Patent application title:

METHODS OF INDUCING AN IMMUNE RESPONSE WITH COMPOSITIONS COMPRISING A NEISSERIA MENINGITIDIS 741 PROTEIN

Publication number:

US20150273044A1

Publication date:
Application number:

14/739,985

Filed date:

2015-06-15

Abstract:

Two or more Neisserial proteins are joined such that they are translated as a single polypeptide chain. Hybrid proteins are represented by the formula NH2-A-[—X-L-]n-B—COOH where X is an amino acid sequence, L is an optional linker amino acid sequence, A is an optional N-terminal amino acid sequence, B is an optional C-terminal amino acid sequence, and n is an integer greater than 1. Proteins where each of the n-X— moieties shares sequence identity to each other —X— moiety, the protein is a ‘tandem protein’.

Inventors:

Assignee:

Interested in similar patents?

Get notified when new applications in this technology area are published.

Classification:

A61K2039/55505 »  CPC further

Medicinal preparations containing antigens or antibodies characterised by a specific combination antigen/adjuvant Inorganic adjuvants

A61K39/095 »  CPC main

Medicinal preparations containing antigens or antibodies; Bacterial antigens Neisseria

A61K39/39 »  CPC further

Medicinal preparations containing antigens or antibodies characterised by the immunostimulating additives, e.g. chemical adjuvants

C07K14/22 »  CPC further

Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from bacteria from Neisseriaceae (F)

Description

CROSS REFERENCE TO RELATED APPLICATIONS

This application is a Continuation of U.S. patent application Ser. No. 14/305,979, filed Jun. 16, 2014, now U.S. Pat. No. 9,056,075; which is a Divisional of U.S. patent application Ser. No. 13/366,252, filed Feb. 3, 2012, now U.S. Pat. No. 8,840,907; which is a Divisional of U.S. patent application Ser. No. 10/488,786, which claims an international filing date of Sep. 6, 2002, now U.S. Pat. No. 8,980,277; which is the National Stage of International Patent Application No. PCT/IB2002/003904, filed Sep. 6, 2002; which claims the benefit of United Kingdom Patent Application No. 0121591.2, filed Sep. 6, 2001; the disclosures of which are herein incorporated by reference in their entirety.

All documents cited herein are incorporated by reference in their entirety.

SUBMISSION OF SEQUENCE LISTING AS ASCII TEXT FILE

The content of the following submission on ASCII text file is incorporated herein by reference in its entirety: a computer readable form (CRF) of the Sequence Listing (file name: 223002100602SeqList.txt, date recorded: Jun. 12, 2015, size: 70 KB).

TECHNICAL FIELD

This invention is in the field of protein expression. In particular, it relates to the expression of proteins from Neisseria (e.g. N. gonorrhoeae or, preferably, N. meningitidis).

BACKGROUND ART

References 1 and 2 disclose alternative and improved approaches for the expression of the Neisserial proteins disclosed in references 3 to 6. One such method is to produce ‘hybrid’ proteins in which two or more Neisserial proteins are expressed as a single polypeptide chain. This approach offers two advantages. First, a protein that may be unstable or poorly expressed on its own can be assisted by adding a suitable hybrid partner that overcomes the problem. Second, commercial manufacture is simplified as only one expression and purification need be employed in order to produce two separately-useful proteins.

It is an object of the present invention to provide further alternative and improved approaches for the expression of Neisserial proteins.

DISCLOSURE OF THE INVENTION

Hybrid Proteins

Thus the invention provides a method for the simultaneous expression of two or more (e.g. 3, 4, 5, 6 or more) Neisserial proteins, in which said two or more proteins are joined such that they are translated as a single polypeptide chain. In general, the hybrid proteins of the invention can be represented by the formula: NH2-A-[—X-L-]n-B—COOH wherein X is an amino acid sequence, L is an optional linker amino acid sequence, A is an optional N-terminal amino acid sequence, B is an optional C-terminal amino acid sequence, and n is an integer greater than 1.

The value of n is between 2 and x, and the value of x is typically 3, 4, 5, 6, 7, 8, 9 or 10. Preferably n is 2, 3 or 4; it is more preferably 2 or 3; most preferably, n=2.

The ˜X˜ Moieties

There are two main groups of hybrid proteins according to the invention. These two groups are not mutually exclusive.

In the first group, each ˜X˜ moiety is:

    • (a) an orf1, orf4, orf25, orf40, orf46.1, orf83, NMB1343, 230, 233, 287, 292, 594, 687, 736, 741, 907, 919, 936, 953, 961 or 983 amino acid sequence;
    • (b) an amino acid sequence having sequence identity to an amino acid sequence from (a); or
    • (c) an amino acid sequence comprising a fragment of an amino acid sequence from (a).

A preferred subset of (a) is: orf46.1, 230, 287, 741, 919, 936, 953, 961 and 983. A more preferred subset of (a) is: orf46.1, 287, 741 and 961. FIG. 3 shows preferred hybrid proteins.

In the second group, the hybrid protein comprises a first —X— moiety (—Xa—) and a second —X— moiety (—Xb—). The —Xa— moiety has one of the following amino acid sequences:

    • (d) the 446 even SEQ IDs (i.e. 2, 4, 6, . . . , 890, 892) disclosed in reference 3.
    • (e) the 45 even SEQ IDs (i.e. 2, 4, 6, . . . , 88, 90) disclosed in reference 4;
    • (f) the 1674 even SEQ IDs 2-3020, even SEQ IDs 3040-3114, and all SEQ IDs 3115-3241, disclosed in reference 5;
    • (g) the 2160 amino acid sequences NMB0001 to NMB2160 from reference 7; or
    • (h) an amino acid sequence disclosed in reference 1 or reference 2.

The —Xb— moiety is related to —Xa— such that: (i) —Xb— has sequence identity to 13 Xa—, and/or (j) —Xb— comprises a fragment of —Xa—.

Examples of this second type of hybrid protein include proteins in which two or more —X— moieties are identical, or in which they are variants of the same protein e.g. two polymorphic forms of the same protein may be expressed as —Xa—Xb—, and three polymorphic forms may be expressed as —Xa—Xb—Xa— etc.

The —Xa— and —Xb— moieties may be in either order from N-terminus to C-terminus.

The —Xa— moiety is preferably an orf1, orf4, orf25, orf40, orf46.1, orf83, NMB1343, 230, 233, 287, 292, 594, 687, 736, 741, 907, 919, 936, 953, 961 or 983 amino acid sequence. The —Xa— moiety is more preferably an orf46.1, 230, 287, 741, 919, 936, 953, 961 or 983 amino acid sequence. The —Xa— moiety is most preferably an orf46.1, 287, 741 or 961 amino acid sequence.

In proteins where each of the n-X— moieties shares sequence identity to each other —X— moiety, the protein is referred to as a ‘tandem protein’. Tandem proteins in which n=2 are preferred.

The degree of ‘sequence identity’ referred to in (b) and (i) is preferably greater than 50% (eg. 60%, 70%, 80%, 90%, 95%, 99% or more, up to 100%). This includes mutants, homologs, orthologs, allelic variants etc. [e.g. see ref. 8]. Identity is preferably determined by the Smith-Waterman homology search algorithm as implemented in the MPSRCH program (Oxford Molecular), using an affine gap search with parameters gap open penalty=12 and gap extension penalty=1. Typically, 50% identity or more between two proteins is considered as an indication of functional equivalence.

The ‘fragment’ referred to in (c) and (j) should consist of least m consecutive amino acids from an amino acid sequence from (a), (d), (e), (f), (g) or (h) and, depending on the particular sequence, m is 7 or more (eg. 8, 10, 12, 14, 16, 18, 20, 25, 30, 35, 40, 50, 60, 70, 80, 90, 100, 150, 200 or more).

Preferably the fragment comprises an epitope from an amino acid sequence from (a), (d), (e), (t), (g) or (h). Preferred fragments are those disclosed in references 9 and 10.

Preferred (c) and (j) fragments are C- and/or N-terminal truncations (e.g. Δ1-287, A2-287 etc.).

Preferred (b), (c), (i) and (j) sequences omit poly-glycine sequences. This has been found to aid expression [ref. 2]. Poly-glycine sequences can be represented as (Gly)g, where g>3 (e.g. 4, 5, 6, 7, 8, 9 or more). If a —X— moiety includes a poly-glycine sequence in its wild-type form, it is preferred to omit this sequence in the hybrid proteins of the invention. This may be by disrupting or removing the (Gly)g—by deletion (e.g. CGGGGS→CGGGS, CGGS, CGS or CS), by substitution (e.g. CGGGGS→CGXGGS, CGXXGS, CGXGXS etc.), and/or by insertion (e.g. CGGGGS→CGGXGGS, CGXGGGS, etc.). Deletion of (Gly)g is preferred, and deletion of the N-terminus portion of a protein up to and including the poly-glycine sequence (e.g. deletion of residues 1-32 in SEQ ID 1) is referred to herein as ‘ΔG’. Poly-glycine omission is particularly useful for proteins 287, 741, 983 and Tbp2 (ΔG287, ΔG741, ΔG983 and ΔGTbp2—references 1 & 2).

Preferred (c) and (j) fragments omit complete protein domains. This is particularly useful for protein 961, 287, and ORF46. Once a protein has been notional divided into domains, (c) and (j) fragments can omit one or more of these domains (e.g. 287B, 287C, 287BC, ORF461-433, ORF46434-608, 961c— reference 2; FIGS. 4 and 5 herein).

287 protein has been notionally split into three domains, referred to as A, B & C (see FIG. 5 of reference 2). Domain B aligns with IgA proteases, domain C aligns with transferrin-binding proteins, and domain A shows no strong alignment with database sequences. An alignment of polymorphic forms of 287 is disclosed in reference 8.

ORF46 has been notionally split into two domains—a first domain (amino acids 1-433; ORF46.1) which is well-conserved between species and serogroups, and a second domain (amino acids 434-608) which is not well-conserved. The second domain is preferably deleted, leaving ORF46.1. An alignment of polymorphic forms of ORF46 is disclosed in reference 8.

961 protein has been notionally split into several domains (FIG. 4).

If a —X— moiety has a leader peptide sequence in its wild-type form, this may be included or omitted in the hybrid proteins of the invention. Where the leader peptide is omitted, this is a preferred example of an amino acid sequence within (c) and (j). In one embodiment, the leader peptides will be deleted except for that of the —X— moiety located at the N-terminus of the hybrid protein i.e. the leader peptide of X1 will be retained, but the leader peptides of X2 . . . Xn will be omitted. This is equivalent to deleting all leader peptides and using the leader peptide of X1 as moiety -A-.

When n=2, preferred pairs of —X— moieties are: ΔG287 and 230; ΔG287 and 936; ΔG287 and 741; 961c and 287; 961c and 230; 961c and 936; 961cL and 287; 961cL and 230; 961cL and 936; ORF46.1 and 936; ORF46.1 and 230; 230 and 961; 230 and 741; 936 and 961; 936 and 741. When n=2, preferred pairs of —X— moieties for tandem proteins are: ΔG741 and 741; ΔG287 and 287. More specifically, the following combinations of X1 and X2 are preferred when n=2:

X1 X2
ΔG287 230
ΔG287 936
ΔG287 741
ΔG287 961
ΔG287 ORF46.1
ΔG287 919
ΔG287 953
961c 287
961c 230
961c 936
961c 741
961c 983
961c ΔG983
961c ORF46.1
961 ORF46.1
961cL 287
961cL 230
961cL 936
ORF46.1 936
ORF46.1 230
ORF46.1 741
ORF46.1 ΔG741
ORF46.1 983
ORF46.1 ΔG983
230 961
230 741
230 ΔG741
936 961
936 741
936 ΔG741
ΔG741 741
ORF46.1 983
ΔG741 ORF46.1
ΔG741 983
ΔG741 961
ΔG741 961c
ΔG983 ORF46.1
ΔG983 961
ΔG983 961c
230 ΔG287
936 ΔG287
741 ΔG287
961 ΔG287
ORF46.1 ΔG287
919 ΔG287
953 ΔG287
287 961c
230 961c
936 961c
741 961c
983 961c
ΔG983 961c
ORF46.1 961c
ORF46.1 961
287 961cL
230 961cL
936 961cL
936 ORF46.1
230 ORF46.1
741 ORF46.1
ΔG741 ORF46.1
983 ORF46.1
ΔG983 ORF46.1
961 230
741 230
ΔG741 230
961 936
741 936
ΔG741 936
ΔG287 287
983 ORF46.1
ORF46.1 ΔG741
983 ΔG741
961 ΔG741
961c ΔG741
ORF46.1 ΔG983
961 ΔG983
961c ΔG983

Where 287 is used in full-length form, it is preferably at the C-terminal end of a hybrid protein; if it is to be used at the N-terminus, if is preferred to use a ΔG form of 287. Similarly, Where 741 is used in full-length form, it is preferably at the C-terminal end of a hybrid protein; if it is to be used at the N-terminus, if is preferred to use a ΔG form of 741.

The -L- Moieties

For each n instances of [—X-L-], linker amino acid sequence -L- may be present or absent. For instance, when n=2 the hybrid may be NH2—X1-L1-X2-L2-COOH, NH2—X1—X2—COOH, NH2—X1-L1-X2—COOH, NH2—X1—X2-L2-COOH, etc.

Linker amino acid sequence(s) -L- will typically be short (e.g. 20 or fewer amino acids i.e. 19, 18, 17, 16, 15, 14, 13, 12, 11, 10, 9, 8, 7, 6, 5, 4, 3, 2, 1). Examples include short peptide sequences which facilitate cloning, poly-glycine linkers (i.e. Glyn where n=2, 3, 4, 5, 6, 7, 8, 9, 10 or more), and histidine tags (i.e. Hisn where n=3, 4, 5, 6, 7, 8, 9, 10 or more). Other suitable linker amino acid sequences will be apparent to those skilled in the art. A useful linker is GSGGGG (SEQ ID 27), with the Gly-Ser dipeptide being formed from a BamHI restriction site, thus aiding cloning and manipulation, and the Gly4 tetrapeptide being a typical poly-glycine linker.

If Xn+1 is a ΔG protein and Ln is a glycine linker, this may be equivalent to Xn+1 not being a ΔG protein and Ln being absent.

The -A- Moiety

-A- is an optional N-terminal amino acid sequence. This will typically be short (e.g. 40 or fewer amino acids i.e. 39, 38, 37, 36, 35, 34, 33, 32, 31, 30, 29, 28, 27, 26, 25, 24, 23, 22, 21, 20, 19, 18, 17, 16, 15, 14, 13, 12, 11, 10, 9, 8, 7, 6, 5, 4, 3, 2, 1). Examples include leader sequences to direct protein trafficking, or short peptide sequences which facilitate cloning or purification (e.g. histidine tags i.e. Hisn where n=3, 4, 5, 6, 7, 8, 9, 10 or more). Other suitable N-terminal amino acid sequences will be apparent to those skilled in the art. If X1 lacks its own N-terminus methionine, -A- may be a methionine residue.

The —B— Moiety

—B— is an optional C-terminal amino acid sequence. This will typically be short (e.g. 40 or fewer amino acids i.e. 39, 38, 37, 36, 35, 34, 33, 32, 31, 30, 29, 28, 27, 26, 25, 24, 23, 22, 21, 20, 19, 18, 17, 16, 15, 14, 13, 12, 11, 10, 9, 8, 7, 6, 5, 4, 3, 2, 1). Examples include sequences to direct protein trafficking, short peptide sequences which facilitate cloning or purification (e.g. comprising histidine tags i.e. Hisn where n=3, 4, 5, 6, 7, 8, 9, 10 or more), or sequences which enhance protein stability. Other suitable C-terminal amino acid sequences will be apparent to those skilled in the art.

Polymorphic Forms of Proteins

The invention can use amino acid sequences from any strains of N. meningitidis. References to a particular protein (e.g. ‘287’, or ‘ORF46.1’) therefore include that protein from any strain. Sequence variations between strains are included within (b), (c), (i) and (j).

Reference sequences from N. meningitidis serogroup B include:

Protein Reference
orf1 Ref. 3, SEQ ID 650
orf25 Ref. 3, SEQ ID 684
orf46 Ref. 6, SEQ ID 1049
NMB1343 Ref. 7, NMB1343
233 Ref. 5, SEQ ID 860
292 Ref. 5, SEQ ID 1220
687 Ref. 5, SEQ ID 2282
741 Ref. 5, SEQ ID 2536
919 Ref. 5, SEQ ID 3070
953 Ref. 5, SEQ ID 2918
983 Ref. 7, NMB1969
orf4 Ref. 3, SEQ ID 218
orf40 Ref. 4, SEQ ID 4
orf83 Ref. 3, SEQ ID 314
230 Ref. 5, SEQ ID 830
287 Ref. 5, SEQ ID 3104
594 Ref. 5, SEQ ID 1862
736 Ref. 5, SEQ ID 2506
907 Ref. 5, SEQ ID 2732
936 Ref. 5, SEQ ID 2884
961 Ref. 5, SEQ ID 940

Reference 8 discloses polymorphic forms of proteins ORF4, ORF40, ORF46, 225, 235, 287, 519, 726, 919 and 953. Polymorphic forms of 961 are disclosed in references 11 & 12. Any of these polymorphic forms may be used in accordance with the present invention.

The sequence listing herein includes polymorphic forms of proteins 741 (SEQ IDs 1-22) and NMB 1343 (SEQ IDs 23-24) which have been identified.

Serogroups and Strains

Preferred proteins of the invention comprise —X— moieties having an amino acid sequence found in N. meningitidis serogroup B. Within a single protein of the invention, individual —X— moieties may be from one or more strains. Where n=2, for instance, X2 may be from the same strain as X1 or from a different strain. Where n=3, the strains might be (i) X1═X2═X3 (ii) X1═X2≠X3 (iii) X1≠X2═X3 (iv) X1≠X2≠X3 or (v) X1═X3≠X2, etc.

Within serogroup B, preferred —X— moieties are from strains 2996, MC58, 95N477, or 394/98. Strain 95N477 is sometimes referred to herein as ‘ET37’, this being its electrophoretic type. Strain 394/98 is sometimes referred to herein as ‘nz’, as it is a New Zealand strain.

Where a form of 287 is used, this is preferably from strain 2996 or from strain 394/98.

Where a form of 741 is used, this is preferably from serogroup B strains MC58, 2996, 394/98, or 95N477, or from serogroup C strain 90/18311.

Where a form of 961 is used, this is preferably from strain 2996.

Strains are indicated as a subscript e.g. 741MC58 is protein 741 from strain MC58. Unless otherwise stated, proteins mentioned herein (e.g. with no subscript) are from N. meningitidis strain 2996, which can be taken as a ‘reference’ strain. It will be appreciated, however, that the invention is not in general limited by strain. As mentioned above, general references to a protein (e.g. ‘287’, ‘919’ etc.) may be taken to include that protein from any strain. This will typically have sequence identity to 2996 of 90% or more (eg. 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or more).

Domain-Based Expression of Protein 961

References 1 and 2 disclose how a protein can be notionally divided into domains and how the protein can be manipulated based on these domains. The present invention extends the application of this approach to protein 961 (also known as ‘NadA’ [11,12]).

In N. meningitidis serogroup B strain 2996, NadA has 405 amino acids. This protein has notionally been divided into the following nine domains (FIG. 4):

Domain name Amino acids Domain name Amino acids
   961-1 ‘L’  1-23 961-6 269-286
961-2 24-87 961-7 287-330
961-3  88-143 961-8 331-350
961-4 144-180 961-9 351-405
961-5 181-268

This information can be used to locate the same domains in other forms of 961.

These domains have been deleted from 961 in strain 2996 in various ways (FIG. 5). Preferred fragments of 961 omit one or more of these nine domains e.g. the following:

    • 961-2 to 961-5 (‘961a’)
    • 961-6 to 961-9 (‘961b’)
    • 961-1 to 961-8 (‘961 cL’)
    • 961-2 to 961-8 (‘961c’)
    • 961-2 to 961-6 and amino acids 287-325 from domain 961-7 (‘961d’)
    • 961-2 to 961-8 and amino acids 351-383 from domain 961-9 (‘961Δ1’)
    • 961-1 to 961-8 and amino acids 351-383 from domain 961-9 (‘961Δ1L’)
    • 961-1 to 961-7 and amino acids 331-343 from domain 961-8 (‘961cL-Δaro’)
    • 961-1 to 961-6 and amino acids 287-315 from domain 961-7 (‘961cL-Δcc’)
    • 961-1 to 961-5 (‘961aL’)
    • 961-1 to 961-4 (‘961aL-Δ1’)
    • 961-1 to 961-3 (‘961aL-Δ2’)
    • 961-1 to 961-2 (‘961aL-Δ3’)

These thirteen fragments (and sub-fragments thereof missing 1, 2, 3, 4 or 5 amino acids at either or both ends) are preferred (c) and (j) fragments, but they may also be expressed in their own right i.e. not in the form of a hybrid protein of the invention. Thus the invention provides a protein comprising one of these fragments, providing that the protein is not full-length 961 and is not a protein specifically disclosed in reference 1 or 2. This protein may be a fusion protein (e.g. a GST-fusion or a His-tag fusion).

Sequences

The invention also provides a protein having an amino acid sequence from SEQ IDs 1 to 24. It also provides proteins and nucleic acid having sequence identity to these. As described above, the degree of ‘sequence identity’ is preferably greater than 50% (eg. 60%, 70%, 80%, 90%, 95%, 99% or more).

The invention also provides nucleic acid encoding such proteins.

Furthermore, the invention provides nucleic acid which can hybridise to this nucleic acid, preferably under “high stringency” conditions (eg. 65° C. in a 0.1×SSC, 0.5% SDS solution).

The invention also provides nucleic acid encoding proteins according to the invention.

It should also be appreciated that the invention provides nucleic acid comprising sequences complementary to those described above (eg. for antisense or probing purposes).

Nucleic acid according to the invention can, of course, be prepared in many ways (eg. by chemical synthesis, from genomic or cDNA libraries, from the organism itself etc.) and can take various forms (eg. single stranded, double stranded, vectors, probes etc.).

In addition, the term “nucleic acid” includes DNA and RNA, and also their analogues, such as those containing modified backbones, and also peptide nucleic acids (PNA) etc.

Mixtures

The invention also provides a composition comprising two or more (i.e. 2, 3, 4, 5, 6 or 7) of the following proteins:

    • (1) 287
    • (2) 741
    • (3) ORF46.1
    • (4) 961
    • (5) NH2-A-[—X-L-]n-B—COOH, wherein n=2, X1=287, X2=953
    • (6) NH2-A-[—X-L-]n-B—COOH, wherein n=2, X1=287, X2=919
    • (7) NH2-A-[—X-L-]n-B—COOH, wherein n=2, X1=287, X2=961

The mixture may include one or both of the following proteins, either in combination with two or more of (1) to (7), or in combination with only one of (1) to (7):

    • (8) NH2-A-[—X-L-]n-B—COOH, wherein n=2, X1=287, X2=741
    • (9) NH2-A-[—X-L-]n-B—COOH, wherein n=2, X1=936, X2=741

Where proteins 287 and 741 are included in the mixture (i.e. in protein 1, 2, 5, 6, 7 or 8), they may be in the ‘ΔG’ form. Where protein 961 is included, it is preferably in the form of ‘961c’ in which the N-terminus leader and C-terminus membrane anchor are absent [e.g. see refs. 1, 2 & 11].

A preferred mixture comprises the following three proteins:

    • (1) 961c, preferably 961c2996 (e.g. SEQ ID 31 herein);
    • (2) NH2-A-[—X-L-]n-B—COOH, wherein n is 2, —X1— is ΔG287 (preferably ΔG287NZ), —X2— is 953 (preferably 9532996) lacking its leader peptide, -L1- is GSGGGG, and -A- comprises a N-terminus methionine (e.g. -A- is M or MA) (e.g. SEQ IDs 28 & 29 herein); and
    • (3) NH2-A-[—X-L-]n-B—COOH, wherein n=2, X1=936 (preferably 9362996), X2=ΔG741 (preferably ΔG741MC58), L1=GSGGGG (e.g. SEQ ID 30 herein).

The mixtures may also comprise N. meningitidis outer membrane vesicles.

Heterologous Host

Whilst expression of the proteins of the invention may take place in Neisseria, the present invention preferably utilises a heterologous host. The heterologous host may be prokaryotic (e.g. a bacterium) or eukaryotic. It is preferably E. coli, but other suitable hosts include Bacillus subtilis, Vibrio cholerae, Salmonella typhi, Salmonenna typhimurium, Neisseria lactamica, Neisseria cinerea, Mycobacteria (e.g. M. tuberculosis), yeast etc.

Vectors Etc.

The invention provides (a) nucleic acid encoding the proteins described above (b) vectors comprising these nucleic acid sequences (c) host cells containing said vectors (d) compositions comprising the proteins or nucleic acids of the invention, which may be suitable as immunogenic compositions (e.g. vaccines) or as diagnostic reagents (e) these compositions for use as medicaments (e.g. as vaccines) or as diagnostic reagents (f) the use of these compositions in the manufacture of (1) a medicament for treating or preventing infection due to Neisserial bacteria (2) a diagnostic reagent for detecting the presence of Neisserial bacteria or of antibodies raised against Neisseria bacteria, and/or (3) a reagent which can raise antibodies against Neisseria bacteria and (g) a method of treating a patient, comprising administering to the patient a therapeutically effective amount of these compositions.

Implementing the invention will typically involve the basic steps of: obtaining a first nucleic acid encoding a first protein; obtaining a second nucleic acid encoding a second protein; and ligating the first and second nucleic acids. The resulting nucleic acid may be inserted into an expression vector, or may already be part of an expression vector.

To improve solubility, purification of hybrid proteins may involve the refolding techniques disclosed herein.

Immunogenic Compositions and Medicaments

The compositions of the invention are preferably immunogenic composition, and are more preferably vaccine compositions. The pH of the composition is preferably between 6 and 7. The pH may be maintained by the use of a buffer. The composition may be sterile.

Vaccines according to the invention may either be prophylactic (i.e. to prevent infection) or therapeutic (i.e. to treat infection), but will typically be prophylactic.

The invention also provides a composition of the invention for use as a medicament. The medicament is preferably able to raise an immune response in a mammal (i.e. it is an immunogenic composition) and is more preferably a vaccine.

The invention also provides the use of a composition of the invention in the manufacture of a medicament for raising an immune response in a mammal. The medicament is preferably a vaccine.

The invention also provides a method for raising an immune response in a mammal comprising the step of administering an effective amount of a composition of the invention. The immune response is preferably protective. The method may raise a booster response.

The mammal is preferably a human. Where the vaccine is for prophylactic use, the human is preferably a child (e.g. a toddler or infant); where the vaccine is for prophylactic use, the human is preferably an adult. A vaccine intended for children may also be administered to adults e.g. to assess safety, dosage, immunogenicity, etc.

These uses and methods are preferably for the prevention and/or treatment of a disease caused by a Neisseria (e.g. meningitis, septicaemia, gonorrhoea etc.). The prevention and/or treatment of bacterial meningitis is preferred.

Further Components of the Composition

The composition of the invention will typically, in addition to the components mentioned above, comprise one or more ‘pharmaceutically acceptable carriers’, which include any carrier that does not itself induce the production of antibodies harmful to the individual receiving the composition. Suitable carriers are typically large, slowly metabolised macromolecules such as proteins, polysaccharides, polylactic acids, polyglycolic acids, polymeric amino acids, amino acid copolymers, trehalose (WO00/56365) and lipid aggregates (such as oil droplets or liposomes). Such carriers are well known to those of ordinary skill in the art. The vaccines may also contain diluents, such as water, saline, glycerol, etc. Additionally, auxiliary substances, such as wetting or emulsifying agents, pH buffering substances, and the like, may be present. A thorough discussion of pharmaceutically acceptable excipients is available in Remington's Pharmaceutical Sciences.

Immunogenic compositions used as vaccines comprise an immunologically effective amount of antigen, as well as any other of the above-mentioned components, as needed. By ‘immunologically effective amount’, it is meant that the administration of that amount to an individual, either in a single dose or as part of a series, is effective for treatment or prevention. This amount varies depending upon the health and physical condition of the individual to be treated, age, the taxonomic group of individual to be treated (e.g. non-human primate, primate, etc.), the capacity of the individual's immune system to synthesise antibodies, the degree of protection desired, the formulation of the vaccine, the treating doctor's assessment of the medical situation, and other relevant factors. It is expected that the amount will fall in a relatively broad range that can be determined through routine trials. Dosage treatment may be a single dose schedule or a multiple dose schedule (e.g. including booster doses). The vaccine may be administered in conjunction with other immunoregulatory agents.

The vaccine may be administered in conjunction with other immunoregulatory agents.

The composition may include other adjuvants in addition to (or in place of) the aluminium salt. Preferred adjuvants to enhance effectiveness of the composition include, but are not limited to: (1) oil-in-water emulsion formulations (with or without other specific immunostimulating agents such as muramyl peptides (see below) or bacterial cell wall components), such as for example (a) MF59™ (WO90/14837; Chapter 10 in ref. 13), containing 5% Squalene, 0.5% Tween 80, and 0.5% Span 85 (optionally containing MTP-PE) formulated into submicron particles using a microfluidizer, (b) SAF, containing 10% Squalane, 0.4% Tween 80, 5% pluronic-blocked polymer L121, and thr-MDP either microfluidized into a submicron emulsion or vortexed to generate a larger particle size emulsion, and (c) Ribi™ adjuvant system (RAS), (Ribi Immunochem, Hamilton, Mont.) containing 2% Squalene, 0.2% Tween 80, and one or more bacterial cell wall components from the group consisting of monophosphorylipid A (MPL), trehalose dimycolate (TDM), and cell wall skeleton (CWS), preferably MPL+CWS (Detox™); (2) saponin adjuvants, such as QS21 or Stimulon™ (Cambridge Bioscience, Worcester, Mass.) may be used or particles generated therefrom such as ISCOMs (immunostimulating complexes), which ISCOMS may be devoid of additional detergent e.g. WO00/07621; (3) Complete Freund's Adjuvant (CFA) and Incomplete Freund's Adjuvant (IFA); (4) cytokines, such as interleukins (e.g. IL-1, IL-2, IL-4, IL-5, IL-6, IL-7, IL-12 (WO99/44636), etc.), interferons (e.g. gamma interferon), macrophage colony stimulating factor (M-CSF), tumor necrosis factor (TNF), etc.; (5) monophosphoryl lipid A (MPL) or 3-0-deacylated MPL (3dMPL) e.g. GB-2220221, EP-A-0689454; (6) combinations of 3dMPL with, for example, QS21 and/or oil-in-water emulsions e.g. EP-A-0835318, EP-A-0735898, EP-A-0761231; (7) oligonucleotides comprising CpG motifs [Krieg Vaccine 2000, 19, 618-622; Krieg Curr opin Mol Ther 2001 3:15-24; Roman et al., Nat. Med., 1997, 3, 849-854; Weiner et al., PNAS USA, 1997, 94, 10833-10837; Davis et al., J. Immunol., 1998, 160, 870-876; Chu et al., J. Exp. Med., 1997, 186, 1623-1631; Lipford et al., Eur. J. Immunol., 1997, 27, 2340-2344; Moldoveanu et al., Vaccine, 1988, 16, 1216-1224, Krieg et al., Nature, 1995, 374, 546-549; Klinman et al., PNAS USA, 1996, 93, 2879-2883; Ballas et al., J. Immunol., 1996, 157, 1840-1845; Cowdery et al., J. Immunol., 1996, 156, 4570-4575; Halpern et al., Cell. Immunol., 1996, 167, 72-78; Yamamoto et al., Jpn. J. Cancer Res., 1988, 79, 866-873; Stacey et al., J. Immunol., 1996, 157, 2116-2122; Messina et al., J. Immunol., 1991, 147, 1759-1764; Yi et al., J. Immunol., 1996, 157, 4918-4925; Yi et al., J. Immunol., 1996, 157, 5394-5402; Yi et al., J. Immunol., 1998, 160, 4755-4761; and Yi et al., J. Immunol., 1998, 160, 5898-5906; International patent applications WO96/02555, WO98/16247, WO98/18810, WO98/40100, WO98/55495, WO98/37919 and WO98/52581] i.e. containing at least one CG dinucleotide, with 5-methylcytosine optionally being used in place of cytosine; (8) a polyoxyethylene ether or a polyoxyethylene ester e.g. WO99/52549;

(9) a polyoxyethylene sorbitan ester surfactant in combination with an octoxynol (e.g. WO01/21207) or a polyoxyethylene alkyl ether or ester surfactant in combination with at least one additional non-ionic surfactant such as an octoxynol (e.g. WO01/21152); (10) an immunostimulatory oligonucleotide (e.g. a CpG oligonucleotide) and a saponin e.g. WO00/62800; (11) an immunostimulant and a particle of metal salt e.g. WO00/23105; (12) a saponin and an oil-in-water emulsion e.g. WO99/11241; (13) a saponin (e.g. QS21)+3dMPL+IL-12 (optionally+a sterol) e.g. WO98/57659; (14) other substances that act as immunostimulating agents to enhance the efficacy of the composition.

Muramyl peptides include N-acetyl-muramyl-L-threonyl-D-isoglutamine (thr-MDP), N-acetyl-normuramyl-L-alanyl-D-isoglutamine (nor-MDP), N-acetylmuramyl-L-alanyl-D-isoglutaminyl-L-alanine-2-(1′-2′-dipalmitoyl-sn-glycero-3-hydroxyphosphoryloxy)-ethylamine MTP-PE), etc.

Further Antigens

Further antigens which can be included in the composition of the invention include:

    • an outer-membrane vesicle (OMV) preparation from N. meningitidis serogroup B, such as those disclosed in refs. 14, 15, 16, 17 etc.
    • a saccharide antigen from N. meningitidis serogroup A, C, W135 and/or Y, such as the oligosaccharide disclosed in ref. 18 from serogroup C [see also ref. 19] or the oligosaccharides of ref. 20.
    • a saccharide antigen from Streptococcus pneumoniae [e.g. refs. 21, 22, 23].
    • a protein antigen from Helicobacter pylori such as CagA [e.g. 24], VacA [e.g. 24], NAP [e.g. 25], HopX [e.g. 26], HopY [e.g. 26] and/or urease.
    • an antigen from hepatitis A virus, such as inactivated virus [e.g. 27, 28].
    • an antigen from hepatitis B virus, such as the surface and/or core antigens [e.g. 28, 29].
    • an antigen from hepatitis C virus [e.g. 30].
    • an antigen from Bordetella pertussis, such as pertussis holotoxin (PT) and filamentous haemagglutinin (FHA) from B. pertussis, optionally also in combination with pertactin and/or agglutinogens 2 and 3 [e.g. refs. 31 & 32].
    • a diphtheria antigen, such as a diphtheria toxoid [e.g. chapter 3 of ref. 33] e.g. the CRM197 mutant [e.g. 34].
    • a tetanus antigen, such as a tetanus toxoid [e.g. chapter 4 of ref. 33].
    • a saccharide antigen from Haemophilus influenzae B [e.g. 19].
    • an antigen from N. gonorrhoeae [e.g. 3, 4, 5].
    • an antigen from Chlamydia pneumoniae [e.g. 35, 36, 37, 38, 39, 40, 41].
    • an antigen from Chlamydia trachomatis [e.g. 42].
    • an antigen from Porphyromonas gingivalis [e.g. 43].
    • polio antigen(s) [e.g. 44, 45] such as IPV or OPV.
    • rabies antigen(s) [e.g. 46] such as lyophilised inactivated virus [e.g.47, RabAvert™]
    • measles, mumps and/or rubella antigens [e.g. chapters 9, 10 & 11 of ref. 33].
    • influenza antigen(s) [e.g. chapter 19 of ref. 33], such as the haemagglutinin and/or neuraminidase surface proteins.
    • an antigen from Moraxella catarrhalis [e.g. 48].
    • a protein antigen from Streptococcus agalactiae (group B streptococcus) [e.g. 49, 50].
    • a saccharide antigen from Streptococcus agalactiae
    • an antigen from Streptococcus pyogenes (group A streptococcus) [e.g. 50, 51, 52].
    • an antigen from Staphylococcus aureus [e.g. 53].

The composition may comprise one or more of these further antigens.

Where a saccharide or carbohydrate antigen is used, it is preferably conjugated to a carrier protein in order to enhance immunogenicity [e.g. refs. 54 to 63]. Preferred carrier proteins are bacterial toxins or toxoids, such as diphtheria or tetanus toxoids. The CRM197 diphtheria toxoid is particularly preferred. Other suitable carrier proteins include the N. meningitidis outer membrane protein [e.g. ref. 64], synthetic peptides [e.g. 65, 66], heat shock proteins [e.g. 67], pertussis proteins [e.g. 68, 69], protein D from H. influenzae [e.g. 70], toxin A or B from C. difficile [e.g. 71], etc. Where a mixture comprises capsular saccharides from both serogroups A and C, it is preferred that the ratio (w/w) of MenA saccharide:MenC saccharide is greater than 1 (e.g. 2:1, 3:1, 4:1, 5:1, 10:1 or higher). Saccharides from different serogroups of N. meningitidis may be conjugated to the same or different carrier proteins.

Any suitable conjugation reaction can be used, with any suitable linker where necessary.

Toxic protein antigens may be detoxified where necessary (e.g. detoxification of pertussis toxin by chemical and/or genetic means [32]).

Where a diphtheria antigen is included in the composition it is preferred also to include tetanus antigen and pertussis antigens. Similarly, where a tetanus antigen is included it is preferred also to include diphtheria and pertussis antigens. Similarly, where a pertussis antigen is included it is preferred also to include diphtheria and tetanus antigens.

Antigens are preferably mixed with (and more preferably adsorbed to) an aluminium salt (e.g. phosphate, hydroxide, hydroxyphosphate, oxyhydroxide, orthophosphate, sulphate). The salt may take any suitable form (e.g. gel, crystalline, amorphous etc.).

Antigens in the composition will typically be present at a concentration of at least 1μg/ml each. In general, the concentration of any given antigen will be sufficient to elicit an immune response against that antigen.

As an alternative to using proteins antigens in the composition of the invention, nucleic acid encoding the antigen may be used [e.g. refs. 72 to 80]. Protein components of the compositions of the invention may thus be replaced by nucleic acid (preferably DNA e.g. in the form of a plasmid) that encodes the protein.

Definitions

The term “comprising” means “including” as well as “consisting” e.g. a composition “comprising” X may consist exclusively of X or may include something additional e.g. X+Y.

The term “about” in relation to a numerical value x means, for example, x±10%.

BRIEF DESCRIPTION OF DRAWINGS

FIG. 1 shows an alignment of twenty-three sequences for protein 741. These are SEQ IDs 1 to 22 plus the sequence from MC58.

FIG. 2 shows an alignment of the NMB 1343 sequence from gonococcus (top; SEQ ID 25) and meningococcus (bottom; SEQ ID 26).

FIG. 3 shows hybrid and tandem proteins of the invention.

FIG. 4 shows 9 domains within 9612996, and FIG. 5 shows how these have been manipulated.

MODES FOR CARRYING OUT THE INVENTION

Hybrid Proteins—X1=ΔG287

In addition to those disclosed in references 1 & 2, seven hybrid proteins with ΔG287 from strain 2996 at the N-terminus were constructed. Eight 287 tandem proteins were also made (see below).

# n X1 L1 X2 L2
1 2 ΔG287 230 (His)6
2 2 936 (His)6
3 2 741MC58 (His)6
4 2 741ET37 (His)6
5 2 74190/18311 (His)6
6 2 74195N477 (His)6
7 2 ΔG287nz 741MC58 (His)6

These proteins were adjuvanted with either Freund's complete adjuvant (FCA) or 3 mg/ml alum and used to immunise mice. The resulting sera were tested against various Neisserial strains using the bactericidal assay. Titres using protein #3 were as follows:

Strain(serogroup)
2996(B) MC58(B) NGH38(B) 394/98(B) 44/76(B) F6124(A)
Al hydroxide 8192 32768 8192 >2048 16384 8192
FCA 16384 262144 8192 >2048 >32768 8192

In further experiments using protein #3 adjuvanted with aluminium hydroxide, anti-287 and anti-741 ELISA titres each exceeded 984150 and BCA titres were as follows:

2996(B) MC58(B) NGH38(B) 394/98(B) 44/76(B) F6124(A) BZ133(C)
8000 65000 4000 4000 32000 8000 16000

Results obtained after immunisation with proteins disclosed in refs. 1 & 2, tested against the homologous strain, were as follows:

Bactericidal
titre ELISA
n X1 L1 X2 L2 FCA Alum FCA Alum
2 ΔG287394/98 961 (His)6 32768 >109350
919 32768 4096 4718 3678
953 >32768 >16384 1900 6936
741 16384 2048 232 862
2 ΔG2872996 961 (His)6 65536 32768 108627 >109350
919 128000 32000 11851 2581
953 65536 3834
741 16384 8192 315 4645

Hybrid Proteins—X1=961c or 961cL

In addition to those disclosed in references 1 & 2, eight hybrid proteins with either 961c or 961cL (i.e. 961c+leader peptide) at the N-terminus were constructed:

# n X1 L1 X2 L2
1 2 961c 287
2 2 287 (His)6
3 2 230 (His)6
4 2 936 (His)6
5 2 961cL 287
6 2 287 (His)6
7 2 230 (His)6
8 2 936 (His)6

These proteins were adjuvanted with either Freund's complete adjuvant (FCA) or 3.3 mg/ml alum and used to immunise mice. The resulting sera were tested against various Neisserial strains using the bactericidal assay. Titres using protein #8 were as follows:

Strain(serogroup) 2996(B) MC58(B) 394/98(B) 44/76(B) F6124(A)
Al hydroxide 8192 8192 512 1024 <16
FCA 65536 16384 >2048 >2048 8192

Titres obtained after immunisation with 961c-741 [refs. 1 & 2] were as follows:

Strain(serogroup)
2996(B) MC58(B) 394/98(B) 44/76(B) F6124(A) BZ133(C)
Al hydroxide 65536 32768 4096 >32768 16384 >2048
FCA >16384 262144 4096 >16384 >2048

These results could be improved by mixing 961c-741 with ORF46.1 or with ΔG287-919.

Results obtained after immunisation with proteins disclosed in refs. 1 & 2, tested against the homologous strain, were as follows:

Bactericidal
titre ELISA
n X1 L1 X2 L2 FCA Alum FCA Alum
2 961c ORF46.1 (His)6 32768 1024 >109350 >109350
741 >16384 8192 >109350 >109350
936 >32768 8192 >109350 >109350

Hybrid Proteins—X1=ORF46.1

In addition to those disclosed in references 1 & 2, two hybrid proteins with ORF46.1 at the N-terminus were constructed:

# n X1 L1 X2 L2
1 2 ORF46.1 936 (His)6
2 2 230 (His)6

These proteins were adjuvanted with either Freund's complete adjuvant (FCA) or 3 mg/ml alum and used to immunise mice. The resulting sera were tested against the homologous strain using the bactericidal assay and by ELISA.

Results obtained after immunisation with proteins disclosed in refs. 1 & 2 were as follows:

Bacteri-
cidal
titre ELISA
n X1 L1 X2 L2 FCA Alum FCA Alum
2 ORF46.1 961 (His)6 8192 8192 21558 >109350
961c (His)6 8192 128 9020 76545

Hybrid Proteins—X1=230

In addition to those disclosed in references 1 & 2, four hybrid proteins with 230 at the N-terminus were constructed:

# n X1 L1 X2 L2
1 2 230 ORF46.1 (His)6
2 2 961 (His)6
3 2 961c (His)6
4 2 741MC58 (His)6

Hybrid Proteins—Xj=936

In addition to those disclosed in references 1 & 2, seven hybrid proteins with 936 at the N-terminus were constructed:

# n X1 L1 X2 L2
1 2 936 ORF46.1 (His)6
2 2 961 (His)6
3 2 741ET37 (His)6
4 2 741MC58 (His)6
5 2 74190/18311 (His)6
6 2 74195N477 (His)6
7 2 741 (His)6

These proteins were adjuvanted with either Freund's complete adjuvant (FCA) or 3 mg/ml alum and used to immunise mice. The resulting sera were tested against various Neisserial strains using the bactericidal assay. Titres using protein #2 were as follows:

Strain(serogroup) 2996(B) MC58(B) 394/98(B) 44/76(B) F6124(A)
Al hydroxide 16384 32768 1024 2048 <16
FCA 65536 65536 >2048 8192 2048 (36%)

Titres using protein #4 were as follows:

Strain(serogroup) 2996(B) MC58(B) 394/98(B) 44/76(B) F6124(A)
Al hydroxide 256 >262144 >2048 32768 8192
FCA 1024 >262144 >2048 >32768 >32768

Titres using protein #7 were as follows:

Strain(serogroup)
2996(B) MC58(B) 394/98(B) 44/76(B) F6124(A) BZ133(C)
Al hydroxide 256 130000 16000 32000 8000 16000

Results obtained after immunisation with proteins disclosed in refs. 1 & 2, tested against the homologous strain, were as follows:

Bactericidal
titre ELISA
n X1 L1 X2 L2 FCA Alum FCA Alum
2 936 741 (His)6 1024 256 1466 5715
936 >32768 >32768 >109350 >109350

Mixtures of Hybrid Proteins

Mice were immunised with of three proteins adjuvanted with aluminium hydroxide, either single or in a triple combination: (1) 287NZ-953; (2) 936-741; and (3) 961c. The mixture was able to induce high bactericidal titres against various strains:

2996(B) MC58(B) NGH38 394/98(B) H44/76(B) F6124(A) BZ133(C) C11(C)
(1) 32000 16000 130000 16000 32000 8000 16000 8000
(2) 256 131000 128 16000 32000 8000 16000 <4
(3) 32000 8000 8000 32000
mix 32000 32000 65000 16000 260000 65000 >65000 8000
(X) 4000 4000 1000 1000 >4000 1000 4000 n.d.
‘—’ indicates that this strain contains no NadA gene
(X) was a combination of protein 287 with outer membrane vesicles, for comparison

Looking at individual mice, the mixture induced high and consistent bactericidal titres:

#
1 2 3 4 5 6 7 8 9 10
2996 32768 16384 65536 32768 32768 65536 65536 32768 65536 8192
MC58 65536 32768 65536 65536 65536 8192 65536 32768 32768 65536
394/98 65536 4096 16384 4096 8192 4096 32768 16384 8192 16384

Tandem Proteins

Hybrid proteins of the invention can be represented by formula NH2—[—X-L-]n-COOH. Where all n instances of —X— are the same basic protein (either identical, or the same protein from different strains or species), the protein is referred to as a ‘tandem’ protein.

Twelve specific tandem proteins are:

# n X1 L1 X2 L2
1 2 ΔG741MC58 741MC58 (His)6
2 2 ΔG2872996 (Gly)6 ΔG287394/98 (His)6
3 2 ΔG2872996 (Gly)6 ΔG2872996 (His)6
4 2 ΔG287394/98 (Gly)6 ΔG287394/98 (His)6
5 2 ΔG287394/98 (Gly)6 ΔG2872996 (His)6
6 2 ΔG2872996 (Gly)6 ΔG287394/98
7 2 ΔG2872996 (Gly)6 ΔG2872996
8 2 ΔG287394/98 (Gly)6 ΔG287394/98
9 2 ΔG287394/98 (Gly)6 ΔG2872996
10 2 ΔG741MC58 741394/98 (His)6
11 2 ΔG741MC58 74190/18311 (His)6
12 2 ΔG741MC58 74195N477 (His)6

Proteins #1 to #5 have all been expressed in soluble form in E. coli. Expression levels were between 0.24 and 0.50 mg protein per litre of culture. The tandem proteins were purified and mixed with aluminium phosphate as an adjuvant. Tandem proteins #2, #4 and #5 adsorbed readily to aluminium phosphate; adsorption was less complete for tandem proteins #1 and #3.

Allelic Variants—741

Twenty-two polymorphic sequences of 741 were found (SEQ IDs 1 to 22). These and the MC58 sequence are aligned in FIG. 1.

Allelic Variants—NMB1343

Using PCR on 42 strains of meningococcus of various serogroups, the gene encoding NMB1343 protein was found in 24/42 and was absent in 18/42 strains (Table 1). The NMB gene was sequenced for 10 of the NMB1343+ strains (Table 1, column 3). The nucleic acid sequence (and thus amino acid sequence SEQ ID 23; GenBank AAF41718) was identical in all 10 strains.

NMB1343 was also detected in two strains of N. gonorrhoeae (F62 and SN4). The amino acid sequence from gonococcus is SEQ ID 24. An alignment with the meningococcal sequence is:

An alignment of the corresponding nucleotide sequences is shown in FIG. 2. This shows that the gonococcal sequence has a 4 mer insertion in the 5′ region of the NMB1343 gene which causes a frameshift and consequent loss of the 5′ methionine residue.

Domain Deletion—961

961 is not present in the N. meningitidis serogroup A genome sequence [81], even though the surrounding regions are conserved (>90%) between serogroups A and B. References 11 and 12 disclose polymorphic forms of 961. The gene was found to be present in 91% of serogroup B strains belonging to hypervirulent lineages ET-5, ET-37 and cluster A4, but was absent in all strains of lineage 3 tested. Most of the serogroup C strains tested were positive even if not belonging to hypervirulent lineages. The same was true for the serogroup B strains with serotype 2a and 2b. For serogroup A, one strain belonging to subgroup III was positive whereas the other two strains belonging to subgroup IV-1 were negative. 961 was absent in N. gonorrhoeae and in commensal species N. lactamica and N. cinerea.

FIGS. 4 and 5 show domains in protein 961.

When the anchor region (domain 9) of protein 961 is deleted (‘961cL’) and expressed in E. coli, the protein is exported in the periplasm and secreted in the supernatant of the culture.

To investigate this further, deletion mutants in the C-terminal region of 961 were constructed (961cL-Δaro, 961cLΔcc, 961aL, 961aL-Δ1, 961aL-Δ2, 961aL-Δ3) on the basis of structural features (deletions of aromatic residues in the cases of 961cΔaro mutant, and of coiled-coil regions for the others). These were analysed for expression and secretion into the periplasm and the supernatant of the culture. In all of these deletion mutants, the protein is produced in large amount, is present in periplasmic fraction, and is released in the supernatant of the culture.

ΔG287—Cross-Strain Bactericidal Activity

287 was cloned for five different N. meningitidis serogroup B strains and was manipulated to delete the N-terminus up to the end of the poly-glycine region and to introduce a C-terminal his-tag. This gave five ΔG287 proteins. These were adjuvanted with FCA and used to raise immune sera in mice, which were then tested for bactericidal activity against all five serogroup B strains and also against serogroup A and C strains. Bactericidal titres were as follows:

Protein Sera tested for bactericidal activity against strain*
strain 2996 BZ232 MC58 1000 394/98 F6124 BZ133
2996 16000 128 4096 4096 1024 8000 16000
BZ232 >8000 256 2048 8000 2048 16000 8000
MC58 >8000 64 >8000 8000 2048 8000 8000
1000 >8000 64 4096 8000 1024 16000 16000
394/98 >16000 128 16000 >2048 >16000
*titres against homologous strain shown in bold

Refolding

To improve the levels of soluble protein for some hybrid proteins, alternative refolding protocols to those disclosed in reference 2 were adopted.

Inclusion Bodies (IBs) Were Isolated as Follows:

    • 1. Homogenize cells (5 g wet weight) in 25 ml 0.1 M Tris-HCl pH 7, 1 mM EDTA, at 4° C. using an ultraturrax (10 000 rpm)
    • 2. Add 1.5 mg lysozyme per gram cells, mix shortly with an ultraturrax, and incubate at 4° C. for 30 min.
    • 3. Use sonication or high-pressure homogenization (French press) to disrupt the cells.
    • 4. To digest DNA, add MgCl2 to a final concentration of 3 mM and DNase to a final concentration of 10 μg/ml, and incubate for 30 min at 25° C.
    • 5. Add 0.5 vol. 60 mM EDTA, 6% Triton X-100, 1,5M NaCl pH7, to the solution, and incubate for 30 min at 4° C.
    • 6. Spin down inclusion bodies by centrifugation at 31000 g (20 000 rpm) for 10 min, 4° C.
    • 7. Resuspend pellet in 40 ml 0.1 M tris-HCl pH 7, 20 mM EDTA, using an ultraturrax
    • 8. Repeat centrifugation step 6.
    • 9. The inclusion body pellet may be used, or stored frozen at −20° C.

Hybrid proteins were expressed in E. coli as follows:

Culture Flask Inclusion
volume volume Temp Final body yield
Protein (liters) (liters) (° C.) OD600 (w/w)
ORF46.1-961-His 1 2 37 1.51 33.2%
ORF46.1-961c-His 1 2 37 1.6 28.3%
961c-ORF46.1His 1 2 37 1.18 23.5%
orf46.1-741 His 5 5 37 12.42 35.2

The pellets were solubilised, refolded, ultrafiltered, dialysed, and protein was then purified:

ORF46.1-961-His IBs were solubilised as follows: IB proteins were resuspended in 4 ml of 6M guanidine HCl, 1 mM EDTA pH 8.5 buffer, to a final protein concentration of 1 mg/ml. To refold the protein, 2 ml of solubilised protein was diluted in 400 ml of refolding buffer (0.1M Tris HCl, 1M L-arginine, 2 mM EDTA pH 8.2) and incubated for 1 hour at 15° C., resulting in a protein concentration of 5 μg/ml. Subsequently, another 2 ml of the solubilised protein was added and incubated for an additional hour at the same temperature resulting in a final protein concentration of 10 μg/ml. The material was ultrafiltered using a 300 ml Amicon ultrafiltration cell (8400), applying a 3 bar pressure on an Amicon membrane with a 30 kDa cut-off (YM30) resulting in 130 ml final volume. The ultrafiltered material was dialysed using a regenerated cellulose tubular membrane with a 12-14 kDa cutoff (Cellusep—Step bio) for 24 hours against 10 L of 0.1M Tris HCl pH 8.2 buffer. A second dialysis of 24 h against 10 L of 300 mM NaCl, 50 mM sodium phosphate pH 8.0 buffer was performed. The dialysed material was centrifuged at 22000 rpm for 45 minutes at 4° C. in a Beckman centrifuge rotor JA25.5 The supernatant isolated after centrifugation was used for His-tag purification.

orf 46.1-961c-His IBs were solubilised as follows: IB proteins were resuspended in 4 ml of 6M guanidine HCl, 1 mM EDTA pH 8.5 buffer, to a final protein concentration of 1 mg/ml. To refold the protein, 2 ml of the solubilised protein was diluted in 400 ml refolding buffer (0.5M Tris HCl, 1M L-arginine, 2 mM EDTA pH 8.2) and incubated for 1 h at 15° C., resulting in a protein concentration of 5 μg/ml. Subsequently another 2 ml of the solubilised protein was added and incubated for an additional hour at the same temperature resulting in a final protein concentration of 10 μg/ml. The material was ultrafiltered using a 300 ml Amicon ultrafiltration cell (8400), applying a 3 bar pressure on an Amicon membrane with a 30 kDa cut-off (YM30) resulting in 150 ml final volume. The ultrafiltered material was dialysed using a regenerated cellulose tubular membrane with a 12-14 kDa cutoff (Cellusep—Step bio) for 24 h against 10 L of 0.1M Tris HCl pH 8.2 buffer. A second dialysis of 24 h against 10 L of 300 mM NaCl, 50 mM sodium phosphate pH 8.0 buffer was performed. The dialysed material was centrifuged at 22000 rpm for 45 minutes at 4° C. in a Beckman centrifuge rotor JA25.5. The supernatant isolated after centrifugation was used for His-tag purification.

961c-orf46.1-His IBs were solubilised as follows: IB proteins were resuspended in 4 ml of 6M guanidine HCl, 1 mM EDTA pH 8.5 buffer, to a final protein concentration of 1 mg/ml. To refold the protein, 2 ml of the solubilised protein was diluted in 400 ml refolding buffer (0.1M Tris HCl, 0.5 M L-arginine,2 mM EDTA pH 8.2) and incubated for 1 h at 15° C., resulting in a protein concentration of 5 μg/ml. Subsequently another 2 ml of the solubilized protein was added and incubated for an additional hour at the same temperature resulting in a final protein concentration of 10 μg/ml. The material was ultrafiltered using a 300 ml Amicon ultrafiltration cell (8400), applying a 3 bar pressure on an Amicon membrane with a 30 kDa cut-off (YM30) resulting in 150 ml final volume. The ultrafiltered material was dialysed using a regenerated cellulose tubular membrane with a 12-14 kDa cutoff (Cellusep—Step bio) for 24 h against 10 L of 0.1 M Tris HCl pH 8.2 buffer. A second dialysis of 24 h against 10 L of 300 mM NaCl, 50 mM sodium phosphate pH 8.0 buffer was performed. The dialysed material was centrifuged at 22000 rpm for 45 minutes at 4° C. in a Beckman centrifuge rotor JA25.5. The supernatant isolated after centrifugation was used for His-tag purification.

orf46.1-741-His IBs were solubilised as follows: IB proteins were resuspended in 4 ml of 6M guanidine HCl, 1 mM EDTA pH 8.5 buffer, to a final protein concentration of 10 mg/ml. To refold, 2 ml of the solubilised protein was diluted in 400 ml of the refolding buffer (0.5M Tris HCl, 0.7 M L-arginine, 2 mM EDTA pH 7.2) and incubated for 1 h at 15° C., resulting in a protein concentration of 50 μg/ml. Subsequently another 2 ml of the solubilised protein was added and incubated for an additional hour at the same temperature resulting in a final protein concentration of 100 μg/ml. The material was ultrafiltered using a 300 ml Amicon ultrafiltration cell (8400), applying a 3 bar pressure on an Amicon membrane with a 30 kDa cut-off (YM30) resulting in 120 ml final volume. The ultrafiltered material was dialysed using a regenerated cellulose tubular membrane with a 12-14 kDa cutoff (Cellusep—Step bio) for 24 h against 10 L of 0.1M Tris HCl pH 8.2 buffer. A second dialysis of 24 h against 10 L of 300 mM NaCl, 50 mM sodium phosphate pH 8.0 buffer was performed. The dialysed material was centrifuged at 22000 rpm for 45 minutes at 4° C. in a Beckman centrifuge rotor JA25.5 The supernatant isolated after centrifugation was used for His-tag purification.

Compared with proteins purified as described in ref. 2, bactericidal assay titres were as follows:

Reference 2 Refolded
Alumin- Alumin- Alumin-
ium ium ium
hydrox- hydrox- phos-
Protein CFA ide ide MF59 phate
ORF46.1-961-His 8192 8192 32768
ORF46.1-961c-His 8192 128 <64 8192
961c-ORF46.1His 32768 1024 16384
orf46.1-741 His <4 16 <4  256

Similar procedures were used for ORF46.1 to purify the protein from IBs when expressed with no His-tag (‘ORF46.1K’):

Culture Flask Inclusion
volume volume Temp Final body yield
Protein (liters) (liters) (° C.) OD600 (w/w)
orf46.1K 5 5 37 13.7 29.4

IB proteins were resuspended in 4 ml of 6M guanidine HCl, 1 mM EDTA pH 8.5 buffer, to a final protein concentration of 10 mg/ml. To refold, 2 ml of the solubilised protein was diluted in 400 ml of the refolding buffer (0.5M Tris HCl, 0.7 M L-arginine,2 mM EDTA pH 7.2) and incubated for 1 hours at 15° C., resulting in a protein concentration of 50μg/ml. Subsequently another 2 ml of the solubilised protein was added and incubated for an additional hour at the same temperature resulting in a final protein concentration of 100 m/ml. The material was ultrafiltered using a 300 ml Amicon ultrafiltration cell (8400), applying a 3 bar pressure on an Amicon membrane with a 30 kDa cut-off (YM30) resulting in 120 ml final volume. The ultrafiltered material was dialysed using a regenerated cellulose tubular membrane with a 12-14 kDa cutoff (Cellusep—Step bio) for 12 h against 10 L of 50 mM sodium phosphate, 2 mM EDTA, pH 7.2 buffer. A second dialysis of 24 h against 10 L of the same buffer was performed. The dialysed material was centrifuged at 22000 rpm for 45 minutes at 4° C. in a Beckman centrifuge rotor JA25.5. The supernatant isolated after centrifugation was used for cationic exchange chromatography. The purification was done on a AKTA explorer chromatography system (Amersham-Pharmacia Biotech) using a 5 ml HiTrap SP sepharose HP column (Amersham-Pharmacia Biotech). The flow rate applied was of 1.5 ml per minute. The column was washed with 35 ml of 50 mM sodium phosphate buffer pH 7.2. A linear gradient (0-1 M NaCl) was performed using a 50 mM sodium phosphate buffer pH 7.2. The protein eluted in two peaks at 92 mM and 380 mM NaCl. The fractions constituting each peak were pooled and respectively named pool 1 and pool 2.

Compared with proteins purified as described in ref. 2, bactericidal assay titres when adjuvanted with aluminium hydroxide were improved from <4 to 1024. The titre using aluminium phosphate adjuvant with the refolded protein was 2048. ELISA titres were as follows:

Elisa SBA
Protein Aluminium adjuvant (M7) (2996)
Orf46.1k (pool 1) Hydroxide 3.3 mg/ml 1212 512
Phosphate 0.6 mg/ml 154 1024
Orf46.1k (pool 2) Hydroxide 3.3 mg/ml 1085 1024
Phosphate 0.6 mg/ml 250 1024

It will be understood that the invention has been described by way of example only and modifications may be made whilst remaining within the scope and spirit of the invention.

TABLE 1
Strain 1343 Sequence Strain classification
72/00 + ET5 B:15:P1.7, 13, 13a
30/00 + ET5 B:15:P1.7, 16
39/99 + ET5 C:15:P1.7, 16
95330 + ET5 B:4:P1.15
M4102 + ET5 nd
MC58(21) + + ET5 B:15:P1.7, 16b
BZ169(7) + + ET5 B:NT:P1.16
BZ83(19) + ET5 B:15:—.—
CU385 + + ET5 B:4:P1.15
220173I + ET5 NG:4:P1.15
64/96 + + ET5 NG:15:P1.7, 16 (carrier)
220173I + ET5 B:4:P1.15 (carrier)
ISS1071 + nd B:15:P1.7, 16 (ET5?)
BZ198(2) + + lin.3 B:8:P1.1
980-2543 + + lin.3 B:NT:P1.4
16060 + + other B:4:P1.14 (carrier)
394-98 + nd B:4:P1.4 (lin 3?)
ISS1106 + nd B:4:P1.4 (lin.3?)
BZ133(10) + + sub I B:NT:—.—
S3446 + + nd B:14:P1.23, 14
ISS1001 + + nd B:14:P1.13
241175I + other NG:21:P1.16 (carrier)
171274I + other NG:15:— (carrier)
66/96 + other B:17:P1.15 (carrier)
961-5945 A4
96217 A4
312294 A4
90/18311(24) ET37
93/4286(25) ET37
M986 ET37
1000(5) other
NGE28(13) other carrier
NGH38(14) other carrier
BZ232(18) other
F6124(23) sub III A:—.—
C11 C:—
NMB nd
8047 nd
ISS759 nd C:2b:P1.2
ISS1113 nd C:2:P1.5
65/96 nd 4:P1.14
2996(96) nd B:2b:P1.5, 2

REFERENCES (THE CONTENTS OF WHICH ARE HEREBY INCORPORATED BY REFERENCE)

  • 1—International patent application WO01/64920.
  • 2—International patent application WO01/64922.
  • 3—International patent application WO99/24578.
  • 4—International patent application WO99/36544.
  • 5—International patent application WO99/57280.
  • 6—International patent application WO00/22430.
  • 7—Tettelin et al. (2000) Science 287:1809-1815.
  • 8—International patent application WO00/66741.
  • 9—International patent application WO00/71574.
  • 10—International patent application WO01/04316
  • 11—International patent application PCT/IB02/03396.
  • 12—Comanducci et al. (2002) J Exp Med 195:1445-1454.
  • 13—Vaccine Design: subunit & adjuvant approach (1995) Powell & Newman (ISBN: 030644867X).
  • 14—International patent application WO01/52885.
  • 15—Bjune et al. (1991) Lancet 338(8775):1093-1096.
  • 16—Fukasawa et al. (1999) Vaccine 17:2951-2958.
  • 17—Rosenqvist et al. (1998) Dev. Biol. Stand. 92:323-333.
  • 18—Costantino et al. (1992) Vaccine 10:691-698.
  • 19—Costantino et al. (1999) Vaccine 17:1251-1263.
  • 20—International patent application PCT/IB02/03191.
  • 21—Watson (2000) Pediatr Infect Dis J 19:331-332.
  • 22—Rubin (2000) Pediatr Clin North Am 47:269-285, v.
  • 23—Jedrzejas (2001) Microbiol Mol Biol Rev 65:187-207.
  • 24—International patent application WO93/18150.
  • 25—International patent application WO99/53310.
  • 26—International patent application WO98/04702.
  • 27—Bell (2000) Pediatr Infect Dis J 19:1187-1188.
  • 28—Iwarson (1995) APMIS 103:321-326.
  • 29—Gerlich et al. (1990) Vaccine 8 Suppl:S63-68 & 79-80.
  • 30—Hsu et al. (1999) Clin Liver Dis 3:901-915.
  • 31—Gustafsson et al. (1996) N. Engl. J. Med. 334:349-355.
  • 32—Rappuoli et al. (1991) TIBTECH 9:232-238.
  • 33—Vaccines (1988) eds. Plotkin & Mortimer. ISBN 0-7216-1946-0.
  • 34—Del Guidice et al. (1998) Molecular Aspects of Medicine 19:1-70.
  • 35—International patent application WO02/02606.
  • 36—Kalman et al. (1999) Nature Genetics 21:385-389.
  • 37—Read et al. (2000) Nucleic Acids Res 28:1397-406.
  • 38—Shirai et al. (2000) J. Infect. Dis. 181(Suppl 3):S524-S527.
  • 39—International patent application WO99/27105.
  • 40—International patent application WO00/27994.
  • 41—International patent application WO00/37494.
  • 42—International patent application WO99/28475.
  • 43—Ross et al. (2001) Vaccine 19:4135-4142.
  • 44—Sutter et al. (2000) Pediatr Clin North Am 47:287-308.
  • 45—Zimmerman & Spann (1999) Am Fam Physician 59:113-118, 125-126.

46—Dreesen (1997) Vaccine 15 Suppl:S2-6.

47—MMWR Morb Mortal Wkly Rep 1998 Jan. 16; 47(1):12, 19.

  • 48—McMichael (2000) Vaccine 19 Suppl 1:S101-107.
  • 49—Schuchat (1999) Lancet 353(9146):51-6.
  • 50—WO02/34771.
  • 51—Dale (1999) Infect Dis Clin North Am 13:227-43, viii.
  • 52—Ferretti et al. (2001) PNAS USA 98: 4658-4663.
  • 53—Kuroda et al. (2001) Lancet 357(9264):1225-1240; see also pages 1218-1219.
  • 54—Ramsay et al. (2001) Lancet 357(9251):195-196.
  • 55—Lindberg (1999) Vaccine 17 Suppl 2:S28-36.
  • 56—Buttery & Moxon (2000) J R Coll Physicians Lond 34:163-168.
  • 57—Ahmad & Chapnick (1999) Infect Dis Clin North Am 13:113-133, vii.
  • 58—Goldblatt (1998) J. Med. Microbiol. 47:563-567.

59—European patent 0 477 508.

  • 60—U.S. Pat. No. 5,306,492.
  • 61—International patent application WO98/42721.
  • 62—Conjugate Vaccines (eds. Cruse et al.) ISBN 3805549326, particularly vol. 10:48-114.
  • 63—Hermanson (1996) Bioconjugate Techniques ISBN: 0123423368 or 012342335X.
  • 64—European patent application 0372501.
  • 65—European patent application 0378881.
  • 66—European patent application 0427347.
  • 67—International patent application WO93/17712.
  • 68—International patent application WO98/58668.
  • 69—European patent application 0471177.
  • 70—International patent application WO00/56360.
  • 71—International patent application WO00/61761.
  • 72—Robinson & Torres (1997) Seminars in Immunology 9:271-283.
  • 73—Donnelly et al. (1997) Annu Rev Immunol 15:617-648.
  • 74—Scott-Taylor & Dalgleish (2000) Expert Opin Investig Drugs 9:471-480.
  • 75—Apostolopoulos & Plebanski (2000) Curr Opin Mol Ther 2:441-447.
  • 76—Ilan (1999) Curr Opin Mol Ther 1:116-120.
  • 77—Dubensky et al. (2000) Mol Med 6:723-732.
  • 78—Robinson & Pertmer (2000) Adv Virus Res 55:1-74.
  • 79—Donnelly et al. (2000) Am J Respir Crit Care Med 162(4 Pt 2):S190-193.
  • 80—Davis (1999) Mt. Sinai J. Med. 66:84-90.
  • 81—Parkhill et al. (2000) Nature 404:502-506.

SEQUENCE LISTING
741 from strain 1000
SEQ ID 1
MTRSKPVNRTAFCCLSLTAALILTACSSGGGGVAADIGAGLADAL
TTPLDHKDKSLQSLTLDQSVRKNEKLKLAAQGAEKTYGNGDSLNT
GKLKNDKVSRFDFIRQIEVDGQTITLASGEFQIYKQNHSAVVALQ
IEKINNPDKIDSLINQRSFLVSGLGGEHTAFNQLPDGKAEYHGKA
FSSDDPNGRLHYSIDFTKKQGYGRIEHLKTPEQNVELASAELKAD
EKSHAVILGDTRYGGEEKGTYHLALFGDRAQEIAGSATVKIREKV
HEIGIAGKQ
741 from strain 2201731
(premature stop codon, though reliable sequence)
SEQ ID 2
MTRSKPVNRTAFCCLSLTTALILTACSSGGGGVAADIGAGLADAL
TAPLDHKDKGLQSLTLDQSVRKNEKLKLAAQGAEKTYGNGDSLNT
GKLKNDKVSRFDFIRQIEVDGQLITLESGEFQVYKQSHSALTAFQ
TEQIQDSEHSGKMVAKRQFRIGDIAGEHTSFDKLPEGGRATYRGT
AFGSDDAGGKLTYTIDFAAKQGNGKIEHLKSPELNVDLAAADIKP
DGKRHAVISGSVLYNQAEKGSYSLGIFGGKA
741 from strain 90/18311 (incomplete) 
SEQ ID 3
GLADALTAPLDHKDKSLQSLTLDQSVRKNEKLKLAAQGAEKTYGN
GDSLNTGKLKNDKVSRFDFIRQIEVDGQLITLESGEFQIYKQDHS
AVVALQIEKINNPDKIDSLINQRSFLVSGLGGEHTAFNQLPSGKA
EYHGKAFSSDDPNGRLHYSIDFTKKQGYGRIEHLKTPEQNVELAS
AELKADEKSHAVILGDTRYGGEEKGTYHLALFGDRAQEIAGSATV
KIREKVHET
741 from strain L93/4286 (incomplete)
SEQ ID 4
VAADIGAGLADALTAPLDHKDKGLQSLMLDQSVRKNEKLKLAAQG
AEKTYGNGDSLNTGKLKNDKVSRFDFIRQIEVDGQTITLASGEFQ
IYKQNHSAVVALQIEKINNPDKIDSLINQRSFLVSGLGGEHTAFN
QLPDGKAEYHGKAFSSDDPNGRLHYSIDFTKKQGYGRIEHLKTPE
QNVELASAELKADEKSHAVILGDTRYGGEEKGTYHLALFGDRAQE
IAGSATVKIREKVHEIGIAGKQ
741 from strain 2996
SEQ ID 5
MTRSKPVNRTAFCCLSLTAALILTACSSGGGGVAADIGAGLADAL
TAPLDHKDKSLQSLTLDQSVRKNEKLKLAAQGAEKTYGNGDSLNT
GKLKNDKVSRFDFIRQIEVDGQLITLESGEFQIYKQDHSAVVALQ
IEKINNPDKIDSLINQRSFLVSGLGGEHTAFNQLPDGKAEYHGKA
FSSDDAGGKLTYTIDFAAKQGHGKIEHLKTPEQNVELAAAELKAD
EKSHAVILGDTRYGSEEKGTYHLALFGDRAQEIAGSATVKIGEKV
HEIGIAGKQ
741 from strain 30/00
SEQ ID 6
KDKGLQSLTLDQSVRKNEKLKLAAQGAEKTYGNGDSLNTGKLKND
KVSRFDFIRQIEVDGQLITLESGEFQVYKQSHSALTAFQTEQIQD
SEHSGKMVAKRQFRIGDIAGEHTSFDKLPEGGRATYRGTAFGSDD
AGGKLTYTIDFAAKQGNGKIEHLKSPELNVDLAAADIKPDGKRHA
VISGSVLYNQAEKGSYSLGIFGGKAQEVAGSAEVKTVNGIRHIGL
AAKQ
741 from strain 312294
SEQ ID 7
MTRSKPVNRTAFCCLSLTAALILTACSSGGGGVAADIGAGLADAL
TAPLDHKDKSLQSLTLDQSVRKNEKLKLAAQGAEKTYGNGDSLNT
GKLKNDKVSRFDFIRQIEVDGQLITLESGEFQIYKQDHSAVVALQ
IEKINNPDKIDSLINQRSFLVSGLGGEHTAFNQLPDGKAEYHGKA
FSSDDAGGKLTYTIDFAAKQGHGKIEHLKTPEQNVELAAAELKAD
EKSHAVILGDTRYGSEEKGTYHLALFGDRAQEIAGSATVKIGEKV
HEIGIAGKQ
741 from strain 39/99 (incomplete)
SEQ ID 8
DKGLQSLTLDQSVRKNEKLKLAAQGAEKTYGNGDSLNTGKLKNDK
VSRFDFIRQIEVDGQLITLESGEFQVYKQSHSALTAFQTEQIQDS
EHSGKMVAKRQFRIGDIAGEHTSFDKLPEGGRATYRGTAFGSDDA
GGKLTYTIDFAAKQGNGKIEHLKSPELNVDLAAADIKPDGKRHAV
ISGSVLYNQAEKGSYSLGIFGGKAQEVAGSAEVKTVNGIRHIGLA
AKQ
741 from strain 5/99
SEQ ID 9
MTRSKPVNRTAFCCLSLTAALILTACSSGGGGVAADIGAGLADAL
TAPLDHKDKGLQSLTLDQSVRKNEKLKLAAQGAEKTYGNGDSLNT
GKLKNDKVSRFDFIRQIEVDGQLITLESGEFQIYKQDHSAVVALQ
IEKINNPDKIDSLINQRSFLVSGLGGEHTAFNQLPSGKAEYHGKA
FSSDDPNGRLHYSIDFTKKQGYGRIEHLKTPEQNVELASAELKAD
EKSHAVILGDTRYGGEEKGTYHLALFGDRAQEIAGSATVKIREKV
HEIGIAGKQ
741 from strain 67/00
SEQ ID 10
MTRSKPVNRTAFCCFSLTAALILTACSSGGGGVAADIGAGLADAL
TAPLDHKDKSLQSLTLDQSVRKNEKLKLAAQGAEKTYGNGDSLNT
GKLKNDKVSRFDFIRQIEVDGQLITLESGEFQVYKQSHSALTALQ
TEQEQDPEHSGKMVAKRRFKIGDIAGEHTSFDKLPKDVMATYRGT
AFGSDDAGGKLTYTIDFAAKQGHGKIEHLKSPELNVELATAYIKP
DEKHHAVISGSVLYNQDEKGSYSLGIFGGQAQEVAGSAEVETANG
IHHIGLAAKQ
741 from strain BZ169
SEQ ID 11
LQSLTLDQSVRKNEKLKLAAQGAEKTYGNGDSLNTGKLKNDKVSR
FDFIRQIEVDGQLITLESGEFQVYKQSHSALTAFQTEQIQDSEHS
GKMVAKRQFRIGDIAGEHTSFDKLPEGGRATYRGTAFGSDDAGGK
LTYTIDFAAKQGNGKIEHLKSPELNVDLAAADIKPDGKRHAVISG
SVLYNQAEKGSYSLGIFGGKAQEVAGSAEVKTVNGIRHIGLAAKQ
741 from strain 72/00
SEQ ID 12
LQSLTLDQSVRKNEKLKLAAQGAEKTYGNGDSLNTGKLKNDKVSR
FDFIRQIEVDGQLITLESGEFQVYKQSHSALTAFQTEQIQDSEHS
GKMVAKRQFRIGDIAGEHTSFDKLPEGGRATYRGTAFGSDDAGGK
LTYTIDFAAKQGNGKIEHLKSPELNVDLAAADIKPDGKRHAVISG
SVLYNQAEKGSYSLGIFGGKAQEVAGSAEVKTVNGIRHIGLAAKQ
741 from strain 93/114
SEQ ID 13
MTRSKPVNRTAFCCFSLTAALILTACSSGGGGVAADIGAGLADAL
TAPLDHKDKSLQSLTLDQSVRKNEKLKLAAQGAEKTYGNGDSLNT
GKLKNDKVSRFDFIRQIEVDGQLITLESGEFQVYKQSHSALTALQ
TEQEQDPEHSGKMVAKRRFKIGDIAGEHTSFDKLPKDVMATYRGT
AFGSDDAGGKLTYTIDFAAKQGHGKIEHLKSPELNVELATAYIKP
DEKHHAVISGSVLYNQDEKGSYSLGIFGGQAQEVAGSAEVETANG
IHHIGLAAKQ
741 from strain 95N477
SEQ ID 14
MTRSKPVNRTAFCCLSLTAALILTACSSGGGGVAADIGAGLADAL
TAPLDHKDKSLQSLTLDQSVRKNEKLKLAAQGAEKTYGNGDSLNT
GKLKNDKVSRFDFIRQIEVDGQLITLESGEFQIYKQDHSAVVALQ
IEKINNPDKIDSLINQRSFLVSGLGGEHTAFNQLPSGKAEYHGKA
FSSDDPNGRLHYSIDFTKKQGYGRIEHLKTPEQNVELASAELKAD
EKSHAVILGDTRYGGEEKGTYHLALFGDRAQEIAGSATVKIREKV
HEIGIAGKQ
741 from strain 96217
SEQ ID 15
MTRSKPVNRTAFCCLSLTAALILTACSSGGGGVAADIGAGLADAL
TAPLDHKDKSLQSLTLDQSVRKNEKLKLAAQGAEKTYGNGDSLNT
GKLKNDKVSRFDFIRQIEVDGQLITLESGEFQIYKQDHSAVVALQ
IEKINNPDKIDSLINQRSFLVSGLGGEHTAFNQLPDGKAEYHGKA
FSSDDAGGKLTYTIDFAAKQGHGKIEHLKTPEQNVELAAAELKAD
EKSHAVILGDTRYGSEEKGTYHLALFGDRAQEIAGSATVKIGEKV
HEIGIAGKQ
741 from strain BZ133
SEQ ID 16
MTRSKPVNRTAFCCLSLTAALILTACSSGGGGVAADIGAGLADAL
TAPLDHKDKSLQSLTLDQSVRKNEKLKLAAQGAEKTYGNGDSLNT
GKLKNDKVSRFDFIRQIEVDGQLITLESGEFQVYKQSHSALTALQ
TEQVQDSEHSGKMVAKRQFRIGDIAGEHTSFDKLPEGGRATYRGT
AFGSDDASGKLTYTIDFAAKQGHGKIEHLKSPELNVDLAASDIKP
DKKRHAVISGSVLYNQAEKGSYSLGIFGGQAQEVAGSAEVETANG
IRHIGLAAKQ
741 from strain BZ232
SEQ ID 17
MTRSKPVNRTAFCCLSLTAALILTACSSGGGGVAADIGAGLADAL
TAPLDHKDKSLQSLTLDQSVRKNEKLKLAAQGAEKTYGNGDSLNT
GKLKNDKVSRFDFIRQIEVDGQTITLASGEFQIYKQNHSAVVALQ
IEKINNPDKIDSLINQRSFLVSGLGGEHTAFNQLPDGKAEYHGKA
FSSDDPNGRLHYSIDFTKKQGYGRIEHLKTPEQNVELASAELKAD
EKSHAVILGDTRYGGEEKGTYHLALFGDRAQEIAGSATVKIREKV
HEIGIAGKQ
741 from strain C11
SEQ ID 18
MTRSKPVNRTAFCCLSLTAALILTACSSGGGGVAADIGAGLADAL
TAPLDHKDKSLQSLTLDQSVRKNEKLKLAAQGAEKTYGNGDSLNT
GKLKNDKVSRFDFIRQIEVDGQLITLESGEFQIYKQDHSAVVALQ
IEKINNPDKIDSLINQRSFLVSGLGGEHTAFNQLPSGKAEYHGKA
FSSDDPNGRLHYSIDFTKKQGYGRIEHLKTPEQNVELASAELKAD
EKSHAVILGDTRYGGEEKGTYHLALFGDRAQEIAGSATVKIREKV
HEIGIAGKQ
741 from strain M1090
SEQ ID 19
MTRSKPVNRTAFCCLSLTAALILTACSSGGGGVAADIGAGLADAL
TAPLDHKDKSLQSLTLDQSVRKNEKLKLAAQGAEKTYGNGDSLNT
GKLKNDKVSRFDFIRQIEVDGQLITLESGEFQIYKQDHSAVVALQ
IEKINNPDKIDSLINQRSFLVSGLGGEHTAFNQLPSGKAEYHGKA
FSSDDAGGKLTYTIDFAAKQGHGKIEHLKTPEQNVELASAELKAD
EKSHAVILGDTRYGGEEKGTYHLALFGDRAQEIAGSATVKIREKV
HEIGIAGKQ
741 from strain M1096
SEQ ID 20
MTRSKPVNRTAFCCLSLTAALILTACSSGGGGVAADIGAGLADAL
TTPLDHKDKSLQSLTLDQSVRKNEKLKLAAQGAEKTYGNGDSLNT
GKLKNDKVSRFDFIRQIEVDGQTITLASGEFQIYKQNHSAVVALQ
IEKINNPDKIDSLINQRSFLVSGLGGEHTAFNQLPDGKAEYHGKA
FSSDDPNGRLHYSIDFTKKQGYGRIEHLKTPEQNVELASAELKAD
EKSHAVILGDTRYGGEEKGTYHLALFGDRAQEIAGSATVKIREKV
HEIGIAGKQ
741 from strain M198/172
SEQ ID 21
MTRSKPVNRTAFCCLSLTAALILTACSSGGGGVAADIGAGLADAL
TAPLDHKDKSLQSLTLDQSVRKNEKLKLAAQGAEKTYGNGDSLNT
GKLKNDKVSRFDFIRQIEVDGQLITLESGEFQVYKQSHSALTALQ
TEQVQDSEHSGKMVAKRQFRIGDIAGEHTSFDKLPEGGRATYRGT
AFGSDDASGKLTYTIDFAAKQGHGKIEHLKSPELNVDLAASDIKP
DKKRHAVISGSVLYNQAEKGSYSLGIFGGQAQEVAGSAEVETANG
IRHIGLAAKQ
741 from strain NGH38
SEQ ID 22
MTRSKPVNRTAFCCLSLTAALILTACSSGGGGVAADIGAGLADAL
TAPLDHKDKSLQSLTLDQSVRKNEKLKLAAQGAEKTYGNGDSLNT
GKLKNDKVSRFDFIRQIEVDGQTITLASGEFQIYKQNHSAVVALQ
IEKINNPDKIDSLINQRSFLVSGLGGEHTAFNQLPDGKAEYHGKA
FSSDDPNGRLHYSIDFTKKQGYGRIEHLKTPEQNVELASAELKAD
EKSHAVILGDTRYGGEEKGTYHLALFGDRAQEIAGSATVKIREKV
HEIGIAGKQ
NMB1343 from ten meningococcal strains
SEQ ID 23
MGNFLYRGISCQQDEQNNGQLKPKGNKAEVAIRYDGKFKYDGKAT
HGPSVKNAVYAHQIETGLYDGCYISTTTDKEIAKKFATSSGIENG
YIYVLNRDLFGQYSIFEYEVEHPENPNEKEVTIRAEDCGCIPEEV
IIAKELIEIN
NMB1343 from gonococcus
SEQ ID 24
INNLWEISYLYRGISCQQDEQNNGQLKPKGNKAEVAIRYDGKFKY
DGKATHGPSVKNAVYAHQIETDLYDGCYISTTTDKEIAKKFATSS
GIENGYIYVLNRDLFGQYSIFEYEVEHPENPDEKEVTIRAEDCGC
IPEEVIIAKELIEIN
NMB1343 nucleic acid sequence (gonococcus)
SEQ ID 25
TCCGCCGCATTACCTTATAAAATAAAACATCCCTCTCAAGCAGTC
TGATAATGTTTGGATTGCTTGAGATTGATGAGTGATGGTGTTAAA
TTCAAACTTTAAATTAATAACTTATGGGAAATTTCTTATTTATAT
AGAGGCATTAGTTGCCAACAAGATGAGCAAAATAATGGACAGTTA
AAACCTAAAGGTAATAAAGCTGAAGTTGCAATTCGTTATGATGGT
AAGTTTAAATATGATGGTAAAGCTACACATGGTCCAAGTGTGAAG
AATGCAGTTTACGCCCATCAAATTGAAACAGATCTATATGACGGA
TGTTATATATCTACGACAACAGACAAGGAAATTGCCAAGAAATTT
GCAACAAGCTCCGGCATCGAAAATGGCTATATATATGTTTTAAAT
AGAGATTTGTTTGGTCAATATTCTATTTTTGAATATGAGGTTGAA
CATCCAGAAAACCCAGATGAGAAGGAAGTAACAATCAGAGCTGAA
GATTGTGGCTGTATTCCTGAAGAAGTGATTATTGCTAAAGAGTTG
ATAGAAATTAACTAAGTTGAAAGGTCAATATAATGGCTTTAGTTG
AATTGAAAGTGCCCGACATTGGCGGACACGAAAATGTAGATATTA
TCGC
NMB1343 nucleic acid sequence (meningococcus)
SEQ ID 26
TCCGCCGCATTACCTTATAAAATAAAACATCCCTCTCAAGCAGTC
TGATAATGTTTGGATTGCTTGAGATTGATGAGTAATGGTGTTAAA
TTCAACCTTTAAATTAATAACTTATGGGAAATTTCTTATATAGAG
GCATTAGTTGCCAACAAGATGAGCAAAATAATGGACAGTTAAAAC
CTAAAGGTAATAAAGCTGAAGTTGCAATTCGTTATGATGGTAAGT
TTAAATATGATGGTAAAGCTACACATGGTCCAAGTGTGAAGAATG
CAGTTTACGCCCATCAAATTGAAACAGGTCTATATGACGGATGTT
ATATATCTACGACAACAGACAAGGAAATTGCCAAGAAATTTGCAA
CAAGTTCCGGCATCGAAAATGGCTATATATATGTTTTAAATAGGG
ATTTGTTTGGTCAATATTCTATTTTTGAATATGAGGTTGAACATC
CAGAAAACCCAAATGAGAAGGAAGTAACAATCAGAGCTGAAGATT
GTGGCTGTATTCCTGAAGAAGTGATTATTGCTAAAGAGTTGATAG
AAATTAACTAAGTTGAAAGGTCAATATAATGGCTTTAGTTGAATT
GAAAGTGCCCGACATTGGCGGACACGAAAATGTAGATATTATCGC
linker
SEQ ID 27
GSGGGG
preferred ΔG287NZ-953 hybrid
SEQ ID 28
MASPDVKSADTLSKPAAPVVAEKETEVKEDAPQAGSQGQGAPSTQ
GSQDMAAVSAENTGNGGAATTDKPKNEDEGPQNDMPQNSAESANQ
TGNNQPADSSDSAPASNPAPANGGSNFGRVDLANGVLIDGPSQNI
TLTHCKGDSCNGDNLLDEEAPSKSEFENLNESERIEKYKKDGKSD
KFTNLVATAVQANGTNKYVIIYKDKSASSSSARFRRSARSRRSLP
AEMPLIPVNQADTLIVDGEAVSLTGHSGNIFAPEGNYRYLTYGAE
KLPGGSYALRVQGEPAKGEMLAGTAVYNGEVLHFHTENGRPYPTR
GRFAAKVDFGSKSVDGIIDSGDDLHMGTQKFKAAIDGNGFKGTWT
ENGGGDVSGRFYGPAGEEVAGKYSYRPTDAEKGGFGVFAGKKEQD
GSGGGGATYKVDEYHANARFAIDHFNTSTNVGGFYGLTGSVEFDQ
AKRDGKIDITIPVANLQSGSQHFTDHLKSADIFDAAQYPDIRFVS
TKFNFNGKKLVSVDGNLTMHGKTAPVKLKAEKFNCYQSPMAKTEV
CGGDFSTTIDRTKWGVDYLVNVGMTKSVRIDIQIEAAKQ
ΔG287NZ-953 hybrid
SEQ ID 29
MASPDVKSADTLSKPAAPVVSEKETEAKEDAPQAGSQGQGAPSAQ
GGQDMAAVSEENTGNGGAAATDKPKNEDEGAQNDMPQNAADTDSL
TPNHTPASNMPAGNMENQAPDAGESEQPANQPDMANTADGMQGDD
PSAGGENAGNTAAQGTNQAENNQTAGSQNPASSTNPSATNSGGDF
GRTNVGNSVVIDGPSQNITLTHCKGDSCSGNNFLDEEVQLKSEFE
KLSDADKISNYKKDGKNDGKNDKFVGLVADSVQMKGINQYIIFYK
PKPTSFARFRRSARSRRSLPAEMPLIPVNQADTLIVDGEAVSLTG
HSGNIFAPEGNYRYLTYGAEKLPGGSYALRVQGEPSKGEMLAGTA
VYNGEVLHFHTENGRPSPSRGRFAAKVDFGSKSVDGIIDSGDGLH
MGTQKFKAAIDGNGFKGTWTENGGGDVSGKFYGPAGEEVAGKYSY
RPTDAEKGGFGVFAGKKEQDGSGGGGATYKVDEYHANARFAIDHF
NTSTNVGGFYGLTGSVEFDQAKRDGKIDITIPVANLQSGSQHFTD
HLKSADIFDAAQYPDIRFVSTKFNFNGKKLVSVDGNLTMHGKTAP
VKLKAEKFNCYQSPMAKTEVCGGDFSTTIDRTKWGVDYLVNVGMT
KSVRIDIQIEAAKQ
936-ΔG741 hybrid
SEQ ID 30
MKPKPHTVRTLIAAIFSLALSGCVSAVIGSAAVGAKSAVDRRTTG
AQTDDNVMALRIETTARSYLRQNNQTKGYTPQISVVGYNRHLLLL
GQVATEGEKQFVGQIARSEQAAEGVYNYITVASLPRTAGDIAGDT
WNTSKVRATLLGISPATQARVKIVTYGNVTYVMGILTPEEQAQIT
QKVSTTVGVQKVITLYQNYVQRGSGGGGVAADIGAGLADALTAPL
DHKDKGLQSLTLDQSVRKNEKLKLAAQGAEKTYGNGDSLNTGKLK
NDKVSRFDFIRQIEVDGQLITLESGEFQVYKQSHSALTAFQTEQI
QDSEHSGKMVAKRQFRIGDIAGEHTSFDKLPEGGRATYRGTAFGS
DDAGGKLTYTIDFAAKQGNGKIEHLKSPELNVDLAAADIKPDGKR
HAVISGSVLYNQAEKGSYSLGIFGGKAQEVAGSAEVKTVNGIRHI
GLAAKQ
961c
SEQ ID 31
MATNDDDVKKAATVAIAAAYNNGQEINGFKAGETIYDIDEDGTIT
KKDATAADVEADDFKGLGLKKVVTNLTKTVNENKQNVDAKVKAAE
SEIEKLTTKLADTDAALADTDAALDATTNALNKLGENITTFAEET
KTNIVKIDEKLEAVADTVDKHAEAFNDIADSLDETNTKADEAVKT
ANEAKQTAEETKQNVDAKVKAAETAAGKAEAAAGTANTAADKAEA
VAAKVTDIKADIATNKDNIAKKANSADVYTREESDSKFVRIDGLN
ATTEKLDTRLASAEKSIADHDTRLNGLDKTVSDLRKETRQGLAEQ
AALSGLFQPYNVG

Claims

1. (canceled)

2. A purified polypeptide comprising (i) an amino acid sequence having at least 80% identity to SEQ ID NO: 3, or (ii) at least 50 consecutive amino acids from SEQ ID NO: 3.

3. The purified polypeptide of claim 2, wherein the amino acid sequence has at least 90% identity to SEQ ID NO: 3.

4. The purified polypeptide of claim 2, wherein the polypeptide comprises at least 60 consecutive amino acids from SEQ ID NO: 3.

5. A method of inducing an immune response in a subject comprising administering to the subject an effective amount of a composition comprising the purified polypeptide of claim 2.

6. The method of claim 5, wherein the composition comprises an aluminum salt adjuvant.

7. The method of claim 6, wherein the purified polypeptide is adsorbed to the aluminum salt adjuvant.

8. The method of claim 6, wherein the aluminum salt adjuvant comprises aluminum phosphate.

9. The method of claim 7, wherein the aluminum salt adjuvant comprises aluminum phosphate.

10. The method of claim 6, wherein the aluminum salt adjuvant comprises aluminum phosphate.

11. The method of claim 7, wherein the aluminum salt adjuvant comprises aluminum phosphate.

12. A purified protein having formula:


NH2-A-[—X-L-]n-B—COOH

wherein L is an optional linker amino acid sequence, A is an optional N-terminal amino acid sequence, B is an optional C-terminal amino acid sequence, and n is 2 and X is an amino acid sequence comprising at least 40 consecutive amino acids from a 741 protein, wherein the first 741 protein is SEQ ID NO: 3 and the second 741 protein is SEQ ID NO: 7.

13. A composition comprising the purified protein of claim 12 adsorbed to an aluminum salt adjuvant.

14. A composition comprising the purified protein of claim 12 and an aluminum hydroxyphosphate adjuvant.

15. A method of inducing an immune response in a subject comprising administering to the subject an effective amount of a composition comprising the purified polypeptide of claim 12.

16. The method of claim 15, wherein the composition comprises an aluminum salt adjuvant.

17. The method of claim 16, wherein the purified polypeptide is adsorbed to the aluminum salt adjuvant.

18. The method of claim 16, wherein the aluminum salt adjuvant comprises aluminum phosphate.

19. The method of claim 17, wherein the aluminum salt adjuvant comprises aluminum phosphate.

20. The method of claim 16, wherein the aluminum salt adjuvant comprises aluminum phosphate.

21. The method of claim 17, wherein the aluminum salt adjuvant comprises aluminum phosphate.

Resources

Images & Drawings included:

Sources:

Recent applications in this class:

Recent applications for this Assignee: