory elements (Christopherson et al., Proc. Natl. Acad. Sci. USA 89:6314-6318 (1992); Kreutzweiser et al., Ecotoxicol. Environ. Safety 28:14-24 (1994)); heat shock inducible regulatory elements (Takahashi et al., Plant Physiol. 99:383-390 (1992); Yabe et al., Plant Cell Physiol. 35:1207-1219 (1994); Ueda et al., Mol. Gen. Genet. 250:533-539 (1996)); and lac operon elements, which are used in combination with a constitutively expressed lac repressor to confer, for example, IPTG-inducible expression (Wilde et al., EMBO J. 11:1251-1259 (1992)). An inducible regulatory element also can be, for example, a nitrate-inducible promoter, e.g., derived from the spinach nitrite reductase gene (Back et al., Plant Mol. Biol. 17:9 (1991)), or a light-inducible promoter, such as that associated with the small subunit of RuBP carboxylase or the LHCP gene families (Feinbaum et al., Mol. Gen. Genet. 226:449 (1991); Lam and Chua, Science 248:471 (1990)), or a light.
In one example, a promoter sequence that is responsive to light may be used to drive expression of a Tla1 nucleic acid construct that is introduced into Chlamydomonas that is exposed to light (e.g., Hahn, Curr Genet 34:459-66, 1999; Loppes, Plant Mol Biol 45:215-27, 2001; Villand, Biochem J 327:51-7), 1997. Other light-inducible promoter systems may also be used, such as the phytochrome/PIF3 system (Shimizu-Sato, Nat Biotechnol 20):1041-4, 2002). Further, a promoter can be used that is also responsive to heat can be employed to drive expression in algae such as Chlamydomonas (Muller, Gene 111:165-73, 1992; von Gromoff, Mol Cell Biol 9:3911-8, 1989). Additional promoters, e.g., for expression in algae such as green microalgae, include the RbcS2 and PsaD promoters (see, e.g., Stevens et al., Mol. Gen. Genet. 251: 23-30, 1996; Fischer & Rochaix, Mol Genet Genomics 265:888-94, 2001).
In some embodiments, the promoter may be from a gene associated with photosynthesis in the species to be transformed or another species. For example such a promoter from one species may be used to direct expression of a protein in transformed algal cells or cells of another photosynthetic marine organism. Suitable promoters may be isolated from or synthesized based on known sequences from other photosynthetic organisms. Preferred promoters are those for genes from other photosynthetic species that are homologous to the photosynthetic genes of the algal host to be transformed. For example, a series of light harvesting promoters from the fucoxanthing chlorophyll binding protein have been identified in Phaeodactylum tricornutum (see, e.g., Apt, et al. Mol Gen. Genet. 252:572-579, 1996). In other embodiments, a carotenoid chrlophyll binding protein promoter, such as that of peridinin chlorophyll binding protein, can be used.
In some embodiments, promoters are identified by analyzing the 5Ⲡsequences of a genomic clone corresponding to the Tla1 genes described here. Sequences characteristic of promoter sequences can be used to identify the promoter. Sequences controlling eukaryotic gene expression have been extensively studied and include basal elements such as CG-rich regions, TATA consensus sequences etc. In plants, further upstream, there is typically a promoter element with a series of adenines surrounding the trinucleotide G (or T) N G. J. Messing et al., in GENETIC ENGINEERING IN PLANTS, pp. 221-227 (Kosage, Meredith and Hollaender, eds. (1983)).
A number of methods are known to those of skill in the art for identifying and characterizing promoter regions in plant genomic DNA (see, e.g., Jordano, et al., Plant Cell, 1: 855 866 (1989); Bustos, et al., Plant Cell, 1:839 854 (1989); Green, et al., EMBO J. 7, 4035 4044 (1988); Meier, et ah, Plant Cell, 3, 309 316 (1991); and Zhang, et al., Plant Physiology 110: 1069 1079 (1996)). A promoter can be additionally evaluated by testing the ability of the promoter to drive expression in plant cells, e.g., green algae, in which it is desirable to introduce a Tla1 expression construct.
The vector comprising Tla1 nucleic acid sequences will typically comprise a marker gene that confers a selectable phenotype on plant or algae cells. Such markers are known. For example, the marker may encode biocide resistance, particularly antibiotic resistance, such as resistance to zeocin, kanamycin, G418, bleomycin, hygromycin, or herbicide resistance, such as resistance to chlorosluforon or Basta. In some embodiments, selectable markers for use in Chlamydomonas can be markers that provide spectinomycin resistance (Fargo, Mol Cell Biol 19:6980-90, 1999), kanamycin and amikacin resistance (Bateman, Mol-Gen Genet 263:404-10, 2000), zeomycin and phleomycin resistance (Stevens, Mol Gen Genet 251:23-30, 1996), and paramomycin and neomycin resistance (Sizova, Gene 277:221-9, 2001).
Tla1 nucleic acid sequences of the invention can be expressed recombinantly in plant cells, e.g., green algae, or other host cell expression systems, such as bacteria, yeast, and the like, to increase levels of Tla1 polypeptides. As appreciated by one of skill in the art, expression constructs can be designed taking into account such properties as codon usage frequencies of the organism in which the Tla1 nucleic acid is to be expressed. Tla1 polypeptides can be used, e.g., for the production of antibodies to monitor Tla1 expression. Alternatively, antisense or other Tla1 constructs are used to suppress Tla1 levels of expression.
A variety of different expression constructs, such as expression cassettes and vectors suitable for transformation of plant cells can be prepared. Techniques for transforming a wide variety of plant species are well known and described in the technical and scientific literature. See, e.g., Weising et al. Ann. Rev. Genet. 22:421-477 (1988). For example, a Tla1 nucleic acid construct can be directly introduced into a plant or algae cell by microparticle bombardment, or using a glass bead method (e.g., Kindle, Proc. Natl. Acad. Sci. USA 87: 1228-1232, 1990). Alternatively, e.g., when transfecting higher plants, the DNA constructs may be combined with suitable T-DNA flanking regions and introduced into a conventional Agrobacterium tumefaciens host vector. The virulence functions of the Agrobacterium tumefaciens host will direct the insertion of the construct and adjacent marker into the plant cell DNA when the cell is infected by the bacteria. Other techniques are also known. For example, the introduction of DNA constructs using polyethylene glycol precipitation is described in Paszkowski et al. EMBO J. 3:2717-2722 (1984). Electroporation techniques are described in Fromm et al., Proc. Natl. Acad. Sci. USA 82:5824 (1985). Ballistic transformation techniques are described in Klein et al., Nature 327:70-73 (1987).
In some embodiments, Tla1 nucleic acid constructs are introduced into algae, e.g., green algae. As noted above, the nuclear, mitochondrial, and chloroplast genomes can be transformed through a variety of known methods (see, e.g., Kindle, J Cell Biol 109:2589-601, 1989; Kindle, Proc Natl Acad Sci USA 87:1228-32, 1990; Kindle, Proc Natl Acad Sci USA 88:1721-5, 1991; Shimogawara, Genetics 148:1821-8, 1998; Boynton, Science 240:1534-8, 1988; Boynton, Methods Enzymol 264:279-96, 1996; Randolph-Anderson, Mol Gen Genet 236:235-44, 1993).
The invention provides methods for generating a plant having a reduced chlorophyll antenna size by suppressing expression of a nucleic acid molecule encoding Tla1. In a transgenic plant of the invention, a nucleic acid molecule, or antisense constructs thereof, encoding a Tla1 gene product can be operatively linked to an exogenous regulatory element. The invention provides, for example, a transgenic plant characterized by reduced chlorophyll antenna size having an expressed nucleic acid molecule encoding a Tla1 gene product, or antisense construct thereof, that is operatively linked to an exogenous constitutive regulatory element. In one embodiment, the invention provides a transgenic plant that is characterized by small chlorophyll antenna size due to suppression of a nucleic acid molecule encoding a Tla1 polypeptide. Such a plant typically comprises an expression cassette stably transfected into the plant cell, such that that Tla1 polypeptide expression is inhibited constitutively or under certain conditions, e.g., when an inducible promoter is used.
Tla1 nucleic acid sequences can be used to prepare expression cassettes useful for inhibiting or suppressing Tla1 expression. A number of methods can be used to inhibit gene expression in plants. For instance, siRNA, antisense, or ribozyme technology can be conveniently used. For example, in Chlamydomonas, antisense inhibition can be used to decrease expression of a targeted gene (e.g., Schroda, Plant Cell 11:1165-78, 1999). Alternatively, an RNA interference construct can be used (e.g., Schroda, Curr Genet. 49:69-84, 2006, Epub 2005 Nov. 25).
For antisense expression, a nucleic acid segment from the desired Tla1 gene is cloned and operably linked to a promoter such that the antisense strand of RNA will be transcribed. The expression cassette is then transformed into plants, e.g., algae, and the antisense strand of RNA is produced. The antisense nucleic acid sequence transformed into plants will be substantially identical to at least a portion of the endogenous gene or genes to be repressed. The sequence, however, does not have to be perfectly identical to inhibit expression. Thus, an antisense or sense nucleic acid molecule encoding only a portion of Tla1 can be useful for producing a plant in which Tla1 expression is suppressed. The vectors of the present invention can be designed such that the inhibitory effect applies to other proteins within a family of genes exhibiting homology or substantial homology to the target gene.
For antisense suppression, the introduced sequence also need not be full length relative to either the primary transcription product or fully processed mRNA. Generally, higher homology can be used to compensate for the use of a shorter sequence. Furthermore, the introduced sequence need not have the same intron or exon pattern, and homology of non-coding segments may be equally effective. Normally, a sequence of between about 30 or 40 nucleotides and about full length nucleotides should be used, though a sequence of at least about 100 nucleotides is preferred, a sequence of at least about 200 nucleotides is more preferred, and a sequence of at least about 500 nucleotides is especially preferred. SEquences can also be longer, e.g., 1000 or 2000 nucleotides are greater in length.
Catalytic RNA molecules or ribozymes can also be used to inhibit expression of Tla1 genes. It is possible to design ribozymes that specifically pair with virtually any target RNA and cleave the phosphodiester backbone at a specific location, thereby functionally inactivating the target RNA. In carrying out this cleavage, the ribozyme is not itself altered, and is thus capable of recycling and cleaving other molecules, making it a true enzyme. The inclusion of ribozyme sequences within antisense RNAs confers RNA cleaving activity upon them, thereby increasing the activity of the constructs.
A number of classes of ribozymes have been identified. One class of ribozymes is derived from a number of small circular RNAs that are capable of self-cleavage and replication in plants. Ribozymes, e.g., Group I introns, have also been identified in the chloroplast of green algae (see, e.g., Cech, Annu Rev Biochem 59:543-568, 1990; Bhattacharya, Molec Biol and Evol 13: 978-989, 1996; Erin, et al., Amer J Botany 90:628-633, 2003; Turmel, et al., Nucl Acids Res. 21:5242-5250, 1993; and Van Oppen et al., Molec Biol and Evol 10:1317-1326, 1993). The design and use of target RNA-specific ribozymes is described, e.g., in Haseloff et al. Nature, 334:585-591 (1988).
Another method of suppression is sense suppression (also known as co-suppression). Introduction of expression cassettes in which a nucleic acid is configured in the sense orientation with respect to the promoter has been shown to be an effective means by which to block the transcription of target genes. For an example of the use of this method to modulate expression of endogenous genes see, Napoli et al., The Plant Cell 2:279-289 (1990); Flavell, Proc. Natl. Acad. Sci., USA 91:3490-3496 (1994); Kooter and Mol, Current Opin. Biol. 4:166-171 (1993); and U.S. Pat. Nos. 5,034,323, 5,231,020, and 5,283,184.
Generally, where inhibition of expression is desired, some transcription of the introduced sequence occurs. The effect may occur where the introduced sequence contains no coding sequence per se, but only intron or untranslated sequences homologous to sequences present in the primary transcript of the endogenous sequence. The introduced sequence generally will be substantially identical to the endogenous sequence intended to be repressed. This minimal identity will typically be greater than about 65%, but a higher identity might exert a more effective repression of expression of the endogenous sequences. Substantially greater identity of more than about 80% is preferred, though about 90% or 95% to absolute identity would be most preferred. As with antisense regulation, the effect should apply to any other proteins within a similar family of genes exhibiting homology or substantial homology.
For sense suppression, the introduced sequence in the expression cassette, needing less than absolute identity, also need not be full length, relative to either the primary transcription product or fully processed mRNA. This may be preferred to avoid concurrent production of some plants that are overexpressers. A higher identity in a shorter than full length sequence compensates for a longer, less identical sequence. Furthermore, the introduced sequence need not have the same intron or exon pattern, and identity of non-coding segments will be equally effective. Normally, a sequence of the size ranges noted above for antisense regulation is used.
Endogenous gene expression may also be suppressed by means of RNA interference (RNAi), which uses a double-stranded RNA having a sequence identical or similar to the sequence of the target TLA1 gene. RNAi is the phenomenon in which when a double-stranded RNA having a sequence identical or similar to that of the target gene is introduced into a cell, the expressions of both the inserted exogenous gene and target endogenous gene are suppressed. The double-stranded RNA may be formed from two separate complementary RNAs or may be a single RNA with internally complementary sequences that form a double-stranded RNA. The introduced double-stranded RNA is initially cleaved into small fragments, which then serve as indexes of the target gene in some manner, thereby degrading the target gene. RNAi is known to be also effective in plants (see, e.g., Chuang, C. F. & Meyerowitz, E. M., Proc. Natl. Acad. Sci. USA 97: 4985 (2000); Waterhouse et al., Proc. Natl. Acad. Sci. USA 95:13959-13964 (1998); Tabara et al. Science 282:430-431 (1998)). For example, to achieve suppression of the expression of a DNA encoding a protein using RNAi, a double-stranded RNA having the sequence of a DNA encoding the protein, or a substantially similar sequence thereof (including those engineered not to translate the protein) or fragment thereof, is introduced into a plant of interest, e.g., green algae. The resulting plants may then be screened for a phenotype associated with the target protein and/or by monitoring steady-state RNA levels for transcripts encoding the protein. Although the genes used for RNAi need not be completely identical to the target gene, they may be at least 70%, 80%, 90%, 95% or more identical to the target gene sequence. See, e.g., U.S. Patent Publication No. 2004/0029283. The constructs encoding an RNA molecule with a stem-loop structure that is unrelated to the target gene and that is positioned distally to a sequence specific for the gene of interest may also be used to inhibit target gene expression. See, e.g., U.S. Patent Publication No. 2003/0221211.
The RNAi polynucleotides may encompass the full-length target RNA or may correspond to a fragment of the target RNA. In some cases, the fragment will have fewer than 100, 200, 300, 400, 500 600, 700, 800, 900 or 1,000 nucleotides corresponding to the target sequence. In addition, in some embodiments, these fragments are at least, e.g., 15, 20, 25, 30, 50, 100, 150, 200, or more nucleotides in length. In some cases, fragments for use in RNAi will be at least substantially similar to regions of a target protein that do not occur in other proteins in the organism or may be selected to have as little similarity to other organism transcripts as possible, e.g., selected by comparison to sequences in analyzing publicly-available sequence databases. Thus, RNAi fragments may be selected for similarity or identity with the N terminal region of the Tla1 sequences of the invention (i.e., those sequences lacking significant homology to sequences in the databases) or may be selected for identity or similarity to conserved regions of Tla1 proteins, e.g., the hydrophobic region.
Expression vectors that continually express siRNA in transiently- and stably-transfected cells have been engineered to express small hairpin RNAs, which get processed in vivo into siRNAs molecules capable of carrying out gene-specific silencing (Brummelkamp et al., Science 296:550-553 (2002), and Paddison, et al., Genes & Dev. 16:948-958 (2002)). Post-transcriptional gene silencing by double-stranded RNA is discussed in further detail by Hammond et al. Nature Rev Gen 2: 110-119 (2001), Fire et al. Nature 391: 806-811 (1998) and Timmons and Fire Nature 395: 854 (1998).
One of skill in the art will recognize that using technology based on specific nucleotide sequences (e.g., antisense or sense suppression technology), families of homologous genes can be suppressed with a single sense or antisense transcript. For instance, if a sense or antisense transcript is designed to have a sequence that is conserved among a family of genes, then multiple members of a gene family can be suppressed. Conversely, if the goal is to only suppress one member of a homologous gene family, then the sense or antisense transcript should be targeted to sequences with the most variation between family members.
The invention also provides methods of screening for plants, e.g., green algae, having reduced Tla1 gene expression. Such plants can be generated using the techniques described above to target Tla1 genes. In other embodiments mutagenized plants, e.g., algae, can be screened for reduced Tla1 gene expression.
Methods for introducing genetic mutations into plant genes and selecting plants with desired traits are well known. For instance, plant cells can be treated with a mutagenic chemical substance, according to standard techniques. Such chemical substances include, but are not limited to, the following: diethyl sulfate, ethylene imine, ethyl methanesulfonate and N-nitroso-N-ethylurea. Alternatively, ionizing radiation from sources such as, X-rays or gamma rays can be used. In other embodiments, insertional mutagenesis can be performed (see, e.g., Polle et al., Planta 217:49-59, 2003).
Alternatively, homologous recombination can be used to induce targeted gene modifications by specifically targeting a Tla1 gene in vivo to suppress expression (see, generally, Grewal and Klar, Genetics 146: 1221-1238 (1997) and Xu et al., Genes Dev. 10: 2411-2422 (1996)). Homologous recombination has been demonstrated in plants (Puchta et al., Experientia 50: 277-284 (1994), Swoboda et al., EMBO J. 13: 484-489 (1994); Offringa et al., Proc. Natl. Acad. Sci. USA 90: 7346-7350 (1993); and Kempin et al. Nature 389:802-803 (1997)).
In applying homologous recombination technology to the genes of the invention, mutations in selected portions of Tla1 gene sequences (including 5Ⲡupstream, 3Ⲡdownstream, and intragenic regions) such as those disclosed here are made in vitro and then introduced into the desired plant using standard techniques. Since the efficiency of homologous recombination is known to be dependent on the vectors used, use of dicistronic gene targeting vectors as described by Mountford et al., Proc. Natl. Acad. Sci. USA 91: 4303-4307 (1994); and Vaulont et al., Transgenic Res. 4: 247-255 (1995) are conveniently used to increase the efficiency of selecting for decreased Tla1 gene expression in transgenic plants. The mutated gene will interact with the target wild-type gene in such a way that homologous recombination and targeted replacement of the wild-type gene will occur in transgenic plant cells, resulting in suppression of Tla1 activity.
Alternatively, oligonucleotides composed of a contiguous stretch of RNA and DNA residues in a duplex conformation with double hairpin caps on the ends can be used. The RNA/DNA sequence is designed to align with the sequence of the target Tla1 gene and to contain the desired nucleotide change. Introduction of the chimeric oligonucleotide on an extrachromosomal T-DNA plasmid results in efficient and specific Tla1 gene conversion directed by chimeric molecules in a small number of transformed plant cells. This method is described in Cole-Strauss et al., Science 273:1386-1389 (1996) and Yoon et al., Proc. Natl. Acad. Sci. USA 93: 2071-2076 (1996).
In other embodiments, insertional mutagenesis can be used to mutagenize a population of plants, e.g., green algae, that can subsequently be screened.
Plants, e.g., green algae, with mutations can be screened for decreased Tla1 gene expression. Such decreases are determined by examining levels of Tla1 gene or protein expression. Techniques for performing such an analysis are readily known in the art and include quantitative RT-PCR, northern blots, immunoassays, and the like. Tla1 expression can also be evaluated by analyzing a phenotypic endpoint such as chlorophyll antenna size and selecting plants having reduce chlorophyll antenna size relative to normal.
Plants that can be Targeted
Tla1 can be suppressed in any number of eukaryotic green plants where it is desirable to reduce the rate of light absorption. For example, crop plants, such as tobacco, soybeans, barley, maize, and others (see, e.g., Okabe, et al., J Plant Physiol. 60: 150-156, 1977; Melis & Thielen, Biochim. Biophys. Acta 589: 275-286, 1980; Ghirardi et al., Biochim. Biophys. Acta 851: 331-339, 1986; Ghirardi & Melis, Biochim. Biophys. Acta 932: 130-137, 1988; Droppa, et al., Biochim. Biophys. Acta 932: 138-145, 1988; and Greene, et al., Plant Physiol. 87: 365-370, 1988).
In some embodiments, Tla1 is suppressed in algae. Algae, alga or the like, refer to plants belonging to the subphylum Algae of the phylum Thallophyta. The algae are unicellular, photosynthetic, anoxygenic algae and are non-parasitic plants without roots, stems or leaves; they contain chlorophyll and have a great variety in size, from microscopic to large seaweeds. Green algae, which are single cell eukaryotic organisms of oxygenic photosynthesis endowed with chlorophyll a and chlorophyll b belonging to Eukaryota-Viridiplantae-Chlorophyta-Chlorophyceae, are often a preferred target. For example, Tla1 expression can be suppressed in C. reinhardtii, which is classified as Volvocales-Chlamydomonadaceae. Algae strains that are of particular interest for this invention are, e.g., Chlamydomonas reinhardtii, Scenedesmus obliquus, Chlorella vulgaris, Botryococcus braunii, Botryococcus sudeticus, Dunaliella salina, and Haematococcus pluvialis.
Algae can be used in high density photobioreactors (see, e.g., Lee et al., Biotech. Bioengineering 44:1161-1167, 1994; Chaumont, J Appl. Phycology 5:593-604, 1990), bioreactors for sewage and waste water treatments (e.g., Sawayama et al., Appl. Micro. Biotech., 41:729-731, 1994; Lincoln, Bulletin De L'institut Oceangraphique (Monaco), 12:109-115, 1993), elimination of heavy metals from contaminated water (e.g., Wilkinson, Biotech. Letters, 11:861-864, 1989), the production of β-carotene (e.g., Yamaoka, Seibutsu-Kogaku Kaishi, 72:111-114, 1994), the production of hydrogen (e.g., U.S. Patent Application Publication No. 20030162273), and pharmaceutical compounds (e.g., Cannell, 1990), as well as nutritional supplements for both humans and animals (Becker, 1993, âBulletin De L'institut Oceanographique (Monaco), 12, 141-155) and for the production of other compounds of nutritional value.
Conditions for growing Tla1-suppressed algae for the exemplary purposes illustrated above are known in the art (see, e.g., the exemplary references cited herein).
Chlamydomonas reinhardtii strain cw15, the arginine-requiring CC425, the chlorophyll-deficient mutant tla1 and Tla1-complemented strains of the tla1 mutant were grown to the mid-exponential growth phase either in TAP [Tris Acetate Phosphate, pH 7.4], TAP+Arg (Sueoka, Proc. Natl. Acad. Sci. USA 46: 83-91, 1960; Harris, The Chlamydomonas source book: A comprehensive guide to biology and laboratory use: Academic Press, San Diego, 1989), or in modified minimal media containing 40 mM Tris-HCl, pH 7.4, supplemented with 25 mM sodium bicarbonate with or without Arg (TBP medium, Polle et al., Planta 211: 335-344, 2000) in flat 1-1 Roux bottles at 25° C. under continuous illumination of 200 Οmol photons m-2 s-1 provided by cool-white fluorescent lamps. The cultures were stirred continuously to ensure a uniform illumination of the cells and to prevent settling.
Cell density was estimated upon counting the number of cells per ml culture using a Neubauer ultraplane hemacytometer. Pigments from intact cells were extracted in 80% acetone and cell debris removed by centrifugation at 10,000 g for 5 min. The absorbance of the supernatant was measured with a Shimadzu UV-160U spectrophotometer and the chlorophyll (a and b) concentration of the samples was determined according to Arnon, Plant Physiol 24: 1-15, 1949, with equations corrected as in Melis et al. (Photochem. Photobiol. 45: 129-136, 1987).
Genomic DNA was isolated using either Stratagene's (La Jolla, Calif.) DNA purification kit or a combination of QIAGEN's (Valencia, Calif.) DNeasy plant mini kit and phenol chloroform extraction (Davies et al. 1992). BAC DNA was isolated using QIAGEN's midi prep kit. Total RNA was isolated using either QIAGENS's Plant RNeasy Kit or the Trizol Reagent (Invitrogen, Carlsbad, Calif.).
Cloning of Plasmid Insert Flanking Sequences from the Tla1 Mutant
Genomic DNA of the tla1 mutant was digested with Apa I (New England Biolab, Beverly, Mass.) and size-fractionated by 0.8% agarose gel electrophoresis. Restriction enzyme digestion yielded a DNA fragment of about 5 kb, containing about 2 kb of Chlamydomonas genomic DNA flanking the insertion and about 3 kb portion of the 5Ⲡend of the pJD67 plasmid sequence (Polle et al. 2003, supra). Similarly, a 3.2 kb DNA fragment was identified, which contained about 2.2 kb of the 3Ⲡend of the pJD67 plasmid sequences and about 1 kb of Chlamydomonas genomic DNA flanking the insertion (Polle et al. 2003, supra). Therefore, following agarose gel electrophoresis of Apa I-digested tla1 genomic DNA, fragments migrating in the 6-4 kb region were used for the construction of a 5Ⲡinsert flanking DNA library. Similarly, fragments migrating in the 4-3 kb region were used to construct a 3Ⲡinsert flanking DNA library.
The vector was digested with Apa I and treated with alkaline phosphatase (Promega, San Luis Obispo, Calif.) to avoid self-ligation of the plasmid. DNA fragments that migrated between the molecular weight markers of 4-6 kb and 3-4 kb were gel purified using QIAEX II gel extraction kit (QIAGEN, Valencia, Calif.) and were ligated into the pZero Kan+ vector (which includes a kanamycin resistance gene, Promega, San Luis Obispo, Calif.) for the construction of a partial genomic library containing insert-5Ⲡand 3Ⲡflanking sequences. Use of the Apa I restriction enzyme in the digestion of the tla1 genomic DNA proved useful not only in the spatial separation of the 5â˛-insert flanking sequences from the 3â˛-insert flanking sequences, but also in the separation of the insert flanking sequences from the endogenous copy of the ARG7.8 gene.
About 5000 E. coli colonies containing the partial genomic DNA libraries of the tla1 mutant were screened using appropriate DNA probes derived from the ARG7.8 gene (Polle et al. 2003, supra). The probe Sal I-Sal I (1.3 kb representing the 5Ⲡend of the ARG7 structural gene) was used to screen a partial genomic library containing the 5â˛-insert flanking sequences. The probe Nde I-Nde I (0.75 kb) derived from the 3Ⲡend of the ARG7 was used to screen a partial genomic library containing the 3â˛-insert flanking sequences (FIG. 1).
A DNA fragment containing the insert-3Ⲡflanking sequence was subsequently used for screening a commercially available wild type Chlamydomonas reinhardtii BAC library, constructed in pBACmn vector and printed on nylon membrane referred to as a high-density filter (Incyte Genomics Inc, Palo Alto, Calif.).
For Southern blot analysis, 10 Οg of genomic or BAC DNA was used for restriction digestion, separated on 0.8% agarose gels for Southern blot analyses. After separation of the DNA fragments, nucleic acids were either blotted onto a positively charged nylon membrane (NEN Life Science Products, Inc, Wellesley, Mass.) or DNA was purified from excised gel pieces in the region of appropriate molecular weight. The blotted membranes were hybridized with 32P-labeled probes (Random oligonucleotides DNA Labeling System, Roche Diagnostic Corporation, Alameda, Calif.). The probe DNA was PCR-amplified using specific primers designed from the insert-3Ⲡflanking sequence of the tla1 mutant. Both of these primers were derived from the coding region of the Tla1 gene.
Tla1-cDNAs were synthesized using 1 Îźg of total RNA isolated from either WT or tla1 mutant with âprimer 5â (Table 1) designed from the coding-2 region of the Tla1 gene and an oligo dT anchor primer (Invitrogen, Carlsbad, Calif.). These cDNAs were used as templates for 5Ⲡand 3ⲠRACE analyses using a kit from Boehringer, Mannheim (Germany).
| TABLE 1 |
| Exemplary PCR primers and expected product sizes in wild type, tla1 mutant and |
| tla1 complemented strains. |
| Expected products from strains |
| tla1 | tla1- | ||
| Primers | WT | mutant | complements |
| âprimer 1ââ(5â˛âTACGGGAATTTGCGGAACCTC 3â˛; SEQ | 589 bp | No product | 589 bp |
| ID NO: 4) and âprimer 4â | genomic | genomic | |
| (5â˛TTGTTGTCCAGCACCAGCAC 3â˛; SEQ ID NO: 5); | DNA | DNA product | |
| probing for the 5â˛UTR of Tla1 | product | ||
| âprimer 7ââ(5â˛âCAACGCATATAGCGCTAGCAG C 3â˛; | No | 681 bp | 681 bp |
| SEQ ID NO: 6) and âprimer 4ââ(5Ⲡ| product | genomic | genomic |
| TTGTTGTCCAGCACCAGCAC 3â˛; SEQ ID NO: 5); | DNA | DNA product | |
| probing for the 3â˛end of pJD67 | product | ||
| âprimer 1ââ(5â˛âTACGGGAATTTGCGGAACCTC 3â˛; SEQ | 939 bp | No product | 939 bp |
| ID NO: 4) and âprimer 6ââ(5â˛âAACACACACCCCGCACT | genomic | genomic | |
| 3â˛; SEQ ID NO: 31); probing for the full length Tla1 gene | DNA | DNA product; | |
| and transcript | product; | 823 bp cDNA | |
| 823 bp | product | ||
| cDNA | |||
| product | |||
| âprimer 8ââ(5â˛GGGACTTCGTGGAGGACG 3â˛; SEQ ID | No | No product | 436 bp |
| NO: 8) and | product | genomic | |
| âprimer 9ââ(5â˛âGGTTAGTCCTGCTCCTCGG 3â˛; SEQ ID | DNA product | ||
| NO: 9); probing for the Ble gene | |||
| âprimer 3ââ(5â˛âGGGCCCTTCAGCTGCTCCGCTGACC | 409 bp | 40 bp | 409 bp cDNA |
| AAACC 3â˛; SEQ ID NO: 10)and âprimer 5ââ(5Ⲡ| cDNA | cDNA | product |
| GGGCCCGAACGGG TTGTCCGCCTGCGCCTTGC 3â˛; | product | product | |
| SEQ ID NO: 11); Probing for the Tla1 transcript | |||
| âprimer 2ââ(5â˛âGCTGCTCCGCTGACCAAA 3â˛; SEQ ID | 525 bp | 525 bp | 525 bp |
| NO: 12) and âprimer 5ââ(5Ⲡ| genomic | genomic | genomic |
| GGGCCCGAACGGGTTGTCCGCCTG CGCCTTGC 3â˛; | DNA | DNA | DNA product; |
| SEQ ID NO: 11); Probing for the Tla1 transcript | product; | product; | 454 bp cDNA |
| 454 bp | no cDNA | product | |
| cDNA | product | ||
| product | |||
| TCF (5â˛âCGGGGTACCACTTTCAGCTGCTCCGCT 3â˛; SEQ ID NO: 13) and TCR (5Ⲡ|
| CCAAGCTTCCTCTT TCCCCCCCACC 3â˛; SEQ ID NO: 14); cloning primers used for amplifying |
| the cDNA coding for the full length Tla1, off the cDNA library for Tla1 overexpression. |
| PCR product size is 750 bp. |
BAC clone 39e16 DNA was digested with restriction enzymes ApaI or PstI. An approximately 3.7 kb DNA fragment, derived upon Apa I digestion (Apa I-Apa I), and an about 3 kb DNA fragment, derived upon Pst I digestion (Pst I-Pst I) were subcloned. The 2 kb DNA overlap region between these two clones (p5â˛TlaApa-4 and p3â˛TlaPst-3-3) was removed upon Apa I digestion of the 3 kb p3â˛TlaPst-3-3 clone. Subsequently, the Apa I -Apa I fragment and the 3Ⲡend of the Pst I-Pst I DNA fragment, which resulted from the ApaI digestion, were re-ligated to yield the complete 4.7 kb sequence of the Tla1 gene in pBluescript. The resulting pFT1a-5 plasmid DNA was sequenced to confirm the correct coding sequence of the Tla1 gene.
The ble gene encoding zeocin resistance along with its RbcS2 promoter and terminator was excised from plasmid pSP124S (Stevens et al., Mol. Gen. Genet. 251: 23-30, 1996) by Hind III digestion and inserted at the 5Ⲡend of the Tla1 gene in tandem to generate plasmid pSK9.2B1eFT1a. This plasmid was linearized upon digestion with Kpn I and used to transform the tla1 mutant by the glass bead method (Debuchy et al., EMBO J 8: 2803-2809, 1989). Transformant colonies were selected for zeocin resistance on TAP agar plates in the presence of 5 ΟM zeocin. Zeocin-resistant colonies were further screened for tla1 complementation by visual inspection of the colony coloration. Zeocin-resistant colonies having dark green coloration were tested for the presence of the wild type Tla1 gene and Tla1 protein amount by PCR/RT-PCR and Western blot analysis, respectively.
Strains with tla1 mutations complemented with the Tla1 gene (tla1-complements) were first tested by PCR to check for the presence of two distinct Tla1 genes (wild type and mutant) and of the Ble tag. PCR was applied to genomic DNA by using two different forward primers, namely a Tla1 5â˛UTR specific primer (âprimer 1â: 5ⲠTACGGGAATTTGCGGAACCTC 3Ⲡ(SEQ ID NO:4), Table 1) and a primer designed from the 3Ⲡend of the pJD67 vector that was inserted just upstream of the start codon of the Tla1 gene (âprimer 7â: 5ⲠCAACGCATATAGCGCTAGCAGC 3Ⲡ(SEQ ID NO:6), Table 1). A reverse primer was defined from the second exon of the Tla1 gene (âprimer 4â: 5ⲠTTGTTGTCCAGCACCAGCAC 3Ⲡ(SEQ ID NO:5), Table 1). Upstream 5â˛UTR specific primer âprimer 1â and the down stream 3ⲠUTR specific PCR primer (âprimer 6â: 5ⲠAACACACACCCCGGCACT 3Ⲡ(SEQ ID NO:31, Table 1) were used to probe for the full-length Tla1 transcript. Tla1 5â˛UTR specific âprimer 2â (5ⲠGCTGCTCCGCTGACCAAA 3â˛; SEQ ID NO:12) or Tla1 exon 1-specific âprimer 3â (5ⲠGGGCCCTTCAGCTGCTCCGCTGACCAAACC 3Ⲡ(SEQ ID NO:10, Table 1) were used in conjunction with the reverse âprimer 5â (5ⲠGGGCCCGAACGGGTTGTCCGCCTGCGCCTTGC 3; SEQ ID NO:11) defined from the second exon of the Tla1 gene to check for the presence of the Tla1 transcript in the tla1-complemented strains. Presence of the Ble tag was tested by PCR using a forward primer located in the second exon of the Ble gene (âprimer 8â: GGGACTTCGTGGAGGACG 3Ⲡ(SEQ ID NO:8), Table 1) and a reverse primer located in the third exon of the Ble gene (âprimer 9â: 5ⲠGGTTAGTCCTGCTCCTCGG 3Ⲡ(SEQ ID NO:9), Table 1). The one-step RT-PCR kit (QIAGEN, Valencia, Calif.) was used for RT-PCR experiments. Platinum Taq polymerase (Invitrogen, Carlsbad, Calif.) was used for the PCR amplification. A 1 kb plus DNA ladder was used as DNA size markers (Invitrogen, Carlsbad, Calif.).
An amplified Chlamydomonas cDNA core library obtained from the laboratory of Dr. James V. Moroney (Louisiana State University, Baton Rouge, La.) was used to amplify Tla1 cDNA for generating the Tla1 protein overexpression construct. This cDNA library has been generated by cloning the cDNA core library (Chlamydomonas Genetics Center, Duke University) into the lambda ZapII vector (Stratagene, La Jolla, Calif.). In vivo excision of the pBluescript phagemid from the lambda ZapII vector, involving the Ex-Assist interference-resistant helper phage along with the SOLR strain of E. coli was used in the amplification of the cDNA core library.
The Tla1 cDNA sequence coding for the full length Tla1 protein was amplified from the cDNA library by PCR. The 5Ⲡend PCR primer (TCF) has the sequence 5â˛-CGGGGTACCACTTTCAGCTGCTCCGCT-3Ⲡ(SEQ ID NO:13) (Table 1) and a KpnI site was incorporated at the 5Ⲡend. The 3Ⲡend PCR primer (TCR) has the sequence 5â˛-CCCAAGCTTCCTCTTTCCCCCCCACC-3Ⲡ(SEQ ID NO:32) and a HindIII site was incorporated at the 5Ⲡend. Amplified Tla1 cDNAs were purified from the DNA gel using the QIAEX II gel extraction kit (QIAGEN, Valencia, Calif.) and were cloned into the pQE80L overexpression vector (QIAGEN, Valencia, Calif.) which has a 6*His (SEQ ID NO:33) tag. The vector and the purified Tla1 cDNAs were double digested with Kpn I and Hind III. Ligation of the 733 bp Tla1 PCR product immediately downstream of the 6*His (SEQ ID NO:33) tag sequence in the pQE80L vector was performed following the protocol given in the New England Biolab (NEB, Beverly, Mass.) technical manual. E. coli strain DH5Îą cells were transformed. Transformants were isolated by screening colonies on LB+Amp (100 Îźg/mL-1) plates. In-frame insertion of Tla1 with the His tag sequence in the recombinant clone was verified by double restriction enzyme digestion analyses with Kpn I and Hind III and DNA sequencing.
Overexpression and Purification of his-Tagged Tla1 Protein for the Generation of Polyclonal Specific Antibodies
Selected E. coli clones of Tla1 were grown at 37° C. in 200 mL of LB media on a rotary shaker. The cells were induced for 5 h with 1 mM IPTG when the culture OD600 was between 0.6 and 0.7. Both induced and uninduced E. coli cells were harvested and resuspended in lysis buffer [100 mM NaH2PO4, 10 mM Tris-Cl (pH 8), 8 M urea] followed by sonication. Equal amounts of protein samples from induced and uninduced cells were subjected to 12.5% SDS-PAGE gel electrophoresis to test for the overexpression of the recombinant protein.
The recombinant fusion protein was purified by a one-step affinity chromatography using Ni-NTA superflow columns. Crude sonicated cell extracts were passed through Ni-NTA superflow columns (1 mL of the nickel-charged resin binds 10-15 mg of the recombinant protein). The column was washed with 6 L of wash buffer [100 mM NaH2PO4, 10 mM Tris-HCl (pH 6.3), 8 M urea]. At the final step, fusion proteins were eluted from the column by elution buffer [100 mM NaH2PO4, 10 mM Tris-HCl (pH 4.5), 8 M urea]. Purified recombinant proteins were further concentrated by a passage through Centricon columns (Amicon, Billerica, Mass.). The recombinant proteins were recovered from the membrane of the filter upon elution with phosphate buffered saline (pH 7.4) containing 137 mM NaCl, 2.7 mM KCl, 4.3 mM NaH2PO4 and 1.4 mM KH2PO44. Purification of the recombinant protein was tested upon SDS-PAGE using the Benchmark prestained protein ladder (Invitrogen, Carlsbad, Calif. The purified recombinant protein was used for the generation of specific polyclonal antibodies (ProSci Incorporated (Poway, Calif.) following a standard protocol. Approximately 1.6 mg of protein in each of two rabbits was used to generate the Tla1 antibodies.
Chlamydomonas cells were harvested, washed twice with fresh medium and resuspended in TEN buffer (10 mM Tris-HCl, 10 mM EDTA and 150 mM NaCl; pH 8). Following sonication, the crude cell extract was incubated in the presence of solubilization buffer (Smith et al. 1990). Protein concentration was determined and gel lanes were loaded with an equal amount of Chl, in the range of 4 to 6 nmol Chl, as indicated. SDS-PAGE analysis was performed on a 12.5% gel, using either the Benchmark prestained or unstained protein ladder (Invitrogen, Carlsbad, Calif.), at a constant current of 10 mA for 5 h. Gels were stained with 1% Coomassie brilliant Blue R for protein visualization.
Electrophoretic transfer of the SDS-PAGE resolved proteins onto nitrocellulose was carried out for 2 h at a constant current of 400 mA in the transfer buffer (25 mM Tris, 192 mM glycine and 20% methanol). The titer of the Tla1 immune serum was probed with different amounts of the purified recombinant His tagged Tla1 protein (2 pg-20 ng), as well as with the total protein extract of wild type (CC425), tla1 mutant, and tla1-complements. The Tla1 immune serum was diluted with buffer [Tris-buffered saline, 0.005% Tween 20 and 1% bovine serum albumin (pH 7.4)] to a ratio of 1:3,000 before being used as a primary probe. The secondary antibody used for Western blotting was conjugated to horseradish peroxidase (BioRad, Hercules, Calif.) and diluted to a ratio of 1:30,000 with the antibody buffer. Western blots were developed by using The Supersignal West chemiluminescent substrate kit (Pierce, Rockford, Ill.).
GenBank Accession numbers for the exemplary Tla1 sequences in the examples are AF534570 (complete Tla1 genomic DNA sequence with exons and intron) and AF534571 (complete mRNA sequence with 5Ⲡand 3Ⲡuntranslated regions).
Southern blot analyses of the Chlamydomonas reinhardtii tla1 mutant revealed a single pJD67 plasmid insert in the nuclear genome. Genetic crosses and random progeny analyses revealed that the exogenous ARG7.8 gene co-segregated with the tla1 phenotype (Polle et al. 2003, supra). On the basis of these properties, it was inferred that insertion of the pJD67 plasmid must have interrupted, or deleted, a gene that is involved in the regulation of the light-harvesting Chl antenna size of photosynthesis.
The 5Ⲡend vector sequence information, required for plasmid rescue, had been deleted from the insert site (FIG. 1A). Thus, plasmid rescue could not be employed for the cloning of the genomic DNA that is flanking the insert. To identify the gene, two different partial genomic libraries of the tla1 mutant, representing the 5Ⲡand 3Ⲡplasmid insert flanking sequences were constructed and screened with appropriate probes (see Materials and methods). Three positive clones were identified from the 5Ⲡinsert flanking DNA library and only one positive clone from the 3Ⲡinsert flanking DNA library. All of the above four positive clones were confirmed by restriction enzyme and sequence analysis.
A database search with the 5â˛-insert flanking sequence did not show significant homology to any existing EST sequences. However, a BLAST search with the 3â˛-insert flanking sequence matched the Chlamydomonas EST sequence 894001DO4.yl, which was deposited in the GenBank with Accession No. BE024188. The designation âyâ in this EST sequence denoted a 5Ⲡend of the respective cDNA.
The 3â˛-insert flanking sequence of tla1 was used to screen a high-density filter containing a Chlamydomonas wild type BAC library. A BAC clone, number 39e16, was identified as containing the complete Tla1 gene sequence. Southern blot analysis of the 39e16 clone DNA with several restriction enzymes (using the 3â˛-insert flanking sequence as a probe) permitted construction of a Tla1 restriction map.
FIG. 1A shows a map of the pJD67 insertion site in the nuclear genome of the tla1 mutant. It is shown that about 2.3 kb of the 5Ⲡend of the pJD67 was deleted upon plasmid insertion in the C. reinhardtii nuclear genome. It is also shown that about 6 kb of genomic DNA was deleted upon plasmid insertion. Nine bps of the 3Ⲡend of the plasmid sequences were also deleted upon plasmid insertion.
A full-length cDNA was obtained upon RT-PCR, and 5Ⲡand 3ⲠRACE analyses using cDNA from the WT (cw15) strain. The full-length cDNA showed an open reading frame encoding a protein of 213 amino acids. DNA sequence analyses of the 39e16 BAC clone revealed the structure of the full-length Tla1 genomic DNA. Genomic and cDNA analysis of the Tla1 gene showed the presence of a 104 bp 5ⲠUTR, a single intron of 116 bases, and 1.26 kb of 3ⲠUTR. FIG. 1B also compares the DNA structure in the Tla1 upstream region in wild type and tla1 mutant. In the tla1 mutant, the 3Ⲡend of the pJD67 plasmid replaced the promoter and 5ⲠUTR of the wild type gene.
Transcription of the Tla1 gene in wild type and tla1 mutant was tested by RT-PCR and compared to that of genomic DNA PCR. Given the presence of the pJD67 insert in the 5ⲠUTR of the Tla1 gene, a question was raised as to whether the tla1 mutant was able to transcribe the remnant of the Tla1 gene. RT-PCR was performed with a forward primer designed from the 5ⲠUTR sequence of Tla1, (âprimer 2â) and a reverse primer (âprimer 5â) from the coding-2 sequence of this gene (FIG. 2). This RT-PCR yielded products in the WT but not in the tla1 mutant (FIG. 3, lanes 1 and 2). With the set of PCR primers that were designed from within the coding sequence of the Tla1 (âprimer 3â and âprimer 5â), RT-PCR yielded products in both the WT and tla1 mutant (FIG. 3, lanes 4 and 5). PCR products obtained with the same primers from the genomic DNA of the tla1 strain were 116 bp larger than those obtained from the cDNA due to the presence of an intron (FIG. 3, lane 6).
5ⲠRace analysis of the Tla1 cDNAs from the wild type and mutant revealed polymorphism in the 5ⲠUTR sequences of wild type and tla1 mutant. FIG. 4 (upper) shows the 5ⲠRACE analysis of the wild type cDNA with a portion of the 5ⲠUTR, the ATG start codon, and the corresponding downstream coding nucleotide sequence. In the tla1 mutant (FIG. 4, middle panel), the ATG start codon is preserved. However, the entire upstream 5ⲠUTR and promoter regions of the Tla1 gene are deleted and replaced by the 3Ⲡend of the pJD67 plasmid sequence, represented by the lower case and underlined nucleotide sequence. FIG. 4 (lower panel) shows the nucleotide sequence of the complete 3Ⲡend of the pJD67 plasmid DNA. Nucleotides denoted in upper case characters belong to the ARG7.8 gene. Nucleotides denoted in lower case characters belong to the 3Ⲡend of the vector sequence (pBR322). The underlined portion of the pJD67 3â˛end is also found in the cDNA nucleotide sequence obtained from the 5ⲠRACE analysis of the tla1 mutant (FIG. 4, middle panel, lower case underlined nucleotides). Note that nine bases, i.e., at t a a a g c t, at the 3Ⲡend of the full-length pJD67 (FIG. 4, lower panel) were deleted from the insertion site (FIG. 4, lower panel, black background). In sum, 187 bp of the 3Ⲡend of the pJD67 vector sequence have become the 5ⲠUTR sequence of the Tla1 gene in the tla1 mutant, as they were amplified by the 5ⲠRACE in the latter.
A 4.7 kb genomic DNA, representing the full length Tla1 gene was cloned in pBluescript (FIG. 5). This plasmid was digested with Hind III and the Ble gene was added at the 5Ⲡend of the Tla1 gene to generate plasmid pSK9.2B1eFTla1 (see Materials and methods). This plasmid was used to complement the tla1 mutant. Transformant colonies were selected on agar plates in the presence of 5 ΟM zeocin and screened for dark green coloration. Three dark green colonies, putative complements of the Tla1 gene were randomly isolated and streaked on to a TAP agar plate along with the wild type and tla1 mutant strains (FIG. 6). These putative complements, tla1-comp1, tla1-comp2 and tla1-comp3, showed wild type phenotype in terms of coloration and in vivo chlorophyll fluorescence induction kinetics. The putative complements were grown autotrophically in TBP medium and tested for the Chl/cell and Chl a/Chl b ratios.
Table 2 shows that wild type C. reinhardtii had a Chl a/Chl b ratio of 2.6, whereas the tla1 mutant had a Chl a/Chl b ratio of 6. The putative tla1-complemented strains had much lower Chl a/Chl b ratios, ranging between 2.8-3.0. These values are much closer to that of the wild type than to the tla1 parental host strain. A lower Chl a/Chl b ratio suggests assembly of peripheral subunits of the Chl a-b light-harvesting complex, underlying an enlarged photosystem Chl antenna size (Polle, et al., Plant Cell Physiol. 42: 482-491, 2001; and Polle et al., 2003, supra). Table 2 also shows the Chl/cell values of the various strains. Chl/cell in the wild type (3.2Ă10-15 mol/cell) was substantially greater than that in the tla1 mutant (1.1Ă10â15 mol/cell). The complemented strains had Chl/cell values (2.2-2.8Ă10â15 mol/cell) comparable to that of the wild type, providing evidence of the return of the tla1-complemented strains to wild type levels of Chl content. Moreover, chlorophyll fluorescence induction kinetic measurements, with intact cells in the presence of DCMU, showed that the complemented strains, very much like the wild type, had a sigmoidal fluorescence rise curve, evidence of a statistical pigment bed organization afforded by a large Chl antenna size, as compared with the exponential fluorescence induction kinetics in the tla1 mutant (not shown). The lower Chl a/Chl b ratio, greater Chl/cell ratio (Table 2) and sigmoidal fluorescence induction kinetics in the Tla1-complemented strains are evidence of a direct cause-and-effect relationship between the amount of the Tla1 protein and the amount of chlorophyll in C. reinhardtii. Thus, it is concluded that the Tla1 gene regulates the Chl antenna size of photosynthesis in this model green alga.
| TABLE 2 |
| Chl a/Chl b ratio and Chl content per cell in C. reinhardtii |
| wild type (WT), tla1 mutant and tla1 mutant complemented |
| with the Tla1 gene (comp1-3). Statistical error (+/âSD) |
| was <10% of the values shown. |
| Chl a/Chl b | Chl, Ă10â15 | ||
| Strain | ratio | mol/cell | |
| WT (cw15) | 2.6 | 3.2 | |
| tla1 | 6.0 | 1.1 | |
| tla1-comp1 | 2.9 | 2.8 | |
| tla1-comp2 | 3.0 | 2.2 | |
| tla1-comp3 | 2.8 | 2.4 | |
In the subsequent more detailed biochemical and molecular analyses, a comparative and quantitative evaluation of wild type, tla1 mutant, tla1-comp1 and tla1-comp2 was undertaken. When PCR was performed on the genomic DNA using âprimer 1â and âprimer 4â (Tla1 5â˛UTR/Exon-2, FIGS. 2A and 2C) wild type, tla1-comp1 and tla1-comp2 yielded a 589 bp product, whereas the tla1 mutant failed to yield a product, consistent with the absence of its 5â˛UTR region (FIG. 7A). When âprimer 7â and âprimer 4â (pJD67 3Ⲡend/Tla1 Exon-2, FIG. 2B) were used in the PCR reaction, the tla1 mutant, tla1-comp1 and tla1-comp2 generated a product of 684 bp whereas the wild type did not, consistent with the absence of the pJD67 plasmid in the latter (FIG. 7B). When Ble primers, âprimer 8â and âprimer 9â (FIG. 2C) were used for the genomic DNA PCR reaction, tla1-comp1 and tla1-comp2 yielded a product of 436 bp, whereas both wild type and tla1 mutant failed to generate a product (FIG. 7C). PCR was also employed to test for the presence of the intact full length Tla1 gene in the two complements using the âprimer 1â and âprimer 6â (Tla1 5â˛UTR/Tla1 3â˛UTR, FIG. 2A). Wild type, tla1-comp1 and tla1-comp2 gave a product of 939 bp whereas the tla1 mutant did not yield a product (FIG. 7D). When the same primers were used to perform RT-PCR, wild type, tla1-comp1 and tla1-comp2 gave a product of 823 bp, whereas the tla1 mutant did not yield a product (FIG. 7E). These results are evidence of successful complementation of the tla1 mutant by the ble-Tla1 construct.
Western Blot Analysis with Tla1-Specific Antibodies in Wild Type, Tla1 Mutant and Tla1 Complemented Strains
E. coli cells harboring the recombinant 6*His-Tla1 construct were induced for 5 h at 37° C. to overexpress the His-tagged Tla1 fusion protein. The overexpressed recombinant Tla1 protein comprised approximately 20% of the total E. coli protein (FIG. 8A). The recombinant fusion protein was purified by one-step affinity chromatography using Ni-NTA superflow columns and further concentrated by a passage through Centricon columns. Purification of the 25 kD fusion protein was confirmed by SDS-PAGE and Coomassie staining (FIG. 8B).
Tla1 specific polyclonal antibodies positively cross-reacted with the purified 25 kD recombinant Tla1 protein and at levels as low as 2 pg (FIG. 9A). Whereas the molecular weight of the native Tla1 protein is 23.2 kD, the recombinant protein was slightly larger (25 kD) because of the extra seventeen amino acids, including the 6*His tag (SEQ ID NO:33), at its N-terminal end.
Total cell extract from wild type (CC425) and the tla1 mutant were loaded on a 12.5% SDS-PAGE gel on an equal chlorophyll basis (FIG. 9B). Tla1 antibodies detected the 23.2 kD Tla1 protein in the total protein extract from the wild type and tla1 mutant (FIG. 9C). The amount of the Tla1 protein was substantially lower in the tla1 mutant compared to that in the wild type (FIG. 9C). This provides evidence that a limited translation of the tla1 mRNA did occur in the mutant, however, this is in no way comparable to the levels of translation seen in the wild type. The substantially suppressed translation level of the Tla1 protein in the tla1 mutant is attributed to the absence of the native 5â˛UTR in this strain. The apparent molecular weight of the Tla1 protein is the same in WT and tla1 mutant (FIG. 9C). This observation is consistent with the notion that the wild type Tla1 protein lacks a transit peptide and is apparently a cytoplasmic protein.
Total protein extracts from the wild type, tla1 mutant and two tla1 complements (tla1-comp1 and tla1-comp2) were resolved on a 12.5% SDS-PAGE gel, lanes loaded on an equal chlorophyll basis (FIG. 10A). Western blot analysis of the total cell extract from these samples showed that the amount of the Tla1 protein in the two complements (FIG. 10B, lanes 1 and 2) was comparable to that in the wild type (FIG. 10B, W), whereas the amount of the Tla1 protein in the tla1 mutant was substantially lower from that of the other three (FIG. 10B, lane T).
Analysis of the N-terminus sequence of the predicted Tla1 protein by ChloroP, (http://www.cbs.dtu.dk/services/ChloroP/), TargetP (http://www.cbs.dtu.dk/services/TargetP/) and MitoP (http://ihg.gsf.de/ihg/mitoprot.html) software programs failed to indicate the presence of a transit peptide, suggesting that Tla1 is a cytosolic protein. This indication was strengthened by the results of the Western blot analysis, where the mature protein size matched the predicted translation product size, suggesting absence of a cleavable transit peptide. FIG. 11 shows the hydropathy plot of the deduced amino acid sequence of the Tla1 protein, derived according to the method of Kyte & Doolittle (Kyte and Doolittle, J Mol Biol. 157:105-32982, 1982; http://occawlonline.pearsoned.com/bookbind/pubbooks/bc_mcampbell_genomicsâ1/medialib/activities/kd/kyte-doolittle.htm). The Tla1 protein contains 213 mostly hydrophilic amino acids, suggesting that it is a soluble cytosolic protein. There was a single hydrophobic domain comprising 27 amino acids between residues 42 and 69, theoretically long enough to qualify as a transmembrane domain. This hydrophobic domain of 27 amino acids is highly conserved in similar proteins from other diverse organisms, suggesting a role in the catalytic/regulatory activity of the Tla1 protein.
Tla1 Homology with Genes from Other Organisms
A Blastp (protein database using protein sequence) search showed high homology of the Tla1 protein with expressed protein sequences of Arabidopsis thaliana (GenBank Accession No. NPâ568832) Oryza sativa (japonica cultivar-group) (Accession No. CAD39888) Ustilago maydis (Accession No. EAK83164), Drosophila melanogaster (Accession No. NPâ611731), Homo sapiens (Accession No. AAQ83690), Danio rerio (zebrafish) (Accession No. NPâ956420), Rattus norvegicus (Norway rat) (Accession No. XPâ214198), Xenopus tropicalis (Accession No. NPâ989181), Mus musculus (house mouse) (Accession No. NPâ035056). In view of the Chlamydomonas reinhardtii specific codon usage, we also searched nucleotide databases using the Tla1 protein sequence (tblastnâprotein query against translated data base). EST sequences deposited from several other plant species showed fairly high homology with the Tla1, including sequences from Hordeum vulgare, Solanum tuberosum, Medicago truncatula, Lycopersicon esculentum, Gossypium arboretum, Secale cereale, Triticum aestivum, Pinus taeda, Beta vulgaris, Populus tremula, Sorghum bicolor (results not shown). It is concluded that the Tla1 gene is present in many eukaryotes, including many wild-land and crop plants.
FIG. 12A shows an alignment of the deduced amino acid sequence of the Tla1 protein from C. reinhardtii alongside that of proteins from A. thaliana, O. sativa, H. sapiens and D. melanogaster. The sequence alignment in FIG. 12A shows very high similarity between the Tla1 protein in C. reinhardtii and the related proteins in these diverse organisms. Moreover, examination of identity/similarity patterns in FIG. 12A, based on the ClustalW analysis, revealed the common occurrence of domains where high similarity or identity of amino acids is observed. The highly conserved nature of these domains across diverse species suggest a common functional role for these proteins.
These related protein sequences were also aligned pair-wise and degrees of identity, high and low similarity were calculated on the basis of a ClustalW comparison. Results from such analyses (Table 3) showed that the C. reinhardtii Tla1 protein had a 72.68% homology to the corresponding protein in A. thaliana, 75.99% homology to O. sativa, 70.94% to D. melanogaster and 67.14% to H. sapiens (CGI-112). FIG. 12B shows a phylogenetic tree of the above-mentioned Tla1 homologues, based on the amino acid sequence comparisons (www.ebi.ac.uk/clustalw/).
| TABLE 3 |
| Homology comparison of Tla1-like proteins in Chlamydomonas |
| reinhardtii, Arabidopsis thaliana, Oryza sativa, Drosophila melanogaster |
| and Homo sapiens. The % of amino acid identity, high similarity and |
| low similarity was based on a ClustalW analysis of the deduced amino |
| acid sequence of the respective proteins. |
| High | Low | |||
| Pair compared | % Identity | similarity | similarity | % Homology |
| C.r.-A.t. | 35.62 | 23.75 | 13.31 | 72.68 |
| C.r.-O.s.. | 38.27 | 23.92 | 13.8 | 75.99 |
| C.r.-D.m. | 30.54 | 23.15 | 17.24 | 70.94 |
| C.r.-H.s. | 28.09 | 24.76 | 14.28 | 67.14 |
The ability of the photosynthetic apparatus to regulate the size of the functional Chl antenna was first recognized in pioneering work by Bjorkman and co-workers, more than 30-years ago (Bjorkman et al., Carnegie Institution Yearbook 71:115-135, 1972). In spite of the substantial number of physiological and biochemical studies on this phenomenon (reviewed Anderson, Annu Rev Plant Physiol 37: 93-136, 1986; Melis, In, Oxygenic Photosynthesis: The Light Reactionsâ (D R Ort, C F Yocum, eds), Kluwer Academic Publishers, Dordrecht, The Netherlands, pp. 523-538, 1996), genes for the regulation of the Chl antenna size of photosynthesis have not been identified. The current invention is based on the discovery that Tla1 plays a role in the regulation of the chlorophyll antenna size of photosynthesis. Not to be bound by theory, Tla1 is likely to regulate the expression of other genes that directly affect the chloroplast and the Chl antenna size and may define the relationship between nucleus and organelle in green algae, thereby regulating the rate of Chl biosynthesis and by extension the Chl antenna size of the photosystems. For example, in the tla1 mutant, total amount of Chl, Lhcb gene expression, abundance of LHC polypeptides, and levels of Chl b were all down regulated (Table 2), presumably as a consequence of down-regulation of translation of the Tla1 mRNA. Sensitive absorbance-difference kinetic spectrophotometry confirmed that the tla1 mutant had a truncated PSII Chl antenna size, down to 50%, and a truncated PSI Chl antenna size, down to 67% of that in the wild type (Polle et al. 2003, supra). Thus, in the tla1 mutant, the Chl antenna size of both photosystems, as well as total chlorophyll per cell were lowered relative to the wild type.
Further evidence for the role of the Tla1 gene in the regulation of the Chl antenna size of photosynthesis was obtained from the study of C. reinhardtii diploid analysis and from Tla1 complementation studies. Diploid analysis showed that the tla1 mutation is recessive (results not shown). About 25 diploids were tested, all of which showed WT phenotype in terms of normal green coloration of the colonies, normal Chl fluorescence and normal Chl a to Chl b ratio (in the range of 2.2-3.0) as opposed to the tla1 mutant phenotype of yellow-green coloration, lower Chl fluorescence and higher Chl a to Chl b ratio. The results of the diploid analysis served as the basis upon which a functional complementation of the tla1 mutant was undertaken. This was successfully implemented (FIGS. 6 and 7) upon transformation of the tla1 strain with a WT copy of the Tla1 gene, containing about a 4.7 kb DNA sequence comprising the promoter region and its 5Ⲡflanking sequence, the 5ⲠUTR, the coding sequence with a single intron, and the 3ⲠUTR region of the Tla1 gene.
Sequence analysis of the 3â˛-insert flanking sequence from the tla1 mutant revealed that the 3Ⲡend of the plasmid was inserted within the C. reinhardtii genomic DNA, just prior to the ATG start codon of the Tla1 gene. In spite of the absence of the promoter and 5â˛UTR region of the Tla1 gene and the presence of a sizable plasmid insertion just prior to the âATGâ start codon of the Tla1 gene, RT-PCR analysis (FIG. 3) revealed the presence of Tla1 transcripts in the tla1 mutant. One possible explanation of this unusual observation is that, in the tla1 mutant, the Tla1 gene is co-transcribed along with the ARG7 gene under the control of the ARG7 gene promoter. Northern blot analyses, using the coding region of the Tla1 gene as a probe, revealed similar the Tla1-transcript size from both WT and tla1 mutant (results not shown). High molecular weight transcripts of the Tla1 gene could not be detected in the tla1 mutant, as would be expected from the unprocessed ARG7-Tla1 hybrid transcripts.
From the above characteristics (tla1 phenotype, diploid properties, complementation of the tla1 mutant with wild type Tla1 gene, and presence of Tla1 transcripts in the tla1 mutant), it is concluded that transcription of the Tla1 gene occurs in the tla1 mutant but translation of the respective mRNA is either impaired or minimized Polymorphism in the 5ⲠUTR of the Tla1 gene has not measurably affected its mRNA stability since levels of these transcripts detected by Northern blot (data not shown) and RT-PCR analysis were the same in both the wild type and mutant. However, it has had a substantial effect on the rate of translation of the respective mRNAs, as evidenced from the Western blot analysis results. In the tla1 mutant, the 5â˛UTR consists of 187 bp sequences from the 3â˛end of the plasmid pJD67. Normally, the eukaryotic translation machinery does not recognize prokaryotic sequences. This could explain the much lower translation levels of the Tla1 mRNA in the mutant relative to that in the wild type.
It is apparent from these data that in green unicellular algae the Tla1 gene acts as an early component affecting the molecular regulatory mechanism for the Chl antenna size in of oxygenic photosynthesis. A genetic tendency of the algae to assemble large arrays of light absorbing chlorophyll antenna molecules in their photosystems is a survival strategy and a competitive advantage in the wild, where light is often limiting (Kirk, Light and photosynthesis in aquatic ecosystems, 2nd edn. Cambridge University Press, Cambridge, England, 1994). This property of the algae is detrimental to the yield and productivity in a mass culture under direct sunlight (Melis, Trends in Plant Science 4: 130-135, 1999), however. A truncated Chl antenna size, which would compromise the ability of the strain to compete and survive in the wild, is helpful in a controlled mass culture environment in photoreactors in diminishing the over-absorption and wasteful dissipation of excitation energy by individual cells. The size reduction of the Chl antenna will also diminish photoinhibition of photosynthesis (Powles, Annu Rev Plant Physiol 35: 15-44, 1984; Melis, 1999, supra) at the surface while permitting for greater transmittance of light deeper into the culture (Melis, 2005, supra). Such altered optical properties of the cells result in greater photosynthetic productivity and enhanced solar conversion efficiency by the culture as a whole. In support of this contention, preliminary experiments (Powles, Annu Rev Plant Physiol 35: 15-44, 1984) confirmed that a smaller Chl antenna size would result in a relatively higher light intensity for the saturation of photosynthesis in individual cells, while permitting for an overall greater solar conversion efficiency and productivity by the mass culture (Powles, Annu Rev Plant Physiol 35: 15-44, 1984). Thus, the Tla1 gene can be useful as a target to down-regulation Chl antenna size, e.g., in green microalgae.
The above examples are provided by way of illustration only and not by way of limitation. Those of skill in the art will readily recognize a variety of noncritical parameters that could be changed or modified to yield essentially similar results.
All publications, accession numbers, and patent applications cited in this specification are herein incorporated by reference as if each individual publication or patent application were specifically and individually indicated to be incorporated by reference.
| Table of Exemplary Tla1 nucleic acid and polypeptide sequences |
| SEQ ID NO: 1 Tla1 cDNA sequence--coding sequence 105-746 |
| 1 | ggaacctcga tgtcgtgttg actttgcgtt acaaccgtga agtatattag aactcatttg |
| 61 | cctgccacaa cctcagacca agagacgcgc gaaaaactga cacgatgact ttcagctgct |
| 121 | ccgctgacca aaccgcgctc ttaaagattc ttgcacacgc ggctaagtat ccatcaaata |
| 181 | gcgtgaatgg tgtcctcgtc gggacagcga aggagggcgg ctctgtcgaa atcctggacg |
| 241 | cgattccact gtgtcacacg acgctgaccc tggcgccagc actggagata ggtctcgccc |
| 301 | aggtggagtc ctacacgcat atcacgggca gcgtggcgat tgtgggctac taccaatcag |
| 361 | acgcacgttt cggccccggg gacctacccc cgctaggtcg caaaattgcg gacaaggtgt |
| 421 | ctgagcacca ggctcaggcg gtggtgctgg tgctggacaa caagcggctg gagcagttct |
| 481 | gcaaggcgca ggcggacaac ccgttcgagc tgttcagcaa ggatggcagc aagggttgga |
| 541 | agcgcgcgag cgccgatggc ggagagctgg cgcttaaaaa cgcggactgg aagaagctgc |
| 601 | gcgaggagtt cttcgttatg ttcaagcagc tgaagcaccg gacactccac gattttgagg |
| 661 | agcacctgga cgacgccggg aaagactggc tcaacaaggg cttcgcctcc tcggtcaaat |
| 721 | tcctgttgcc cggcaacgcg ctgtaagggc cgcgtgaggc tagccgggat ggcggttccg |
| 781 | cgggatggtc gcagtgccgg ggtgtgtgtt gagaggagga gccggtgggg gggaaagagg |
| 841 | ttgaggaggt aggagagagg cgctggcatg gaggccggga ggcgctggag ctggagctgg |
| 901 | cgagctggtg ggtggtgctg ggcgagatcc tggaggcaca ggagtggtat gggcggtgca |
| 961 | gggacagcga cagcggatcg gcggacggta ttggtggagg gtgcgggggc cctggggtag |
| 1021 | tgtgcagggt gtgtgccacg tggcttgccg caaagcgcag cgtaccgata gttgagagaa |
| 1081 | agcacctgcg gccctgcgcg gccgcggcgt ggcggcgcgt ggggacacgc gcatcgtgcc |
| 1141 | gggtcgccgc aggccggagt gaatttcgtg ctgcacggcg cgttgaccag tccaccgact |
| 1201 | gacggccaac ggccatgagg gcttgttttg ggggataggg tcacatgaca ttttcggcgt |
| 1261 | tctttgcagt cagaatcagg atacgcttgc tttagtcttg attgtcagac ttgtcaggct |
| 1321 | gacgtttcag gcagacgaga gctcatgtgg ttttgactaa ccgggcgttg accatgggca |
| 1381 | gtcccaaacg tgccgtgcca cagggcatag cgagtgccat gtgctctcga gggcgaggtc |
| 1441 | gtgaggcacg tggaaactgt tgcggcgcct tcaccatggg tgctttctcg cgtgaggcac |
| 1501 | gtgaaactgt tgcggcgcct tcaccatggg tgctctctct cgtgaggctc agcggcaagt |
| 1561 | accagggagg gcgcaagaca cggatgaagc agtggttgcg catgccgcgg tctgttggcc |
| 1621 | gccgggaggt gatcggtgtg acgtggctgg tgcgtgtggt ggtttctccc gtggcctccc |
| 1681 | gtgtgtgact ggtgcgtgtt tgacgtggca aggtaggtaa atagtagtaa agcggcccag |
| 1741 | atacgttgct gtggcggttg tgcgtgcgca ggtggtgcat aggacagcgt tggttgtgtg |
| 1801 | tgcctgtgct gtgctgtgcg gtgccggacc gaagcgcggg gcggacaggc gcagggtggt |
| 1861 | agcggcgtgg cgggtaggct gccgcacaca gtacgtgtaa ctgtatgctg cgctgcatgt |
| 1921 | tactctgctt acggatgctt cctgactgta cgtgtggtgc ttgggtcgtg tcgccgtgca |
| 1981 | acgctgctgg cggcttcaat gggtggctgc ggatcagtgg gtggctgcgt gtatcggcgc |
| 2041 | gcccgtgttg aatcgaggac tgcag |
| SEQ ID NO: 2 Tla1 polypeptide sequence |
| MTFSCSADQTALLKILAHAAKYPSNSVNGVLVGTAKEGGSVEILDAIPLCHTTLTLAP |
| ALEIGLAQVESYTHITGSVAIVGYYQSDARFGPGDLPPLGRKIADKVSEHQAQAVVL |
| VLDNKRLEQFCKAQADNPFELFSKDGSKGWKRASADGGELALKNADWKKLREEFF |
| VMFKQLKHRTLHDFEEHLDDAGKDWLNKGFASSVKFLLPGNAL |
| Conserved Domains (SEQ ID NOs: 24-28): |
| Domain A: amino acid positions 9-33 (QTALLKILAHAAKYPSNSVNGVLVG) |
| Domain B: amino acid positions 41-70 (VEILDAIPLCHTTLTLAPALEIGLAQVESY) |
| Domain C: amino acid positions 75-129 |
| (GSVAIVGYYQSDARFGPGDLPPLGRKIADKVSEHQAQAVVLVLDNKRLEQFCKAQ) |
| Domain D: amino acid positions 135-163 (ELFSKDGSKGWKRASADGGELALKNADWK) |
| Domain E: amino acid positions 177-200 (KHRTLHDFEEHLDDAGKDWLNKGF) |
| SEQ ID NO: 3 Tla1 genomic sequence |
| 1 | ggaacctcga tgtcgtgttg actttgcgtt acaaccgtga agtatattag aactcatttg |
| 61 | cctgccacaa cctcagacca agagacgcgc gaaaaactga cacgatgact ttcagctgct |
| 121 | ccgctgacca aaccgcgctc ttaaagattc ttgcacacgc ggctaagtat ccatcaaata |
| 181 | gcgtgaatgg tgtcctcgtc gggacagcga aggagggcgg ctctgtcgaa atcctggacg |
| 241 | cgattccact gtgtcacacg acgctgaccc tggcgccagc actggagata ggtctcgccc |
| 301 | aggtgcgcat ggccccgaga gcccggggcg tggcttgtgc tcgtcgatct gcgtgcatta |
| 361 | gttaccgcat cgctcccatg ctgcattccg cgctcagcct caaataccct gattgcaggt |
| 421 | ggagtcctac acgcatatca cgggcagcgt ggcgattgtg ggctactacc aatcagacgc |
| 481 | acgtttcggc cccggggacc tacccccgct aggtcgcaaa attgcggaca aggtgtctga |
| 541 | gcaccaggct caggcggtgg tgctggtgct ggacaacaag cggctggagc agttctgcaa |
| 601 | ggcgcaggcg gacaacccgt tcgagctgtt cagcaaggat ggcagcaagg gttggaagcg |
| 661 | cgcgagcgcc gatggcggag agctggcgct taaaaacgcg gactggaaga agctgcgcga |
| 721 | ggagttcttc gttatgttca agcagctgaa gcaccggaca ctccacgatt ttgaggagca |
| 781 | cctggacgac gccgggaaag actggctcaa caagggcttc gcctcctcgg tcaaattcct |
| 841 | gttgcccggc aacgcgctgt aagggccgcg tgaggctagc cgggatggcg gttccgcggg |
| 901 | atggtcgcag tgccggggtg tgtgttgaga ggaggagccg gtggggggga aagaggttga |
| 961 | ggaggtagga gagaggcgct ggcatggagg ccgggaggcg ctggagctgg agctggcgag |
| 1021 | ctggtgggtg gtgctgggcg agatcctgga ggcacaggag tggtatgggc ggtgcaggga |
| 1081 | cagcgacagc ggatcggcgg acggtattgg tggagggtgc gggggccctg gggtagtgtg |
| 1141 | cagggtgtgt gccacgtggc ttgccgcaaa gcgcagcgta ccgatagttg agagaaagca |
| 1201 | cctgcggccc tgcgcggccg cggcgtggcg gcgcgtgggg acacgcgcat cgtgccgggt |
| 1261 | cgccgcaggc cggagtgaat ttcgtgctgc acggcgcgtt gaccagtcca ccgactgacg |
| 1321 | gccaacggcc atgagggctt gttttggggg atagggtcac atgacatttt cggcgttctt |
| 1381 | tgcagtcaga atcaggatac gcttgcttta gtcttgattg tcagacttgt caggctgacg |
| 1441 | tttcaggcag acgagagctc atgtggtttt gactaaccgg gcgttgacca tgggcagtcc |
| 1501 | caaacgtgcc gtgccacagg gcatagcgag tgccatgtgc tctcgagggc gaggtcgtga |
| 1561 | ggcacgtgga aactgttgcg gcgccttcac catgggtgct ttctcgcgtg aggcacgtga |
| 1621 | aactgttgcg gcgccttcac catgggtgct ctctctcgtg aggctcagcg gcaagtacca |
| 1681 | gggagggcgc aagacacgga tgaagcagtg gttgcgcatg ccgcggtctg ttggccgccg |
| 1741 | ggaggtgatc ggtgtgacgt ggctggtgcg tgtggtggtt tctcccgtgg cctcccgtgt |
| 1801 | gtgactggtg cgtgtttgac gtggcaaggt aggtaaatag tagtaaagcg gcccagatac |
| 1861 | gttgctgtgg cggttgtgcg tgcgcaggtg gtgcatagga cagcgttggt tgtgtgtgcc |
| 1921 | tgtgctgtgc tgtgcggtgc cggaccgaag cgcggggcgg acaggcgcag ggtggtagcg |
| 1981 | gcgtggcggg taggctgccg cacacagtac gtgtaactgt atgctgcgct gcatgttact |
| 2041 | ctgcttacgg atgcttcctg actgtacgtg tggtgcttgg gtcgtgtcgc cgtgcaacgc |
| 2101 | tgctggcggc ttcaatgggt ggctgcggat cagtgggtgg ctgcgtgtat cggcgcgccc |
| 2161 | gtgttgaatc gaggactgca g |
1. A method of decreasing chlorophyll antenna size in a plant, the method comprising:
inhibiting expression of a Tla1 nucleic acid in a plant by introducing into the plant an expression cassette comprising a promoter operably linked to a polynucleotide, or a complement thereof, that specifically hybridizes to a nucleic acid that is at least 70% identical to at least 200 contiguous nucleotides of the Tla1 nucleic acid; and
selecting a plant with decreased chlorophyll antenna size compared to a plant in which the expression cassette has not been introduced.
2. The method of claim 1, wherein the promoter is constitutive.
3. The method of claim 1, wherein the promoter is inducible.
4. The method of claim 1, wherein the polynucleotide is operably linked to the promoter in the antisense orientation.
5. The method of claim 1, wherein the polynucleotide is operably linked to the promoter in the sense orientation.
6. The method of claim 1, wherein the plant is green algae.
7. A plant comprising an expression cassette comprising a polynucleotide, or a complement thereof, that specifically hybridizes to a nucleic acid that is at least 70% highest percent identity to at least 200 contiguous nucleotides of a Tla1 nucleic acid.
8. The plant of claim 7, wherein the plant is green algae.
9. A method of enhancing yields of photosynthetic productivity under high-density growth conditions, the method comprising cultivating a plant of claim 7 under bright sunlight and high density growth conditions.
10. A method of enhancing production of a compound of interest, the method comprising suppressing Tla1 gene expression in a plant; and cultivating the plant under conditions in which the compound is produced.
11. The method of claim 10, wherein the plant is green algae.
12. The method of claim 11, wherein the compound is H2, biodiesel, Beta-carotene, lutein, zeaxanthin, or astaxanthinproduction production, the method comprising suppressing Tla1 gene expression in a plante to be used for H2 production; and cultivating the plant under conditions in which H2 is produced.