US20150267224A1
2015-09-24
14/729,507
2015-06-03
Various 1-alkenes, including 1-nonadecene and 1-octadecene, are synthesized by the engineered microorganisms and methods of the invention. In certain embodiments, the microorganisms comprise recombinant 1-alkene synthases. The engineered microorganisms may be photosynthetic microorganisms such as cyanobacteria.
Get notified when new applications in this technology area are published.
C12P5/026 » CPC main
Preparation of hydrocarbons or halogenated hydrocarbons acyclic Unsaturated compounds, i.e. alkenes, alkynes or allenes
C12P5/02 IPC
Preparation of hydrocarbons or halogenated hydrocarbons acyclic
This application claims priority to earlier filed U.S. patent application Ser. No. 12/821,107, filed Jun. 22, 2010, which claims the benefit of earlier filed U.S. Provisional Patent Application No. 61/219,369, filed Jun. 22, 2009, the disclosures of which are incorporated herein by reference.
The instant application contains a Sequence Listing which has been submitted in ASCII format via EFS-Web and is hereby incorporated by reference in its entirety. Said ASCII copy, created on Jun. 3, 2015, is named â22547_US_sequence listing.txtâ and is 107,384 bytes in size.
This invention generally relates to genes useful in producing carbon-based products of interest in host cells. The invention also relates to methods for producing fuels and chemicals through engineering metabolic pathways in photosynthetic and non-photosynthetic organisms.
Unsaturated linear hydrocarbons such as Îą-olefins or 1-alkenes are an industrially important group of molecules which can serve as lubricants and surfactants in addition to being used in fuels. The biosynthesis of organic chemicals can provide an efficient alternative to chemical synthesis. Thus, a need exists for microbial strains which can make increased yields of hydrocarbons, particularly terminal alkenes.
The invention relates to a metabolic system and methods employing such systems in the production of fuels and chemicals. Various microorganisms are genetically engineered to increase 1-alkene synthase activity for the production of alkenes (also referred to as olefins), particularly 1-alkenes, including 1-nonadecene and 1-octadecene.
The invention provides isolated polynucleotides comprising or consisting of nucleic acid sequences selected from the group consisting of coding sequences for a 1-alkene synthase and/or an A1174 hydrolase, expression optimized variants for these nucleic acid sequences and related nucleic acid sequences and fragments. The invention also provides vectors and host cells comprising the isolated polynucleotides.
The invention further provides isolated polypeptides comprising or consisting of polypeptide sequences selected from the group consisting of sequences encoded by a 1-alkene synthase gene, and related polypeptide sequences, fragments and fusions. The invention also provides isolated polypeptides comprising or consisting of polypeptide sequences selected from the group consisting of sequences encoded by an A1174 hydrolase gene, and related polypeptide sequences, fragment and fusions. Antibodies that specifically bind to the isolated polypeptides are also provided.
The invention also provides methods for expressing in a host cell a heterologous nucleic acid sequence encoding improved 1-alkene synthase activity in a 1-alkene biosynthetic pathway.
The invention also provides a coding sequence of a 1-alkene synthase activity, a nucleic acid sequence that is an expression optimized coding sequence of a 1-alkene synthase activity gene and related nucleic acid sequences and fragments. Likewise, the invention provides a coding sequence of an A1174 hydrolase activity and related nucleic acid sequences and fragments.
The invention described herein provides a gene which can be over-expressed in a range of organisms and which encodes an enzyme involved in the synthesis of 1-alkenes and other carbon-based products of interest. Over-expression of the gene can be used in combination with other genes to achieve high levels of 1-alkene production. Organisms such as a recombinant or photosynthetic bacterium (for example, cyanobacteria) can be genetically modified to optimize production of 1-alkenes using light, water and carbon dioxide. Alternatively, microorganisms can be engineered to produce 1-alkenes directly or indirectly from exogenously added carbon substrates.
In one embodiment, the invention provides an isolated or recombinant polynucleotide comprising or consisting of a nucleic acid sequence selected from the group consisting of: SEQ ID NO:1 or SEQ ID NO:3; a nucleic acid sequence that is a degenerate variant of SEQ ID NO:1 or SEQ ID NO:3; a nucleic acid sequence at least 71%, at least 72%, at least 73%, at least 74%, at least 75%, at least 76%, at least 77%, at least 78%, at least 79%, at least 80%, at least 81%, at least 82%, at least 83%, at least 84%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or at least 99.5% identical to SEQ ID NO:1 or SEQ ID NO:3; a nucleic acid sequence that encodes a polypeptide having the amino acid sequence of SEQ ID NO:2 or SEQ ID NO:4; a nucleic acid sequence that encodes a polypeptide at least 50%, at least 55%, at least 60%, at least 65%, at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%%, at least 99.1%, at least 99.2%, at least 99.3%, at least 99.4%, at least 99.5%, at least 99.6%, at least 99.7%, at least 99.8% or at least 99.9% identical to SEQ ID NO:2 or SEQ ID NO:4; and a nucleic acid sequence that hybridizes under stringent conditions to SEQ ID NO:1 or SEQ ID NO:3.
In another embodiment, the invention provides the isolated or recombinant polynucleotide of the previous paragraph, wherein the nucleic acid sequence encodes a polypeptide having 1-alkene synthase activity. In yet another embodiment, the isolated or recombinant polynucleotide encodes a polypeptide having an A1174 hydrolase activity. In yet another embodiment, the invention provides the isolated polynucleotide of the previous paragraph, wherein the nucleic acid sequence and the sequence of interest are operably linked to one or more expression control sequences. In another embodiment, the invention provides a vector comprising one of the polynucleotides in the previous paragraph. In yet another embodiment, the invention provides a host cell comprising a recombinant or isolated polynucleotide described in the previous paragraph. In a related embodiment, the host cell is selected from the group consisting of prokaryotes, eukaryotes, yeasts, filamentous fungi, protozoa, algae and synthetic cells. In yet another embodiment, the host cell produces carbon-based products of interest. In still another embodiment, the invention provides an isolated antibody or antigen-binding fragment or derivative thereof which binds selectively to one of the isolated polypeptides of the previous paragraph.
The invention also provides a method of genetically engineering an organism to increase expression of a 1-alkene synthase, comprising modifying the promoter of an endogenous 1-alkene synthase, recombinantly expressing an endogenous 1-alkene synthase in said organism, or by increasing read-through of a promoter upstream of the promoter for the organism's endogenous 1-alkene synthase by, e.g., removing the structural gene encoded by the upstream promoter.
The invention also provides a method for identifying a modified gene that improves 1-alkene synthesis by a microorganism, comprising: modifying a gene encoding a 1-alkene synthase by employing rational design, error prone PCR, site-directed mutagenesis, whole gene site saturation mutagenesis, site-directed site saturation mutagenesis, gene shuffling or correlated site saturation mutagenesis; expressing the modified synthase gene in a host cell; and screening the host cell for increased 1-alkene synthase activity (e.g., measuring increased production of 1-nonadecene or another 1-alkene of interest). In yet another embodiment, the invention provides improved enzymes identified by the aforementioned method, wherein said enzyme is characterized by improved substrate affinity, substrate catalytic conversion rate, improved thermostability, activity at a different pH, or optimized codon usage for improved expression in a host cell. In yet another embodiment, the invention provides nucleic acids encoded the aforementioned 1-alkene synthases, wherein said nucleic acid is characterized by, e.g., increased stability and/or expression when expressed in a transformed microorganism.
In yet another embodiment, the invention provides a method for the biosynthetic production of 1-alkenes, comprising: culturing an engineered microorganism in a culture medium, wherein said engineered microorganism comprises a recombinant 1-alkene synthase, and wherein said engineered microorganism produces 1-alkenes, and wherein the amount of said 1-alkenes produced by said engineered microorganism is greater than the amount that would be produced by an otherwise identical microorganism, cultured under identical conditions, but lacking said recombinant 1-alkene synthase. In a related embodiment, the amount of 1-nonadecene produced is at least two times, at least three times, or between two and ten times the amount produced by an otherwise identical microorganism lacking said recombinant 1-alkene synthase. In another related embodiment, the amount of 1-nonadecene produced is at least 0.75% dry cell weight (âDCWâ). In a related embodiment, the recombinant 1-alkene synthase is an endogenous 1-alkene synthase expressed, at least in part, from a promoter other than its native promoter. In yet another related embodiment, the recombinant 1-alkene synthase is a heterologous 1-alkene synthase. In yet another related embodiment, the recombinant 1-alkene synthase is expressed from a heterologous promoter. In yet another related embodiment, the 1-alkene synthase is endogenous to said microorganism but is recombinantly expressed from a heterologous promoter.
In another embodiment of the method for producing 1-alkenes, the engineered microorganism is a photosynthetic microorganism, wherein exposing said engineered microorganism to light and carbon dioxide results in the production of alkenes by said microorganism. In a related embodiment, the engineered microorganism is a cyanobacterium. In yet another embodiment of the method for producing 1-alkenes, the 1-alkenes are selected from the group consisting of 1-nonadecene and 1-octadecene. In yet another embodiment of the method, said 1-alkenes are isolated from said cyanobacterium or said culture medium. In yet another embodiment, exogenous fatty acids acids are added to said culture medium as a substrate for said recombinant 1-alkene synthase.
In another embodiment, the invention provides a method for the biosynthetic production of an olefin, comprising (1) culturing a cyanobacterium in a culture medium, wherein said cyanobacterium comprises a 1-alkene synthase activity, and wherein said culture medium comprises an exogenous fatty acid; and (2) exposing said engineered cyanobacterium to light and carbon dioxide, wherein said exposure results in the production of an olefin by said cyanobacterium, and wherein the amount of said olefin produced is greater than the amount that would be produced by an otherwise identical cyanobacterium, cultured under identical conditions but in the absence of said exogenous fatty acid. In a related embodiment, the concentration of exogenously added fatty acid in said culture medium is at least 1 Îźg/ml. In other related embodiments, the concentration is at least 10 Îźg/ml, at least 50 Îźg/ml, at least 100 Îźg/ml, at least 500 Îźg/ml, at least 1 mg/ml, at least 10 mg/ml, at least 50 mg/ml, at least 100 mg/ml, or at least 500 mg/ml or a range between any two of these concentrations (i.e., between 1 Îźg/ml and 500 mg/ml). In yet another related embodiment, the fatty acid is an odd-chain fatty acid, such as, e.g., tridecanoic acid. In yet another related embodiment, the fatty acid is tridecanoic acid and the olefin produced is 1-octadecene. In yet another related embodiment, the amount of said 1-octadecene produced is at least 0.01% dry cell weight (âDCWâ), at least 0.039% dry cell weight, at least 0.05% dry cell weight, at least 0.1% dry cell weight. In yet another related embodiment, the amount of said 1-octadecene produced is between 0.3% dry cell weight and 1% dry cell weight. In yet another related embodiment, the % DCW of said 1-octadecene produced is at least half the % DCW of 1-nonadecene produced by the microorganism. In yet another related embodiment, the fatty acid is an even-chain fatty acid and the olefin produced is 1-nonadecene. In yet another related embodiment, the olefin produced is isolated from said cyanobacterium or said culture medium.
In yet another embodiment, the invention provides a method for the biosynthetic production of alkenes, comprising (1) culturing an engineered microorganism in a culture medium, wherein said engineered microorganism comprises a modification, wherein said modification reduces the activity of an A1174 hydrolase native to said cyanobacterium; and (2) exposing said engineered microorganism to light and carbon dioxide, wherein said exposure results in the production of alkenes by said engineered microogransims, wherein said alkenes comprise 1-alkenes, and wherein the amount of 1-alkenes produced is greater than the amount that would be produced by an otherwise identical cyanobacterium, cultured under identical conditions, but lacking said modification. In a related embodiment, the 1-alkenes include 1-nonadecene. In yet another related embodiment, the microorganism is a cyanobacteria.
In yet another embodiment, the invention provides an engineered cyanobacterium, wherein said cyanobacterium comprises a mutation in an A1174 hydrolase, wherein the mutation reduces the activity of said hydrolase. In yet another embodiment, the mutation is a knockout mutation, e.g., a deletion of all or part of the structural gene encoding the A1174 hydrolase.
In yet another embodiment, the invention provides an engineered cell for the production of olefins, wherein said cell comprises a recombinant nonA gene, and wherein the activity of the protein encoded by said nonA gene is greater than the activity of said protein in an otherwise identical cell lacking said recombinant nonA gene. In a related embodiment, the recombinant nonA gene is a heterologous gene. In yet another related embodiment, the recombinant nonA gene comprises a recombinant promoter. In yet another related embodiment, the engineered cyanobacterium comprises a deletion of all or part of the structural gene encoding the A1174 hydrolase.
In yet another embodiment, the invention provides an engineered cyanobacterium, wherein said cyanobacterium comprises a nonA knockout.
In various related embodiments, the 1-alkene synthase in the methods and compositions recited above is at least 50%, at least 60%, at least 70%, at least 80%, at least 85%, at least 80%, or at least 95% identical to the 1-alkene synthase of SEQ ID NO:2, SEQ ID NO:8 or SEQ ID NO:9. In yet other embodiments, the 1-alkene synthase is identical to the 1-alkene synthase of SEQ ID NO:2, SEQ ID NO:8 or SEQ ID NO:9.
In various related embodiments, the microorganism in the methods and compositions recited above is E. coli. In other related embodiments, the microorganism is a species of Synechococcus. In still other related embodiments, the microorganism is Synechococcus sp. PCC 7002.
Additional information related to the invention may be found in the following Drawings and Detailed Description.
FIG. 1 shows a representation of the domains found in the 1-alkene synthase YPâ001734428 (NonA), as identified by the conserved domain (CD) searching program available on the NCBI website. Abbreviations for domains: acyl-carrier protein (ACP); phosphopantetheinyl (PP); ketosynthase (KS); acyltransferase (AT); ketoreductase (KR); sulfotransferase (ST); and thioesterase (TE). By reference to the YPâ001734428 gene sequence, the domains are located at the following residues: LuxE domain: 10-557; ACP domain: 598-675; KS domain: 693-1095; AT domain: 1216-1490; KR domain: 1777-1943; ST domain: 2145-2360; TE domain: 2449-2708.
FIG. 2 summarizes the Claisen condensation catalyzed by polyketide synthases (PKSs). In step 1, an acyltransferase (AT) catalyzes thioester exchange between a specific extender unit (in this case malonyl-CoA) and a thiol group on a pantetheinyl group attached to an ACP. CoA is displaced in this reaction. All ACPs must be post-translationally modified by a phosphopantetheinyl transferase in order to be active. In step 2, the (poly)ketide chain is transferred from the upstream ACP to an active site serine on the KS as the extender unit undergoes decarboxylation. In step 3, the ester linkage on the KS undergoes nucleophilic attack by the carbanion to yield a new polyketide chain that has been extended by two carbons.
FIG. 3 illustrates the putative mechanism of 1-nonadecene biosynthesis from stearic acid, stearyl-ACP or stearyl-CoA. AT, acyltransferase; ACP, acyl-carrier protein; KS, ketosynthase; KR, ketoreductase; ST, sulfotransferase; TE, thioesterase.
FIG. 4 shows the MS fragmentation patterns of 1-nonadecene (left) and the corresponding peak in the JCC138 cell pellet extract (right).
FIG. 5 shows GC/FID chromatograms in stacked form allowing comparison of the cell pellet extracts from the indicated cyanobacterial strains. The interval between tick marks on the FID response axis is 100,000. *Nonadecadiene co-elutes with an unrelated metabolite under these conditions. BHT=butylated hydroxytoluene
FIG. 6 shows GC/FID chromatograms in stacked form allowing comparison of the acetone cell pellet extracts of JCC138 incubated with 0, 2.8 or 11.2 mg of tridecanoic acid. The interval between tick marks on the FID response axis is 10,000. *Nonadecadiene co-elutes with an unrelated metabolite under these conditions.
FIG. 7 shows MS fragmentation spectra of the JCC138 1-octadecene peak (top mass spectrum) plotted against the 1-octadecene spectrum in the NIST library (bottom mass spectrum).
Unless otherwise defined herein, scientific and technical terms used in connection with the invention shall have the meanings that are commonly understood by those of ordinary skill in the art. Further, unless otherwise required by context, singular terms shall include the plural and plural terms shall include the singular. Generally, nomenclatures used in connection with, and techniques of, biochemistry, enzymology, molecular and cellular biology, microbiology, genetics and protein and nucleic acid chemistry and hybridization described herein are those well known and commonly used in the art. The methods and techniques are generally performed according to conventional methods well known in the art and as described in various general and more specific references that are cited and discussed throughout the present specification unless otherwise indicated. See, e.g., Sambrook et al. Molecular Cloning: A Laboratory Manual, 2d ed., Cold Spring Harbor Laboratory Press, Cold Spring Harbor, N.Y. (1989); Ausubel et al., Current Protocols in Molecular Biology, Greene Publishing Associates (1992, and Supplements to 2002); Harlow and Lane, Antibodies: A Laboratory Manual, Cold Spring Harbor Laboratory Press, Cold Spring Harbor, N.Y. (1990); Taylor and Drickamer, Introduction to Glycobiology, Oxford Univ. Press (2003); Worthington Enzyme Manual, Worthington Biochemical Corp., Freehold, N.J.; Handbook of Biochemistry: Section A Proteins, Vol. I, CRC Press (1976); Handbook of Biochemistry: Section A Proteins, Vol. II, CRC Press (1976); Essentials of Glycobiology, Cold Spring Harbor Laboratory Press (1999).
The following terms, unless otherwise indicated, shall be understood to have the following meanings
The term âpolynucleotideâ or ânucleic acid moleculeâ refers to a polymeric form of nucleotides of at least 10 bases in length. The term includes DNA molecules (e.g., cDNA or genomic or synthetic DNA) and RNA molecules (e.g., mRNA or synthetic RNA), as well as analogs of DNA or RNA containing non-natural nucleotide analogs, non-native inter-nucleoside bonds, or both. The nucleic acid can be in any topological conformation. For instance, the nucleic acid can be single-stranded, double-stranded, triple-stranded, quadruplexed, partially double-stranded, branched, hair-pinned, circular, or in a padlocked conformation.
Unless otherwise indicated, and as an example for all sequences described herein under the general format âSEQ ID NO:â, ânucleic acid comprising SEQ ID NO:1â refers to a nucleic acid, at least a portion of which has either (i) the sequence of SEQ ID NO:1, or (ii) a sequence complementary to SEQ ID NO:1. The choice between the two is dictated by the context. For instance, if the nucleic acid is used as a probe, the choice between the two is dictated by the requirement that the probe be complementary to the desired target.
An âisolatedâ or âsubstantially pureâ nucleic acid or polynucleotide (e.g., an RNA, DNA or a mixed polymer) is one which is substantially separated from other cellular components that naturally accompany the native polynucleotide in its natural host cell, e.g., ribosomes, polymerases and genomic sequences with which it is naturally associated. The term embraces a nucleic acid or polynucleotide that (1) has been removed from its naturally occurring environment, (2) is not associated with all or a portion of a polynucleotide in which the âisolated polynucleotideâ is found in nature, (3) is operatively linked to a polynucleotide which it is not linked to in nature, or (4) does not occur in nature. The term âisolatedâ or âsubstantially pureâ also can be used in reference to recombinant or cloned DNA isolates, chemically synthesized polynucleotide analogs, or polynucleotide analogs that are biologically synthesized by heterologous systems.
However, âisolatedâ does not necessarily require that the nucleic acid or polynucleotide so described has itself been physically removed from its native environment. For instance, an endogenous nucleic acid sequence in the genome of an organism is deemed âisolatedâ herein if a heterologous sequence is placed adjacent to the endogenous nucleic acid sequence, such that the expression of this endogenous nucleic acid sequence is altered. In this context, a heterologous sequence is a sequence that is not naturally adjacent to the endogenous nucleic acid sequence, whether or not the heterologous sequence is itself endogenous (originating from the same host cell or progeny thereof) or exogenous (originating from a different host cell or progeny thereof). By way of example, a promoter sequence can be substituted (e.g., by homologous recombination) for the native promoter of a gene in the genome of a host cell, such that this gene has an altered expression pattern. This gene would now become âisolatedâ because it is separated from at least some of the sequences that naturally flank it.
A nucleic acid is also considered âisolatedâ if it contains any modifications that do not naturally occur to the corresponding nucleic acid in a genome. For instance, an endogenous coding sequence is considered âisolatedâ if it contains an insertion, deletion or a point mutation introduced artificially, e.g., by human intervention. An âisolated nucleic acidâ also includes a nucleic acid integrated into a host cell chromosome at a heterologous site and a nucleic acid construct present as an episome. Moreover, an âisolated nucleic acidâ can be substantially free of other cellular material or substantially free of culture medium when produced by recombinant techniques or substantially free of chemical precursors or other chemicals when chemically synthesized.
The term ârecombinantâ refers to a biomolecule, e.g., a gene or protein, that (1) has been removed from its naturally occurring environment, (2) is not associated with all or a portion of a polynucleotide in which the gene is found in nature, (3) is operatively linked to a polynucleotide which it is not linked to in nature, or (4) does not occur in nature. The term ârecombinantâ can be used in reference to cloned DNA isolates, chemically synthesized polynucleotide analogs, or polynucleotide analogs that are biologically synthesized by heterologous systems, as well as proteins and/or mRNAs encoded by such nucleic acids. For example, a ârecombinant 1-alkene synthaseâ can be a protein encoded by a heterologous 1-alkene synthase gene; or a protein encoded by a duplicate copy of an endogenous 1-alkene synthase gene; or a protein encoded by a modified endogenous 1-alkene synthase gene; or a protein encoded by an endogenous 1-alkene synthase gene expressed from a heterologous promoter; or a protein encoded by an endogenous 1-alkene synthase gene where expression is driven, at least in part, by an endogenous promoter different from the organism's native 1-alkene synthase promoter.
As used herein, the phrase âdegenerate variantâ of a reference nucleic acid sequence encompasses nucleic acid sequences that can be translated, according to the standard genetic code, to provide an amino acid sequence identical to that translated from the reference nucleic acid sequence. The term âdegenerate oligonucleotideâ or âdegenerate primerâ is used to signify an oligonucleotide capable of hybridizing with target nucleic acid sequences that are not necessarily identical in sequence but that are homologous to one another within one or more particular segments.
The term âpercent sequence identityâ or âidenticalâ in the context of nucleic acid sequences refers to the residues in the two sequences which are the same when aligned for maximum correspondence. The length of sequence identity comparison may be over a stretch of at least about nine nucleotides, usually at least about 20 nucleotides, more usually at least about 24 nucleotides, typically at least about 28 nucleotides, more typically at least about 32 nucleotides, and preferably at least about 36 or more nucleotides. There are a number of different algorithms known in the art which can be used to measure nucleotide sequence identity. For instance, polynucleotide sequences can be compared using FASTA, Gap or Bestfit, which are programs in Wisconsin Package Version 10.0, Genetics Computer Group (GCG), Madison, Wis. FASTA provides alignments and percent sequence identity of the regions of the best overlap between the query and search sequences. Pearson, Methods Enzymol. 183:63-98 (1990) (hereby incorporated by reference in its entirety). For instance, percent sequence identity between nucleic acid sequences can be determined using FASTA with its default parameters (a word size of 6 and the NOPAM factor for the scoring matrix) or using Gap with its default parameters as provided in GCG Version 6.1, herein incorporated by reference. Alternatively, sequences can be compared using the computer program, BLAST (Altschul et al., J. Mol. Biol. 215:403-410 (1990); Gish and States, Nature Genet. 3:266-272 (1993); Madden et al., Meth. Enzymol. 266:131-141 (1996); Altschul et al., Nucleic Acids Res. 25:3389-3402 (1997); Zhang and Madden, Genome Res. 7:649-656 (1997)), especially blastp or tblastn (Altschul et al., Nucleic Acids Res. 25:3389-3402 (1997)).
A particular, non-limiting example of a mathematical algorithm utilized for the comparison of sequences is that of Karlin and Altschul (Proc. Natl. Acad. Sci. (1990) USA 87:2264-68; Proc. Natl. Acad. Sci. USA (1993) 90: 5873-77) as used in the NBLAST and XBLAST programs (version 2.0) of Altschul et al. (J. Mol. Biol. (1990) 215:403-10). BLAST nucleotide searches can be performed with the NBLAST program, score=100, wordlength=12 to obtain nucleotide sequences homologous to nucleic acid molecules of the invention. BLAST polypeptide searches can be performed with the XBLAST program, score=50, wordlength=3 to obtain amino acid sequences homologous to polypeptide molecules of the invention. To obtain gapped alignments for comparison purposes, Gapped BLAST can be utilized as described in Altschul et al. (Nucleic Acids Research (1997) 25(17):3389-3402). When utilizing BLAST and Gapped BLAST programs, the default parameters of the respective programs (e.g., XBLAST and NBLAST) can be used (http://www.ncbi.nlm.nih.gov). One skilled in the art may also use the ALIGN program incorporating the non-linear algorithm of Myers and Miller (Comput. Appl. Biosci. (1988) 4:11-17). For amino acid sequence comparison using the ALIGN program one skilled in the art may use a PAM 120 weight residue table, a gap length penalty of 12, and a gap penalty of 4.
The term âsubstantial homologyâ or âsubstantial similarity,â when referring to a nucleic acid or fragment thereof, indicates that, when optimally aligned with appropriate nucleotide insertions or deletions with another nucleic acid (or its complementary strand), there is nucleotide sequence identity in at least about 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, preferably at least about 90%, and more preferably at least about 95%, 96%, 97%, 98% or 99% of the nucleotide bases, as measured by any well-known algorithm of sequence identity, such as FASTA, BLAST or Gap, as discussed above.
Alternatively, substantial homology or similarity exists when a nucleic acid or fragment thereof hybridizes to another nucleic acid, to a strand of another nucleic acid, or to the complementary strand thereof, under stringent hybridization conditions. âStringent hybridization conditionsâ and âstringent wash conditionsâ in the context of nucleic acid hybridization experiments depend upon a number of different physical parameters. Nucleic acid hybridization will be affected by such conditions as salt concentration, temperature, solvents, the base composition of the hybridizing species, length of the complementary regions, and the number of nucleotide base mismatches between the hybridizing nucleic acids, as will be readily appreciated by those skilled in the art. One having ordinary skill in the art knows how to vary these parameters to achieve a particular stringency of hybridization.
In general, âstringent hybridizationâ is performed at about 25° C. below the thermal melting point (Tm) for the specific DNA hybrid under a particular set of conditions. âStringent washingâ is performed at temperatures about 5° C. lower than the Tm for the specific DNA hybrid under a particular set of conditions. The Tm is the temperature at which 50% of the target sequence hybridizes to a perfectly matched probe. See Sambrook et al., Molecular Cloning: A Laboratory Manual, 2d ed., Cold Spring Harbor Laboratory Press, Cold Spring Harbor, N.Y. (1989), page 9.51, hereby incorporated by reference. For purposes herein, âstringent conditionsâ are defined for solution phase hybridization as aqueous hybridization (i.e., free of formamide) in 6ĂSSC (where 20ĂSSC contains 3.0 M NaCl and 0.3 M sodium citrate), 1% SDS at 65° C. for 8-12 hours, followed by two washes in 0.2ĂSSC, 0.1% SDS at 65° C. for 20 minutes. It will be appreciated by the skilled worker that hybridization at 65° C. will occur at different rates depending on a number of factors including the length and percent identity of the sequences which are hybridizing.
A preferred, non-limiting example of stringent hybridization conditions includes hybridization in 4Ă sodium chloride/sodium citrate (SSC), at about 65-70° C. (or hybridization in 4ĂSSC plus 50% formamide at about 42-50° C.) followed by one or more washes in 1ĂSSC, at about 65-70° C. A preferred, non-limiting example of highly stringent hybridization conditions includes hybridization in 1ĂSSC, at about 65-70° C. (or hybridization in 1ĂSSC plus 50% formamide at about 42-50° C.) followed by one or more washes in 0.3ĂSSC, at about 65-70° C. A preferred, non-limiting example of reduced stringency hybridization conditions includes hybridization in 4ĂSSC, at about 50-60° C. (or alternatively hybridization in 6ĂSSC plus 50% formamide at about 40-45° C.) followed by one or more washes in 2ĂSSC, at about 50-60° C. Intermediate ranges e.g., at 65-70° C. or at 42-50° C. are also within the scope of the invention. SSPE (1ĂSSPE is 0.15 M NaCl, 10 mM NaH2PO4, and 1.25 mM EDTA, pH 7.4) can be substituted for SSC (1ĂSSC is 0.15 M NaCl and 15 mM sodium citrate) in the hybridization and wash buffers; washes are performed for 15 minutes each after hybridization is complete. The hybridization temperature for hybrids anticipated to be less than 50 base pairs in length should be 5-10° C. less than the melting temperature (Tm) of the hybrid, where Tm is determined according to the following equations. For hybrids less than 18 base pairs in length, Tm (° C.)=2(# of A+T bases)+4(# of G+C bases). For hybrids between 18 and 49 base pairs in length, Tm(° C.)=81.5+16.6(log10[Na+])+0.41 (% G+C)â(600/N), where N is the number of bases in the hybrid, and [Na+] is the concentration of sodium ions in the hybridization buffer ([Na+] for 1ĂSSC=0.165 M).
The skilled practitioner recognizes that reagents can be added to hybridization and/or wash buffers. For example, to decrease non-specific hybridization of nucleic acid molecules to, for example, nitrocellulose or nylon membranes, blocking agents, including but not limited to, BSA or salmon or herring sperm carrier DNA and/or detergents, including but not limited to, SDS, chelating agents EDTA, Ficoll, PVP and the like can be used. When using nylon membranes, in particular, an additional, non-limiting example of stringent hybridization conditions is hybridization in 0.25-0.5M NaH2PO4, 7% SDS at about 65° C., followed by one or more washes at 0.02M NaH2PO4, 1% SDS at 65° C. (Church and Gilbert (1984) Proc. Natl. Acad. Sci. USA 81:1991-1995) or, alternatively, 0.2ĂSSC, 1% SDS.
The nucleic acids (also referred to as polynucleotides) may include both sense and antisense strands of RNA, cDNA, genomic DNA, and synthetic forms and mixed polymers of the above. They may be modified chemically or biochemically or may contain non-natural or derivatized nucleotide bases, as will be readily appreciated by those of skill in the art. Such modifications include, for example, labels, methylation, substitution of one or more of the naturally occurring nucleotides with an analog, intemucleotide modifications such as uncharged linkages (e.g., methyl phosphonates, phosphotriesters, phosphoramidates, carbamates, etc.), charged linkages (e.g., phosphorothioates, phosphorodithioates, etc.), pendent moieties (e.g., polypeptides), intercalators (e.g., acridine, psoralen, etc.), chelators, alkylators, and modified linkages (e.g., alpha anomeric nucleic acids, etc.) Also included are synthetic molecules that mimic polynucleotides in their ability to bind to a designated sequence via hydrogen bonding and other chemical interactions. Such molecules are known in the art and include, for example, those in which peptide linkages substitute for phosphate linkages in the backbone of the molecule. Other modifications can include, for example, analogs in which the ribose ring contains a bridging moiety or other structure such as the modifications found in âlockedâ nucleic acids.
The term âmutatedâ when applied to nucleic acid sequences means that nucleotides in a nucleic acid sequence may be inserted, deleted or changed compared to a reference nucleic acid sequence. A single alteration may be made at a locus (a point mutation) or multiple nucleotides may be inserted, deleted or changed at a single locus. In addition, one or more alterations may be made at any number of loci within a nucleic acid sequence. A nucleic acid sequence may be mutated by any method known in the art including but not limited to mutagenesis techniques such as âerror-prone PCRâ (a process for performing PCR under conditions where the copying fidelity of the DNA polymerase is low, such that a high rate of point mutations is obtained along the entire length of the PCR product; see, e.g., Leung et al., Technique, 1:11-15 (1989) and Caldwell and Joyce, PCR Methods Applic. 2:28-33 (1992)); and âoligonucleotide-directed mutagenesisâ (a process which enables the generation of site-specific mutations in any cloned DNA segment of interest; see, e.g., Reidhaar-Olson and Sauer, Science 241:53-57 (1988)).
The term âderived fromâ is intended to include the isolation (in whole or in part) of a polynucleotide segment from an indicated source. The term is intended to include, for example, direct cloning, PCR amplification, or artificial synthesis from, or based on, a sequence associated with the indicated polynucleotide source.
The term âgeneâ as used herein refers to a nucleotide sequence that can direct synthesis of an enzyme or other polypeptide molecule (e.g., can comprise coding sequences, for example, a contiguous open reading frame (ORF) which encodes a polypeptide) or can itself be functional in the organism. A gene in an organism can be clustered within an operon, as defined herein, wherein the operon is separated from other genes and/or operons by intergenic DNA. Individual genes contained within an operon can overlap without intergenic DNA between the individual genes.
An âisolated gene,â as described herein, includes a gene which is essentially free of sequences which naturally flank the gene in the chromosomal DNA of the organism from which the gene is derived (i.e., is free of adjacent coding sequences which encode a second or distinct polypeptide or RNA molecule, adjacent structural sequences or the like) and optionally includes 5Ⲡand 3Ⲡregulatory sequences, for example promoter sequences and/or terminator sequences. In one embodiment, an isolated gene includes predominantly coding sequences for a polypeptide.
The term âexpressionâ when used in relation to the transcription and/or translation of a nucleotide sequence as used herein generally includes expression levels of the nucleotide sequence being enhanced, increased, resulting in basal or housekeeping levels in the host cell, constitutive, attenuated, decreased or repressed.
The term âattenuateâ as used herein generally refers to a functional deletion, including a mutation, partial or complete deletion, insertion, or other variation made to a gene sequence or a sequence controlling the transcription of a gene sequence, which reduces or inhibits production of the gene product, or renders the gene product non-functional. In some instances a functional deletion is described as a knockout mutation. Attenuation also includes amino acid sequence changes by altering the nucleic acid sequence, placing the gene under the control of a less active promoter, down-regulation, expressing interfering RNA, ribozymes or antisense sequences that target the gene of interest, or through any other technique known in the art. In one example, the sensitivity of a particular enzyme to feedback inhibition or inhibition caused by a composition that is not a product or a reactant (non-pathway specific feedback) is lessened such that the enzyme activity is not impacted by the presence of a compound. In other instances, an enzyme that has been altered to be less active can be referred to as attenuated.
A âdeletionâ is the removal of one or more nucleotides from a nucleic acid molecule or one or more amino acids from a protein, the regions on either side being joined together.
A âknock-outâ is a gene whose level of expression or activity has been reduced to zero. In some examples, a gene is knocked-out via deletion of some or all of its coding sequence. In other examples, a gene is knocked-out via introduction of one or more nucleotides into its open-reading frame, which results in translation of a non-sense or otherwise non-functional protein product.
The term âcodon usageâ is intended to refer to analyzing a nucleic acid sequence to be expressed in a recipient host organism (or acellular extract thereof) for the occurrence and use of preferred codons the host organism transcribes advantageously for optimal nucleic acid sequence transcription. The recipient host may be recombinantly altered with any preferred codon. Alternatively, a particular cell host can be selected that already has superior codon usage, or the nucleic acid sequence can be genetically engineered to change a limiting codon to a non-limiting codon (e.g., by introducing a silent mutation(s)).
The term âvectorâ as used herein is intended to refer to a nucleic acid molecule capable of transporting another nucleic acid to which it has been linked. One type of vector is a âplasmid,â which refers to a circular double stranded DNA loop into which additional DNA segments may be ligated. Other vectors include cosmids, bacterial artificial chromosomes (BAC) and yeast artificial chromosomes (YAC), fosmids, phage and phagemids. Another type of vector is a viral vector, wherein additional DNA segments may be ligated into the viral genome (discussed in more detail below). Certain vectors are capable of autonomous replication in a host cell into which they are introduced (e.g., vectors having an origin of replication which functions in the host cell). Other vectors can be integrated into the genome of a host cell upon introduction into the host cell, and are thereby replicated along with the host genome. Moreover, certain preferred vectors are capable of directing the expression of genes to which they are operatively linked. Such vectors are referred to herein as ârecombinant expression vectorsâ (or simply âexpression vectorsâ).
âExpression optimizationâ as used herein is defined as one or more optional modifications to the nucleotide sequence in the promoter and terminator elements resulting in desired rates and levels of transcription and translation into a protein product encoded by said nucleotide sequence. Expression optimization as used herein also includes designing an effectual predicted secondary structure (for example, stem-loop structures and termination sequences) of the messenger ribonucleic acid (mRNA) sequence to promote desired levels of protein production. Other genes and gene combinations essential for the production of a protein may be used, for example genes for proteins in a biosynthetic pathway, required for post-translational modifications or required for a heteromultimeric protein, wherein combinations of genes are chosen for the effect of optimizing expression of the desired levels of protein product. Conversely, one or more genes optionally may be âknocked-outâ or otherwise altered such that lower or eliminated expression of said gene or genes achieves the desired expression levels of protein. Additionally, expression optimization can be achieved through codon optimization. Codon optimization, as used herein, is defined as modifying a nucleotide sequence for effectual use of host cell bias in relative concentrations of transfer ribonucleic acids (tRNA) such that the desired rate and levels of gene nucleotide sequence translation into a final protein product are achieved, without altering the peptide sequence encoded by the nucleotide sequence.
The term âexpression control sequenceâ as used herein refers to polynucleotide sequences which are necessary to affect the expression of coding sequences to which they are operatively linked. Expression control sequences are sequences which control the transcription, post-transcriptional events and translation of nucleic acid sequences. Expression control sequences include appropriate transcription initiation, termination, promoter and enhancer sequences; efficient RNA processing signals such as splicing and polyadenylation signals; sequences that stabilize cytoplasmic mRNA; sequences that enhance translation efficiency (e.g., ribosome binding sites); sequences that enhance protein stability; and when desired, sequences that enhance protein secretion. The nature of such control sequences differs depending upon the host organism; in prokaryotes, such control sequences generally include promoter, ribosomal binding site, and transcription termination sequence. The term âcontrol sequencesâ is intended to include, at a minimum, all components whose presence is essential for expression, and can also include additional components whose presence is advantageous, for example, leader sequences and fusion partner sequences.
âOperatively linkedâ or âoperably linkedâ expression control sequences refers to a linkage in which the expression control sequence is contiguous with the gene of interest to control the gene of interest, as well as expression control sequences that act in trans or at a distance to control the gene of interest.
The term ârecombinant host cellâ (or simply âhost cellâ), as used herein, is intended to refer to a cell into which a recombinant vector has been introduced. It should be understood that such terms are intended to refer not only to the particular subject cell but to the progeny of such a cell. Because certain modifications may occur in succeeding generations due to either mutation or environmental influences, such progeny may not, in fact, be identical to the parent cell, but are still included within the scope of the term âhost cellâ as used herein. A recombinant host cell may be an isolated cell or cell line grown in culture or may be a cell which resides in a living tissue or organism.
The term âpeptideâ as used herein refers to a short polypeptide, e.g., one that is typically less than about 50 amino acids long and more typically less than about 30 amino acids long. The term as used herein encompasses analogs and mimetics that mimic structural and thus biological function.
The term âpolypeptideâ encompasses both naturally-occurring and non-naturally-occurring proteins, and fragments, mutants, derivatives and analogs thereof. A polypeptide may be monomeric or polymeric. Further, a polypeptide may comprise a number of different domains each of which has one or more distinct activities.
The term âisolated proteinâ or âisolated polypeptideâ is a protein or polypeptide that by virtue of its origin or source of derivation (1) is not associated with naturally associated components that accompany it in its native state, (2) exists in a purity not found in nature, where purity can be adjudged with respect to the presence of other cellular material (e.g., is free of other proteins from the same species) (3) is expressed by a cell from a different species, or (4) does not occur in nature (e.g., it is a fragment of a polypeptide found in nature or it includes amino acid analogs or derivatives not found in nature or linkages other than standard peptide bonds). Thus, a polypeptide that is chemically synthesized or synthesized in a cellular system different from the cell from which it naturally originates will be âisolatedâ from its naturally associated components. A polypeptide or protein may also be rendered substantially free of naturally associated components by isolation, using protein purification techniques well known in the art. As thus defined, âisolatedâ does not necessarily require that the protein, polypeptide, peptide or oligopeptide so described has been physically removed from its native environment.
An isolated or purified polypeptide is substantially free of cellular material or other contaminating polypeptides from the expression host cell from which the polypeptide is derived, or substantially free from chemical precursors or other chemicals when chemically synthesized. In one embodiment, an isolated or purified polypeptide has less than about 30% (by dry weight) of contaminating polypeptide or chemicals, more advantageously less than about 20% of contaminating polypeptide or chemicals, still more advantageously less than about 10% of contaminating polypeptide or chemicals, and most advantageously less than about 5% contaminating polypeptide or chemicals.
The term âpolypeptide fragmentâ as used herein refers to a polypeptide that has a deletion, e.g., an amino-terminal and/or carboxy-terminal deletion compared to a full-length polypeptide. In a preferred embodiment, the polypeptide fragment is a contiguous sequence in which the amino acid sequence of the fragment is identical to the corresponding positions in the naturally-occurring sequence. Fragments typically are at least 5, 6, 7, 8, 9 or 10 amino acids long, preferably at least 12, 14, 16 or 18 amino acids long, more preferably at least 20 amino acids long, more preferably at least 25, 30, 35, 40 or 45, amino acids, even more preferably at least 50 or 60 amino acids long, and even more preferably at least 70 amino acids long.
A âmodified derivativeâ refers to polypeptides or fragments thereof that are substantially homologous in primary structural sequence but which include, e.g., in vivo or in vitro chemical and biochemical modifications or which incorporate amino acids that are not found in the native polypeptide. Such modifications include, for example, acetylation, carboxylation, phosphorylation, glycosylation, ubiquitination, labeling, e.g., with radionuclides, and various enzymatic modifications, as will be readily appreciated by those skilled in the art. A variety of methods for labeling polypeptides and of substituents or labels useful for such purposes are well known in the art, and include radioactive isotopes such as 125I, 32P, 35S, and 3H, ligands which bind to labeled antiligands (e.g., antibodies), fluorophores, chemiluminescent agents, enzymes, and antiligands which can serve as specific binding pair members for a labeled ligand. The choice of label depends on the sensitivity required, ease of conjugation with the primer, stability requirements, and available instrumentation. Methods for labeling polypeptides are well known in the art. See, e.g., Ausubel et al., Current Protocols in Molecular Biology, Greene Publishing Associates (1992, and Supplements to 2002) (hereby incorporated by reference).
The terms âthermal stabilityâ and âthermostabilityâ are used interchangeably and refer to the ability of an enzyme (e.g., whether expressed in a cell, present in an cellular extract, cell lysate, or in purified or partially purified form) to exhibit the ability to catalyze a reaction at least at about 20° C., preferably at about 25° C. to 35° C., more preferably at about 37° C. or higher, in more preferably at about 50° C. or higher, and even more preferably at least about 60° C. or higher.
The term âchimericâ refers to an expressed or translated polypeptide in which a domain or subunit of a particular homologous or non-homologous protein is genetically engineered to be transcribed, translated and/or expressed collinearly in the nucleotide and amino acid sequence of another homologous or non-homologous protein.
The term âfusion proteinâ refers to a polypeptide comprising a polypeptide or fragment coupled to heterologous amino acid sequences. Fusion proteins are useful because they can be constructed to contain two or more desired functional elements from two or more different proteins. A fusion protein comprises at least 10 contiguous amino acids from a polypeptide of interest, more preferably at least 20 or 30 amino acids, even more preferably at least 40, 50 or 60 amino acids, yet more preferably at least 75, 100 or 125 amino acids. Fusions that include the entirety of the proteins have particular utility. The heterologous polypeptide included within the fusion protein is at least 6 amino acids in length, often at least 8 amino acids in length, and usefully at least 15, 20, and 25 amino acids in length. Fusions that include larger polypeptides, such as an IgG Fc region, and even entire proteins, such as the green fluorescent protein (âGFPâ) chromophore-containing proteins, have particular utility. Fusion proteins can be produced recombinantly by constructing a nucleic acid sequence which encodes the polypeptide or a fragment thereof in frame with a nucleic acid sequence encoding a different protein or peptide and then expressing the fusion protein. Alternatively, a fusion protein can be produced chemically by crosslinking the polypeptide or a fragment thereof to another protein.
As used herein, the term âprotomerâ refers to a polymeric form of amino acids forming a subunit of a larger oligomeric protein structure. Protomers of an oligomeric structure may be identical or non-identical. Protomers can combine to form an oligomeric subunit, which can combine further with other identical or non-identical protomers to form a larger oligomeric protein.
As used herein, the term âantibodyâ refers to a polypeptide, at least a portion of which is encoded by at least one immunoglobulin gene, or fragment thereof, and that can bind specifically to a desired target molecule. The term includes naturally-occurring forms, as well as fragments and derivatives.
Fragments within the scope of the term âantibodyâ include those produced by digestion with various proteases, those produced by chemical cleavage and/or chemical dissociation and those produced recombinantly, so long as the fragment remains capable of specific binding to a target molecule. Among such fragments are Fab, Fabâ˛, Fv, F(abâ˛)2, and single chain Fv (scFv) fragments.
Derivatives within the scope of the term include antibodies (or fragments thereof) that have been modified in sequence, but remain capable of specific binding to a target molecule, including: interspecies chimeric and humanized antibodies; antibody fusions; heteromeric antibody complexes and antibody fusions, such as diabodies (bispecific antibodies), single-chain diabodies, and intrabodies (see, e.g., Intracellular Antibodies: Research and Disease Applications (1998) Marasco, ed., Springer-Verlag New York, Inc.), the disclosure of which is incorporated herein by reference in its entirety).
As used herein, antibodies can be produced by any known technique, including harvest from cell culture of native B lymphocytes, harvest from culture of hybridomas, recombinant expression systems and phage display.
The term ânon-peptide analogâ refers to a compound with properties that are analogous to those of a reference polypeptide. A non-peptide compound may also be termed a âpeptide mimeticâ or a âpeptidomimetic.â See, e.g., Jones, Amino Acid and Peptide Synthesis, Oxford University Press (1992); Jung, Combinatorial Peptide and Nonpeptide Libraries: A Handbook, John Wiley (1997); Bodanszky et al., Peptide ChemistryâA Practical Textbook, Springer Verlag (1993); Synthetic Peptides: A Users Guide, (Grant, ed., W. H. Freeman and Co., 1992); Evans et al., J. Med. Chem. 30:1229 (1987); Fauchere, J. Adv. Drug Res. 15:29 (1986); Veber and Freidinger, Trends Neurosci., 8:392-396 (1985); and references sited in each of the above, which are incorporated herein by reference. Such compounds are often developed with the aid of computerized molecular modeling. Peptide mimetics that are structurally similar to useful peptides may be used to produce an equivalent effect and are therefore envisioned to be part of the invention.
A âpolypeptide mutantâ or âmuteinâ refers to a polypeptide whose sequence contains an insertion, duplication, deletion, rearrangement or substitution of one or more amino acids compared to the amino acid sequence of a native or wild-type protein. A mutein may have one or more amino acid point substitutions, in which a single amino acid at a position has been changed to another amino acid, one or more insertions and/or deletions, in which one or more amino acids are inserted or deleted, respectively, in the sequence of the naturally-occurring protein, and/or truncations of the amino acid sequence at either or both the amino or carboxy termini. A mutein may have the same but preferably has a different biological activity compared to the naturally-occurring protein.
A mutein has at least 85% overall sequence homology to its wild-type counterpart. Even more preferred are muteins having at least 90% overall sequence homology to the wild-type protein.
In an even more preferred embodiment, a mutein exhibits at least 95% sequence identity, even more preferably 98%, even more preferably 99% and even more preferably 99.9% overall sequence identity.
Sequence homology may be measured by any common sequence analysis algorithm, such as Gap or Bestfit.
Amino acid substitutions can include those which: (1) reduce susceptibility to proteolysis, (2) reduce susceptibility to oxidation, (3) alter binding affinity for forming protein complexes, (4) alter binding affinity or enzymatic activity, and (5) confer or modify other physicochemical or functional properties of such analogs.
As used herein, the twenty conventional amino acids and their abbreviations follow conventional usage. See ImmunologyâA Synthesis (Golub and Gren eds., Sinauer Associates, Sunderland, Mass., 2nd ed. 1991), which is incorporated herein by reference. Stereoisomers (e.g., D-amino acids) of the twenty conventional amino acids, unnatural amino acids such as Îą-, Îą-disubstituted amino acids, N-alkyl amino acids, and other unconventional amino acids may also be suitable components for polypeptides. Examples of unconventional amino acids include: 4-hydroxyproline, Îł-carboxyglutamate, -N,N,N-trimethyllysine, -N-acetyllysine, O-phosphoserine, N-acetylserine, N-formylmethionine, 3-methylhistidine, 5-hydroxylysine, N-methylarginine, and other similar amino acids and imino acids (e.g., 4-hydroxyproline). In the polypeptide notation used herein, the left-hand end corresponds to the amino terminal end and the right-hand end corresponds to the carboxy-terminal end, in accordance with standard usage and convention.
A protein has âhomologyâ or is âhomologousâ to a second protein if the nucleic acid sequence that encodes the protein has a similar sequence to the nucleic acid sequence that encodes the second protein. Alternatively, a protein has homology to a second protein if the two proteins have âsimilarâ amino acid sequences. (Thus, the term âhomologous proteinsâ is defined to mean that the two proteins have similar amino acid sequences.) As used herein, homology between two regions of amino acid sequence (especially with respect to predicted structural similarities) is interpreted as implying similarity in function.
When âhomologousâ is used in reference to proteins or peptides, it is recognized that residue positions that are not identical often differ by conservative amino acid substitutions. A âconservative amino acid substitutionâ is one in which an amino acid residue is substituted by another amino acid residue having a side chain (R group) with similar chemical properties (e.g., charge or hydrophobicity). In general, a conservative amino acid substitution will not substantially change the functional properties of a protein. In cases where two or more amino acid sequences differ from each other by conservative substitutions, the percent sequence identity or degree of homology may be adjusted upwards to correct for the conservative nature of the substitution. Means for making this adjustment are well known to those of skill in the art. See, e.g., Pearson, 1994, Methods Mol. Biol. 24:307-331 and 25:365-389 (herein incorporated by reference).
The following six groups each contain amino acids that are conservative substitutions for one another: 1) Serine (S), Threonine (T); 2) Aspartic Acid (D), Glutamic Acid (E); 3) Asparagine (N), Glutamine (Q); 4) Arginine (R), Lysine (K); 5) Isoleucine (I), Leucine (L), Methionine (M), Alanine (A), Valine (V), and 6) Phenylalanine (F), Tyrosine (Y), Tryptophan (W).
Sequence homology for polypeptides, which is also referred to as percent sequence identity, is typically measured using sequence analysis software. See, e.g., the Sequence Analysis Software Package of the Genetics Computer Group (GCG), University of Wisconsin Biotechnology Center, 910 University Avenue, Madison, Wis. 53705. Protein analysis software matches similar sequences using a measure of homology assigned to various substitutions, deletions and other modifications, including conservative amino acid substitutions. For instance, GCG contains programs such as âGapâ and âBestfitâ which can be used with default parameters to determine sequence homology or sequence identity between closely related polypeptides, such as homologous polypeptides from different species of organisms or between a wild-type protein and a mutein thereof. See, e.g., GCG Version 6.1.
A preferred algorithm when comparing a particular polypeptide sequence to a database containing a large number of sequences from different organisms is the computer program BLAST (Altschul et al., J. Mol. Biol. 215:403-410 (1990); Gish and States, Nature Genet. 3:266-272 (1993); Madden et al., Meth. Enzymol. 266:131-141 (1996); Altschul et al., Nucleic Acids Res. 25:3389-3402 (1997); Zhang and Madden, Genome Res. 7:649-656 (1997)), especially blastp or tblastn (Altschul et al., Nucleic Acids Res. 25:3389-3402 (1997)).
Preferred parameters for BLASTp are: Expectation value: 10 (default); Filter: seg (default); Cost to open a gap: 11 (default); Cost to extend a gap: 1 (default); Max. alignments: 100 (default); Word size: 11 (default); No. of descriptions: 100 (default); Penalty Matrix: BLOWSUM62.
The length of polypeptide sequences compared for homology will generally be at least about 16 amino acid residues, usually at least about 20 residues, more usually at least about 24 residues, typically at least about 28 residues, and preferably more than about 35 residues. When searching a database containing sequences from a large number of different organisms, it is preferable to compare amino acid sequences. Database searching using amino acid sequences can be measured by algorithms other than blastp known in the art. For instance, polypeptide sequences can be compared using FASTA, a program in GCG Version 6.1. FASTA provides alignments and percent sequence identity of the regions of the best overlap between the query and search sequences. (Pearson, Methods Enzymol. 183:63-98 (1990) (herein incorporated by reference). For example, percent sequence identity between amino acid sequences can be determined using FASTA with its default parameters (a word size of 2 and the PAM250 scoring matrix), as provided in GCG Version 6.1, herein incorporated by reference.
To determine the percent identity of two amino acid sequences or of two nucleic acids, the sequences are aligned for optimal comparison purposes, and, if necessary, gaps can be introduced in the first amino acid or nucleic acid sequence for optimal alignment with a second amino or nucleic acid sequence. When a position in the first sequence is occupied by the same amino acid residue or nucleotide as the corresponding position in the second sequence, then the molecules are identical at that position. The percent identity between the two sequences is a function of the number of identical positions shared by the sequences as evaluated, for example, by calculating # of identical positions/total # of positionsĂ100. Additional evaluations of the sequence alignment can include a numeric penalty taking into account the number of gaps and size of said gaps necessary to produce an optimal alignment.
âSpecific bindingâ refers to the ability of two molecules to bind to each other in preference to binding to other molecules in the environment. Typically, âspecific bindingâ discriminates over adventitious binding in a reaction by at least two-fold, more typically by at least 10-fold, often at least 100-fold. Typically, the affinity or avidity of a specific binding reaction, as quantified by a dissociation constant, is about 10â7 M or stronger (e.g., about 10â8 M, 10â9 M or even stronger).
The term âregionâ as used herein refers to a physically contiguous portion of the primary structure of a biomolecule. In the case of proteins, a region is defined by a contiguous portion of the amino acid sequence of that protein.
The term âdomainâ as used herein refers to a structure of a biomolecule that contributes to a known or suspected function of the biomolecule. Domains may be co-extensive with regions or portions thereof; domains may also include distinct, non-contiguous regions of a biomolecule. Examples of protein domains include, but are not limited to, an Ig domain, an extracellular domain, a transmembrane domain, and a cytoplasmic domain.
As used herein, the term âmoleculeâ means any compound, including, but not limited to, a small molecule, peptide, protein, sugar, nucleotide, nucleic acid, lipid, etc., and such a compound can be natural or synthetic.
The term âsubstrate affinityâ as used herein refers to the binding kinetics, Km, the Michaelis-Menten constant as understood by one having skill in the art, for a substrate. More particularly the Km is optimized over endogenous activity for the purpose of the invention described herein.
The term âsugarâ as used herein refers to any carbohydrate endogenously produced from sunlight, carbon dioxide and water, any carbohydrate produced endogenously and/or any carbohydrate from any exogenous carbon source such as biomass, comprising a sugar molecule or pool or source of such sugar molecules.
The term âcarbon sourceâ as used herein refers to carbon dioxide, exogenous sugar or biomass.
âCarbon-based products of interestâ include alcohols such as ethanol, propanol, isopropanol, butanol, fatty alcohols, fatty acid esters, wax esters; hydrocarbons and alkanes such as propane, octane, diesel, Jet Propellant 8 (JP8); polymers such as 1-nonadecene, terephthalate, 1,3-propanediol, 1,4-butanediol, polyols, Polyhydroxyalkanoates (PHA), poly-beta-hydroxybutyrate (PHB), acrylate, adipic acid, Îľ-caprolactone, isoprene, caprolactam, rubber; commodity chemicals such as lactate, docosahexaenoic acid (DHA), 3-hydroxypropionate, Îł-valerolactone, lysine, serine, aspartate, aspartic acid, sorbitol, ascorbate, ascorbic acid, isopentenol, lanosterol, omega-3 DHA, lycopene, itaconate, 1,3-butadiene, ethylene, propylene, succinate, citrate, citric acid, glutamate, malate, 3-hydroxypropionic acid (HPA), lactic acid, THF, gamma butyrolactone, pyrrolidones, hydroxybutyrate, glutamic acid, levulinic acid, acrylic acid, malonic acid; specialty chemicals such as carotenoids, isoprenoids, itaconic acid; pharmaceuticals and pharmaceutical intermediates such as 7-aminodeacetoxycephalosporanic acid (7-ADCA)/cephalosporin, erythromycin, polyketides, statins, paclitaxel, docetaxel, terpenes, peptides, steroids, omega fatty acids, olefins, alkenes and other such suitable products of interest. Such products are useful in the context of biofuels, industrial and specialty chemicals, as intermediates used to make additional products, such as nutritional supplements, neutraceuticals, polymers, paraffin replacements, personal care products and pharmaceuticals.
A âbiofuelâ as used herein is any fuel that derives from a biological source. A âfuelâ refers to one or more hydrocarbons (e.g., 1-alkenes), one or more alcohols, one or more fatty esters or a mixture thereof. Preferably, liquid hydrocarbons are used.
As used herein, the term âhydrocarbonâ generally refers to a chemical compound that consists of the elements carbon (C), hydrogen (H) and optionally oxygen (O). There are essentially three types of hydrocarbons, e.g., aromatic hydrocarbons, saturated hydrocarbons and unsaturated hydrocarbons such as alkenes, alkynes, and dienes. The term also includes fuels, biofuels, plastics, waxes, solvents and oils. Hydrocarbons encompass biofuels, as well as plastics, waxes, solvents and oils.
Polyketide synthases are enzymes or enzyme complexes that produce polyketides, a large class of secondary metabolites in bacteria, fungi, plants and animals. The invention described herein provides a recombinant 1-alkene synthase gene, which is related to type I polyketides synthases. As used herein, a â1-alkene synthaseâ is an enzyme which (1) comprises regions homologous or identical to each of the domains identified in FIG. 1, or whose BLAST alignment covers 90% of the length of YPâ001734428.1 and has at least 50% identity to the amino acid sequence of YPâ001734428.1, i.e., the 1-alkene synthase of Synechococcus sp. PCC 7002 (SEQ ID NO:2); and (2) which catalyzes the synthesis of 1-alkenes. The 1-alkene synthase is also referred to herein as NonA; the corresponding gene may be referred to as nonA.
An exemplary 1-alkene synthase is the 1-alkene synthase of Synechococcus sp. PCC 7002 (SEQ ID NO: 2). An exemplary gene encoding a 1-alkene synthase is the nonA gene of Synechococcus sp. PCC 7002 (SEQ ID NO:2). Other exemplary 1-alkene synthases are YPâ002377174.1 from Cyanothece sp. PCC7424 (SEQ ID NO: 8) and ZPâ03153601.1 from Cyanothece sp. PCC7822 (SEQ ID NO 9). The amino acid sequences of these genes as they appear in the NCBI database on Jun. 22, 2010 are hereby incorporated by reference. The invention also provides 1-alkene synthases that are at least 95% identical to SEQ ID NO:2, or at least 95% identical to YPâ002377174.1 (SEQ ID NO: 8) or at least 95% identical to ZPâ03153601.1 (SEQ ID NO: 9), in addition to engineered microorganisms expressing genes encoding these 1-alkene synthases and methods of producing 1-alkenes by culturing these microorganisms.
The invention also provides an isolated or recombinant A1174 hydrolase gene, which refers to a gene encoding a hydrolase with an amino acid sequence that is at least 95% identical to the YPâ001734429.1 hydrolase of Synechococcus sp. PCC 7002 (SEQ ID NO:4).
Preferred parameters for BLASTp are: Expectation value: 10 (default); Filter: seg (default); Cost to open a gap: 11 (default); Cost to extend a gap: 1 (default); Max. alignments: 100 (default); Word size: 11 (default); No. of descriptions: 100 (default); Penalty Matrix: BLOWSUM62.
The term âcatabolicâ and âcatabolismâ as used herein refers to the process of molecule breakdown or degradation of large molecules into smaller molecules. Catabolic or catabolism refers to a specific reaction pathway wherein the molecule breakdown occurs through a single or multitude of catalytic components or a general, whole cell process wherein the molecule breakdown occurs using more than one specified reaction pathway and a multitude of catalytic components.
The term âanabolicâ and âanabolismâ as used herein refers to the process of chemical construction of small molecules into larger molecules. Anabolic refers to a specific reaction pathway wherein the molecule construction occurs through a single or multitude of catalytic components or a general, whole cell process wherein the molecule construction occurs using more than one specified reaction pathway and a multitude of catalytic components.
The term âcorrelatedâ in âcorrelated saturation mutagenesisâ as used herein refers to altering an amino acid type at two or more positions of a polypeptide to achieve an altered functional or structural attribute differing from the structural or functional attribute of the polypeptide from which the changes were made.
Unless otherwise defined, all technical and scientific terms used herein have the same meaning as commonly understood by one of ordinary skill in the art to which this invention pertains. Exemplary methods and materials are described below, although methods and materials similar or equivalent to those described herein can also be used and will be apparent to those of skill in the art. All publications and other references mentioned herein are incorporated by reference in their entirety. In case of conflict, the present specification, including definitions, will control. The materials, methods, and examples are illustrative only and not intended to be limiting.
Throughout this specification and claims, the word âcompriseâ or variations such as âcomprisesâ or âcomprisingâ, will be understood to imply the inclusion of a stated integer or group of integers but not the exclusion of any other integer or group of integers.
The cyanobacterium Synechococcus sp. PCC7002 (formerly, Agmenellum quadruplicatum) has been shown to produce the linear alpha olefin 1-nonadecene (Winters et al. 1969). Strains which produce this metabolite also produce a nonadecadiene as a minor metabolite (Winters et al. 1969) which has been identified as 1,14-(cis)-nonadecadiene (Goodloe and Light, 1982). Feeding of 14C-labelled stearic acid resulted in incorporation of the fatty acid into 1-nonadecene demonstrating that the olefin is derived from fatty acid biosynthesis (Goodloe and Light, 1982) but the enzyme or enzymes responsible for the production of the olefin was not identified.
In one embodiment, the invention therefore provides an isolated 1-alkene synthase gene, defined above, which encodes an enzyme (NonA) related to type I polyketides synthases and which carries out the conversion of stearic acid to 1-nonadecene. Exemplary 1-alkane synthases include SYNPCC7002_A1173 (NCBI Sequence # NCâ010475.1; SEQ ID NO: 1 and SEQ ID NO:2 are the nucleic acid and encoded protein sequences, respectively) and contain the catalytic domains needed to carry out the biosynthesis of 1-nonadecene (FIG. 1). The first domain is related to LuxE, which indicates that the protein can attach a fatty acid by acting as an acyltransferase (AT). LuxE is the protein which serves as an acyl-protein synthetase in the Lux operon (Lin et al. (1996)). A phosphopantetheinyl (PP) attachment site is next which is characteristic of acyl-carrier protein (ACP) domains. Several other domains are also present that include a ketosynthase (KS), an acyltransferase (AT), a ketoreductase (KR) domain, a sulfotransferase (ST) and a thioesterase (TE) domain.
In general, the biosynthesis of polyketides is similar to fatty acid synthesis, where a thioester bond is formed between a starter unit and an ACP of the PKS, and then Claisen condensations catalyzed by a β-ketosynthase (KS) occur between the acyl-thioester substrate and an acyl-CoA intermediate to form the growing polyketide chain (FIG. 2). During chain elongation each condensation step can be followed by sequential reactions of the β-carbonyl by a stereospecific β-keto reduction to form a β-hydroxy, dehydration to yield ι, β double bond, and an enoyl reduction resulting in the formation of a methylene. The chains are extended for a defined number of times until released from the enzyme through the action of a thioesterase domain.
The putative mechanism of 1-nonadecene biosynthesis by NonA is shown in FIG. 3. Step 1 is loading of stearic acid onto the ACP by the fatty acid acyl transferase. The likely starter unit is a thioester of stearate (i.e., stearyl-ACP or stearyl-CoA) as opposed to the free acid. In the second step, a round of chain extension occurs, extending the carbon chain by two carbons through decarboxylative condensation with malonyl-CoA. This is followed by reduction of the β-carbonyl by the ketoreductase. The sulfotransferase domain attaches a sulfonate to the β-hydroxyl to yield a sulfate group, and the thioesterase domain catalyzes hydrolysis of the thioester bond which is followed by a decarboxylative elimination of sulfate to yield the terminal alkene.
An object of the invention described herein is to recombinantly express in a host cell genes encoding 1-alkene synthase to produce 1-alkenes, including 1-nonadecene and 1-octadecene, and other carbon-based products of interest. The pathway can be over-expressed in a Synechococcus strain such as JCC138 (Synechococcus sp. PCC 7002) or any other photosynthetic organism to produce a hydrocarbon from light and carbon dioxide. It can also be expressed in non-photosynthetic organisms to produce hydrocarbons from sugar sources. Accordingly, the invention provides isolated nucleic acid molecules encoding enzymes having 1-alkene synthase activity, and variants thereof, including expression optimized forms of said polyketide and hydrolase genes, and methods of improvement thereon. The full-length nucleic acid sequence (SEQ ID NO:1) for the 1-alkene synthase gene from Synechococcus sp. PCC 7002, YPâ001734428, is provided herein, as is the protein sequence (SEQ ID NO:2).
Also provided herein is a coding (SEQ ID NO:3) and amino acid sequence (SEQ ID NO:4) for an A1174 hydrolase, as defined above. An exemplary A1774 hydrolase is the hydrolase from Synechococcus sp. PCC 7002, YPâ001734429 (also referred to as SYNPCC7002_A1174). In Synechococcus sp. PCC7002, the gene encoding this hydrolase is adjacent to the 1-alkene synthase gene. Deletion of the structural gene encoding this protein (but retaining its endogenous promoter) is shown herein to modulate the yield of 1-nonadecene produced by the cell.
In one embodiment is provided an isolated nucleic acid molecule having a nucleic acid sequence comprising or consisting of 1-alkene synthase gene homologs, variants and derivatives of the wild-type polyketide synthase gene coding sequence SEQ ID NO:1. The invention provides nucleic acid molecules comprising or consisting of sequences which are structurally and functionally optimized versions of the wild-type or native 1-alkene synthase gene. In a preferred embodiment, nucleic acid molecules and homologs, variants and derivatives comprising or consisting of sequences optimized for substrate affinity and/or substrate catalytic conversion rate are provided.
In one embodiment is provided an isolated nucleic acid molecule having a nucleic acid sequence comprising or consisting of A1174 hydrolase gene homologs, variants and derivatives of the wild-type hydrolase gene coding sequence SEQ ID NO:3. The invention provides nucleic acid molecules comprising or consisting of sequences which are structurally and functionally optimized versions of the native or wild-type A1174 hydrolase gene. In a preferred embodiment, nucleic acid molecules and homologs, variants and derivatives comprising or consisting of sequences optimized for substrate affinity and/or substrate catalytic conversion rate are provided.
In other embodiments, the invention provides vectors constructed for the preparation of nonA and/or A1174 gene-knockout strains of Synechococcus sp. PCC7002 and other cyanobacterial strains. These vectors contain sufficient lengths of upstream and downstream sequences relative to the respective gene flanking a selectable marker, e.g., an antibiotic resistance marker (gentamycin, kanamycin, ampicillin, etc.), such that recombination with the vector replaces the chromosomal copy of the gene with the antibiotic resistance gene. Exemplary examples of such vectors are provided herein (e.g., SEQ ID NO:5 and SEQ ID NO:6).
In other embodiments, the invention provides knockout strains of cyanobacteria and other microbes wherein the A1774 gene or the nonA gene is inactivated by mutation or deletion.
In a further embodiment is provided nucleic acid molecules and homologs, variants and derivatives thereof comprising or consisting of sequences which are variants of the 1-alkene synthase gene having at least 71% identity to SEQ ID NO:1. In a further embodiment provided nucleic acid molecules and homologs, variants and derivatives comprising or consisting of sequences which are variants of the 1-alkene synthase gene having at least 50% identity to SEQ ID NO:1 and optimized for substrate affinity, substrate catalytic conversion rate, improved thermostability, activity at a different pH and/or optimized codon usage for improved expression in a host cell. The nucleic acid sequences can be preferably 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 90%, 95%, 98%, 99%, 99.9% or even higher identity to the wild-type gene.
In a further embodiment is provided nucleic acid molecules and homologs, variants and derivatives thereof comprising or consisting of sequences which are variants of the A1174 hydrolase gene having at least 71% identity to SEQ ID NO:3. In a further embodiment provided nucleic acid molecules and homologs, variants and derivatives comprising or consisting of sequences which are variants of the A1174 hydrolase gene having at least 71% identity to SEQ ID NO:3 and optimized for substrate affinity, substrate catalytic conversion rate, improved thermostability, activity at a different pH and/or optimized codon usage for improved expression in a host cell. The nucleic acid sequences can be preferably 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 90%, 95%, 98%, 99%, 99.9% or even higher identity to the wild-type gene.
In another embodiment, the nucleic acid molecule encodes a polypeptide having the amino acid sequence of SEQ ID NO:2 and/or SEQ NO:4. Also provided is a nucleic acid molecule encoding a polypeptide sequence that is at least 50% identical to either SEQ ID NO:2 or SEQ ID NO:4. Preferably, the nucleic acid molecule encodes a polypeptide sequence of at least 55%, 60%, 70%, 80%, 90% or 95% identical to SEQ ID NO:2 or SEQ ID NO:4, and the identity can even more preferably be 98%, 99%, 99.9% or even higher.
Provided also are nucleic acid molecules that hybridize under stringent conditions to the above-described nucleic acid molecules. As defined above, and as is well known in the art, stringent hybridizations are performed at about 25° C. below the thermal melting point (Tm) for the specific DNA hybrid under a particular set of conditions, where the Tm is the temperature at which 50% of the target sequence hybridizes to a perfectly matched probe. Stringent washing can be performed at temperatures about 5° C. lower than the Tm for the specific DNA hybrid under a particular set of conditions.
The nucleic acid molecule includes DNA molecules (e.g., linear, circular, cDNA, chromosomal DNA, double stranded or single stranded) and RNA molecules (e.g., tRNA, rRNA, mRNA) and analogs of the DNA or RNA molecules of the described herein using nucleotide analogs. The isolated nucleic acid molecule of the invention includes a nucleic acid molecule free of naturally flanking sequences (i.e., sequences located at the 5Ⲡand 3Ⲡends of the nucleic acid molecule) in the chromosomal DNA of the organism from which the nucleic acid is derived. In various embodiments, an isolated nucleic acid molecule can contain less than about 10 kb, 5 kb, 4 kb, 3 kb, 2 kb, 1 kb, 0.5 kb, 0.1 kb, 50 bp, 25 bp or 10 bp of naturally flanking nucleotide chromosomal DNA sequences of the microorganism from which the nucleic acid molecule is derived.
The 1-alkene synthase and/or A1174 hydrolase genes, as described herein, include nucleic acid molecules, for example, a polypeptide or RNA-encoding nucleic acid molecule, separated from another gene or other genes by intergenic DNA (for example, an intervening or spacer DNA which naturally flanks the gene and/or separates genes in the chromosomal DNA of the organism).
Nucleic acid molecules comprising a fragment of any one of the above-described nucleic acid sequences are also provided. These fragments preferably contain at least 20 contiguous nucleotides. More preferably the fragments of the nucleic acid sequences contain at least 25, 30, 35, 40, 45, 50, 60, 70, 80, 90, 100 or even more contiguous nucleotides.
In another embodiment, an isolated 1-alkene synthase-encoding nucleic acid molecule hybridizes to all or a portion of a nucleic acid molecule having the nucleotide sequence set forth in SEQ ID NO:1 or hybridizes to all or a portion of a nucleic acid molecule having a nucleotide sequence that encodes a polypeptide having the amino acid sequence of SEQ ID NO: 2. Such hybridization conditions are known to those skilled in the art (see, for example, Current Protocols in Molecular Biology, Ausubel et al., eds., John Wiley & Sons, Inc. (1995); Molecular Cloning: A Laboratory Manual, Sambrook et al., Cold Spring Harbor Press, Cold Spring Harbor, N.Y. (1989)). In another embodiment, an isolated nucleic acid molecule comprises a nucleotide sequence that is complementary to a 1-alkene synthase-encoding nucleotide sequence as set forth herein.
In another embodiment, an isolated hydrolase-encoding nucleic acid molecule hybridizes to all or a portion of a nucleic acid molecule having the nucleotide sequence set forth in SEQ ID NO:3 or hybridizes to all or a portion of a nucleic acid molecule having a nucleotide sequence that encodes a polypeptide having the amino acid sequence of SEQ ID NO: 4. Such hybridization conditions are known to those skilled in the art (see, for example, Current Protocols in Molecular Biology, Ausubel et al., eds., John Wiley & Sons, Inc. (1995); Molecular Cloning: A Laboratory Manual, Sambrook et al., Cold Spring Harbor Press, Cold Spring Harbor, N.Y. (1989)). In another embodiment, an isolated nucleic acid molecule comprises a nucleotide sequence that is complementary to a polyketide synthase-encoding nucleotide sequence as set forth herein.
The nucleic acid sequence fragments display utility in a variety of systems and methods. For example, the fragments may be used as probes in various hybridization techniques. Depending on the method, the target nucleic acid sequences may be either DNA or RNA. The target nucleic acid sequences may be fractionated (e.g., by gel electrophoresis) prior to the hybridization, or the hybridization may be performed on samples in situ. One of skill in the art will appreciate that nucleic acid probes of known sequence find utility in determining chromosomal structure (e.g., by Southern blotting) and in measuring gene expression (e.g., by Northern blotting). In such experiments, the sequence fragments are preferably detectably labeled, so that their specific hybridization to target sequences can be detected and optionally quantified. One of skill in the art will appreciate that the nucleic acid fragments may be used in a wide variety of blotting techniques not specifically described herein.
It should also be appreciated that the nucleic acid sequence fragments disclosed herein also find utility as probes when immobilized on microarrays. Methods for creating microarrays by deposition and fixation of nucleic acids onto support substrates are well known in the art. Reviewed in DNA Microarrays: A Practical Approach (Practical Approach Series), Schena (ed.), Oxford University Press (1999) (ISBN: 0199637768); Nature Genet. 21(1)(suppl):1-60 (1999); Microarray Biochip: Tools and Technology, Schena (ed.), Eaton Publishing Company/BioTechniques Books Division (2000) (ISBN: 1881299376), the disclosures of which are incorporated herein by reference in their entireties. Analysis of, for example, gene expression using microarrays comprising nucleic acid sequence fragments, such as the nucleic acid sequence fragments disclosed herein, is a well-established utility for sequence fragments in the field of cell and molecular biology. Other uses for sequence fragments immobilized on microarrays are described in Gerhold et al., Trends Biochem. Sci. 24:168-173 (1999) and Zweiger, Trends Biotechnol. 17:429-436 (1999); DNA Microarrays: A Practical Approach (Practical Approach Series), Schena (ed.), Oxford University Press (1999) (ISBN: 0199637768); Nature Genet. 21(1)(suppl):1-60 (1999); Microarray Biochip: Tools and Technology, Schena (ed.), Eaton Publishing Company/BioTechniques Books Division (2000) (ISBN: 1881299376), the disclosures of each of which is incorporated herein by reference in its entirety.
In another embodiment, the invention provides isolated nucleic acid molecules encoding a 1-alkene synthase in a 1-nonadecene biosynthetic pathway which exhibit increased activity.
As is well known in the art, enzyme activities are measured in various ways. For example, the pyrophosphorolysis of OMP may be followed spectroscopically. Grubmeyer et al., J. Biol. Chem. 268:20299-20304 (1993). Alternatively, the activity of the enzyme is followed using chromatographic techniques, such as by high performance liquid chromatography. Chung and Sloan, J. Chromatogr. 371:71-81 (1986). As another alternative the activity is indirectly measured by determining the levels of product made from the enzyme activity. More modern techniques include using gas chromatography linked to mass spectrometry (Niessen, W. M. A. (2001). Current practice of gas chromatographyâmass spectrometry. New York, N.Y: Marcel Dekker. (ISBN: 0824704738)). Additional modern techniques for identification of recombinant protein activity and products including liquid chromatography-mass spectrometry (LCMS), high performance liquid chromatography (HPLC), capillary electrophoresis, Matrix-Assisted Laser Desorption Ionization time of flight-mass spectrometry (MALDI-TOF MS), nuclear magnetic resonance (NMR), near-infrared (NIR) spectroscopy, viscometry (Knothe, G., R. O. Dunn, and M. O. Bagby. 1997. Biodiesel: The use of vegetable oils and their derivatives as alternative diesel fuels. Am. Chem. Soc. Symp. Series 666: 172-208), physical property-based methods, wet chemical methods, etc. are used to analyze the levels and the identity of the product produced by the organisms. Other methods and techniques may also be suitable for the measurement of enzyme activity, as would be known by one of skill in the art.
Another embodiment comprises mutant or chimeric 1-alkene synthase and/or A1174 hydrolase nucleic acid molecules or genes. Typically, a mutant nucleic acid molecule or mutant gene is comprised of a nucleotide sequence that has at least one alteration including, but not limited to, a simple substitution, insertion or deletion. The polypeptide of said mutant can exhibit an activity that differs from the polypeptide encoded by the wild-type nucleic acid molecule or gene. Typically, a chimeric mutant polypeptide includes an entire domain derived from another polypeptide that is genetically engineered to be collinear with a corresponding domain. Preferably, a mutant nucleic acid molecule or mutant gene encodes a polypeptide having improved activity such as substrate affinity, substrate specificity, improved thermostability, activity at a different pH, or optimized codon usage for improved expression in a host cell.
The recombinant vector can be altered, modified or engineered to have different or a different quantity of nucleic acid sequences than in the derived or natural recombinant vector nucleic acid molecule. Preferably, the recombinant vector includes a gene or recombinant nucleic acid molecule operably linked to regulatory sequences including, but not limited to, promoter sequences, terminator sequences and/or artificial ribosome binding sites (RBSs), as defined herein.
Typically, a gene encoding 1-alkene synthase is operably linked to regulatory sequence(s) in a manner which allows for the desired expression characteristics of the nucleotide sequence. Preferably, the gene encoding a 1-alkene synthase in a 1-nonadecene biosynthetic pathway is transcribed and translated into a gene product encoded by the nucleotide sequence when the recombinant nucleic acid molecule is included in a recombinant vector, as defined herein, and is introduced into a microorganism.
The regulatory sequence may be comprised of nucleic acid sequences which modulate, regulate or otherwise affect expression of other nucleic acid sequences. In one embodiment, a regulatory sequence can be in a similar or identical position and/or orientation relative to a nucleic acid sequence as observed in its natural state, e.g., in a native position and/or orientation. For example, a gene of interest can be included in a recombinant nucleic acid molecule or recombinant vector operably linked to a regulatory sequence which accompanies or is adjacent to the gene of interest in the natural host cell, or can be adjacent to a different gene in the natural host cell, or can be operably linked to a regulatory sequence from another organism. Regulatory sequences operably linked to a gene can be from other bacterial regulatory sequences, bacteriophage regulatory sequences and the like.
In one embodiment, a regulatory sequence is a sequence which has been modified, mutated, substituted, derivated, deleted, including sequences which are chemically synthesized. Preferably, regulatory sequences include promoters, enhancers, termination signals, anti-termination signals and other expression control elements that, for example, serve as sequences to which repressors or inducers bind or serve as or encode binding sites for transcriptional and/or translational regulatory polypeptides, for example, in the transcribed mRNA (see Sambrook, J., Fritsh, E. F., and Maniatis, T. Molecular Cloning: A Laboratory Manual. 2nd, ed, Cold Spring Harbor Laboratory, Cold Spring Harbor Laboratory Press, Cold Spring Harbor, N.Y., 1989). Regulatory sequences include promoters directing constitutive expression of a nucleotide sequence in a host cell, promoters directing inducible expression of a nucleotide sequence in a host cell and promoters which attenuate or repress expression of a nucleotide sequence in a host cell. Regulating expression of a gene of interest also can be done by removing or deleting regulatory sequences. For example, sequences involved in the negative regulation of transcription can be removed such that expression of a gene of interest is enhanced. In one embodiment, a recombinant nucleic acid molecule or recombinant vector includes a nucleic acid sequence or gene that encodes at least one bacterial 1-alkene synthase, wherein the gene encoding the enzyme(s) is operably linked to a promoter or promoter sequence. Preferably, promoters include native promoters, surrogate promoters and/or bacteriophage promoters.
In one embodiment, a promoter is associated with a biochemical housekeeping gene. In another embodiment, a promoter is a bacteriophage promoter. Other promoters include tef (the translational elongation factor (TEF) promoter) which promotes high level expression in Bacillus (e.g. Bacillus subtilis). Additional advantageous promoters, for example, for use in Gram positive microorganisms include, but are not limited to, the amyE promoter or phage SP02 promoters. Additional advantageous promoters, for example, for use in Gram negative microorganisms include, but are not limited to tac, trp, tet, trp-tet, lpp, lac, lpp-lac, lacIq, T7, T5, T3, gal, trc, ara, SP6, Îť-pR or Îť-pL.
In another embodiment, a recombinant nucleic acid molecule or recombinant vector includes a transcription terminator sequence or sequences. Typically, terminator sequences refer to the regulatory sequences which serve to terminate transcription of a gene. Terminator sequences (or tandem transcription terminators) can further serve to stabilize mRNA (e.g., by adding structure to mRNA), for example, against nucleases.
In another embodiment, a recombinant nucleic acid molecule or recombinant vector has sequences allowing for detection of the vector containing sequences (i.e., detectable and/or selectable markers), for example, sequences that overcome auxotrophic mutations (e.g. ura3 or ilvE), fluorescent markers, and/or calorimetric markers (e.g., lacZ/β-galactosidase), and/or antibiotic resistance genes (e.g., gen, spec, bla or tet).
It is understood that any one of the polyketide synthase and/or a hydrolase genes of the invention can be introduced into a vector also comprising one or more genes involved in the biosynthesis of 1-nonadecene from light, water and carbon dioxide.
Also provided are vectors, including expression vectors, which comprise the above nucleic acid molecules, as described further herein. In a first embodiment, the vectors include the isolated nucleic acid molecules described above. In an alternative embodiment, the vectors include the above-described nucleic acid molecules operably linked to one or more expression control sequences. The vectors of the instant invention may thus be used to express a polypeptide having 1-alkene synthase in a 1-nonadecene biosynthetic pathway.
Vectors useful for expression of nucleic acids in prokaryotes are well known in the art. A useful vector herein is plasmid pCDF Duet-1 that is available from Novagen. Another useful vector is the endogenous Synechococcus sp. PCC 7002 plasmid pAQ1 (Genbank accession number NCâ010476).
In one embodiment, polypeptides encoded by nucleic acid sequences are produced by recombinant DNA techniques and can be isolated from expression host cells by an appropriate purification scheme using standard polypeptide purification techniques. In another embodiment, polypeptides encoded by nucleic acid sequences are synthesized chemically using standard peptide synthesis techniques.
Included within the scope of the invention are polyketide synthase polypeptides or gene products that are derived polypeptides or gene products encoded by naturally-occurring bacterial genes. Further, included within the inventive scope, are bacteria-derived polypeptides or gene products which differ from wild-type genes, including genes that have altered, inserted or deleted nucleic acids but which encode polypeptides substantially similar in structure and/or function to the wild-type 1-alkene synthase gene. Similar variants with respect to the A1174 hydrolase are also included within the scope of the invention.
For example, it is well understood that one of skill in the art can mutate (e.g., substitute) nucleic acids which, due to the degeneracy of the genetic code, encode for an identical amino acid as that encoded by the naturally-occurring gene. This may be desirable in order to improve the codon usage of a nucleic acid to be expressed in a particular organism. Moreover, it is well understood that one of skill in the art can mutate (e.g., substitute) nucleic acids which encode for conservative amino acid substitutions. It is further well understood that one of skill in the art can substitute, add or delete amino acids to a certain degree to improve upon or at least insubstantially affect the function and/or structure of a gene product (e.g., 1-alkene synthase activity) as compared with a naturally-occurring gene product, each instance of which is intended to be included within the scope of the invention. For example, the 1-alkene synthase activity, enzyme/substrate affinity, enzyme thermostability, and/or enzyme activity at various pHs can be unaffected or rationally altered and readily evaluated using the assays described herein.
In various aspects, isolated polypeptides (including muteins, allelic variants, fragments, derivatives, and analogs) encoded by the nucleic acid molecules are provided. In one embodiment, the isolated polypeptide comprises the polypeptide sequence corresponding to SEQ ID NO:2 or SEQ ID NO:4. In an alternative embodiment, the isolated polypeptide comprises a polypeptide sequence at least 50% identical to SEQ ID NO:2 or SEQ ID NO:4. Preferably the isolated polypeptide has preferably 50%, 60%-70%, 70%-80%, 80%-90%, 90%-95%, 95%-98%, 98.1%, 98.2%, 98.3%, 98.4%, 98.5%, 98.6%, 98.7%, 98.8%, 98.9%, 99%, 99.1%, 99.2%, 99.3%, 99.4%, 99.5%, 99.6%, 99.7%, 99.8%, 99.9% or even higher identity to the sequences optimized for substrate affinity and/or substrate catalytic conversion rate.
According to other embodiments, isolated polypeptides comprising a fragment of the above-described polypeptide sequences are provided. These fragments preferably include at least 20 contiguous amino acids, more preferably at least 25, 30, 35, 40, 45, 50, 60, 70, 80, 90, 100 or even more contiguous amino acids.
The polypeptides also include fusions between the above-described polypeptide sequences and heterologous polypeptides. The heterologous sequences can, for example, include sequences designed to facilitate purification, e.g. histidine tags, and/or visualization of recombinantly-expressed proteins. Other non-limiting examples of protein fusions include those that permit display of the encoded protein on the surface of a phage or a cell, fusions to intrinsically fluorescent proteins, such as green fluorescent protein (GFP), and fusions to the IgG Fc region.
In other aspects, host cells transformed with the nucleic acid molecules or vectors, and descendants thereof, are provided. In some embodiments, these cells carry the nucleic acid sequences on vectors which may be freely replicating vectors, e.g., pAQ1, pAQ3, pAQ4, pAQ5, pAQ6, and pAQ7. In other embodiments, the nucleic acids have been integrated into the genome of the host cells.
The host cell encoding 1-alkene synthase can be a host cell lacking an endogenous 1-alkene synthase gene or a host with an endogenous 1-alkene synthase gene. The host cell can be engineered to express a recombinant 1-alkene synthase in addition to its endogenous 1-alkene synthase gene, and/or the host cell can be modified such that its endogenous 1-alkene synthase gene is overexpressed (e.g., by promoter swapping or by increasing read-through from an upstream promoter).
In a preferred embodiment, the host cell comprises one or more recombinant nucleic acids encoding a 1-alkene synthase (e.g., SEQ ID NO:1).
In an alternative embodiment, the host cells can be mutated by recombination with a disruption, deletion or mutation of the isolated nucleic acid so that the activity of the 1-alkene synthase is reduced or eliminated compared to a host cell lacking the mutation.
In another embodiment, the host cell containing a 1-alkene synthase is suitable for producing 1-nonadecene or 1 octadiene. In a particular embodiment, the host cell is a recombinant host cell that produces 1-nonadecene comprising a heterologous nucleic acid encoding a nucleic acid of SEQ ID NO:1.
In certain aspects, methods for expressing a polypeptide under suitable culture conditions and choice of host cell line for optimal enzyme expression, activity and stability (codon usage, salinity, pH, temperature, etc.) are provided.
In another aspect, the invention provides methods for producing 1-alkenes (e.g., 1-nonadecene, 1-octadecene, and/or other long-chain 1-alkenes) by culturing a host cell under conditions in which the 1-alkene synthase is expressed at sufficient levels to produce a measureable quantity of the -alkene of interest (e.g., 1-nonadecene, 1-octadecene, etc). In a related embodiment, methods for producing 1-alkenes are carried out by contacting a cell lysate obtained from the above host cell under conditions in which the 1-alkenes are produced from light, water and carbon dioxide. Accordingly, the invention provides enzyme extracts having improved 1-alkene synthase activity, and having, for example, thermal stability, activity at various pH, and/or superior substrate affinity or specificity.
Microorganism: Includes prokaryotic and eukaryotic microbial species from the Domains Archaea, Bacteria and Eucarya, the latter including yeast and filamentous fungi, protozoa, algae, or higher Protista. The terms âmicrobial cellsâ and âmicrobesâ are used interchangeably with the term microorganism.
A variety of host organisms can be transformed to produce 1-alkenes. Photoautotrophic organisms include eukaryotic plants and algae, as well as prokaryotic cyanobacteria, green-sulfur bacteria, green non-sulfur bacteria, purple sulfur bacteria, and purple non-sulfur bacteria.
Host cells can be a Gram-negative bacterial cell or a Gram-positive bacterial cell. A Gram-negative host cell of the invention can be, e.g., Gluconobacter, Rhizobium, Bradyrhizobium, Alcaligenes, Rhodobacter, Rhodococcus. Azospirillum, Rhodospirillum, Sphingomonas, Burkholderia, Desuifomonas, Geospirillum, Succinomonas, Aeromonas, Shewanella, Halochromatium, Citrobacter, Escherichia, Klebsiella, Zymomonas Zymobacter, or Acetobacter. A Gram-positive host cell of the invention can be, e.g., Fibrobacter, Acidobacter, Bacteroides, Sphingobacterium, Actinomyces, Corynebacterium, Nocardia, Rhodococcus, Propionibacterium, Bifidobacterium, Bacillus, Geobacillus, Paenibacillus, Sulfobacillus, Clostridium, Anaerobacter, Eubacterium, Streptococcus, Lactobacillus, Leuconostoc, Enterococcus, Lactococcus, Thermobifida, Cellulomonas, or Sarcina.
Extremophiles are also contemplated as suitable organisms. Such organisms withstand various environmental parameters such as temperature, radiation, pressure, gravity, vacuum, desiccation, salinity, pH, oxygen tension, and chemicals. They include hyperthermophiles, which grow at or above 80° C. such as Pyrolobus fumarii; thermophiles, which grow between 60-80° C. such as Synechococcus lividis; mesophiles, which grow between 15-60° C. and psychrophiles, which grow at or below 15° C. such as Psychrobacter and some insects. Radiation tolerant organisms include Deinococcus radiodurans. Pressure tolerant organisms include piezophiles or barophiles which tolerate pressure of 130 MPa. Hypergravity (e.g., >1 g) hypogravity (e.g., <1 g) tolerant organisms are also contemplated. Vacuum tolerant organisms include tardigrades, insects, microbes and seeds. Dessicant tolerant and anhydrobiotic organisms include xerophiles such as Artemia salina; nematodes, microbes, fungi and lichens. Salt tolerant organisms include halophiles (e.g., 2-5 M NaCl) Halobacteriacea and Dunaliella salina. pH tolerant organisms include alkaliphiles such as Natronobacterium, Bacillus firmus OF4, Spirulina spp. (e.g., pH>9) and acidophiles such as Cyanidium caldarium, Ferroplasma sp. (e.g., low pH). Anaerobes, which cannot tolerate O2 such as Methanococcus jannaschii; microaerophils, which tolerate some O2 such as Clostridium and aerobes, which require O2 are also contemplated. Gas tolerant organisms, which tolerate pure CO2 include Cyanidium caldarium and metal tolerant organisms include metalotolerants such as Ferroplasma acidarmanus (e.g., Cu, As, Cd, Zn), Ralstonia sp. CH34 (e.g., Zn, Co, Cd, Hg, Pb). Gross, Michael. Life on the Edge: Amazing Creatures Thriving in Extreme Environments. New York: Plenum (1998) and Seckbach, J. âSearch for Life in the Universe with Terrestrial Microbes Which Thrive Under Extreme Conditions.â In Cristiano Batalli Cosmovici, Stuart Bowyer, and Dan Wertheimer, eds., Astronomical and Biochemical Origins and the Search for Life in the Universe, p. 511. Milan: Editrice Compositori (1997).
Plants include but are not limited to the following genera: Arabidopsis, Beta, Glycine, Jatropha, Miscanthus, Panicum, Phalaris, Populus, Saccharum, Salix, Simmondsia and Zea.
Algae and cyanobacteria include but are not limited to the following genera: Acanthoceras, Acanthococcus, Acaryochloris, Achnanthes, Achnanthidium, Actinastrum, Actinochloris, Actinocyclus, Actinotaenium, Amphichrysis, Amphidinium, Amphikrikos, Amphipleura, Amphiprora, Amphithrix, Amphora, Anabaena, Anabaenopsis, Aneumastus, Ankistrodesmus, Ankyra, Anomoeoneis, Apatococcus, Aphanizomenon, Aphanocapsa, Aphanochaete, Aphanothece, Apiocystis, Apistonema, Arthrodesmus, Artherospira, Ascochloris, Asterionella, Asterococcus, Audouinella, Aulacoseira, Bacillaria, Balbiania, Bambusina, Bangia, Basichlamys, Batrachospermum, Binuclearia, Bitrichia, Blidingia, Botrdiopsis, Botrydium, Botryococcus, Botryosphaerella, Brachiomonas, Brachysira, Brachytrichia, Brebissonia, Bulbochaete, Bumilleria, Bumilleriopsis, Caloneis, Calothrix, Campylodiscus, Capsosiphon, Carteria, Catena, Cavinula, Centritractus, Centronella, Ceratium, Chaetoceros, Chaetochloris, Chaetomorpha, Chaetonella, Chaetonema, Chaetopeltis, Chaetophora, Chaetosphaeridium, Chamaesiphon, Chara, Characiochloris, Characiopsis, Characium, Charales, Chilomonas, Chlainomonas, Chlamydoblepharis, Chlamydocapsa, Chlamydomonas, Chlamydomonopsis, Chlamydomyxa, Chlamydonephris, Chlorangiella, Chlorangiopsis, Chlorella, Chlorobotrys, Chlorobrachis, Chlorochytrium, Chlorococcum, Chlorogloea, Chlorogloeopsis, Chlorogonium, Chlorolobion, Chloromonas, Chlorophysema, Chlorophyta, Chlorosaccus, Chlorosarcina, Choricystis, Chromophyton, Chromulina, Chroococcidiopsis, Chroococcus, Chroodactylon, Chroomonas, Chroothece, Chrysamoeba, Chrysapsis, Chrysidiastrum, Chrysocapsa, Chrysocapsella, Chrysochaete, Chrysochromulina, Chrysococcus, Chrysocrinus, Chrysolepidomonas, Chrysolykos, Chrysonebula, Chrysophyta, Chrysopyxis, Chrysosaccus, Chrysophaerella, Chrysostephanosphaera, Clodophora, Clastidium, Closteriopsis, Closterium, Coccomyxa, Cocconeis, Coelastrella, Coelastrum, Coelosphaerium, Coenochloris, Coenococcus, Coenocystis, Colacium, Coleochaete, Collodictyon, Compsogonopsis, Compsopogon, Conjugatophyta, Conochaete, Coronastrum, Cosmarium, Cosmioneis, Cosmocladium, Crateriportula, Craticula, Crinalium, Crucigenia, Crucigeniella, Cryptoaulax, Cryptomonas, Cryptophyta, Ctenophora, Cyanodictyon, Cyanonephron, Cyanophora, Cyanophyta, Cyanothece, Cyanothomonas, Cyclonexis, Cyclostephanos, Cyclotella, Cylindrocapsa, Cylindrocystis, Cylindrospermum, Cylindrotheca, Cymatopleura, Cymbella, Cymbellonitzschia, Cystodinium Dactylococcopsis, Debarya, Denticula, Dermatochrysis, Dermocarpa, Dermocarpella, Desmatractum, Desmidium, Desmococcus, Desmonema, Desmosiphon, Diacanthos, Diacronema, Diadesmis, Diatoma, Diatomella, Dicellula, Dichothrix, Dichotomococcus, Dicranochaete, Dictyochloris, Dictyococcus, Dictyosphaerium, Didymocystis, Didymogenes, Didymosphenia, Dilabifilum, Dimorphococcus, Dinobryon, Dinococcus, Diplochloris, Diploneis, Diplostauron, Distrionella, Docidium, Draparnaldia, Dunaliella, Dysmorphococcus, Ecballocystis, Elakatothrix, Ellerbeckia, Encyonema, Enteromorpha, Entocladia, Entomoneis, Entophysalis, Epichrysis, Epipyxis, Epithemia, Eremosphaera, Euastropsis, Euastrum, Eucapsis, Eucocconeis, Eudorina, Euglena, Euglenophyta, Eunotia, Eustigmatophyta, Eutreptia, Fallacia, Fischerella, Fragilaria, Fragilariforma, Franceia, Frustulia, Curcilla, Geminella, Genicularia, Glaucocystis, Glaucophyta, Glenodiniopsis, Glenodinium, Gloeocapsa, Gloeochaete, Gloeochrysis, Gloeococcus, Gloeocystis, Gloeodendron, Gloeomonas, Gloeoplax, Gloeothece, Gloeotila, Gloeotrichia, Gloiodictyon, Golenkinia, Golenkiniopsis, Gomontia, Gomphocymbella, Gomphonema, Gomphosphaeria, Gonatozygon, Gongrosia, Gongrosira, Goniochloris, Gonium, Gonyostomum, Granulochloris, Granulocystopsis, Groenbladia, Gymnodinium, Gymnozyga, Gyrosigma, Haematococcus, Hafniomonas, Hallassia, Hammatoidea, Hannaea, Hantzschia, Hapalosiphon, Haplotaenium, Haptophyta, Haslea, Hemidinium, Hemitoma, Heribaudiella, Heteromastix, Heterothrix, Hibberdia, Hildenbrandia, Hillea, Holopedium, Homoeothrix, Hormanthonema, Hormotila, Hyalobrachion, Hyalocardium, Hyalodiscus, Hyalogonium, Hyalotheca, Hydrianum, Hydrococcus, Hydrocoleum, Hydrocoryne, Hydrodictyon, Hydrosera, Hydrurus, Hyella, Hymenomonas, Isthmochloron, Johannesbaptistia, Juranyiella, Karayevia, Kathablepharis, Katodinium, Kephyrion, Keratococcus, Kirchneriella, Klebsormidium, Kolbesia, Koliella, Komarekia, Korshikoviella, Kraskella, Lagerheimia, Lagynion, Lamprothamnium, Lemanea, Lepocinclis, Leptosira, Lobococcus, Lobocystis, Lobomonas, Luticola, Lyngbya, Malleochloris, Mallomonas, Mantoniella, Marssoniella, Martyana, Mastigocoleus, Gastogloia, Melosira, Merismopedia, Mesostigma, Mesotaenium, Micractinium, Micrasterias, Microchaete, Microcoleus, Microcystis, Microglena, Micromonas, Microspora, Microthamnion, Mischococcus, Monochrysis, Monodus, Monomastix, Monoraphidium, Monostroma, Mougeotia, Mougeotiopsis, Myochloris, Myromecia, Myxosarcina, Naegeliella, Nannochloris, Nautococcus, Navicula, Neglectella, Neidium, Nephroclamys, Nephrocytium, Nephrodiella, Nephroselmis, Netrium, Nitella, Nitellopsis, Nitzschia, Nodularia, Nostoc, Ochromonas, Oedogonium, Oligochaetophora, Onychonema, Oocardium, Oocystis, Opephora, Ophiocytium, Orthoseira, Oscillatoria, Oxyneis, Pachycladella, Palmella, Palmodictyon, Pnadorina, Pannus, Paralia, Pascherina, Paulschulzia, Pediastrum, Pedinella, Pedinomonas, Pedinopera, Pelagodictyon, Penium, Peranema, Peridiniopsis, Peridinium, Peronia, Petroneis, Phacotus, Phacus, Phaeaster, Phaeodermatium, Phaeophyta, Phaeosphaera, Phaeothamnion, Phormidium, Phycopeltis, Phyllariochloris, Phyllocardium, Phyllomitas, Pinnularia, Pitophora, Placoneis, Planctonema, Planktosphaeria, Planothidium, Plectonema, Pleodorina, Pleurastrum, Pleurocapsa, Pleurocladia, Pleurodiscus, Pleurosigma, Pleurosira, Pleurotaenium, Pocillomonas, Podohedra, Polyblepharides, Polychaetophora, Polyedriella, Polyedriopsis, Polygoniochloris, Polyepidomonas, Polytaenia, Polytoma, Polytomella, Porphyridium, Posteriochromonas, Prasinochloris, Prasinocladus, Prasinophyta, Prasiola, Prochlorphyta, Prochlorothrix, Protoderma, Protosiphon, Provasoliella, Prymnesium, Psammodictyon, Psammothidium, Pseudanabaena, Pseudenoclonium, Psuedocarteria, Pseudochate, Pseudocharacium, Pseudococcomyxa, Pseudodictyosphaerium, Pseudokephyrion, Pseudoncobyrsa, Pseudoquadrigula, Pseudosphaerocystis, Pseudostaurastrum, Pseudostaurosira, Pseudotetrastrum, Pteromonas, Punctastruata, Pyramichlamys, Pyramimonas, Pyrrophyta, Quadrichloris, Quadricoccus, Quadrigula, Radiococcus, Radiofilum, Raphidiopsis, Raphidocelis, Raphidonema, Raphidophyta, Peimeria, Rhabdoderma, Rhabdomonas, Rhizoclonium, Rhodomonas, Rhodophyta, Rhoicosphenia, Rhopalodia, Rivularia, Rosenvingiella, Rossithidium, Roya, Scenedesmus, Scherffelia, Schizochlamydella, Schizochlamys, Schizomeris, Schizothrix, Schroederia, Scolioneis, Scotiella, Scotiellopsis, Scourfieldia, Scytonema, Selenastrum, Selenochloris, Sellaphora, Semiorbis, Siderocelis, Diderocystopsis, Dimonsenia, Siphononema, Sirocladium, Sirogonium, Skeletonema, Sorastrum, Spermatozopsis, Sphaerellocystis, Sphaerellopsis, Sphaerodinium, Sphaeroplea, Sphaerozosma, Spiniferomonas, Spirogyra, Spirotaenia, Spirulina, Spondylomorum, Spondylosium, Sporotetras, Spumella, Staurastrum, Stauerodesmus, Stauroneis, Staurosira, Staurosirella, Stenopterobia, Stephanocostis, Stephanodiscus, Stephanoporos, Stephanosphaera, Stichococcus, Stichogloea, Stigeoclonium, Stigonema, Stipitococcus, Stokesiella, Strombomonas, Stylochrysalis, Stylodinium, Styloyxis, Stylosphaeridium, Surirella, Sykidion, Symploca, Synechococcus, Synechocystis, Synedra, Synochromonas, Synura, Tabellaria, Tabularia, Teilingia, Temnogametum, Tetmemorus, Tetrachlorella, Tetracyclus, Tetradesmus, Tetraedriella, Tetraedron, Tetraselmis, Tetraspora, Tetrastrum, Thalassiosira, Thamniochaete, Thorakochloris, Thorea, Tolypella, Tolypothrix, Trachelomonas, Trachydiscus, Trebouxia, Trentepholia, Treubaria, Tribonema, Trichodesmium, Trichodiscus, Trochiscia, Tryblionella, Ulothrix, Uroglena, Uronema, Urosolenia, Urospora, Uva, Vacuolaria, Vaucheria, Volvox, Volvulina, Westella, Woloszynskia, Xanthidium, Xanthophyta, Xenococcus, Zygnema, Zygnemopsis, and Zygonium.
Green non-sulfur bacteria include but are not limited to the following genera: Chloroflexus, Chloronema, Oscillochloris, Heliothrix, Herpetosiphon, Roseiflexus, and Thermomicrobium.
Green sulfur bacteria include but are not limited to the following genera: Chlorobium, Clathrochloris, and Prosthecochloris.
Purple sulfur bacteria include but are not limited to the following genera: Allochromatium, Chromatium, Halochromatium, Isochromatium, Marichromatium, Rhodovulum, Thermochromatium, Thiocapsa, Thiorhodococcus, and Thiocystis,
Purple non-sulfur bacteria include but are not limited to the following genera: Phaeospirillum, Rhodobaca, Rhodobacter, Rhodomicrobium, Rhodopila, Rhodopseudomonas, Rhodothalassium, Rhodospirillum, Rodovibrio, and Roseospira.
Aerobic chemolithotrophic bacteria include but are not limited to nitrifying bacteria such as Nitrobacteraceae sp., Nitrobacter sp., Nitrospina sp., Nitrococcus sp., Nitrospira sp., Nitrosomonas sp., Nitrosococcus sp., Nitrosospira sp., Nitrosolobus sp., Nitrosovibrio sp.; colorless sulfur bacteria such as, Thiovulum sp., Thiobacillus sp., Thiomicrospira sp., Thiosphaera sp., Thermothrix sp.; obligately chemolithotrophic hydrogen bacteria such as Hydrogenobacter sp., iron and manganese-oxidizing and/or depositing bacteria such as Siderococcus sp., and magnetotactic bacteria such as Aquaspirillum sp.
Archaeobacteria include but are not limited to methanogenic archaeobacteria such as Methanobacterium sp., Methanobrevibacter sp., Methanothermus sp., Methanococcus sp., Methanomicrobium sp., Methanospirillum sp., Methanogenium sp., Methanosarcina sp., Methanolobus sp., Methanothrix sp., Methanococcoides sp., Methanoplanus sp.; extremely thermophilic sulfur-metabolizers such as Thermoproteus sp., Pyrodictium sp., Sulfolobus sp., Acidianus sp. and other microorganisms such as, Bacillus subtilis, Saccharomyces cerevisiae, Streptomyces sp., Ralstonia sp., Rhodococcus sp., Corynebacteria sp., Brevibacteria sp., Mycobacteria sp., and oleaginous yeast.
In preferred embodiments the parental photoautotrophic organism can be transformed with a gene encoding 1-alkene synthase.
Preferred organisms for HyperPhotosynthetic conversion include: Arabidopsis thaliana, Panicum virgatum, Miscanthus giganteus, and Zea mays (plants), Botryococcus braunii, Chlamydomonas reinhardtii and Dunaliela salina (algae), Synechococcus sp PCC 7002, Synechococcus sp. PCC 7942, Synechocystis sp. PCC 6803, and Thermosynechococcus elongatus BP-1 (cyanobacteria), Chlorobium tepidum (green sulfur bacteria), Chloroflexus auranticus (green non-sulfur bacteria), Chromatium tepidum and Chromatium vinosum (purple sulfur bacteria), Rhodospirillum rubrum, Rhodobacter capsulatus, and Rhodopseudomonas palusris (purple non-sulfur bacteria).
Yet other suitable organisms include synthetic cells or cells produced by synthetic genomes as described in Venter et al. US Pat. Pub. No. 2007/0264688, and cell-like systems or synthetic cells as described in Glass et al. US Pat. Pub. No. 2007/0269862.
Still, other suitable organisms include microorganisms that can be engineered to fix carbon dioxide bacteria such as Escherichia coli, Acetobacter aceti, Bacillus subtilis, yeast and fungi such as Clostridium ljungdahlii, Clostridium thermocellum, Penicillium chrysogenum, Pichia pastoris, Saccharomyces cerevisiae, Schizosaccharomyces pombe, Pseudomonas fluorescens, or Zymomonas mobilis.
A common theme in selecting or engineering a suitable organism is autotrophic fixation of CO2 to products. This would cover photosynthesis and methanogenesis. Acetogenesis, encompassing the three types of CO2 fixation; Calvin cycle, acetyl CoA pathway and reductive TCA pathway is also covered. The capability to use carbon dioxide as the sole source of cell carbon (autotrophy) is found in almost all major groups of prokaryotes. The CO2 fixation pathways differ between groups, and there is no clear distribution pattern of the four presently-known autotrophic pathways. Fuchs, G. 1989. Alternative pathways of autotrophic CO2 fixation, p. 365-382. In H. G. Schlegel, and B. Bowien (ed.), Autotrophic bacteria. Springer-Verlag, Berlin, Germany. The reductive pentose phosphate cycle (Calvin-Bassham-Benson cycle) represents the CO2 fixation pathway in many aerobic autotrophic bacteria, for example, cyanobacteria.
The 1-nonadecene producing gene can be propagated by insertion into the host cell genome. Integration into the genome of the host cell is optionally done at particular loci to impair or disable unwanted gene products or metabolic pathways.
In another embodiment is described the integration of a 1-alkene synthase gene and/or a hydrolase gene in the 1-alkene synthesis pathway into a plasmid. The plasmid can express one or more genes, optionally an operon including one or more genes, preferably one or more genes involved in the synthesis of 1-alkenes, or more preferably one or more genes of a related metabolic pathway that feeds into the biosynthetic pathway for 1-alkenes.
Yet another embodiment provides a method of integrating one or more 1-alkene synthase genes into an expression vector including, but not limited to, pJB5 (see, e.g., WO 2009/111513, published Sep. 11, 2009) or pCDFDuet-1 (Novagen).
In another aspect, provided herein are isolated antibodies, including fragments and derivatives thereof that bind specifically to the isolated polypeptides and polypeptide fragments or to one or more of the polypeptides encoded by the isolated nucleic acids. The antibodies may be specific for linear epitopes, discontinuous epitopes or conformational epitopes of such polypeptides or polypeptide fragments, either as present on the polypeptide in its native conformation or, in some cases, as present on the polypeptides as denatured, as, e.g., by solubilization in SDS. Among the useful antibody fragments are Fab, Fabâ˛, Fv, F(abâ˛)2, and single chain Fv fragments.
By âbind specificallyâ and âspecific bindingâ is here intended the ability of the antibody to bind to a first molecular species in preference to binding to other molecular species with which the antibody and first molecular species are admixed. An antibody is said specifically to ârecognizeâ a first molecular species when it can bind specifically to that first molecular species.
As is well known in the art, the degree to which an antibody can discriminate as among molecular species in a mixture will depend, in part, upon the conformational relatedness of the species in the mixture; typically, the antibodies will discriminate over adventitious binding to unrelated polypeptides by at least two-fold, more typically by at least 5-fold, typically by more than 10-fold, 25-fold, 50-fold, 75-fold, and often by more than 100-fold, and on occasion by more than 500-fold or 1000-fold.
Typically, the affinity or avidity of an antibody (or antibody multimer, as in the case of an IgM pentamer) for a polypeptide or polypeptide fragment will be at least about 1Ă10â6 M, typically at least about 5Ă10â7 M, usefully at least about 1Ă10â7 M, with affinities and avidities of 1Ă10â8 M, 5Ă10â9 M, 1Ă10â10 M and even stronger proving especially useful.
The isolated antibodies may be naturally-occurring forms, such as IgG, IgM, IgD, IgE, and IgA, from any mammalian species. For example, antibodies are usefully obtained from species including rodents-typically mouse, but also rat, guinea pig, and hamster-lagomorphs, typically rabbits, and also larger mammals, such as sheep, goats, cows, and horses. The animal is typically affirmatively immunized, according to standard immunization protocols, with the polypeptide or polypeptide fragment.
Virtually all fragments of 8 or more contiguous amino acids of the polypeptides may be used effectively as immunogens when conjugated to a carrier, typically a protein such as bovine thyroglobulin, keyhole limpet hemocyanin, or bovine serum albumin, conveniently using a bifunctional linker. Immunogenicity may also be conferred by fusion of the polypeptide and polypeptide fragments to other moieties. For example, peptides can be produced by solid phase synthesis on a branched polylysine core matrix; these multiple antigenic peptides (MAPs) provide high purity, increased avidity, accurate chemical definition and improved safety in vaccine development. See, e.g., Tam et al., Proc. Natl. Acad. Sci. USA 85:5409-5413 (1988); Posnett et al., J. Biol. Chem. 263, 1719-1725 (1988).
Protocols for immunization are well-established in the art. Such protocols often include multiple immunizations, either with or without adjuvants such as Freund's complete adjuvant and Freund's incomplete adjuvant. Antibodies may be polyclonal or monoclonal, with polyclonal antibodies having certain advantages in immunohistochemical detection of the proteins and monoclonal antibodies having advantages in identifying and distinguishing particular epitopes of the proteins. Following immunization, the antibodies may be produced using any art-accepted technique. Host cells for recombinant antibody productionâeither whole antibodies, antibody fragments, or antibody derivativesâcan be prokaryotic or eukaryotic. Prokaryotic hosts are particularly useful for producing phage displayed antibodies, as is well known in the art. Eukaryotic cells, including mammalian, insect, plant and fungal cells are also useful for expression of the antibodies, antibody fragments, and antibody derivatives. Antibodies can also be prepared by cell free translation.
The isolated antibodies, including fragments and derivatives thereof, can usefully be labeled. It is, therefore, another aspect to provide labeled antibodies that bind specifically to one or more of the polypeptides and polypeptide fragments. The choice of label depends, in part, upon the desired use. In some cases, the antibodies may usefully be labeled with an enzyme. Alternatively, the antibodies may be labeled with colloidal gold or with a fluorophore. For secondary detection using labeled avidin, streptavidin, captavidin or neutravidin, the antibodies may usefully be labeled with biotin. When the antibodies are used, e.g., for Western blotting applications, they may usefully be labeled with radioisotopes, such as 33 P, 32P, 35S, 3H and 125I. As would be understood, use of the labels described above is not restricted to any particular application.
Increased 1-alkene production can be achieved through the expression and optimization of the 1-alkene synthase and the 1-alkene synthesis pathway in organisms well suited for modern genetic engineering techniques, i.e., those that rapidly grow, are capable of thriving on inexpensive food resources and from which isolation of a desired product is easily and inexpensively achieved. To increase the rate of production of 1-alkenes it would be advantageous to design and select variants of the enzymes, including but not limited to, variants optimized for substrate affinity, substrate specificity, substrate catalytic conversion rate, improved thermostability, activity at a different pH and/or optimized codon usage for improved expression in a host cell. See, for example, amino acid changes correlated to alterations in the catalytic rate while maintaining similar affinities (R L Zheng and R G Kemp, J. Biol. Chem. (1994) Vol. 269:18475-18479) or amino acid changes correlated with changes in the stability of the transition state that affect catalytic turnover (MA Phillips, et al., J. Biol. Chem., (1990) Vol. 265:20692-20698). It would be another advantage to design and select for enzymes altered to have substantially decreased reverse reaction activity in which enzyme-substrate products would be the result of energetically unfavorable bond formation or molecular re-configuration of the substrate, and have improved forward reaction activity in which enzyme-substrate products would be the result of energetically favorable molecular bond reduction or molecular re-configuration.
Accordingly, one method for the design of improved polyketide synthase proteins for synthesizing 1-nonadecene utilizes computational and bioinformatic analysis to design and select for advantageous changes in primary amino acid sequences encoding ethanologenic enzyme activity. Computational methods and bioinformatics provide tractable alternatives for rational design of protein structure and function. Recently, algorithms analyzing protein structure for biophysical character (for example, motional dynamics and total energy or Gibb's Free Energy evaluations) have become a commercially feasible methodology supplementing protein sequence analysis data that assess homology, identity and/or degree of sequence and domain conservation to improve upon or design the desirable qualities of a protein (Rosetta++, University of Washington). For example, an in silico redesign of the endonuclease I-MsoI was based on computational evaluation of biophysical parameters of rationally selected changes to the primary amino acid sequence. Researchers were able to maintain wild-type binding selectivity and affinity yet improve the catalytic turnover by four orders of magnitude (Ashworth, et al., Nature (2006) vol. 441:656-659).
In one embodiment, polypeptide sequences or related homologues in a complex with a substrate are obtained from the Protein Data Bank (PDB; HM Berman, et al., Nucleic Acids Research (2000) vol. 28:235-242) for computational analysis on steady state and/or changes in Gibb's free energy relative to the wild type protein. Substitutions of one amino acid residue for another are accomplished in silico interactively as a means for identifying specific residue substitutions that optimize structural or catalytic contacts between the protein and substrate using standard software programs for viewing molecules as is well known to those skilled in the art. To the extent that in silico structures for the polypeptides (and homologues) described herein are available through the PDB, those structures can be used to rationally design modified proteins with desired (typically, improved) activities. Specific amino acid substitutions are rationally chosen based on substituted residue characteristics that optimize, for example, Van der Waal's interactions, hydrophobicity, hydrophilicity, steric non-interferences, pH-dependent electrostatics and related chemical interactions. The overall energetic change of the substitution protein model when unbound and bound to its substrate is calculated and assessed by one having skill in the art to be evaluated for the change in free energy for correlations to overall structural stability (e.g., Meiler, J. and D. Baker, Proteins (2006) 65:538-548). In addition, such computational methods provide a means for accurately predicting quaternary protein structure interactions such that in silico modifications are predictive or determinative of overall multimeric structural stability (Wollacott, A M, et al., Protein Science (2007) 16:165-175; Joachimiak, L A, et al., J. Mol. Biol. (2006) 361:195-208).
Preferably, a rational design change to the primary structure of 1-alkene synthase protein sequences minimally alters the Gibb's free energy state of the unbound polypeptide and maintain a folded, functional and similar wild-type enzyme structure. More preferably a lower computational total free energy change of the protein sequence is achieved to indicate the potential for optimized enzyme structural stability.
Although lower free energy of a protein structure relative to the wild type structure is an indicator of thermodynamic stability, the positive correlation of increased thermal stability to optimized function does not always exist. Therefore, preferably, optimal catalytic contacts between the modified 1-alkene synthase protein structure and the substrate are achieved with a concomitant predicted favorable change in total free energy of the catabolic reaction, for example by rationally designing 1-alkene synthase protein/substrate interactions that stabilize the transition state of the enzymatic reaction while maintaining a similar or favorable change in free energy of the unbound 1-alkene synthase protein for a desired environment in which a host cell expresses the mutant 1-alkene synthase protein. Even more preferably, rationally selected amino acid changes result in a substantially decreased 1-alkene synthase enzyme's anabolic protein/substrate reaction or increase the 1-alkene synthase's catabolic protein/substrate reaction. In a further embodiment any and/or all 1-alkene synthase sequences are expression optimized for the specific expression host cell.
Several methods well known to those with skill in the art are available to generate random nucleotide sequence variants for a corresponding polypeptide sequence using the Polymerase Chain Reaction (âPCRâ) (U.S. Pat. No. 4,683,202). One embodiment is the generation of 1-alkene synthase gene variants using the method of error prone PCR. (R. Cadwell and G. Joyce, PCR Meth. Appl. (1991) Vol. 2:28-33; Leung, et al., Technique (1989) Vol. 1:11-15). Error prone PCR is achieved by the establishment of a chemical environment during the PCR experiment that causes an increase in unfaithful replication of a parent copy of DNA sought to be replicated. For example, increasing the manganese or magnesium ion content of the chemical admixture used in the PCR experiment, very low annealing temperatures, varying the balance among di-deoxy nucleotides added, starting with a low population of parent DNA templates or using polymerases designed to have increased inefficiencies in accurate DNA replication all result in nucleotide changes in progeny DNA sequences during the PCR replication process. The resultant mutant DNA sequences are genetically engineered into an appropriate vector to be expressed in a host cell and analyzed to screen and select for the desired effect on whole cell production of a product or process of interest. In one embodiment, random mutagenesis of the 1-alkene synthase-encoding nucleotide sequences is generated through error prone PCR using techniques well known to one skilled in the art. Resultant nucleotide sequences are analyzed for structural and functional attributes through clonal screening assays and other methods as described herein.
Another embodiment is generating a specifically desired protein mutant using site-directed mutagenesis. For example, with overlap extension (An, et al., Appl. Microbiol. Biotech. (2005) vol. 68(6):774-778) or mega-primer PCR (E. Burke and S. Batik, Methods Mol. Bio. (2003) vol 226:525-532) one can use nucleotide primers that have been altered at corresponding codon positions in the parent nucleotide to yield DNA progeny sequences containing the desired mutation. Alternatively, one can use cassette mutagenesis (Kegler-Ebo, et al., Nucleic Acids Res. (1994) vol. 22(9):1593-1599) as is commonly known by one skilled in the art.
In one aspect, using site-directed mutagenesis and cassette mutagenesis, all possible positions in SEQ ID NO:2 are changed to a proline, transformed into a suitable high expression vector and expressed at high levels in a suitable expression host cell. Purified aliquots at concentrations necessary for the appropriate biophysical analytical technique are obtained by methods as known to those with skill in the art (P. Rellos and R. K. Scopes, Prot. Exp. Purific. (1994) Vol. 5:270-277) and evaluated for increased thermostability.
Another embodiment is to select for a polypeptide variant for expression in a recipient host cell by comparing a first nucleic acid sequence encoding the polypeptide with the nucleic acid sequence of a second, related nucleic acid sequence encoding a polypeptide having more desirable qualities, and altering at least one codon of the first nucleic acid sequence to have identity with the corresponding codon of the second nucleic acid sequence, such that improved polypeptide activity, substrate specificity, substrate affinity, substrate catalytic conversion rate, improved thermostability, activity at a different pH and/or optimized codon usage for expression and/or structure of the altered polypeptide is achieved in the host cell.
In yet another embodiment, all amino acid residue variations are encoded at any desired, specified nucleotide codon position using such methods as site saturation mutagenesis (Meyers, et al., Science (1985) Vol. 229:242-247; Derbyshire, et al., Gene (1986) Vol. 46:145-152; U.S. Pat. No. 6,171,820). Whole gene site saturation mutagenesis (K. Kretz, et al., Meth. Enzym. (2004) Vol. 388:3-11) is preferred wherein all amino acid residue variations are encoded at every nucleotide codon position. Both methods yield a population of protein variants differing from the parent polypeptide by one amino acid, with each amino acid substitution being correlated to structural/functional attributes at any position in the polypeptide. Saturation mutagenesis uses PCR and primers homologous to the parent sequence wherein one or more codon encoding nucleotide triplets is randomized. Randomization results in the incorporation of codons corresponding to all amino acid replacements in the final, translated polypeptide. Each PCR product is genetically engineered into an expression vector to be introduced into an expression host and screened for structural and functional attributes through clonal screening assays and other methods as described herein.
In one aspect of saturation mutagenesis, correlated saturation mutagenesis (âCSMâ) is used wherein two or more amino acids at rationally designated positions are changed concomitantly to different amino acid residues to engineer improved enzyme function and structure. Correlated saturation mutagenesis allows for the identification of complimentary amino acid changes having, e.g., positive, synergistic effects on 1-alkene synthase enzyme structure and function. Such synergistic effects include, but are not limited to, significantly altered enzyme stability, substrate affinity, substrate specificity or catalytic turnover rate, independently or concomitantly increasing advantageously the production of 1-alkenes.
In yet another embodiment, amino acid substitution combinations of CSM derived protein variants being optimized for a particular function are combined with one or more CSM derived protein variants being optimized for another particular function to derive a 1-alkene synthase and/or A1174 hydrolase protein variant exhibiting multiple optimized structural and functional characteristics. For example, amino acid changes in combinatorial mutants showing optimized protomer interactions are combined with amino acid changes in combinatorial mutants showing optimized catalytic turnover.
In one embodiment, mutational variants derived from the methods described herein are cloned. DNA sequences produced by saturation mutagenesis are designed to have restriction sites at the ends of the gene sequences to allow for excision and transformation into a host cell plasmid. Generated plasmid stocks are transformed into a host cell and incubated at optimal growth conditions to identify successfully transformed colonies.
Another embodiment utilizes gene shuffling (P. Stemmer, Nature (1994) Vol. 370:389-391) or gene reassembly (U.S. Pat. No. 5,958,672) to develop improved protein structure/function through the generation of chimeric proteins. With gene shuffling, two or more homologous 1-alkene synthases encoding nucleotide sequences are treated with endonucleases at random positions, mixed together, heated until sufficiently melted and reannealed. Nucleotide sequences from homologues will anneal to develop a population of chimeric genes that are repaired to fill in any gaps resulting from the re-annealing process, expressed and screened for improved structure/function 1-alkene synthase chimeras. Gene reassembly is similar to gene shuffling; however, nucleotide sequences for specific, homologous 1-alkene synthase protein domains are targeted and swapped with other homologous domains for reassembly into a chimeric gene. The genes are expressed and screened for improved structure/function 1-alkene synthase chimeras.
In a further embodiment any and/or all sequences additionally are expression optimized for the specific expression host cell.
Variations in expressed polypeptide sequences may result in measurable differences in the whole-cell rate of substrate conversion. It is desirable to determine differences in the rate of substrate conversion by assessing productivity in a host cell having a particular protein variant relative to other whole cells having a different protein variant. Additionally, it would be desirable to determine the efficacies of whole-cell substrate conversion as a function of environmental factors including, but not limited to, pH, temperature nutrient concentration and salinity.
Therefore, in one embodiment, the biophysical analyses described herein on protein variants are performed to measure structural/functional attributes. Standard analyses of polypeptide activity are well known to one of ordinary skill in the art. Such analysis can require the expression and high purification of large quantities of polypeptide, followed by various physical methods (including, but not limited to, calorimetry, fluorescence, spectrophotometric, spectrometric, liquid chromatography (LC), mass spectrometry (MS), LC-MS, affinity chromatography, light scattering, nuclear magnetic resonance and the like) to assay function in a specific environment or functional differences among homologues.
In another embodiment, the polypeptides are expressed, purified and subject to the aforementioned analytical techniques to assess the functional difference among polypeptide sequence homologues, for example, the rate of substrate conversion and/or 1-alkene synthesis.
Batch culture (or closed system culture) analysis is well known in the art and can provide information on host cell population effects for host cells expressing genetically engineered genes. In batch cultures a host cell population will grow until available nutrients are depleted from the culture media.
In one embodiment, the polypeptides are expressed in a batch culture and analyzed for approximate doubling times, expression efficacy of the engineered polypeptide and end-point net product formation and net biomass production.
Turbidostats are well known in the art as one form of a continuous culture within which media and nutrients are provided on an uninterrupted basis and allow for non-stop propagation of host cell populations. Turbidostats allow the user to determine information on whole cell propagation and steady-state productivity for a particular biologically produced end product such as host cell doubling time, temporally delimited biomass production rates for a particular host cell population density, temporally delimited host cell population density effects on substrate conversion and net productivity of a host cell substrate conversion. Turbidostats can be designed to monitor the partitioning of substrate conversion products to the liquid or gaseous state. Additionally, quantitative evaluation of net productivity of a carbon-based product of interest can be accurately performed due to the exacting level of control that one skilled in the art has over the operation of the turbidostat. These types of information are useful to assess the parsed and net efficacies of a host cell genetically engineered to produce a specific carbon-based product of interest.
In one embodiment, identical host cell lines differing only in the nucleic acid and expressed polypeptide sequence of a homologous enzyme are cultured in a uniform-environment turbidostat to determine highest whole cell efficacy for the desired carbon-based product of interest.
In another embodiment, identical host cell lines differing only in the nucleic acid and expressed polypeptide sequence of a homologous enzyme are cultured in a batch culture or a turbidostat in varying environments (e.g. temperature, pH, salinity, nutrient exposure) to determine highest whole cell efficacy for the desired carbon-based product of interest.
In one embodiment, mutational variants derived from the methods described herein are cloned. DNA sequences produced by saturation mutagenesis are designed to have restriction sites at the ends of the gene sequences to allow for cleavage and transformation into a host cell plasmid. Generated plasmid stocks are transformed into a host cell and incubated at optimal growth conditions to identify successfully transformed colonies.
It is desirable to engineer into an organism better suited for industrial use a genetic system from which 1-nonadecene can be produced efficiently and cleanly.
Accordingly, the invention includes the conversion of water, carbon dioxide and light into 1-alkenes using the 1-alkene synthase enzyme described herein. In one embodiment, the invention includes producing 1-alkenes, including 1-nonadecene and 1-octadecene, using genetically engineered host cells expressing a 1-alkene synthase gene.
In another preferred embodiment, the genetically engineered host cells expresses a 1-alkene synthase and one or more genes in a 1-alkene biosynthetic pathway enabling the host cell to convert water, light and carbon dioxide and/or stearic acid into 1-nonadecene.
In another embodiment of the invention, the genetically engineered host cell is processed into an enzymatic lysate for performing the above conversion reaction. In yet another embodiment, the 1-alkene synthase gene product is purified, as described herein, for carrying out the conversion reaction.
The host cells and/or enzymes, for example in the lysate, partially purified, or purified, used in the conversion reactions are in a form allowing them to perform their intended function, producing a desired compound, for example, 1-nonadecene. The microorganisms used can be whole cells, or can be only those portions of the cells necessary to obtain the desired end result. The microorganisms can be suspended (e.g., in an appropriate solution such as buffered solutions or media), rinsed (e.g., rinsed free of media from culturing the microorganism), acetone-dried, immobilized (e.g., with polyacrylamide gel or k-carrageenan or on synthetic supports, for example, beads, matrices and the like), fixed, cross-linked or permeabilized (e.g., have permeabilized membranes and/or walls such that compounds, for example, substrates, intermediates or products can more easily pass through said membrane or wall).
In yet another embodiment, a purified or unpurified 1-alkene synthesizing enzyme (e.g., a 1-alkene synthase) is used in the conversion reactions. The enzyme is in a form that allows it to perform its intended function. For example, the enzyme can be immobilized, conjugated or floating freely.
In yet another embodiment the 1-alkene synthase enzymes are chimeric wherein a polypeptide linker is encoded between the polyketide synthase enzyme and another enzyme. Upon translation into a polypeptide, two enzymes of a metabolic pathway are tethered together by a polypeptide linker. Such arrangement of two or more functionally related proteins tethered together in a host cell increases the local effective concentration of metabolically related enzymes that can increase the efficiency of substrate conversion.
The following examples are for illustrative purposes and are not intended to limit the scope of the invention.
Three vectors were constructed so that gene knockout strains of Synechococcus sp. PCC7002 could be prepared for nonA (SYNPCC7002_A1173), an upstream putative hydrolase gene (SYNPCC7002_A1174) and an unrelated gene to use as a marker control strain (SYNPCC7002_A1189). These plasmids contain approximately 750 bp of upstream and downstream sequence for the respective gene flanking a gentamycin resistance marker. The DNA sequences of these plasmids are given in SEQ ID NO: 5, SEQ ID NO: 6 and SEQ ID NO: 7, respectively.
The knockout strains of Synechococcus sp. PCC 7002 were prepared using the following procedure. A 5 ml culture of in A+ medium containing 200 mg/L spectinomycin was incubated in an Infors shaking incubator at 150 rpm at 37° C. under 2% CO2/air and continuous light (70-130 ΟE m2/s PAR, measured with a LI-250A light meter (LI-COR)) until it reached an OD730 of 1. A+ medium comprises 18.0 g/L sodium chloride, 5.0 g/L magnesium sulfate heptahydrate, 1.0 g/L sodium nitrate, 1.0 g/L Tris, 0.6 g/L potassium chloride, 0.3 g/L calcium chloride (anhydrous), 50 mg/L potassium phosphate monobasic, 34.3 mg/L boric acid, 29.4 mg/L EDTA (disodium salt dihydrate), 3.9 mg/L iron (III) chloride hexahydrate, 4.3 mg/L manganese chloride tetrahydrate, 315.0 Οg/L zinc chloride, 30.0 Οg/L molybdenum (VI) oxide, 12.2 Οg/L cobalt (II) chloride hexahydrate, 10.0 Οg/L vitamin B12, and 3.0 Οg/L copper (II) sulfate pentahydrate. For each plasmid, 500 Οl of culture and 5 Οg of plasmid DNA were added into a microcentrifuge tube. The tubes were then incubated at 37° C. in New Brunswick shaking incubator at 250 rpm in the dark for 4 h. 250 Οl for each transformation was then plated on A+ agar plates. The plates were incubated overnight in a Percival lighted incubator under constant illumination (40-60 ΟE/m2/s PAR, measured with a LI-250A light meter (LI-COR)) at 37° C. for about 24 hours. On the following day, a gentamycin solution was added underneath the agar of the plates to a final estimated concentration of 25 mg/L gentamycin (assuming 40 ml A+ agar in the plate). These plates were placed back into the incubator until tiny colonies became visible. The plates were moved to another Percival incubator under the same conditions except that 1% CO2 was maintained in the air (allows for faster growth). Two colonies from each transformation plate were streaked onto A+ plates containing 50 mg/L gentamycin and incubated in a Percival incubator (ambient CO2 concentration) until colonies were present. This plating step was repeated, and segregated strains with the respective genes removed (Table 1) were identified by PCR screening with primers designed to probe for the presence of the respective genes.
| TABLE 1 |
| Strains investigated for the production of 1-alkenes. |
| Parent | |||
| JCC # | strain | Genotype | Marker |
| JCC138 | NA | Synechococcus sp. PCC 7002 | NA |
| JCC1129 | JCC138 | ÎA1189 (type II site-specific | gentamycin |
| deoxyribonuclease) | |||
| JCC1218 | JCC138 | ÎA1173 (nonA) | gentamycin |
| JCC1219 | JCC138 | ÎA1174 (hydrolase domain- | gentamycin |
| containing protein) | |||
One 30-ml culture of each strain listed in Table 1 was prepared in JB 2.1 medium (see, e.g., PCT US2009/006516, published Jun. 17, 2010) at an OD730=0.2 in 125 ml flasks (inocula were from five ml A+ cultures containing 200 mg/L spectinomyin started from colonies incubated for 3 days in a Multitron II Infors shaking photoincubator under continuous light of Ë100 ÎźE mâ2 sâ1 photosynthetically active radiation (PAR) at 37° C. at 150 rpm in 2% CO2-enriched air). The cultures were incubated for four days in the Infors incubators under continuous light of Ë100 ÎźE mâ2 sâ1 photosynthetically active radiation (PAR) at 37° C. at 150 rpm in 2% CO2-enriched air. Water loss was compensated by adding back milli-Q water (based on weight loss of flasks). Optical density measurements at 730 nm (OD730) were taken (Table 2). 2.5 ml of each culture was removed and the cells were pelleted using a Sorvall RC6 Plus superspeed centrifuge (Thermo Electron Corp) and a F13S-14X50CY rotor (5000 rpm for 10 min). The media supernatant was removed and the cells were resuspended in 1 ml of Milli-Q water. The cells were pelleted again using a benchtop centrifuge, the supernatant discarded and the cell pellets were stored at â80° C. until analyzed for the presence of 1-nonadecene.
Cell pellets were thawed and 1 ml aliquots of acetone (Acros Organics 326570010) containing 100 mg/L butylated hydroxytoluene (Sigma-Aldrich B1378) and 50 mg/L ethyl arachidate (Sigma A9010) were added. The cell pellets were vortexed twice for 15 seconds (total extraction time of 1-2 min). The suspensions were centrifuged for 2 min to pellet debris, and the supernatants analyzed with a gas chromatograph using flame ionization detection (GC/FID) or a mass spectral detection (GC/MS).
An Agilent 7890A GC/5975C EI-MS equipped with a 7683 series autosampler was used to confirm the identification of 1-nonadecene. One ÎźL of each sample was injected into the GC inlet using pulsed splitless injection (pressure: 20 psi, pulse time: 0.3 min, purge time: 0.2 min, purge flow: 15 mL/min) and an inlet temperature of 280° C. The column was a HP-5MS (Agilent, 30 mĂ0.25 mmĂ0.25 Îźm) and the carrier gas was helium at a flow of 1.0 mL/min. The GC oven temperature program was 50° C., hold one minute; 10°/min increase to 280° C.; hold ten minutes. The GC/MS interface was 290° C., and the MS range monitored was 25 to 600 amu. A peak was present in the extract of JCC138 which had the same retention time (17.5 min) and mass spectrum (FIG. 4) as a commercially available standard of 1-nonadecene (Fluka 74320) confirming the production of the 1-alkene by this strain.
An Agilent 7890A GC/FID equipped with a 7683 series autosampler was used to quantify 1-nonadecene. One microliter of each sample was injected into the GC inlet (split 5:1, pressure: 20 psi, pulse time: 0.3 min, purge time: 0.2 min, purge flow: 15 mL/min), which was at a temperature of 280° C. The column was an HP-5MS (Agilent, 30 mĂ0.25 mmĂ0.25 Îźm), and the carrier gas was helium at a flow of 1.0 mL/min. The GC oven temperature program was 50° C., hold one minute; 10°/min increase to 280° C.; hold ten minutes. A calibration curve was constructed using the 1-nonadecene standard (rt 18.8), and the concentrations in the extracts were determined and normalized to the concentration of ethyl arachidate (internal standard).
Deletion of nonA in Synechococcus sp. PCC7002 abolishes production of 1-nonadecene, confirming that the gene is essential for the production of the alkene (FIG. 5). JCC1219 (Ahydrolase) produced approximately 3Ă more 1-nonadecene than JCC138 and JCC1129 strains (FIG. 5; Table 2). This demonstrates that JCC138 can be engineered to overproduce 1-alkenes.
| TABLE 2 |
| The OD730 and % dry cell weights |
| (DCWs) of 1-nonadecene in various cultures |
| Strain | Genotype | OD730 | 1-nonadecene (% DCW*) |
| JCC138 | Wild type | 11.8 | 0.25 |
| JCC1129 | Î ribonuclease | 11.4 | 0.26 |
| JCC1218 | Î nonA | 9.1 | None detected |
| JCC1219 | Î hydrolase | 11.5 | 0.75 |
| *The DCWs were estimated based on the OD measurement using an experimentally determined average of 300 mg Lâ1 OD730â1. |
Three 30-ml cultures of JCC138 was prepared in JB 2.1 at an OD730=0.07 in 125 ml flasks (inocula were from five ml A+ cultures containing 200 mg/L spectinomyin started from colonies incubated for 3 days in a Multitron II Infors shaking photoincubator under continuous light of Ë100 ÎźE mâ2 sâ1 photosynthetically active radiation (PAR) at 37° C. at 150 rpm in 2% CO2-enriched air). The cultures were incubated for three days in the Infors incubators under continuous light of â100 ÎźE mâ2 sâ1 photosynthetically active radiation (PAR) at 37° C. at 150 rpm in 2% CO2-enriched air. All three cultures had an OD730=6.2. 2.8 mg of tridecanoic acid (Fluka 91988) in 75 Îźl of ethanol was added to one flask and 11.2 mg of the fatty acid was added to another flask in the same volume of ethanol. 75 Îźl of ethanol was added to the third flask as a control. The cultures were placed back in the Infors and incubated for a total of 231.8 h. Optical density measurements at 730 nm (OD730) were taken (Table 3), and cell pellet samples were taken for dry cell weight determination and for 1-alkene extraction. The acetone extraction and GC analysis was performed as described in Example 1.
Examination of the GC/FID chromatograms revealed the presence of several new peaks in the tridecanoic acid-fed cultures (FIG. 6). Analysis of the extracts by GC/MS allowed the identification of one of these peaks as 1-octadecene (r.t. 17.8 in FIG. 6). This was done by matching the experimentally determined mass spectrum associated with the peak with mass spectral matches found by searching in a NIST 08 MS database (FIG. 7). Quantification of the 1-octadecene was carried out by estimating a response factor from the experimentally-determined response factor for 1-nonadecene. After identification of 1-octadecene from the cultures incubated with the tridecanoic acid, examination of the JCC138 spectral data revealed that low amounts of 1-octadecene are produced by JCC138. The ratio of 1-octadecene to 1-nonadecene and % DCWs found in the JCC138 cultures are given in Table 3.
| TABLE 3 |
| OD730 and % DCWs of 1-octadecene and 1-nonadecene |
| following tridecanoic acid (FA) feeding |
| % | % | |||
| DCW | DCW | |||
| 1-octa- | 1-nona- | |||
| Culture | OD730 | 1-octadecene:1-nonadecene* | decene | decene |
| JCC138 | 23.6 | â1:140.9 | 0.0018 | 0.27 |
| JCC138 + | 22.3 | 1:7.48 | 0.023 | 0.18 |
| 2.8 mg FA | ||||
| JCC138 + | 20.1 | 1:1.87 | 0.039 | 0.077 |
| 11.2 mg FA | ||||
| *The molar ratio of 1-octadecene to 1-nonadecene is indicated. |
Cloning of nonA (SYNPCC7002_A1173)
A preferred cloning method is to synthesize nonA and/or the A1174 hydrolase based on nucleotide sequences retrieved from BLAST searches, and optionally including changes to the sequence that reflect desired optimization of expression, enzyme structure or enzyme function. Synthesized 1-alkene synthase and/or A1174 hydrolase genes can be acquired from, for example, DNA2.0 (Menlo Park, Calif.). Alternatively, PCR can be used to amplify the genes using, e.g., JCC1138 or a cyanobacteria comprising a homologous gene as a source. Several other strategies may be used for cloning the genes into a suitable host as described in Ausubel, et al., Current Protocols in Molecular Biology (Green Pub. Assoc. and Wiley Intersciences, N.Y. 1993) and Sambrook, et al., Molecular Cloning: A Laboratory Manual (Cold Spring Harbor, N.Y. 2nd ed. 1989).
Plasmid pJB5 was designed as an empty expression vector for recombination into Synechococcus sp. PCC 7002. Two regions of homology, the Upstream Homology Region (UHR) and the Downstream Homology Region (DHR) were designed to flank the construct. These 500 bp regions of homology correspond to positions 3301-3800 and 3801-4300 (Genbank Accession NCâ005025) for the UHR and DHR, respectively. The aadA promoter, gene sequence, and terminator were designed to confer spectinomycin and streptomycin resistance to the integrated construct. For expression, pJB5 was designed with the aph2 kanamycin resistance cassette promoter and ribosome binding site (RBS). Downstream of this promoter and RBS, restriction endonuclease recognition sites are designed and inserted for NdeI and EcoRI, as well as the sites for XhoI, BamHI, SpeI and PacI. Following the EcoRI site, the natural terminator from the pyruvate decarboxylase gene from Zymomonas mobilis (pdc) terminator is included. Convenient XbaI restriction sites flank the UHR and DHR, allowing cleavage of the DNA intended for recombination from the rest of the vector. pJB5 was constructed by DNA2.0 (Menlo Park, Calif.).
Construction of pJB5-NonA Vector
The 1-alkene synthase from JCC138 is cloned into the pJB5 plasmid using standard procedures. Constructs are transformed into high efficiency NEB 5-Îą Fâ˛Iq competent E. coli cells (New England BioLabs, Ipswitch, Mass.). The genes are expressed in E. coli and 1-nonadecene is produced.
Genetically Modified Synechococcus Sp. PCC 7002
The pJB5-NonA construct is cloned into Synechococcus sp. PCC 7002 using the following protocol. Synechococcus 7002 is grown for 48 hours from colonies in an incubated shaker flask at 30° C. at 1% CO2 to an OD730 of 1 in A+ medium described in Frigaard N U et al. (2004) âGene inactivation in the cyanobacterium Synechococcus sp. PCC 7002 and the green sulfur bacterium Chlorobium tepidum using in vitro-made DNA constructs and natural transformationâ Methods Mol Biol 274:325-340. 5004, of culture is added to a test-tube with 30 ÎźL of 1-5 Îźg of DNA prepped from a Qiagen Qiaprep Spin Miniprep Kit (Valencia, Calif.) for each construct. Cells are incubated bubbling in 1% CO2 at approximately 1 bubble every 2 seconds for 4 hours. 2004 of cells are plated on A+ medium plates with 1.5% agarose and grown at 30° C. for two days in low light. 10 Îźg/mL of spectinomycin is underplayed on the plates. Resistant colonies are visible in 7-10 days.
In another embodiment, stronger promoters and/or constitutive and/or inducible promoters are placed in front of nonA and higher production of 1-nonadecene (and/or other 1-alkenes) is observed relative to that in otherwise identical strains lacking the stronger, constitutive and/or inducible promoters. In another embodiment, the copy number of nonA in the cell is increased by at least duplicating the gene in the chromosome, and higher production of 1-nonadecene (and/or other 1-alkenes) is observed relative to that in otherwise identical strains lacking the duplicated gene.
Complete cites to various articles referred to herein are provided below:
All publications, patents and other references mentioned herein are hereby incorporated by reference in their entireties and for all purposes.
| >SYNPCC7002_A1173 1-alkene synthase (PKS) [Synechococcus sp. PCC 7002] |
| SEQ ID NO. 1 |
| ATGGTTGGTCAATTTGCAAATTTCGTCGATCTGCTCCAGTACAGAGCTAAACTTCAGGCGCGGAAAACCG | |
| TGTTTAGTTTTCTGGCTGATGGCGAAGCGGAATCTGCGGCCCTGACCTACGGAGAATTAGACCAAAAAGC | |
| CCAGGCGATCGCCGCTTTTTTGCAAGCTAACCAGGCTCAAGGGCAACGGGCATTATTACTTTATCCACCG | |
| GGTTTAGAGTTTATCGGTGCCTTTTTGGGATGTTTGTATGCTGGTGTTGTTGCGGTGCCAGCTTACCCAC | |
| CACGGCCGAATAAATCCTTTGACCGCCTCCATAGCATTATCCAAGATGCCCAGGCAAAATTTGCCCTCAC | |
| CACAACAGAACTTAAAGATAAAATTGCCGATCGCCTCGAAGCTTTAGAAGGTACGGATTTTCATTGTTTG | |
| GCTACAGATCAAGTTGAATTAATTTCAGGAAAAAATTGGCAAAAACCGAACATTTCCGGCACAGATCTCG | |
| CTTTTTTGCAATACACCAGTGGCTCCACGGGCGATCCTAAAGGAGTGATGGTTTCCCACCACAATTTGAT | |
| CCACAACTCCGGCTTGATTAACCAAGGATTCCAGGATACAGAGGCGAGTATGGGCGTTTCCTGGTTGCCG | |
| CCCTACCATGATATGGGCTTGATCGGTGGGATTTTACAGCCCATCTATGTGGGAGCAACGCAAATTTTAA | |
| TGCCTCCCGTGGCCTTTTTGCAGCGACCTTTTCGGTGGCTAAAGGCGATCAACGATTATCGGGTTTCCAC | |
| CAGCGGTGCGCCGAATTTTGCCTATGATCTCTGTGCCAGCCAAATTACCCCGGAACAAATCAGAGAACTC | |
| GATTTGAGCTGTTGGCGACTGGCTTTTTCCGGGGCCGAACCGATCCGCGCTGTGACCCTCGAAAATTTTG | |
| CGAAAACCTTCGCTACAGCAGGCTTTCAAAAATCAGCATTTTATCCCTGTTATGGTATGGCTGAAACCAC | |
| CCTGATCGTTTCCGGTGGTAATGGTCGTGCCCAGCTTCCCCAGGAAATTATCGTCAGCAAACAGGGCATC | |
| GAAGCAAACCAAGTTCGCCCTGCCCAAGGGACAGAAACAACGGTGACCTTGGTCGGCAGTGGTGAAGTGA | |
| TTGGCGACCAAATTGTCAAAATTGTTGACCCCCAGGCTTTAACAGAATGTACCGTCGGTGAAATTGGCGA | |
| AGTATGGGTTAAGGGCGAAAGTGTTGCCCAGGGCTATTGGCAAAAGCCAGACCTCACCCAGCAACAATTC | |
| CAGGGAAACGTCGGTGCAGAAACGGGCTTTTTACGCACGGGCGATCTGGGTTTTTTGCAAGGTGGCGAAC | |
| TGTATATTACGGGTCGTTTAAAGGATCTCCTGATTATCCGGGGGCGCAACCACTATCCCCAGGACATTGA | |
| ATTAACCGTCGAAGTGGCCCATCCCGCTTTACGACAGGGGGCCGGAGCCGCTGTATCAGTAGACGTTAAC | |
| GGGGAAGAACAGTTAGTCATTGTCCAGGAAGTTGAGCGTAAATATGCCCGCAAATTAAATGTCGCGGCAG | |
| TAGCCCAAGCTATTCGTGGGGCGATCGCCGCCGAACATCAACTGCAACCCCAGGCCATTTGTTTTATTAA | |
| ACCCGGTAGCATTCCCAAAACATCCAGCGGGAAGATTCGTCGCCATGCCTGCAAAGCTGGTTTTCTAGAC | |
| GGAAGCTTGGCTGTGGTTGGGGAGTGGCAACCCAGCCACCAAAAAGAAGGAAAAGGAATTGGGACACAAG | |
| CCGTTACCCCTTCTACGACAACATCAACGAATTTTCCCCTGCCTGACCAGCACCAACAGCAAATTGAAGC | |
| CTGGCTTAAGGATAATATTGCCCATCGCCTCGGCATTACGCCCCAACAATTAGACGAAACGGAACCCTTT | |
| GCAAGTTATGGGCTGGATTCAGTGCAAGCAGTACAGGTCACAGCCGACTTAGAGGATTGGCTAGGTCGAA | |
| AATTAGACCCCACTCTGGCCTACGATTATCCGACCATTCGCACCCTGGCTCAGTTTTTGGTCCAGGGTAA | |
| TCAAGCGCTAGAGAAAATACCACAGGTGCCGAAAATTCAGGGCAAAGAAATTGCCGTGGTGGGTCTCAGT | |
| TGTCGTTTTCCCCAAGCTGACAACCCCGAAGCTTTTTGGGAATTATTACGTAATGGTAAAGATGGAGTTC | |
| GCCCCCTTAAAACTCGCTGGGCCACGGGAGAATGGGGTGGTTTTTTAGAAGATATTGACCAGTTTGAGCC | |
| GCAATTTTTTGGCATTTCCCCCCGGGAAGCGGAACAAATGGATCCCCAGCAACGCTTACTGTTAGAAGTA | |
| ACCTGGGAAGCCTTGGAACGGGCAAATATTCCGGCAGAAAGTTTACGCCATTCCCAAACGGGGGTTTTTG | |
| TCGGCATTAGTAATAGTGATTATGCCCAGTTGCAGGTGCGGGAAAACAATCCGATCAATCCCTACATGGG | |
| GACGGGCAACGCCCACAGTATTGCTGCGAATCGTCTGTCTTATTTCCTCGATCTCCGGGGCGTTTCTCTG | |
| AGCATCGATACGGCCTGTTCCTCTTCTCTGGTGGCGGTACATCTGGCCTGTCAAAGTTTAATCAACGGCG | |
| AATCGGAGTTGGCGATCGCCGCCGGGGTGAATTTGATTTTGACCCCCGATGTGACCCAGACTTTTACCCA | |
| GGCGGGCATGATGAGTAAGACGGGCCGTTGCCAGACCTTTGATGCCGAGGCTGATGGCTATGTGCGGGGC | |
| GAAGGTTGTGGGGTCGTTCTCCTCAAACCCCTGGCCCAGGCAGAACGGGACGGGGATAATATTCTCGCGG | |
| TGATCCACGGTTCGGCGGTGAATCAAGATGGACGCAGTAACGGTTTGACGGCTCCCAACGGGCGATCGCA | |
| ACAGGCCGTTATTCGCCAAGCCCTGGCCCAAGCCGGCATTACCGCCGCCGATTTAGCTTACCTAGAGGCC | |
| CACGGCACCGGCACGCCCCTGGGTGATCCCATTGAAATTAATTCCCTGAAGGCGGTTTTACAAACGGCGC | |
| AGCGGGAACAGCCCTGTGTGGTGGGTTCTGTGAAAACAAACATTGGTCACCTCGAGGCAGCGGCGGGCAT | |
| CGCGGGCTTAATCAAGGTGATTTTGTCCCTAGAGCATGGAATGATTCCCCAACATTTGCATTTTAAGCAG | |
| CTCAATCCCCGCATTGATCTAGACGGTTTAGTGACCATTGCGAGCAAAGATCAGCCTTGGTCAGGCGGGT | |
| CACAAAAACGGTTTGCTGGGGTAAGTTCCTTTGGGTTTGGTGGCACCAATGCCCACGTGATTGTCGGGGA | |
| CTATGCTCAACAAAAATCTCCCCTTGCTCCTCCGGCTACCCAAGACCGCCCTTGGCATTTGCTGACCCTT | |
| TCTGCTAAAAATGCCCAGGCCTTAAATGCCCTGCAAAAAAGCTATGGAGACTATCTGGCCCAACATCCCA | |
| GCGTTGACCCACGCGATCTCTGTTTGTCTGCCAATACCGGGCGATCGCCCCTCAAAGAACGTCGTTTTTT | |
| TGTCTTTAAACAAGTCGCCGATTTACAACAAACTCTCAATCAAGATTTTCTGGCCCAACCACGCCTCAGT | |
| TCCCCCGCAAAAATTGCCTTTTTGTTTACGGGGCAAGGTTCCCAATACTACGGCATGGGGCAACAACTGT | |
| ACCAAACCAGCCCAGTATTTCGGCAAGTGCTGGATGAGTGCGATCGCCTCTGGCAGACCTATTCCCCCGA | |
| AGCCCCTGCCCTCACCGACCTGCTGTACGGTAACCATAACCCTGACCTCGTCCACGAAACTGTCTATACC | |
| CAGCCCCTCCTCTTTGCTGTTGAATATGCGATCGCCCAACTATGGTTAAGCTGGGGCGTGACGCCAGACT | |
| TTTGCATGGGCCATAGCGTCGGCGAATATGTCGCGGCTTGTCTGGCGGGGGTATTTTCCCTGGCAGACGG | |
| CATGAAATTAATTACGGCCCGGGGCAAACTGATGCACGCCCTACCCAGCAATGGCAGTATGGCGGCGGTC | |
| TTTGCCGATAAAACGGTCATCAAACCCTACCTATCGGAGCATTTGACCGTCGGAGCCGAAAACGGTTCCC | |
| ATTTGGTGCTATCAGGAAAGACCCCCTGCCTCGAAGCCAGTATTCACAAACTCCAAAGCCAAGGGATCAA | |
| AACCAAACCCCTCAAGGTTTCCCATGCTTTCCACTCCCCTTTGATGGCTCCCATGCTGGCAGAGTTTCGG | |
| GAAATTGCTGAACAAATTACTTTCCACCCGCCGCGTATCCCGCTCATTTCCAATGTCACGGGCGGCCAGA | |
| TTGAAGCGGAAATTGCCCAGGCCGACTATTGGGTTAAGCACGTTTCGCAACCCGTCAAATTTGTCCAGAG | |
| CATCCAAACCCTGGCCCAAGCGGGTGTCAATGTTTATCTCGAAATCGGCGTAAAACCAGTGCTCCTGAGT | |
| ATGGGACGCCATTGCTTAGCTGAACAAGAAGCGGTTTGGTTGCCCAGTTTACGTCCCCATAGTGAGCCTT | |
| GGCCGGAAATTTTGACCAGTCTCGGCAAACTGTATGAGCAAGGGCTAAACATTGACTGGCAGACCGTGGA | |
| AGCTGGCGATCGCCGCCGGAAACTGATTCTGCCCACCTATCCCTTCCAACGGCAACGATATTGGTTTAAT | |
| CAAGGCTCTTGGCAAACTGTTGAGACCGAATCTGTGAACCCAGGCCCTGACGATCTCAATGATTGGTTGT | |
| ATCAGGTGGCGTGGACGCCCCTGGACACTTTGCCCCCGGCCCCTGAACCGTCGGCTAAGCTGTGGTTAAT | |
| CTTGGGCGATCGCCATGATCACCAGCCCATTGAAGCCCAATTTAAAAACGCCCAGCGGGTGTATCTCGGC | |
| CAAAGCAATCATTTTCCGACGAATGCCCCCTGGGAAGTATCTGCCGATGCGTTGGATAATTTATTTACTC | |
| ACGTCGGCTCCCAAAATTTAGCAGGCATCCTTTACCTGTGTCCCCCAGGGGAAGACCCAGAAGACCTAGA | |
| TGAAATTCAAAAGCAAACCAGTGGCTTCGCCCTCCAACTGATCCAAACCCTGTATCAACAAAAGATCGCG | |
| GTTCCCTGCTGGTTTGTGACCCACCAGAGCCAACGGGTGCTTGAAACCGATGCTGTCACCGGATTTGCCC | |
| AAGGGGGATTATGGGGACTCGCCCAGGCGATCGCCCTCGAACATCCAGAGTTGTGGGGGGGAATTATTGA | |
| TGTCGATGACAGCCTGCCAAATTTTGCCCAGATTTGCCAACAAAGACAGGTGCAGCAGTTGGCCGTGCGG | |
| CACCAAAAACTCTACGGGGCACAGCTCAAAAAGCAACCGTCACTGCCCCAGAAAAATCTCCAGATTCAAC | |
| CCCAACAGACCTATCTAGTGACAGGGGGACTGGGGGCCATTGGCCGTAAAATTGCCCAATGGCTAGCCGC | |
| AGCAGGAGCAGAAAAAGTAATTCTCGTCAGCCGGCGCGCTCCGGCAGCGGATCAGCAGACGTTACCGACC | |
| AATGCGGTGGTTTATCCTTGCGATTTAGCCGACGCAGCCCAGGTGGCAAAGCTGTTTCAAACCTATCCCC | |
| ACATCAAAGGAATTTTCCATGCGGCGGGTACCTTAGCTGATGGTTTGCTGCAACAACAAACTTGGCAAAA | |
| GTTCCAGACCGTCGCCGCCGCCAAAATGAAAGGGACATGGCATCTGCACCGCCATAGTCAAAAGCTCGAT | |
| CTGGATTTTTTTGTGTTGTTTTCCTCTGTGGCAGGGGTGCTCGGTTCACCGGGACAGGGGAATTATGCCG | |
| CCGCAAACCGGGGCATGGCGGCGATCGCCCAATATCGACAAGCCCAAGGTTTACCCGCCCTGGCGATCCA | |
| TTGGGGGCCTTGGGCCGAAGGGGGAATGGCCAACTCCCTCAGCAACCAAAATTTAGCGTGGCTGCCGCCC | |
| CCCCAGGGACTAACAATCCTCGAAAAAGTCTTGGGCGCCCAGGGGGAAATGGGGGTCTTTAAACCGGACT | |
| GGCAAAACCTGGCCAAACAGTTCCCCGAATTTGCCAAAACCCATTACTTTGCAGCCGTTATTCCCTCTGC | |
| TGAGGCTGTGCCCCCAACGGCTTCAATTTTTGACAAATTAATCAACCTAGAAGCTTCTCAGCGGGCTGAC | |
| TATCTACTGGATTATCTGCGGCGGTCTGTGGCGCAAATCCTCAAGTTAGAAATTGAGCAAATTCAAAGCC | |
| ACGATAGCCTGTTGGATCTGGGCATGGATTCGTTGATGATCATGGAGGCGATCGCCAGCCTCAAGCAGGA | |
| TTTACAACTGATGTTGTACCCCAGGGAAATCTACGAACGGCCCAGACTTGATGTGTTGACGGCCTATCTA | |
| GCGGCGGAATTCACCAAGGCCCATGATTCTGAAGCAGCAACGGCGGCAGCAGCGATTCCCTCCCAAAGCC | |
| TTTCGGTCAAAACAAAAAAACAGTGGCAAAAACCTGACCACAAAAACCCGAATCCCATTGCCTTTATCCT | |
| CTCTAGCCCCCGGTCGGGTTCGACGTTGCTGCGGGTGATGTTAGCCGGACATCCGGGGTTATATTCGCCG | |
| CCAGAGCTGCATTTGCTCCCCTTTGAGACTATGGGCGATCGCCACCAGGAATTGGGTCTATCCCACCTCG | |
| GCGAAGGGTTACAACGGGCCTTAATGGATCTAGAAAACCTCACCCCAGAGGCAAGCCAGGCGAAGGTCAA | |
| CCAATGGGTCAAAGCGAATACACCCATTGCAGACATCTATGCCTATCTCCAACGGCAGGCGGAACAACGT | |
| TTACTCATCGACAAATCTCCCAGCTACGGCAGCGATCGCCATATTCTAGACCACAGCGAAATCCTCTTTG | |
| ACCAGGCCAAATATATCCATCTGGTACGCCATCCCTACGCGGTGATTGAATCCTTTACCCGACTGCGGAT | |
| GGATAAACTGCTGGGGGCCGAGCAGCAGAACCCCTACGCCCTCGCGGAGTCCATTTGGCGCACCAGCAAC | |
| CGCAATATTTTAGACCTGGGTCGCACGGTTGGTGCGGATCGATATCTCCAGGTGATTTACGAAGATCTCG | |
| TCCGTGACCCCCGCAAAGTTTTGACAAATATTTGTGATTTCCTGGGGGTGGACTTTGACGAAGCGCTCCT | |
| CAATCCCTACAGCGGCGATCGCCTTACCGATGGCCTCCACCAACAGTCCATGGGCGTCGGGGATCCCAAT | |
| TTCCTCCAGCACAAAACCATTGATCCGGCCCTCGCCGACAAATGGCGCTCAATTACCCTGCCCGCTGCTC | |
| TCCAGCTGGATACGATCCAGTTGGCCGAAACGTTTGCTTACGATCTCCCCCAGGAACCCCAGCTAACACC | |
| CCAGACCCAATCCTTGCCCTCGATGGTGGAGCGGTTCGTGACAGTGCGCGGTTTAGAAACCTGTCTCTGT | |
| GAGTGGGGCGATCGCCACCAACCATTGGTGCTACTTCTCCACGGCATCCTCGAACAGGGGGCCTCCTGGC | |
| AACTCATCGCGCCCCAGTTGGCGGCCCAGGGCTATTGGGTTGTGGCCCCAGACCTGCGTGGTCACGGCAA | |
| ATCCGCCCATGCCCAGTCCTACAGCATGCTTGATTTTTTGGCTGACGTAGATGCCCTTGCCAAACAATTA | |
| GGCGATCGCCCCTTTACCTTGGTGGGCCACTCCATGGGTTCCATCATCGGTGCCATGTATGCAGGAATTC | |
| GCCAAACCCAGGTAGAAAAGTTGATCCTCGTTGAAACCATTGTCCCCAACGACATCGACGACGCTGAAAC | |
| CGGTAATCACCTGACGACCCATCTCGATTACCTCGCCGCGCCCCCCCAACACCCGATCTTCCCCAGCCTA | |
| GAAGTGGCCGCCCGTCGCCTCCGCCAAGCCACGCCCCAACTACCCAAAGACCTCTCGGCGTTCCTCACCC | |
| AGCGCAGCACCAAATCCGTCGAAAAAGGGGTGCAGTGGCGTTGGGATGCTTTCCTCCGTACCCGGGCGGG | |
| CATTGAATTCAATGGCATTAGCAGACGACGTTACCTGGCCCTGCTCAAAGATATCCAAGCGCCGATCACC | |
| CTCATCTATGGCGATCAGAGTGAATTTAACCGCCCTGCTGATCTCCAGGCGATCCAAGCGGCTCTCCCCC | |
| AGGCCCAACGTTTAACGGTTGCTGGCGGCCATAACCTCCATTTTGAGAATCCCCAGGCGATCGCCCAAAT | |
| TGTTTATCAACAACTCCAGACCCCTGTACCCAAAACACAATAA | |
| >gi|170077790|ref|YP_001734428.1|1-alkene synthase [Synechococcus sp. | |
| PCC 7002] |
| SEQ ID NO. 2 |
| MVGQFANFVDLLQYRAKLQARKTVFSFLADGEAESAALTYGELDQKAQAIAAFLQANQAQGQRALLLYPP | |
| GLEFIGAFLGCLYAGVVAVPAYPPRPNKSFDRLHSIIQDAQAKFALTTTELKDKIADRLEALEGTDFHCL | |
| ATDQVELISGKNWQKPNISGTDLAFLQYTSGSTGDPKGVMVSHHNLIHNSGLINQGFQDTEASMGVSWLP | |
| PYHDMGLIGGILQPIYVGATQILMPPVAFLQRPFRWLKAINDYRVSTSGAPNFAYDLCASQITPEQIREL | |
| DLSCWRLAFSGAEPIRAVTLENFAKTFATAGFQKSAFYPCYGMAETTLIVSGGNGRAQLPQEIIVSKQGI | |
| EANQVRPAQGTETTVTLVGSGEVIGDQIVKIVDPQALTECTVGEIGEVWVKGESVAQGYWQKPDLTQQQF | |
| QGNVGAETGFLRTGDLGFLQGGELYITGRLKDLLIIRGRNHYPQDIELTVEVAHPALRQGAGAAVSVDVN | |
| GEEQLVIVQEVERKYARKLNVAAVAQAIRGAIAAEHQLQPQAICFIKPGSIPKTSSGKIRRHACKAGFLD | |
| GSLAVVGEWQPSHQKEGKGIGTQAVTPSTTTSTNFPLPDQHQQQIEAWLKDNIAHRLGITPQQLDETEPF | |
| ASYGLDSVQAVQVTADLEDWLGRKLDPTLAYDYPTIRTLAQFLVQGNQALEKIPQVPKIQGKEIAVVGLS | |
| CRFPQADNPEAFWELLRNGKDGVRPLKTRWATGEWGGFLEDIDQFEPQFFGISPREAEQMDPQQRLLLEV | |
| TWEALERANIPAESLRHSQTGVFVGISNSDYAQLQVRENNPINPYMGTGNAHSIAANRLSYFLDLRGVSL | |
| SIDTACSSSLVAVHLACQSLINGESELAIAAGVNLILTPDVTQTFTQAGMMSKTGRCQTFDAEADGYVRG | |
| EGCGVVLLKPLAQAERDGDNILAVIHGSAVNQDGRSNGLTAPNGRSQQAVIRQALAQAGITAADLAYLEA | |
| HGTGTPLGDPIEINSLKAVLQTAQREQPCVVGSVKTNIGHLEAAAGIAGLIKVILSLEHGMIPQHLHFKQ | |
| LNPRIDLDGLVTIASKDQPWSGGSQKRFAGVSSFGFGGTNAHVIVGDYAQQKSPLAPPATQDRPWHLLTL | |
| SAKNAQALNALQKSYGDYLAQHPSVDPRDLCLSANTGRSPLKERRFFVFKQVADLQQTLNQDFLAQPRLS | |
| SPAKIAFLFTGQGSQYYGMGQQLYQTSPVFRQVLDECDRLWQTYSPEAPALTDLLYGNHNPDLVHETVYT | |
| QPLLFAVEYAIAQLWLSWGVTPDFCMGHSVGEYVAACLAGVFSLADGMKLITARGKLMHALPSNGSMAAV | |
| FADKTVIKPYLSEHLTVGAENGSHLVLSGKTPCLEASIHKLQSQGIKTKPLKVSHAFHSPLMAPMLAEFR | |
| EIAEQITFHPPRIPLISNVTGGQIEAEIAQADYWVKHVSQPVKFVQSIQTLAQAGVNVYLEIGVKPVLLS | |
| MGRHCLAEQEAVWLPSLRPHSEPWPEILTSLGKLYEQGLNIDWQTVEAGDRRRKLILPTYPFQRQRYWFN | |
| QGSWQTVETESVNPGPDDLNDWLYQVAWTPLDTLPPAPEPSAKLWLILGDRHDHQPIEAQFKNAQRVYLG | |
| QSNHFPTNAPWEVSADALDNLFTHVGSQNLAGILYLCPPGEDPEDLDEIQKQTSGFALQLIQTLYQQKIA | |
| VPCWFVTHQSQRVLETDAVTGFAQGGLWGLAQAIALEHPELWGGIIDVDDSLPNFAQICQQRQVQQLAVR | |
| HQKLYGAQLKKQPSLPQKNLQIQPQQTYLVTGGLGAIGRKIAQWLAAAGAEKVILVSRRAPAADQQTLPT | |
| NAVVYPCDLADAAQVAKLFQTYPHIKGIFHAAGTLADGLLQQQTWQKFQTVAAAKMKGTWHLHRHSQKLD | |
| LDFFVLFSSVAGVLGSPGQGNYAAANRGMAAIAQYRQAQGLPALAIHWGPWAEGGMANSLSNQNLAWLPP | |
| PQGLTILEKVLGAQGEMGVFKPDWQNLAKQFPEFAKTHYFAAVIPSAEAVPPTASIFDKLINLEASQRAD | |
| YLLDYLRRSVAQILKLEIEQIQSHDSLLDLGMDSLMIMEAIASLKQDLQLMLYPREIYERPRLDVLTAYL | |
| AAEFTKAHDSEAATAAAAIPSQSLSVKTKKQWQKPDHKNPNPIAFILSSPRSGSTLLRVMLAGHPGLYSP | |
| PELHLLPFETMGDRHQELGLSHLGEGLQRALMDLENLTPEASQAKVNQWVKANTPIADIYAYLQRQAEQR | |
| LLIDKSPSYGSDRHILDHSEILFDQAKYIHLVRHPYAVIESFTRLRMDKLLGAEQQNPYALAESIWRTSN | |
| RNILDLGRTVGADRYLQVIYEDLVRDPRKVLTNICDFLGVDFDEALLNPYSGDRLTDGLHQQSMGVGDPN | |
| FLQHKTIDPALADKWRSITLPAALQLDTIQLAETFAYDLPQEPQLTPQTQSLPSMVERFVTVRGLETCLC | |
| EWGDRHQPLVLLLHGILEQGASWQLIAPQLAAQGYWVVAPDLRGHGKSAHAQSYSMLDFLADVDALAKQL | |
| GDRPFTLVGHSMGSIIGAMYAGIRQTQVEKLILVETIVPNDIDDAETGNHLTTHLDYLAAPPQHPIFPSL | |
| EVAARRLRQATPQLPKDLSAFLTQRSTKSVEKGVQWRWDAFLRTRAGIEFNGISRRRYLALLKDIQAPIT | |
| LIYGDQSEFNRPADLQAIQAALPQAQRLTVAGGHNLHFENPQAIAQIVYQQLQTPVPKTQ | |
| SYNPCC7002_A1174 | |
| hydrolase alpha/beta fold domain-containing protein | |
| >gi|170076636: c1215155-1214256 Synechococcus sp. PCC 7002 |
| SEQ ID NO. 3 |
| ATGACCATTACTTCCCCCGCTCATCCCCATACCGATTACAGCTGGCAATGGCACGGCTTCAATATTAACT | |
| ATCGTCAGTGGGGCACCCAGGGGCTGCCCGTTCTTTTCGTCCATGGCTTTGGGGCCTCGGCCGGTCATTG | |
| GCGCAAAAATCTTCCGGTTTTAGGGGAACATTACCGCTGCTATGCCATCGACTTACTGGGCTTTGGGAAA | |
| TCGGCAAAACCCCAACCGGAGGTTGAAGCGGACTACACTTTTGAAACTTGGGCCACCCAGATTAAGGCGT | |
| TCTGTGCTGAAATCATTGGTGAACCGGCTTTTCTAGTTGGTAATTCCATTGGTTGTGTCGTTGTCATGCA | |
| GGCGGCTGTGTCCTATCCCCACTGGGTGCGGGGGGTTGTGGCACTCAATTTTTCCCTGCGGCTGTTCCAT | |
| GAGCGCAATCTTTTAAAAGCACCTTTTTATCAACGCTGGGGCGTTCCCCTCTTCCAAAAACTCTTGACCC | |
| AAACCCCCCTCGGTTCCTTGTTCTTTAAGCAATTGGCCCAGCCGAAAACAATCCGCAAAATTTTAGCCCA | |
| GGCCTACCGAGACAAAACAGCGATTACCGATGAGTTGGTGGAGCTGATCCTGACCCCCGCCCAGGACCCA | |
| GGGGCGGCAGCGGTTTTCCTGGCCTTTACGAGTTATTCCCAGGGGCCACTCCCGGACGACCTGCTGCCCC | |
| AGTTGCATTGCCCCACGGCAGTTTTGTGGGGAACAGCGGATCCGTGGGAACCAGTTGATCTGGGCCGTGC | |
| CCTTGTCGCCCAATATCCTCAGATTGAGTTTATTCCCCTCGATAATGTCGGCCATTGTCCCCAGGATGAA | |
| GCTCCGGCATTAGTCAACGGCTATTTACTCGATTGGTTAGGGCGACAACAGTCAGCGTAG | |
| >gi|170077791|ref|YP_001734429.1|hydrolase alpha/beta fold domain- | |
| containing protein [Synechococcus sp. PCC 7002] |
| SEQ ID NO. 4 |
| MTITSPAHPHTDYSWQWHGFNINYRQWGTQGLPVLFVHGFGASAGHWRKNLPVLGEHYRCYAIDLLGFGK | |
| SAKPQPEVEADYTFETWATQIKAFCAEIIGEPAFLVGNSIGCVVVMQAAVSYPHWVRGVVALNFSLRLFH | |
| ERNLLKAPFYQRWGVPLFQKLLTQTPLGSLFFKQLAQPKTIRKILAQAYRDKTAITDELVELILTPAQDP | |
| GAAAVFLAFTSYSQGPLPDDLLPQLHCPTAVLWGTADPWEPVDLGRALVAQYPQIEFIPLDNVGHCPQDE | |
| APALVNGYLLDWLGRQQSA | |
| The sequence of pJB844, a knockout vector for SYNPCC7002_A1173 (UHR | |
| and DHR in italics; aacC1 gentamycin marker is underlined) |
| SEQ ID NO 5 |
| TTAGAAAAACTCATCGAGCATCAAATGAAACTGCAATTTATTCATATCAGGATTATCAATACCA | |
| TATTTTTGAAAAAGCCGTTTCTGTAATGAAGGAGAAAACTCACCGAGGCAGTTCCATAGGATGG | |
| CAAGATCCTGGTATCGGTCTGCGATTCCGACTCGTCCAACATCAATACAACCTATTAATTTCCC | |
| CTCGTCAAAAATAAGGTTATCAAGTGAGAAATCACCATGAGTGACGACTGAATCCGGTGAGAAT | |
| GGCAAAAGTTTATGCATTTCTTTCCAGACTTGTTCAACAGGCCAGCCATTACGCTCGTCATCAA | |
| AATCACTCGCATCAACCAAACCGTTATTCATTCGTGATTGCGCCTGAGCGAGGCGAAATACGCG | |
| ATCGCTGTTAAAAGGACAATTACAAACAGGAATCGAGTGCAACCGGCGCAGGAACACTGCCAGC | |
| GCATCAACAATATTTTCACCTGAATCAGGATATTCTTCTAATACCTGGAACGCTGTTTTTCCGG | |
| GGATCGCAGTGGTGAGTAACCATGCATCATCAGGAGTACGGATAAAATGCTTGATGGTCGGAAG | |
| TGGCATAAATTCCGTCAGCCAGTTTAGTCTGACCATCTCATCTGTAACATCATTGGCAACGCTA | |
| CCTTTGCCATGTTTCAGAAACAACTCTGGCGCATCGGGCTTCCCATACAAGCGATAGATTGTCG | |
| CACCTGATTGCCCGACATTATCGCGAGCCCATTTATACCCATATAAATCAGCATCCATGTTGGA | |
| ATTTAATCGCGGCCTCGACGTTTCCCGTTGAATATGGCTCATATTCTTCCTTTTTCAATATTAT | |
| TGAAGCATTTATCAGGGTTATTGTCTCATGAGCGGATACATATTTGAATGTATTTAGAAAAATA | |
| AACAAATAGGGGTCAGTGTTACAACCAATTAACCAATTCTGAACATTATCGCGAGCCCATTTAT | |
| ACCTGAATATGGCTCATAACACCCCTTGTTTGCCTGGCGGCAGTAGCGCGGTGGTCCCACCTGA | |
| CCCCATGCCGAACTCAGAAGTGAAACGCCGTAGCGCCGATGGTAGTGTGGGGACTCCCCATGCG | |
| AGAGTAGGGAACTGCCAGGCATCAAATAAAACGAAAGGCTCAGTCGAAAGACTGGGCCTTTCGC | |
| CCGGGCTAATTAGGGGGTGTCGCCCTTCTGAAGTGGGGCCTGCAGG | |
| GCGGCCGCTCATATGTAACAGGAATTC | |
| GGTTACTAGTTTTTAATTAAcgaatccatgtgggagtttattcttgacacagatatttatgata | |
| taataactgagtaagcttaacataaggaggaaaaactaatgttacgcagcagcaacgatgttac | |
| gcagcagggcagtcgccctaaaacaaagttaggtggctcaagtatgggcatcattcgcacatgt | |
| aggctcggccctgaccaagtcaaatccatgcgggctgctcttgatcttttcggtcgtgagttcg | |
| gagacgtagccacctactcccaacatcagccggactccgattacctcgggaacttgctccgtag | |
| taagacattcatcgcgcttgctgccttcgaccaagaagcggttgttggcgctctcgcggcttac | |
| gttctgcccaagtttgagcagccgcgtagtgagatctatatctatgatctcgcagtctccggcg | |
| agcaccggaggcagggcattgccaccgcgctcatcaatctcctcaagcatgaggccaacgcgct | |
| tggtgcttatgtgatctacgtgcaagcagattacggtgacgatcccgcagtggctctctataca | |
| aagttgggcatacgggaagaagtgatgcactttgatatcgacccaagtaccgccacctaGGcgc | |
| gcc | |
| ggccggCCAACGTCAAAAGGGCGACACAAAATT | |
| TATTCTAAATGCATAATAAATACTGATAACATCTTATAGTTTGTATTATATTTTGTATTATCGT | |
| TGACATGTATAATTTTGATATCAAAAACTGATTTTCCCTTTATTATTTTCGAGATTTATTTTCT | |
| TAATTCTCTTTAACAAACTAGAAATATTGTATATACAAAAAATCATAAATAATAGATGAATAGT | |
| TTAATTATAGGTGTTCATCAATCGAAAAAGCAACGTATCTTATTTAAAGTGCGTTGCTTTTTTC | |
| TCATTTATAAGGTTAAATAATTCTCATATATCAAGCAAAGTGACAGGCGCCCTTAAATATTCTG | |
| ACAAATGCTCTTTCCCTAAACTCCCCCCATAAAAAAACCCGCCGAAGCGGGTTTTTACGTTATT | |
| TGCGGATTAACGATTACTCGTTATCAGAACCGCCCAGGGGGCCCGAGCTTAAGACTGGCCGTCG | |
| TTTTACAACACAGAAAGAGTTTGTAGAAACGCAAAAAGGCCATCCGTCAGGGGCCTTCTGCTTA | |
| GTTTGATGCCTGGCAGTTCCCTACTCTCGCCTTCCGCTTCCTCGCTCACTGACTCGCTGCGCTC | |
| GGTCGTTCGGCTGCGGCGAGCGGTATCAGCTCACTCAAAGGCGGTAATACGGTTATCCACAGAA | |
| TCAGGGGATAACGCAGGAAAGAACATGTGAGCAAAAGGCCAGCAAAAGGCCAGGAACCGTAAAA | |
| AGGCCGCGTTGCTGGCGTTTTTCCATAGGCTCCGCCCCCCTGACGAGCATCACAAAAATCGACG | |
| CTCAAGTCAGAGGTGGCGAAACCCGACAGGACTATAAAGATACCAGGCGTTTCCCCCTGGAAGC | |
| TCCCTCGTGCGCTCTCCTGTTCCGACCCTGCCGCTTACCGGATACCTGTCCGCCTTTCTCCCTT | |
| CGGGAAGCGTGGCGCTTTCTCATAGCTCACGCTGTAGGTATCTCAGTTCGGTGTAGGTCGTTCG | |
| CTCCAAGCTGGGCTGTGTGCACGAACCCCCCGTTCAGCCCGACCGCTGCGCCTTATCCGGTAAC | |
| TATCGTCTTGAGTCCAACCCGGTAAGACACGACTTATCGCCACTGGCAGCAGCCACTGGTAACA | |
| GGATTAGCAGAGCGAGGTATGTAGGCGGTGCTACAGAGTTCTTGAAGTGGTGGGCTAACTACGG | |
| CTACACTAGAAGAACAGTATTTGGTATCTGCGCTCTGCTGAAGCCAGTTACCTTCGGAAAAAGA | |
| GTTGGTAGCTCTTGATCCGGCAAACAAACCACCGCTGGTAGCGGTGGTTTTTTTGTTTGCAAGC | |
| AGCAGATTACGCGCAGAAAAAAAGGATCTCAAGAAGATCCTTTGATCTTTTCTACGGGGTCTGA | |
| CGCTCAGTGGAACGACGCGCGCGTAACTCACGTTAAGGGATTTTGGTCATGAGCTTGCGCCGTC | |
| CCGTCAAGTCAGCGTAATGCTCTGCTT | |
| The sequence of pJB845, a knockout vector for SYNPCC7002_A1174 (UHR | |
| and DHR in italics; aacC1 gentamycin marker is underlined) |
| SEQ ID NO 6 |
| TTAGAAAAACTCATCGAGCATCAAATGAAACTGCAATTTATTCATATCAGGATTATCAATACCA | |
| TATTTTTGAAAAAGCCGTTTCTGTAATGAAGGAGAAAACTCACCGAGGCAGTTCCATAGGATGG | |
| CAAGATCCTGGTATCGGTCTGCGATTCCGACTCGTCCAACATCAATACAACCTATTAATTTCCC | |
| CTCGTCAAAAATAAGGTTATCAAGTGAGAAATCACCATGAGTGACGACTGAATCCGGTGAGAAT | |
| GGCAAAAGTTTATGCATTTCTTTCCAGACTTGTTCAACAGGCCAGCCATTACGCTCGTCATCAA | |
| AATCACTCGCATCAACCAAACCGTTATTCATTCGTGATTGCGCCTGAGCGAGGCGAAATACGCG | |
| ATCGCTGTTAAAAGGACAATTACAAACAGGAATCGAGTGCAACCGGCGCAGGAACACTGCCAGC | |
| GCATCAACAATATTTTCACCTGAATCAGGATATTCTTCTAATACCTGGAACGCTGTTTTTCCGG | |
| GGATCGCAGTGGTGAGTAACCATGCATCATCAGGAGTACGGATAAAATGCTTGATGGTCGGAAG | |
| TGGCATAAATTCCGTCAGCCAGTTTAGTCTGACCATCTCATCTGTAACATCATTGGCAACGCTA | |
| CCTTTGCCATGTTTCAGAAACAACTCTGGCGCATCGGGCTTCCCATACAAGCGATAGATTGTCG | |
| CACCTGATTGCCCGACATTATCGCGAGCCCATTTATACCCATATAAATCAGCATCCATGTTGGA | |
| ATTTAATCGCGGCCTCGACGTTTCCCGTTGAATATGGCTCATATTCTTCCTTTTTCAATATTAT | |
| TGAAGCATTTATCAGGGTTATTGTCTCATGAGCGGATACATATTTGAATGTATTTAGAAAAATA | |
| AACAAATAGGGGTCAGTGTTACAACCAATTAACCAATTCTGAACATTATCGCGAGCCCATTTAT | |
| ACCTGAATATGGCTCATAACACCCCTTGTTTGCCTGGCGGCAGTAGCGCGGTGGTCCCACCTGA | |
| CCCCATGCCGAACTCAGAAGTGAAACGCCGTAGCGCCGATGGTAGTGTGGGGACTCCCCATGCG | |
| AGAGTAGGGAACTGCCAGGCATCAAATAAAACGAAAGGCTCAGTCGAAAGACTGGGCCTTTCGC | |
| CCGGGCTAATTAGGGGGTGTCGCCCTTCTGAAGTGGGGCCTGCA | |
| GCGGCCGCTCATATGTAACAGGAATTCGGTTACTA | |
| GTTTTTAATTAAcgaatccatgtgggagtttattcttgacacagatatttatgatataataact | |
| gagtaagcttaacataaggaggaaaaactaatgttacgcagcagcaacgatgttacgcagcagg | |
| gcagtcgccctaaaacaaagttaggtggctcaagtatgggcatcattcgcacatgtaggctcgg | |
| ccctgaccaagtcaaatccatgcgggctgctcttgatcttttcggtcgtgagttcggagacgta | |
| gccacctactcccaacatcagccggactccgattacctcgggaacttgctccgtagtaagacat | |
| tcatcgcgcttgctgccttcgaccaagaagcggttgttggcgctctcgcggcttacgttctgcc | |
| caagtttgagcagccgcgtagtgagatctatatctatgatctcgcagtctccggcgagcaccgg | |
| aggcagggcattgccaccgcgctcatcaatctcctcaagcatgaggccaacgcgcttggtgctt | |
| atgtgatctacgtgcaagcagattacggtgacgatcccgcagtggctctctatacaaagttggg | |
| catacgggaagaagtgatgcactttgatatcgacccaagtaccgccacctaGGcgcgcc | |
| ggccggCCAACGTCAAAAGGGCGA | |
| CACAAAATTTATTCTAAATGCATAATAAATACTGATAACATCTTATAGTTTGTATTATATTTTG | |
| TATTATCGTTGACATGTATAATTTTGATATCAAAAACTGATTTTCCCTTTATTATTTTCGAGAT | |
| TTATTTTCTTAATTCTCTTTAACAAACTAGAAATATTGTATATACAAAAAATCATAAATAATAG | |
| ATGAATAGTTTAATTATAGGTGTTCATCAATCGAAAAAGCAACGTATCTTATTTAAAGTGCGTT | |
| GCTTTTTTCTCATTTATAAGGTTAAATAATTCTCATATATCAAGCAAAGTGACAGGCGCCCTTA | |
| AATATTCTGACAAATGCTCTTTCCCTAAACTCCCCCCATAAAAAAACCCGCCGAAGCGGGTTTT | |
| TACGTTATTTGCGGATTAACGATTACTCGTTATCAGAACCGCCCAGGGGGCCCGAGCTTAAGAC | |
| TGGCCGTCGTTTTACAACACAGAAAGAGTTTGTAGAAACGCAAAAAGGCCATCCGTCAGGGGCC | |
| TTCTGCTTAGTTTGATGCCTGGCAGTTCCCTACTCTCGCCTTCCGCTTCCTCGCTCACTGACTC | |
| GCTGCGCTCGGTCGTTCGGCTGCGGCGAGCGGTATCAGCTCACTCAAAGGCGGTAATACGGTTA | |
| TCCACAGAATCAGGGGATAACGCAGGAAAGAACATGTGAGCAAAAGGCCAGCAAAAGGCCAGGA | |
| ACCGTAAAAAGGCCGCGTTGCTGGCGTTTTTCCATAGGCTCCGCCCCCCTGACGAGCATCACAA | |
| AAATCGACGCTCAAGTCAGAGGTGGCGAAACCCGACAGGACTATAAAGATACCAGGCGTTTCCC | |
| CCTGGAAGCTCCCTCGTGCGCTCTCCTGTTCCGACCCTGCCGCTTACCGGATACCTGTCCGCCT | |
| TTCTCCCTTCGGGAAGCGTGGCGCTTTCTCATAGCTCACGCTGTAGGTATCTCAGTTCGGTGTA | |
| GGTCGTTCGCTCCAAGCTGGGCTGTGTGCACGAACCCCCCGTTCAGCCCGACCGCTGCGCCTTA | |
| TCCGGTAACTATCGTCTTGAGTCCAACCCGGTAAGACACGACTTATCGCCACTGGCAGCAGCCA | |
| CTGGTAACAGGATTAGCAGAGCGAGGTATGTAGGCGGTGCTACAGAGTTCTTGAAGTGGTGGGC | |
| TAACTACGGCTACACTAGAAGAACAGTATTTGGTATCTGCGCTCTGCTGAAGCCAGTTACCTTC | |
| GGAAAAAGAGTTGGTAGCTCTTGATCCGGCAAACAAACCACCGCTGGTAGCGGTGGTTTTTTTG | |
| TTTGCAAGCAGCAGATTACGCGCAGAAAAAAAGGATCTCAAGAAGATCCTTTGATCTTTTCTAC | |
| GGGGTCTGACGCTCAGTGGAACGACGCGCGCGTAACTCACGTTAAGGGATTTTGGTCATGAGCT | |
| TGCGCCGTCCCGTCAAGTCAGCGTAATGCTCTGCTT | |
| The sequence of pJB808, a knockout vector for SYNPCC7002_A1189 (UHR | |
| and DHR in italics; aacC1 gentamycin marker is underlined) |
| SEQ ID NO: 7 |
| TAGAAAAACTCATCGAGCATCAAATGAAACTGCAATTTATTCATATCAGGATTATCAATACCAT | |
| ATTTTTGAAAAAGCCGTTTCTGTAATGAAGGAGAAAACTCACCGAGGCAGTTCCATAGGATGGC | |
| AAGATCCTGGTATCGGTCTGCGATTCCGACTCGTCCAACATCAATACAACCTATTAATTTCCCC | |
| TCGTCAAAAATAAGGTTATCAAGTGAGAAATCACCATGAGTGACGACTGAATCCGGTGAGAATG | |
| GCAAAAGTTTATGCATTTCTTTCCAGACTTGTTCAACAGGCCAGCCATTACGCTCGTCATCAAA | |
| ATCACTCGCATCAACCAAACCGTTATTCATTCGTGATTGCGCCTGAGCGAGGCGAAATACGCGA | |
| TCGCTGTTAAAAGGACAATTACAAACAGGAATCGAGTGCAACCGGCGCAGGAACACTGCCAGCG | |
| CATCAACAATATTTTCACCTGAATCAGGATATTCTTCTAATACCTGGAACGCTGTTTTTCCGGG | |
| GATCGCAGTGGTGAGTAACCATGCATCATCAGGAGTACGGATAAAATGCTTGATGGTCGGAAGT | |
| GGCATAAATTCCGTCAGCCAGTTTAGTCTGACCATCTCATCTGTAACATCATTGGCAACGCTAC | |
| CTTTGCCATGTTTCAGAAACAACTCTGGCGCATCGGGCTTCCCATACAAGCGATAGATTGTCGC | |
| ACCTGATTGCCCGACATTATCGCGAGCCCATTTATACCCATATAAATCAGCATCCATGTTGGAA | |
| TTTAATCGCGGCCTCGACGTTTCCCGTTGAATATGGCTCATATTCTTCCTTTTTCAATATTATT | |
| GAAGCATTTATCAGGGTTATTGTCTCATGAGCGGATACATATTTGAATGTATTTAGAAAAATAA | |
| ACAAATAGGGGTCAGTGTTACAACCAATTAACCAATTCTGAACATTATCGCGAGCCCATTTATA | |
| CCTGAATATGGCTCATAACACCCCTTGTTTGCCTGGCGGCAGTAGCGCGGTGGTCCCACCTGAC | |
| CCCATGCCGAACTCAGAAGTGAAACGCCGTAGCGCCGATGGTAGTGTGGGGACTCCCCATGCGA | |
| GAGTAGGGAACTGCCAGGCATCAAATAAAACGAAAGGCTCAGTCGAAAGACTGGGCCTTTCGCC | |
| CGGGCTAATTAGGGGGTGTCGCCCTTATTCGACTCTATAGTGAAGTTCCTATTCTCTAGAAAGT | |
| ATAGGAACTTCTGAAGTGGGGAAGCTTAAGTATAGGAACTTCTGAAGTGGGGCCTGCA | |
| CGCGGCCGCGGTACCCATATGTA | |
| ACAGGAATTCACTAGTTTTTAATTAAcgaatccatgtgggagtttattcttgacacagatattt | |
| atgatataataactgagtaagcttaacataaggaggaaaaactaatgttacgcagcagcaacga | |
| tgttacgcagcagggcagtcgccctaaaacaaagttaggtggctcaagtatgggcatcattcgc | |
| acatgtaggctcggccctgaccaagtcaaatccatgcgggctgctcttgatcttttcggtcgtg | |
| agttcggagacgtagccacctactcccaacatcagccggactccgattacctcgggaacttgct | |
| ccgtagtaagacattcatcgcgcttgctgccttcgaccaagaagcggttgttggcgctctcgcg | |
| gcttacgttctgcccaagtttgagcagccgcgtagtgagatctatatctatgatctcgcagtct | |
| ccggcgagcaccggaggcagggcattgccaccgcgctcatcaatctcctcaagcatgaggccaa | |
| cgcgcttggtgcttatgtgatctacgtgcaagcagattacggtgacgatcccgcagtggctctc | |
| tatacaaagttgggcatacgggaagaagtgatgcactttgatatcgacccaagtaccgccacct | |
| aGGCGCGCC | |
| GGCCGGCCA | |
| AAATGAAGTGAAGTTCCTATACTTAAGCTTAAAATGAAGTGAAGTTCCTATACTTTCTAGAGAA | |
| TAGGAACTTCTATAGTGAGTCGAATAAGGGCGACACAAAATTTATTCTAAATGCATAATAAATA | |
| CTGATAACATCTTATAGTTTGTATTATATTTTGTATTATCGTTGACATGTATAATTTTGATATC | |
| AAAAACTGATTTTCCCTTTATTATTTTCGAGATTTATTTTCTTAATTCTCTTTAACAAACTAGA | |
| AATATTGTATATACAAAAAATCATAAATAATAGATGAATAGTTTAATTATAGGTGTTCATCAAT | |
| CGAAAAAGCAACGTATCTTATTTAAAGTGCGTTGCTTTTTTCTCATTTATAAGGTTAAATAATT | |
| CTCATATATCAAGCAAAGTGACAGGCGCCCTTAAATATTCTGACAAATGCTCTTTCCCTAAACT | |
| CCCCCCATAAAAAAACCCGCCGAAGCGGGTTTTTACGTTATTTGCGGATTAACGATTACTCGTT | |
| ATCAGAACCGCCCAGGGGGCCCGAGCTTAAGACTGGCCGTCGTTTTACAACACAGAAAGAGTTT | |
| GTAGAAACGCAAAAAGGCCATCCGTCAGGGGCCTTCTGCTTAGTTTGATGCCTGGCAGTTCCCT | |
| ACTCTCGCCTTCCGCTTCCTCGCTCACTGACTCGCTGCGCTCGGTCGTTCGGCTGCGGCGAGCG | |
| GTATCAGCTCACTCAAAGGCGGTAATACGGTTATCCACAGAATCAGGGGATAACGCAGGAAAGA | |
| ACATGTGAGCAAAAGGCCAGCAAAAGGCCAGGAACCGTAAAAAGGCCGCGTTGCTGGCGTTTTT | |
| CCATAGGCTCCGCCCCCCTGACGAGCATCACAAAAATCGACGCTCAAGTCAGAGGTGGCGAAAC | |
| CCGACAGGACTATAAAGATACCAGGCGTTTCCCCCTGGAAGCTCCCTCGTGCGCTCTCCTGTTC | |
| CGACCCTGCCGCTTACCGGATACCTGTCCGCCTTTCTCCCTTCGGGAAGCGTGGCGCTTTCTCA | |
| TAGCTCACGCTGTAGGTATCTCAGTTCGGTGTAGGTCGTTCGCTCCAAGCTGGGCTGTGTGCAC | |
| GAACCCCCCGTTCAGCCCGACCGCTGCGCCTTATCCGGTAACTATCGTCTTGAGTCCAACCCGG | |
| TAAGACACGACTTATCGCCACTGGCAGCAGCCACTGGTAACAGGATTAGCAGAGCGAGGTATGT | |
| AGGCGGTGCTACAGAGTTCTTGAAGTGGTGGGCTAACTACGGCTACACTAGAAGAACAGTATTT | |
| GGTATCTGCGCTCTGCTGAAGCCAGTTACCTTCGGAAAAAGAGTTGGTAGCTCTTGATCCGGCA | |
| AACAAACCACCGCTGGTAGCGGTGGTTTTTTTGTTTGCAAGCAGCAGATTACGCGCAGAAAAAA | |
| AGGATCTCAAGAAGATCCTTTGATCTTTTCTACGGGGTCTGACGCTCAGTGGAACGACGCGCGC | |
| GTAACTCACGTTAAGGGATTTTGGTCATGAGCTTGCGCCGTCCCGTCAAGTCAGCGTAATGCTC | |
| TGCTTT | |
| NonA homolog from Cyanothece sp. PCC7424 YP_002377174.1 |
| SEQ ID NO: 8 |
| MKRNFSNFVDLLNHRAETQSDKILFTFLGDGETESLSLTYQQLDQQARAIAVQLQSLNATGERALLLYQP | |
| GLEFISAFFGCLYGGVIPVPAYPPRANRSIERLQAIVSDAEAKFALTSESLVNSIEGKLTQSLSQEAIQC | |
| VTTDNLELSLSQGWHKPKINPEQLAFLQYTSGSTGNPKGVMVSHSNLMHNAALINHYFQDTPESRGASWL | |
| PPYHDMGLIGGILQPIYVGVYVVLMPPVTFLQRPLRWLEVISRYRITTSGAPNFAYELCATQITPEQREN | |
| LDLSCWELAFSGAEPIRAHTLEQFAKAFAPCGFRPEAFYACYGMAETTLIVTGGKRSEKPFLKEFNSKGI | |
| EKNQVIPASSCDQDRVSLVSCGQVAEAQKVIIVNPETLNQCADDEIGEIWVSSESVAQGYWNRPQLTEAI | |
| FKAYTPDSPERPFLRTGDLGFLQDGELFVTGRLKDLIIIRGRNHYPQDIEMTAEKSHPALRESCGAAFSV | |
| EVGEEERLVITYEVKRSYIRKLNVEEVTSAIRKAVTQTHELQPYAIVLLKTGSIPKTSSGKIQRHACKAE | |
| FLEGSLNSVGQWSVTQLSEASSQQSKPKPRKNLKQHSPSNSQQQLIQDWLVDKIAQRLSISSAEIEITEP | |
| FASYGLDSVQAVRITAELEDWLKVKLSPTLAYDYPSIESLAQYLTALLKGQEIPSTPVLKTVTQQQTKSE | |
| LIAIIGMGCRFPGANNPDQFWQLLQQGKDQITQVKGRWEKETWGGFLDHIDQFDPQFFGISRREAQEIDP | |
| QQRLLLEVSWEALENASIAVDQLAGSQTGVFIGISSSDYSQIRLKSQLDPSAYAGTGNAHSIAANRLSYF | |
| YDFRGPSLTVDTACSSSLVAVHLAISSLQRGECQMAIAGGVNLLLSPELTETFTQAGMMATDGRCKTFDE | |
| GADGYVRGEGCGVVILKSLENAIADGDPILGVIHGSAINQDGRSNGLTAPNGIAQKQVICQALINGNIQA | |
| ADISYIETHGTGTPLGDPIEVNALKSVLMEGRSLDQPLWIGSLKTNIGHLEAAAGIAGLIKVILSLKHQQ | |
| IPPHLHLNSLNPHINLNETPIAIPTQLTPWKIDSKPRLAGVSSFGFGGTNAHVIVGEYNSLSPSPENLSP | |
| YPSPTRREELKPVERPLHILTLSAKREKDLSALIDSYKSYLTSQPTASLEDICFTANVGRSPLKHRVAII | |
| ANSQDQLREKLGKGEVIKAENSAQLTPKIAFLFTGQGSQYVGMGYQLYQTQPTFKTALDTCADLLSPYLK | |
| RPLLEILYPQDSTAISDELDQTAYTQPALFALEYALAQLWLSWGIEPSIVMGHSVGEYVAATLAGVFSLE | |
| DGIKLIAHRGKLMQALPQNGQMVAVLSDEVTVKKAINSHHQKVVIAAINGEKSLVISGEHQAVIEVTEVL | |
| KNQGIKTKPLTVSHAFHSPLMQPMLTEFERVAQEIEYSLPLIPIVSNVTGNIAGEEMATPHYWVNHVVDT | |
| VQFASSMKCLEKQGYKVFLEIGAKPTLLGMGRSTLESDPLNSNSSPYLWLPSLRPEQEDWQQILSSLAQL | |
| YVNGINVDWAGFDQDYPRQRVIGLPTYPFDRQSYWLTQTPQLNSHGLYQVEWEVKQPINDNFSLINPSTW | |
| LILADEQGLGELLGQELEKLGQTCLLIYPENGKGQKETFESLLAEVKQTQQTLGGIIHLWSLDEVTLTEA | |
| QHRGCESILYLLQTLYEQEISSKVWIATRGTQRVTLQENSLSHLQGTLWGLSKVVALEYSQYWGGIIDLD | |
| PEHDPQEAQFFLSEIFNSQKETYLAFRKGQRYVTRLKKATLTPQKLSLYQEGTYLITGGLGAVGLKVAQW | |
| LVKEGAKHLVLMGRSQPSANAQEILNTLEEKGVNLSIVQGDVTELEDINRIFNQIKNSHPPLKGIIHAAG | |
| LLKDGILQGLSWESFQQVLAPKVQGTWNLHQASLDLSLDFFVMFSSAASLLGSPGQGNYAAANGFLDAFA | |
| HYRHSLGLPGLTINWGALSAGMATSTRLGVKGLEMIEIESALEMLSSLLTTSTPQVGVLSVKWDSLSEQF | |
| PDLLKTPFFQEVISQDNKPSHEHSEIFTTLLTLSPPQRTEVLITYLQSSIARILHLSPADISPSDSLVDL | |
| GMDSLMVMEAINTLKKDLQLMLYPREIYEHPKIEALATYLGTEFEGTHGQSPKSPQHNPQKQELVVSRFS | |
| KTYQPLTITKKLPGIIFILSSPRAGSTLLRVMFAGHPDLISPPELHLLPFNTMGQRDQELALSYLGEGLQ | |
| RAFMELGGLDSQTSQSLIEELIHQNTSIPDVYQRLQELAGNRLLVDKSPTYGMQREILDRGEAMFEGAKY | |
| IHLVRHPYSVIDSFSRMRMDKLVGVSGDNPYSIAESVWLESNRNILDFSQTIDKERYYQLRYEDLVTQPS | |
| QMMRSLCEFLDIPFNSALLDPYQGDRMTDGVYNQSISVGDPNFSQRRQIDPKLADAWKKIHLPQPLGDTT | |
| LRLAASFNYELPHETVLPSPPRRGVGGEVISIPMQENYLTIRGLKLCLCSWGPEDGELILCIHGILEQGA | |
| AWEEVATRLAQKGYRVIAPDLRGHGKSDHVGNGGSYNLIDFLGDLDAIATHLTDKPFTLVGHSLGSIIAA | |
| MFTSIRPEKVKHLVLVETVLPTEVHEGDTVEQLATHLNYLSSPPKHPVFPDVETAAKRLQTATPAMSEQL | |
| AMKLAKRITQAGEGGIQWRWDSLLRTRAGIEFNGINRSRYLSLLKQIQAKITLIYGDQSDFNRPEDLQLQ | |
| QQTMSQANRIVVNGGHNLHLEAFEELANIING | |
| NonA homolog from Cyanothece sp. PCC7822 ZP_03153601.1 |
| SEQ ID NO: 9 |
| MKRNFSNFVDLLNHQAEAQSDKTIFTFLGDGESETLSLTYQQLDQQARAIAVQLQSLQAAGERALLLYQP | |
| GLEFISAFFGCLYGGVIPVPAYPPRANRSIERLQAIVSDAEAKFALTTQGIVSTIEGKLTQSQISTEAIQ | |
| CVTTDNLELSLSNQWRRPNLKPDQLAFLQYTSGSTGNPKGVMVSHGNLMHNAALINGYFRDTPSSRGASW | |
| LPPYHDMGLIGGILQPIYADVYVVLMPPVTFLQRPLRWLEVISRYRITTSGAPNFAYELCATQITPEQRE | |
| NLDLSCWELAFSGAEPVRAQTLAQFAEAFAPCGFRKEAFYPCYGMAETTLIVSGGTRGVYPLLKDFDAKG | |
| IEKNQVIPSSPLEPNNLTLVSCGKISGGQKVIIVNPDTLKQCDNYQIGEIWVNSESVAKGYWKRPQLTEA | |
| IFNAYTADTQEGPFLRTGDLGFLEDGELFVTGRLKDLIIIRGRNHYPQDIEMTAEKSHPALRESCGAAFS | |
| VEVGEEERLVITYEVKRSYIRKLNVEEVTSAIRKAVTQTHELQPYAIVLLKTGSIPKTSSGKIQRHACKA | |
| EFLEGSLNSVGQWSAAQTLPKTSKQLLEVNSRKKRGHIIKSNPQQEIIENWLVTNIAQRLGLSPTEIEIT | |
| EPFASYGLDSVQAVRITAELEDWLKVKLSPTLAYDHPTVESLAKYLASGTVETTLATSKPLKTSSSVAII | |
| GMSCRLPGANSPDEFWQLLRQGKDQITQVNARWDRDDWGGYLKGVDLFDAQFFGISPREAQEMDPQQRLL | |
| LEVSWEALEKAALAANQLAGSNTGVFIGISSHDYSQIRLKNALEPSAYAGTGNAASIAANRLSYLYDFRG | |
| PSLTVDTACSSSLVAIHLAIKSLQSGECQMALAGGVNILLSPELSETFTQAGMMAPDGRCKTFDESADGY | |
| VRGEGCGVIVLKSLEDAIRDGDPILGVIHGSAINQDGRSNGLTAPNGIAQQGVIRQALMNAGMSAADISY | |
| VETHGTGTALGDPIEVNSLKSVLMEGRSEKHPLWLGSVKTNIGHLEAAAGIAGLIKVLLCLQHQEIPPHL | |
| HLYRLNSHINLDDSPISIPTQLTPWKPENRPRLAGVSSFGFGGTNAHIIVGEYQNLSPTKRGQVEELERP | |
| LHILTLAAKREKDLSSLVKSYQHYLTAFPSASLEDICFTANNGRTQFKNRLAIIAQSREQLAEKLSRGEF | |
| ITPQIAQKLNPKIAFLFTGQGSQYIGMGYQLYQTQPTFRAALNTCADLLEPYLEYPLLEVLYPQENSNLA | |
| HYLDQTAYTQPALFALEYALAQLWLSWGIEPSVVMGHSVGEYVAATLAGVFSLEDGLKLIAHRGKLMQSL | |
| PQNGQMVAVLSDEETVKKAINSHDEKVVIAAINGERNLVISGENQAIIEVTDRLTHQGIKTKPLQVSHAF | |
| HSPLMQPMLEEFASIAREVEYSLPQIPLVSNVSGNLAAEAIATPEYWVNHVINPVHFSPSIKLMESKGYQ | |
| IFLEIGAKPTLLGMGRSIIESDSSVNHQNAYLWLPSLRPGQSDWQQMLTSLAQLYVQGINIDWAGFEADY | |
| QRQRMGGLPTYPFERQRYWLKPELEIHTGTKRLTTEQVSPPNQDWLYQVVWEAKPINPHQLSNQKTSTWL | |
| IFGDQQGLAKTVAEQLEKLGKTSLLVQSDKGDKNGNHKTLNPTEKNDFQRLLTPFKTSGESLEGIIYLWS | |
| LEEDEISKSNPQSILYLLQTLYEQNLSSRLWIATRGIQPVTTEDLAAPHIPLQGMLWGLGKVIALEYSDY | |
| WGGLIDIGTQPHTDEAKLLLSAIINPDGEQYLAFRDGQRYVARIDKAEIKPKKFSIDENGSYLITGGLGA | |
| VGLKVAQWLAKAGAKHLILMGRSHPTANAQETIKHLEKQGIEIIIAQADVTRQEDIDRVFNQIKTPLKGI | |
| IHAAGLLDDGILQGLSWEKFKKVLAPKVEGTWNLHKASLNHPLDFFVMFSSAASLFGSPGQGNYAAANGF | |
| LDGMAYYRQSQGLPALTVNWGALSGGMAKATRLAVKGLDLIDIEPALDILSHLLADKIAQIGVVSVDWET | |
| LAQQFPQLRQSPYFQRVITQLSPEQVKPDHSQSQILANLLALSPEQRTEALTAYLQSAMAQIMQLSPSQI | |
| SGEDSLLDIGMDSLMIMEAINQLKRDLQLMLYPREIYQHPKIEALANYLAAEFERTHGKGQIPVTSKQEL | |
| VVSRLTIANQPLTITKKLPGILFILSSPRAGSTLLRVMLAGHPDLASPPELHLLPFNSMGQRNQELALSY | |
| LGEGLQRAFMDLQGLDSATSQQLIERLIAEDISIPDVYEMLQQSAGKRLLVDKSPTYGMQREILDRAEAI | |
| FEGAKYIHLVRHPYPVIDSFCRMRMDKLVGSEGDNPYQLAESIWWESNRNIIEFSKTISSDRYYQLRYED | |
| LVTQPSQAMQALCEFLDIPFDSALLDPYQGQRMTDGVYNQSMSVGDPNFSKRKQIDPKLADAWKDIQLPH | |
| PLGDNTRQLAISLNYPLPHQNIPPLLRGEGGITEEVHLEEEYINIRGLNLCLCSWGPKQGELILCVHGIL | |
| EQGAAWGQMATRLAGLGYRVVAPDLRGQGKSDHVGKGGSYNLIDFLADLDAIANSLTDQPFTLVGHSLGS | |
| IIAAMFTSIRPEKVKNLVLVETVLPTEVSQTDAVEQLATHLNYLASPPEHPVFPDVETAAKRLQTATPAM | |
| SEALAISLAKRITEPCEGGIRWRWDSLLRTRAGIEFNGINRSRYISLLEQIQAPITLIYGDNSDFNRPED | |
| LQAQQKAMSAAKRIILKGGHNLHLDAYEQLANIIKQILGKTGQSF |
1. A method for the biosynthetic production of 1-alkenes, comprising:
culturing an engineered microorganism in a culture medium, wherein said engineered microorganism comprises a recombinant 1-alkene synthase, wherein said 1-alkene synthase is at least 95% identical to SEQ ID NO: 2, and wherein the amount of said 1-alkenes produced by said engineered microorganism is greater than the amount that would be produced by an otherwise identical microorganism, cultured under identical conditions, but lacking said recombinant 1-alkene synthase.
2. The method of claim 1, wherein said recombinant 1-alkene synthase is an endogenous 1-alkene synthase expressed, at least in part, from a promoter other than its native promoter.
3. The method of claim 1, wherein said recombinant 1-alkene synthase is a heterologous 1-alkene synthase.
4. The method of claim 1, wherein said recombinant 1-alkene synthase is expressed from a heterologous promoter.
5. The method of claim 4, wherein said 1-alkene synthase is endogenous to said microorganism.
6. The method of claim 1, wherein said engineered microorganism is a photosynthetic microorganism, and wherein exposing said engineered microorganism to light and carbon dioxide results in the production of alkenes by said microorganism.
7. The method of claim 6, wherein said engineered microorganism is a cyanobacterium.
8. The method of claim 1 or 6, wherein said 1-alkenes are selected from the group consisting of 1-nonadecene and 1-octadecene.
9. The method of claim 1 or 6, further comprising isolating said 1-alkenes from said cyanobacterium or said culture medium.
10. A method for the biosynthetic production of an olefin, comprising
(1) culturing a cyanobacterium in a culture medium, wherein said cyanobacterium comprises a 1-alkene synthase activity, wherein said 1-alkene synthase is at least 95% identical to SEQ ID NO: 2, and wherein said culture medium comprises an exogenous fatty acid;
(2) exposing said engineered cyanobacterium to light and carbon dioxide, wherein said exposure results in the production of an olefin by said cyanobacterium, and wherein the amount of said olefin produced is greater than the amount that would be produced by an otherwise identical cyanobacterium, cultured under identical conditions but in the absence of said exogenous fatty acid.
11. The method of claim 10, wherein said concentration of said fatty acid in said culture medium is at least 1 Îźg/ml.
12. The method of claim 11, wherein said fatty acid is an odd-chain fatty acid.
13. The method of claim 12, wherein said odd-chain fatty acid is tridecanoic acid and said olefin is 1-octadecene.
14. The method of claim 13, wherein the amount of said 1-octadecene produced is at least 0.039% dry cell weight.
15. The method of claim 10, further comprising isolating said olefin from said cyanobacterium or said culture medium.
16. A method for the biosynthetic production of alkenes, comprising
(1) culturing an engineered microorganism in a culture medium, wherein said engineered microorganism comprises a modification, wherein said modification reduces the activity of a hydrolase having an amino acid sequence that has at least 95% sequence identity to SEQ ID NO:4; and
(2) exposing said engineered microorganism to light and carbon dioxide, wherein said exposure results in the production of alkenes by said engineered microogransims, wherein said alkenes comprise 1-alkenes, and wherein the amount of 1-alkenes produced is greater than the amount that would be produced by an otherwise identical microorganism, cultured under identical conditions, but lacking said modification.
17. The method of claim 16, wherein said 1-alkenes include 1-nonadecene.
18. The method of claim 16, wherein said microorganism is a cyanobacteria.