US20150306217A9
2015-10-29
14/365,536
2012-12-20
US 9,901,635 B2
2018-02-27
WO; PCT/EP2012/076404; 20121220
WO; WO2013/092875; 20130627
Nianxiang Zou
Womble Bond Dickinson (US) LLP
2032-12-20
The present invention relates to therapeutic compounds, such as vaccines against human papillomavirus (HPV) and in particular to DNA vaccines against HPV16 or HPV18. The invention further relates to protein construct encoding homodimeric peptides, which peptides may be released from a DNA vaccine or used separately. Further described are pharmaceutical formulations, host cells and methods for producing the vaccines, as well as methods for the treatment of various HPV induced diseases, such as cancers and infectious diseases by application.
Get notified when new applications in this technology area are published.
A61K39/39575 » CPC main
Medicinal preparations containing antigens or antibodies; Antibodies ; Immunoglobulins; Immune serum, e.g. antilymphocytic serum against materials from other living beings excluding bacteria and viruses, e.g. protozoa, fungi, plants
C07K16/08 IPC
Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from viruses
C07K14/523 » CPC further
Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans; Cytokines; Lymphokines; Interferons; Chemokines Beta-chemokines, e.g. RANTES, I-309/TCA-3, MIP-1alpha, MIP-1beta/ACT-2/LD78/SCIF, MCP-1/MCAF, MCP-2, MCP-3, LDCF-1, LDCF-2
A61K2039/505 » CPC further
Medicinal preparations containing antigens or antibodies comprising antibodies
A61K39/0011 » CPC further
Medicinal preparations containing antigens or antibodies; Vertebrate antigens Cancer antigens
A61K39/395 IPC
Medicinal preparations containing antigens or antibodies Antibodies ; Immunoglobulins; Immune serum, e.g. antilymphocytic serum
C07K16/084 » CPC further
Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from viruses from DNA viruses Papovaviridae, e.g. papillomavirus, polyomavirus, SV40, BK virus, JC virus
A61K48/00 » CPC further
Medicinal preparations containing genetic material which is inserted into cells of the living body to treat genetic diseases; Gene therapy
A61K2039/53 » CPC further
Medicinal preparations containing antigens or antibodies comprising whole cells, viruses or DNA/RNA DNA (RNA) vaccination
A61K2039/6031 » CPC further
Medicinal preparations containing antigens or antibodies characteristics by the carrier linked to the antigen Proteins
A61K2039/6056 » CPC further
Medicinal preparations containing antigens or antibodies characteristics by the carrier linked to the antigen; Proteins Antibodies
A61K2039/64 » CPC further
Medicinal preparations containing antigens or antibodies characterised by the architecture of the carrier-antigen complex, e.g. repetition of carrier-antigen units
C07K2317/526 » CPC further
Immunoglobulins specific features characterized by immunoglobulin fragments; Constant or Fc region; Isotype CH3 domain
C07K2317/53 » CPC further
Immunoglobulins specific features characterized by immunoglobulin fragments; Constant or Fc region; Isotype Hinge
C07K2319/00 » CPC further
Fusion polypeptide
C07K2319/02 » CPC further
Fusion polypeptide containing a localisation/targetting motif containing a signal sequence
C07K2319/30 » CPC further
Fusion polypeptide Non-immunoglobulin-derived peptide or protein having an immunoglobulin constant or Fc region, or a fragment thereof, attached thereto
C07K2319/735 » CPC further
Fusion polypeptide containing domain for protein-protein interaction containing a domain for self-assembly, e.g. a viral coat protein (includes phage display)
C12N2710/20022 » CPC further
dsDNA viruses; Details; Papillomaviridae New viral proteins or individual genes, new structural or functional aspects of known viral proteins or genes
C12N2710/20034 » CPC further
dsDNA viruses; Details; Papillomaviridae Use of virus or viral component as vaccine, e.g. live-attenuated or inactivated virus, VLP, viral protein
C12N2710/20071 » CPC further
dsDNA viruses; Details; Papillomaviridae Demonstrated effect
C12N2800/22 » CPC further
Nucleic acids vectors Vectors comprising a coding region that has been codon optimised for expression in a respective host
A61K39/12 » CPC further
Medicinal preparations containing antigens or antibodies Viral antigens
A61K39/00 IPC
Medicinal preparations containing antigens or antibodies
C07K14/52 IPC
Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans Cytokines; Lymphokines; Interferons
C07K14/005 » CPC further
Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from viruses
C12N7/00 » CPC further
Viruses; Bacteriophages; Compositions thereof; Preparation or purification thereof
A61K2039/585 » CPC further
Medicinal preparations containing antigens or antibodies raising an immune response against a target which is not the antigen used for immunisation wherein the target is cancer
C07K14/025 IPC
Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from viruses; DNA viruses Papovaviridae, e.g. papillomavirus, polyomavirus, SV40, BK virus, JC virus
The present invention relates to therapeutic compounds, such as vaccines against human papillomavirus (HPV) and in particular to DNA vaccines against HPV16 and/or HPV18. The invention further relates to protein construct encoding homodimeric peptides, which peptides may be released from a DNA vaccine or used separately. Further described are pharmaceutical formulations, host cells and methods for producing the vaccines, as well as methods for the treatment of various HPV induced diseases, such as cancers and infectious diseases by application.
It is now well established that human papillomavirus (HPV) is the cause of cervical cancer and other HPV-associated malignancies such as anogenital (anus, vulvar, vaginal and penile) cancers and a subset of head and neck cancers. In particular, HPV16 and HPV 18 are responsible for about 70% of all cervical cancers worldwide.
To date, two prophylactic HPV vaccines are on the market (Gardasil and Cervarix). The aim of the prophylactic vaccines is to induce humoral immune responses by stimulating the production of neutralizing antibodies specific for the HPV viral capsid proteins, L1 and L2. Although the preventive vaccines are an important milestone for the control of HPV induced cervical cancer and possibly other HPV-associated malignancies, the effect of these vaccines will not be significantly observed for 20-40 years (Ma B et al., Current Cancer Therapy Reviews, 2010). Moreover, since the coverage of mass vaccination for the prophylactic vaccines are to date limited in addition to a substantial population worldwide that already are HPV infected, HPV-associated malignancies will continue to progress. Thus, it will be important to develop HPV-specific therapeutic vaccines in order to reduce the mortality and morbidity of HPV-associated malignancies and its precursor lesions (Ma B et al., Current Cancer Therapy Reviews, 2010).
The development of various cancer vaccines and cancer immunotherapy strategies has throughout the last two decades expanded. Still, only one therapeutic cancer vaccine, called Provenge (Dendreon INC) has so far been approved to be applied as standard therapy for prostate cancer. Notably, due to ethical reasons the majority of therapeutic cancer vaccines are tested on a patient group bearing a late stage tumor. This patient group is substantially immunosuppressed meaning that the tumor cells have for long escaped the immune system and contributed to induce immunological tolerance to the tumor along carcinogenesis. In addition, the choice of antigens (tumor-specific vs. tumor-associated) applied as vaccines are critical in order to induce tumor-specific immune responses and avoid killing of healthy cells in the patients which may lead to serious adverse events. Thus, the major challenges in cancer immunotherapy are to break the immunological tolerance and activate tumor-specific effector functions to recognize and kill tumor cells. Although some case reports show clinical response to therapeutic cancer vaccines in late stage tumor patients, the most common primary endpoint is to observe the impact on overall survival compared to conventional therapy (surgery, chemo and radiation therapy). However, most studies are either not conclusive or that they completely fail to show this. One reason for the negative results lies in the patient group carrying end-stage tumors that are challenging to treat in the first place. A possible strategy could be to include patients with early-stage tumors in therapeutic vaccine trials.
One strategy is to target pre-cancerous lesions. The challenges for this strategy are mainly the lack of reliable biomarkers that are specifically expressed by precancerous lesions for many tissues and poor medical screening (either non-existing or that the existing method suffers from lack of sensitivity). Exceptionally, this is not the case for HPV-induced malignancies. For instance, the majority of western countries have good screening programs for cervical dysplasia and cervical cancer by performing the papanicolaou test (Pap smear test). If there are unclear or abnormal results from Pap smear test, colposcopy will be performed (National Cervical Cancer Coalition). HPV-testing may also be recommended for some patients to detect the presence of âhigh-riskâ HPV-type in the precancerous lesion. Thus, HPV represents a potential biomarker for HPV-associated precancerous lesions, in particular cervical intraepithelial dysplasia (CIN).
DNA vaccines have shown increasing promise for the treatment of human diseases, in particular cancer. DNA vaccines induce strong antigen-specific immune responses and can be repeatedly administered to maintain the target-specific immune responses. Such vaccines are considered to be safe and simple and cheap to produce on a large scale compared to other cancer therapeutic formats. Numerous immunotherapeutic interventions fail to induce immunological memory. Exceptionally, DNA vaccination ensures sustained release of the vaccine product in vivo which enhances antigen-specific immunological memory. Direct delivery of antigens to professional antigen-presenting cells (APCs) stimulates both CD4+ and CD8+ T cell immune responses in vivo. Such strong cellular immune responses have been demonstrated to specifically recognize and kill antigen-positive malignant cells efficiently both in vitro and in vivo.
There is still a need in the art for improved vaccines for inducing strong and specific immune responses against HPV responsible for both infectious diseases and cancers.
It is an object of embodiments of the invention to provide specific and highly effective therapeutic compounds, such as DNA vaccines against diseases and conditions caused by HPV.
It has been found by the present inventors that by combining the antigens of the early gene products E6 and E7 from HPV, such as from HPV16 and/or HPV18 with the targeting module of hMIP-1Îą, therapeutic vaccines are provided, wherein the strong immunogenic epitopes of HPV gene products are presented with high efficiency to APCs to induce a specific and strong immune response. The products according to the present invention is primarily envisioned as therapeutic nucleic acid vaccines, such as DNA vaccines, wherein a nucleic acid construct encoding the vaccibody construct is used as the therapeutic compound leading to in vivo production of the protein product within the person receiving the vaccine. However, as an alternative the protein product itself may be formulated and used directly in the vaccine.
Accordingly, in a first aspect the present invention relates to a homodimeric protein of two identical amino acid chains, each amino acid chain comprising (1) a signal peptide, (2) a targeting unit, (3) a dimerization motif, and (4) an antigenic unit, said targeting unit comprising an amino acid sequence having at least 80% sequence identity to the amino acid sequence 24-93 of SEQ ID NO:1, and an antigenic unit comprising an amino acid sequence of human papillomavirus (HPV), such as an antigenic unit comprising an amino acid sequence of HPV16 and/or HPV18, such as an antigenic unit derived from early proteins E6 and/or E7 of HPV16 and/or HPV18.
In a second aspect the present invention relates to an amino acid chain comprising (1) a signal peptide, (2) a targeting unit, (3) a dimerization motif, and (4) an antigenic unit, said targeting unit comprising an amino acid sequence having at least 80% sequence identity to the amino acid sequence 24-93 of SEQ ID NO:1, and an antigenic unit comprising an amino acid sequence of human papillomavirus (HPV), such as an antigenic unit comprising an amino acid sequence of HPV16 and/or HPV18, such as an antigenic unit derived from early proteins E6 and/or E7 of HPV16 and/or HPV18, which amino acid chain is able to form a homodimeric protein according to the invention.
In a third aspect the present invention relates to a nucleic acid molecule, such as a DNA, encoding an amino acid chain comprising (1) a signal peptide, (2) a targeting unit, (3) a dimerization motif, and (4) an antigenic unit, said targeting unit comprising an amino acid sequence having at least 80% sequence identity to the amino acid sequence 24-93 of SEQ ID NO:1, and an antigenic unit comprising an amino acid sequence of human papillomavirus (HPV), such as an antigenic unit comprising an amino acid sequence of HPV16 and/or HPV18, such as an antigenic unit derived from early proteins E6 and/or E7 of HPV16 and/or HPV18, which amino acid chain is able to form a homodimeric protein according to the invention.
In a further aspect the present invention relates to a homodimeric protein according to the invention, or an amino acid chain according to the invention, or the nucleic acid molecule according to the invention for use as a medicament.
In a further aspect the present invention relates to a pharmaceutical composition comprising a homodimeric protein according to the invention, or an amino acid chain according to the invention, or the nucleic acid molecule according to the invention.
In a further aspect the present invention relates to a host cell comprising the nucleic acid molecule according to the invention.
In a further aspect the present invention relates to a method for preparing a homodimeric protein according to the invention, or an amino acid chain of the invention, the method comprising a) transfecting the nucleic acid molecule according to the invention into a cell population; b) culturing the cell population; c) collecting and purifying the homodimeric protein, or amino acid chain expressed from the cell population.
In a further aspect the present invention relates to a method for preparing a vaccine, such as a DNA vaccine, comprising an immunologically effective amount of a nucleic acid molecule according to the invention, the method comprising a) preparing a nucleic acid molecule according to the invention; b) dissolving the nucleic acid molecule obtained under step a) in a pharmaceutically acceptable carrier, diluent, or buffer.
In a further aspect the present invention relates to a vaccine against HPV comprising an immunologically effective amount of a homodimeric protein according to the invention, or an amino acid chain according to the invention, or nucleic acid molecule, such as a DNA, according to the invention, wherein said vaccine is able to trigger both a T-cell- and B-cell immune response.
In a further aspect the present invention relates to a method of treating or preventing a HPV induced disease or condition, such as a cancer or an infectious disease caused by HPV in a patient, the method comprising administering to the patient in need thereof, a homodimeric protein according to the invention, or an amino acid chain according to the invention, or the nucleic acid molecule, such as a DNA, according to the invention.
FIG. 1: The overall structure of vaccibody vaccines with E7/E6 fusion antigen. Shown are both DNA and protein formats. The vaccibody consist of three functional modules; the chemokine human MIP-1Îą (LD78(3) in the targeting module, hinge and CH3 sequences from human IgG3 in the dimerization module and full-length E7 and/or E6 fusion in the vaccine module.
FIG. 2: The suggested mode of action for a Vaccibody DNA vaccine against HPV -induced malignancies. Naked DNA plasmid encoding vaccibody is injected intradermal followed by electroporation. The plasmid is taken up by local cells and vaccibody proteins are produced and secreted. The chemotactic targeting modules attract CCR1 and CCR5 expressing antigen presenting cells (APC) and ensure binding and uptake into dendritic cells (DC). The DC will present antigenic peptides to CD4+ and CD8+ T cells and the CD8+ T cells will kill HPV infected and transformed cells in the cervix.
FIG. 3: ELISPOT results showing the number of E7 and E6 specific T cell responses as a function of different amounts of vaccine administered. C57BL/6 mice were injected i.d. with naked DNA plasmids encoding VB1009 and VB1016 and their corresponding controls followed by electroporation (Cellectis, France) on day 0 and day 7. Splenocytes were harvested at day 21 and stimulated with MHC class I-restricted E7 or E6 peptide for 24 h. The number of IFNy secreting splenocytes was calculated by ELISPOT. (A)E7-specific responses after i.d. vaccination with 25 Îźg of VB1009, control 1 (antigen alone) and pUMVC4a (empty vector).(B) E7-specific responses after i.d. vaccination with 12.5 and 1.4 Îźg of VB1016, control 2 (antigen alone) and pUMVC4a (empty vector). (C) E6-specific responses after i.d. vaccination with 12.5 and 1.4 Îźg of VB1016, control 2 (antigen alone) and pUMVC4a (empty vector).
FIG. 4.Therapeutic effect of VB1016 shown by measured tumor volume. C57BL/6 mice were injected s.c. with 5Ă105 TC-1 cells at day 0. At day 3 and day 10, the mice were injected i.d. with 12.5 Îźg naked DNA plasmids encoding VB1016, control 2 or empty vector followed by electroporation (Cellectis, France). The tumor sizes were measured by caliper two to three times a week and tumor volume calculated.
FIG. 5.Therapeutic effect of VB1016 shown by measured tumor volume. C57BL/6 mice were injected s.c. in the neck area with 5Ă104 TC-1 cells at day 0. At day 3,7 and day 10, the mice were injected i.d. with 20 Îźg or 2 Îźg naked DNA plasmids encoding VB1016, control 2 or empty vector followed by electroporation (Cellectis, France). The tumor sizes were measured by caliper two to three times a week and tumor volume calculated.
FIG. 6.Therapeutic effect of VB1020 and VB1021 shown by measured tumor volume. C57BL/6 mice were injected s.c. in the thigh with 5Ă104 TC-1 cells at day 0. At day 3 and day 10, the mice were injected i.d. with 10 Îźg naked DNA plasmids encoding VB1016, VB1020, VB1021 or empty vector followed by electroporation (Cellectis, France). The tumor sizes were measured by caliper two to three times a week and tumor volume calculated.
The constructs and DNA vaccine technology described herein by the inventors of the present invention (also referred to as âvaccibodyâ molecules/vaccines/constructs) represents a novel vaccine strategy to induce strong and specific immune responses for both infectious diseases and cancer. The HPV E6/E7, such as HPV16 or HPV18 E6/E7 vaccine described herein may be administered as a DNA vaccine by intradermal injection, preferably followed by electroporation. This results in the uptake of the DNA-construct encoding the vaccibody-HPV16 and/or HPV18 E6/E7 vaccine in cells at the site of injection (dermis) including dendritic cells (Langerhans cells), leading to in vivo production of the vaccibody-E6/E7 molecule.
The early gene products E6 and E7 from âhigh-riskâ HPV types such as HPV16 and 18 may be responsible for transformation of the basal-epithelium cells and induction of precancerous lesions. Both proteins consist of highly immunogenic epitopes and are shown herein to induce strong immune responses leading to specific eradication of âhigh-riskâ HPV positive tumor cells both in vitro and in vivo.
The vaccibody molecule described herein is a homodimer consisting of three modules; targeting module, dimerization module and the vaccine module (FIG. 1). Genes encoding the three modules are genetically engineered to be expressed as one gene. When expressed in vivo, the vaccibody molecule targets antigen presenting cells (APCs) which results in an enhanced vaccine potency compared to identical, non-targeted antigens. In vivo expression of the chemokine human macrophage inflammatory protein 1 alpha (hMIP-1ι/LD78β) leads to attraction of DCs, neutrophils and other immune cells carrying the CCR1 and CCR5 receptors to the site of expression. Thus, the vaccibody molecule consisting of hMIP-1ι as the targeting module, will not only target the antigens to specific cells, but in addition give a response-amplifying effect (adjuvant effect) by recruiting specific immune cells to the injection site. This unique mechanism may be of great importance in a clinical setting where patients can receive the vaccine without any additional adjuvants since the vaccine itself gives the adjuvant effect.
The inventors of the present invention describes herein vaccine constructs where the antigenic module consist of the E7 full length genetic sequence in fusion to the E6 full length sequence originating from the HPV16 or HPV18 subtype. The advantage of this format is that both E6 and E7 will be present in one construct and may thus be equally expressed in vivo. Consequently, one vaccibody molecule consisting of a multi-antigenic unit may represent equal levels of E6 and E7 for the immune system. The HPV16 E6 and E7 gene products are oncogenic in their natural form. To neutralize their oncogenic properties, mutations at specific sites may be introduced in the E6 and E7 genetic sequence.
The mutations, including deletions, may be introduced at specific sites, known to inhibit the oncogenic properties of E6 and E7, such as any one described in any of Dalal S et al., J Virol, 1996; Mßnger K et al., EMBO, 1989; Nakagawa S et al., Virology, 1995; Crook T et al., Cell, 1991; Mßnger K et al., HPV Compendium Online, 1997 (http://www.stdgen.lanl.gov/COMPENDIUM_PDF/97PDF/3/E7.pdf); Nguyen, M et al., J Virol, 2002; NominÊ Yet a., Molecular Cell, 2006; Moody C et al., Nat Rev Cancer, 2010, Polakova I et al., Vaccine, 2010; Xie Q, Virologica Sinica, 2011; Mesplède T et al., J Virol, 2012; US 2008/0102084 and U.S. Pat. No. 6,306,397, which references are hereby incorporated by reference. Accordingly, in some aspects of the invention, the constructs according to the present invention contain HPV16 E6, E7 or HPV16 E6/E7 chimeric constructs with one or more mutations in either of HPV16 E6, E7 or both at a position known to inhibit the oncogenic properties as described in Dalal S et al., 3 Virol, 1996; Mßnger K et al., EMBO, 1989; Nakagawa S et al., Virology, 1995; Crook T et al., Cell, 1991; Mßnger K et al., HPV Compendium Online, 1997 (http://www.stdgen.lanl.gov/COMPENDIUM_PDF/97PDF/3/E7.pdf); Nguyen, M et al., J Virol, 2002; NominÊ Y et a., Molecular Cell, 2006; Moody C et al., Nat Rev Cancer, 2010, Polakova I et al., Vaccine, 2010; Xie Q, Virologica Sinica, 2011; Mesplède T et al., J Virol, 2012; US 2008/0102084 or U.S. Pat. No. 6,306,397. In other aspects of the invention, the constructs according to the present invention contain HPV18 E6, E7 or HPV18 E6/E7 chimeric constructs with one or more mutations in either of HPV18 E6, E7 or both at a position known to inhibit the oncogenic properties as described in Dalal S et al., J Virol, 1996; Mßnger K et al., EMBO, 1989; Nakagawa S et al., Virology, 1995; Crook T et al., Cell, 1991; Mßnger K et al., HPV Compendium Online, 1997 (http://www.stdgen.lanl.gov/COMPENDIUM_PDF/97PDF/3/E7.pdf); Moody C et al., Nat Rev Cancer, 2010, US 2008/0102084 and U.S. Pat. No. 6,306,397.
There is a possibility that the vaccibody-moiety (targeting and dimerization modules) may eradicate the oncogenic properties of E6 and E7 wildtype proteins in the final fusion protein. Thus, in yet another aspect of the invention is the utilization of the wildtype full-length E6 and/or E7 sequences in the vaccibody construction.
The invention describes several variant of Vaccibody HPV therapeutic DNA vaccines all based on the overall format described in FIG. 1, the therapeutic vaccibody-HPV DNA vaccines encodes genes that are naturally expressed in humans; the targeting module genes encode the chemokine hMIP-1Îą, which binds to its cognate receptors, CCR1 and CCR5 expressed on the cell surface of APCs. The dimerization module genes may encode hinge regions and constant heavy chain 3, such as from human IgG3 which connects two vaccibody monomers generating a homodimer molecule. Genes encoding the vaccine module for the current strategy consist of HPV, such as HPV16 and/or HPV18 E7 and E6 antigens, such as the full length HPV16 E7 and E6 antigens, optionally comprising one or more mutation to inhibit the oncogenic properties. Once administered in vivo by i.d. injection followed by electroporation, dermal cells taking up the vaccine construct will express the vaccibody-HPV molecule. The in vivo produced vaccibody vaccines target to CCR1 and CCR5 expressed on the surface of APCs in the skin, in particular DCs. The binding of the vaccibody molecule to its cognate receptors leads to internalization of the complex in the APC, degradation of the proteins into small peptides that are loaded onto MHC molecules and presented to CD4+ and CD8+ T cells to induce HPV16 E6 and E7 specific immune responses. Once stimulated and with help from activated CD4+ T cells, CD8+ T cells will target and kill HPV16 E6 and E7 expressing cells (FIG. 2). Such enhanced immune responses to a vaccine with a âbuilt-inâ adjuvant effect may potentially overcome tumor-escape (tumor immune surveillance) by breaking immunological tolerance and efficiently kill malignant cells. The hMIP-1Îą targeting unit may be connected through a dimerization motif, such as a hinge region, to an antigenic unit, wherein the later is in either the COOH-terminal or the NH2-terminal end. The present invention not only relates to a DNA sequence coding for this recombinant protein, but also to expression vectors comprising these DNA sequences, cell lines comprising said expression vectors, to treatment of mammals preferentially by immunization by means of Vaccibody DNA, Vaccibody RNA, or Vaccibody protein, and finally to pharmaceuticals and a kit comprising the said molecules.
The dimerization motif in the proteins according to the present invention may be constructed to include a hinge region and an immunoglobulin domain (e.g. Cy3 domain), e.g. carboxyterminal C domain (CH3 domain), or a sequence that is substantially identical to said C domain. The hinge region may be Ig derived and contributes to the dimerization through the formation of an interchain covalent bond(s), e.g. disulfide bridge(s). In addition, it functions as a flexible spacer between the domains allowing the two targeting units to bind simultaneously to two target molecules on APC expressed with variable distances. The immunoglobulin domains contribute to homodimerization through non-covalent interactions, e.g. hydrophobic interactions. In a preferred embodiment the CH3 domain is derived from IgG. These dimerization motifs may be exchanged with other multimerization moieties (e.g. from other Ig isotypes/subclasses). Preferably the dimerization motif is derived from native human proteins, such as human IgG.
It is to be understood that the dimerization motif may have any orientation with respect to antigenic unit and targeting unit. In one embodiment the antigenic unit is in the COOH-terminal end of the dimerization motif with the targeting unit in the N-terminal end of the dimerization motif. In another embodiment the antigenic unit is in the N-terminal end of the dimerization motif with the targeting unit in the COOH-terminal end of the dimerization motif.
International application WO 2004/076489, which is hereby incorporated by reference discloses nucleic acid sequences and vectors, which may be used according to the present invention.
The proteins according to the present invention include an antigenic unit derived from HPV, such as HPV16 E7 and E6 antigens, such as the full length HPV16 E7 and E6 antigens, as well as immunogenic fragments or variants thereof. The antigenic sequence should be of sufficient length. The minimal length of such antigenic unit may be around 9 amino acids. Accordingly in some embodiments, the antigenic unit derived from HPV comprises an amino acid sequence of at least 9 amino acids corresponding to at least about 27 nucleotides in a nucleic acids sequence encoding such antigenic unit. Preferably the antigenic unit derived from HPV is considerably longer, such as the full length HPV16 E7 and E6 antigens. Diversity arises within a given HPV genotype through limited nucleotide changes in the coding (at a frequency of <2%) and non-coding (at a frequency of <5%) regions (Bernard, HU et al., Int 3 Cancer, 2006). Such variants phylogenetically segregate based on their geographical origin and are therefore labeled European, African, Asian, Asian-American and North American. Insertion of such sequences in a Vaccibody format might lead to activation of both arms of the immune response.
Immunization by means of Vaccibody protein, Vaccibody DNA, or Vaccibody RNA, the latter two executed e.g. by intramuscular or intradermal injection with or without a following electroporation, are all feasible methods according to the present invention.
As discussed above, the present invention relates to a vaccine composition against cancer or infectious diseases caused by HPV, the vaccine composition comprising an immunologically effective amount of the nucleic acid encoding the molecule of the invention or degenerate variants thereof. The vaccine may be able to trigger both a T-cell- and B-cell immune response. The present invention also relates to a kit comprising Vaccibody DNA, RNA, or protein for diagnostic, medical or scientific purposes.
The invention further relates to a method of preparing the recombinant molecule of the invention comprising, transfecting the vector comprising the molecule of the invention into a cell population; culturing the cell population; collecting recombinant protein expressed from the cell population; and purifying the expressed protein.
The above described nucleotide sequences may be inserted into a vector suited for gene therapy, e.g. under the control of a specific promoter, and introduced into the cells. In some embodiments the vector comprising said DNA sequence is a virus, e.g. an adenovirus, vaccinia virus or an adeno-associated virus. In some embodiments a retroviruses is used as vector. Examples of suitable retroviruses are e.g. MoMuLV or HaMuSV. For the purpose of gene therapy, the DNA/RNA sequences according to the invention can also be transported to the target cells in the form of colloidal dispersions. They comprise e.g. liposomes or lipoplexes.
The present invention encompasses the use of a targeting unit as well as an antigenic unit having minimum degree of sequence identity or sequence homology with amino acid sequence(s) defined herein or with a polypeptide having the specific properties defined herein. The present invention encompasses, in particular, the use of peptide variants or peptide units to be used in the constructs according to the present invention having a degree of sequence identity with any one of SEQ ID NO:1, SEQ ID NO:3, SEQ ID NO:5, SEQ ID NO:7, SEQ ID NO:9, SEQ ID NO:11, SEQ ID NO:13, SEQ ID NO:15, SEQ ID NO:17, SEQ ID NO:19, SEQ ID NO:21, SEQ ID NO:22, SEQ ID NO:23, SEQ ID NO:24, SEQ ID NO:25, SEQ ID NO:26, SEQ ID NO:27, SEQ ID NO:28, SEQ ID NO:29, SEQ ID NO:30, SEQ ID NO:32, or SEQ ID NO:34. Here, the term âvariantâ means an entity having a certain degree of sequence identity with the subject amino acid sequences or the subject nucleotide sequences, where the subject amino acid sequence preferably is SEQ ID NO:1, SEQ ID NO:2, SEQ ID NO:3, SEQ ID NO:4, SEQ ID NO:5, SEQ ID NO:6, SEQ ID NO:7, SEQ ID NO:8, SEQ ID NO:9, SEQ ID NO:10, SEQ ID NO:11, SEQ ID NO:12, SEQ ID NO:13, SEQ ID NO:14, SEQ ID NO:15, SEQ ID NO:16, SEQ ID NO:17, SEQ ID NO:18, SEQ ID NO:19, SEQ ID NO:20, SEQ ID NO:21, SEQ ID NO:22, SEQ ID NO:23, SEQ ID NO:24, SEQ ID NO:25, SEQ ID NO:26, SEQ ID NO:27, SEQ ID NO:28, SEQ ID NO:29, SEQ ID NO:30, SEQ ID NO:31, SEQ ID NO:32, SEQ ID NO:33, or SEQ ID NO:34.
In one aspect, the variant or fragment amino acid sequence and/or nucleotide sequence should provide and/or encode a polypeptide which retains the functional activity and/or enhances the activity of a polypeptide of SEQ ID NO:1, SEQ ID NO:3, SEQ ID NO:5, SEQ ID NO:7, SEQ ID NO:9, SEQ ID NO:11, SEQ ID NO:13, SEQ ID NO:15, SEQ ID NO:17, SEQ ID NO:19, SEQ ID NO:21, SEQ ID NO:22, SEQ ID NO:23, SEQ ID NO:24, SEQ ID NO:25, SEQ ID NO:26, SEQ ID NO:27, SEQ ID NO:28, SEQ ID NO:29, SEQ ID NO:30, SEQ ID NO:32, or SEQ ID NO:34.
In the present context, a variant sequence is taken to include an amino acid sequence which may be at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98% or at least 99%, identical to the subject sequence. Typically, the variants used according to the present invention will comprise the same active sites etc. as the subject amino acid sequence. Although homology can also be considered in terms of similarity (i.e. amino acid residues having similar chemical properties/functions), in the context of the present invention it is preferred to express homology in terms of sequence identity.
Sequence identity comparisons can be conducted by eye, or more usually, with the aid of readily available sequence comparison computer programs. These commercially available computer programs use complex comparison algorithms to align two or more sequences that best reflect the evolutionary events that might have led to the difference(s) between the two or more sequences. Therefore, these algorithms operate with a scoring system rewarding alignment of identical or similar amino acids and penalising the insertion of gaps, gap extensions and alignment of non-similar amino acids. The scoring system of the comparison algorithms include:
Most alignment programs allow the gap penalties to be modified. However, it is preferred to use the default values when using such software for sequence comparisons.
The scores given for alignment of non-identical amino acids are assigned according to a scoring matrix also called a substitution matrix. The scores provided in such substitution matrices are reflecting the fact that the likelihood of one amino acid being substituted with another during evolution varies and depends on the physical/chemical nature of the amino acid to be substituted. For example, the likelihood of a polar amino acid being substituted with another polar amino acid is higher compared to being substituted with a hydrophobic amino acid. Therefore, the scoring matrix will assign the highest score for identical amino acids, lower score for non-identical but similar amino acids and even lower score for non-identical non-similar amino acids. The most frequently used scoring matrices are the PAM matrices (Dayhoff et al. (1978), Jones et al. (1992)), the BLOSUM matrices (Henikoff and Henikoff (1992)) and the Gonnet matrix (Gonnet et al. (1992)).
Suitable computer programs for carrying out such an alignment include, but are not limited to, Vector NTI (Invitrogen Corp.) and the ClustalV, ClustalW and ClustalW2 programs (Higgins D G & Sharp P M (1988), Higgins et al. (1992), Thompson et al. (1994), Larkin et al. (2007). A selection of different alignment tools is available from the ExPASy Proteomics server at www.expasy.org. Another example of software that can perform sequence alignment is BLAST (Basic Local Alignment Search Tool), which is available from the webpage of National Center for Biotechnology Information which can currently be found at http://www.ncbi.nlm.nih.gov/and which was firstly described in Altschul et al. (1990) J. Mol. Biol. 215; 403-410.
Once the software has produced an alignment, it is possible to calculate % similarity and ° A) sequence identity. The software typically does this as part of the sequence comparison and generates a numerical result.
In one embodiment, it is preferred to use the ClustalW software for performing sequence alignments. Preferably, alignment with ClustalW is performed with the following parameters for pairwise alignment:
| Substitution matrix: | Gonnet 250 | |
| Gap open penalty: | 20 | |
| Gap extension penalty: | 0.2 | |
| Gap end penalty: | None | |
ClustalW2 is for example made available on the internet by the European Bioinformatics Institute at the EMBL-EBI webpage www.ebi.ac.uk under toolsâsequence analysisâClustalW2. Currently, the exact address of the ClustalW2 tool is www.ebi.ac.uk/Tools/clustalw2.
In another embodiment, it is preferred to use the program Align X in Vector NTI (Invitrogen) for performing sequence alignments. In one embodiment, Exp10 has been may be used with default settings:
Thus, the present invention also encompasses the use of variants, fragments, and derivatives of any amino acid sequence of a protein, polypeptide, motif or domain as defined herein, particularly those of SEQ ID NO:1, SEQ ID NO:3, SEQ ID NO:5, SEQ ID NO:7, SEQ ID NO:9, SEQ ID NO:11, SEQ ID NO:13, SEQ ID NO:15, SEQ ID NO:17, SEQ ID NO:19, SEQ ID NO:21, SEQ ID NO:22, SEQ ID NO:23, SEQ ID NO:24, SEQ ID NO:25, SEQ ID NO:26, SEQ ID NO:27, SEQ ID NO:28, SEQ ID NO:29, SEQ ID NO:30, SEQ ID NO:32, or SEQ ID NO:34.
The sequences, particularly those of variants, fragments, and derivatives of SEQ ID NO:1, SEQ ID NO:3, SEQ ID NO:5, SEQ ID NO:7, SEQ ID NO:9, SEQ ID NO:11, SEQ ID NO:13, SEQ ID NO:15, SEQ ID NO:17, SEQ ID NO:19, SEQ ID NO:21, SEQ ID NO:22, SEQ ID NO:23, SEQ ID NO:24, SEQ ID NO:25, SEQ ID NO:26, SEQ ID NO:27, SEQ ID NO:28, SEQ ID NO:29, SEQ ID NO:30, SEQ ID NO:32, or SEQ ID NO:34, may also have deletions, insertions or substitutions of amino acid residues which produce a silent change and result in a functionally equivalent substance. Deliberate amino acid substitutions may be made on the basis of similarity in polarity, charge, solubility, hydrophobicity, hydrophilicity, and/or the amphipathic nature of the residues as long as the secondary binding activity of the substance is retained. For example, negatively charged amino acids include aspartic acid and glutamic acid; positively charged amino acids include lysine and arginine; and amino acids with uncharged polar head groups having similar hydrophilicity values include leucine, isoleucine, valine, glycine, alanine, asparagine, glutamine, serine, threonine, phenylalanine, and tyrosine.
The present invention also encompasses conservative substitution (substitution and replacement are both used herein to mean the interchange of an existing amino acid residue, with an alternative residue) that may occur i.e. like-for-like substitution such as basic for basic, acidic for acidic, polar for polar etc. Non-conservative substitution may also occur i.e. from one class of residue to another or alternatively involving the inclusion of unnatural amino acids such as ornithine (hereinafter referred to as Z), diaminobutyric acid ornithine (hereinafter referred to as B), norleucine ornithine (hereinafter referred to as 0), pyriylalanine, thienylalanine, naphthylalanine and phenylglycine.
Conservative substitutions that may be made are, for example within the groups of basic amino acids (Arginine, Lysine and Histidine), acidic amino acids (glutamic acid and aspartic acid), aliphatic amino acids (Alanine, Valine, Leucine, Isoleucine), polar amino acids (Glutamine, Asparagine, Serine, Threonine), aromatic amino acids (Phenylalanine, Tryptophan and Tyrosine), hydroxyl amino acids (Serine, Threonine), large amino acids (Phenylalanine and Tryptophan) and small amino acids (Glycine, Alanine).
Replacements may also be made by unnatural amino acids include; alpha* and alpha-disubstituted* amino acids, N-alkyl amino acids*, lactic acid*, halide derivatives of natural amino acids such as trifluorotyrosine*, p-Cl-phenylalanine*, p-Br-phenylalanine*, p-I-phenylalanine*, L-allyl-glycine*, 0-alanine*, L-Îą-amino butyric acid*, L-Îł-amino butyric acid*, L-Îą-amino isobutyric acid*, L-Îľ-amino caproic acid*, 7-amino heptanoic acid*, L-methionine sulfone*, L-norleucine*, L-norvaline*, p-nitro-L-phenylalanine*, L-hydroxyproline*, L-thioproline*, methyl derivatives of phenylalanine (Phe) such as 4-methyl-Phe*, pentannethyl-Phe*, L-Phe (4-annino)*, L-Tyr (methyl)*, L-Phe (4-isopropyl)*, L-Tic (1,2,3,4-tetrahydroisoquinoline-3-carboxyl acid)*, L-diaminopropionic acid # and L-Phe (4-benzyl)*. The notation * has been utilised for the purpose of the discussion above (relating to homologous or non-conservative substitution), to indicate the hydrophobic nature of the derivative whereas # has been utilised to indicate the hydrophilic nature of the derivative, #* indicates amphipathic characteristics.
Variant amino acid sequences may include suitable spacer groups that may be inserted between any two amino acid residues of the sequence including alkyl groups such as methyl, ethyl or propyl groups in addition to amino acid spacers such as glycine or β-alanine residues. A further form of variation, involves the presence of one or more amino acid residues in peptoid form, will be well understood by those skilled in the art. For the avoidance of doubt, âthe peptoid formâ is used to refer to variant amino acid residues wherein the a-carbon substituent group is on the residue's nitrogen atom rather than the a-carbon. Processes for preparing peptides in the peptoid form are known in the art, for example Simon R J et al. (1992), Horwell D C. (1995).
In one embodiment, the variant targeting unit used in the homodimeric protein according to the present invention is variant having the sequence of amino acids at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98% or at least 99% amino acid sequence identity therewith.
In one aspect, preferably the protein or sequence used in the present invention is in a purified form. The term âpurifiedâ means that a given component is present at a high level. The component is desirably the predominant active component present in a composition.
A âvariantâ or âvariantsâ refers to proteins, polypeptides, units, motifs, domains or nucleic acids. The term âvariantâ may be used interchangeably with the term âmutant.â Variants include insertions, substitutions, transversions, truncations, and/or inversions at one or more locations in the amino acid or nucleotide sequence, respectively. The phrases âvariant polypeptideâ, âpolypeptideâ, âvariantâ and âvariant enzymeâ mean a polypeptide/protein that has an amino acid sequence that has been modified from the amino acid sequence of SEQ ID NO: 1. The variant polypeptides include a polypeptide having a certain percent, e.g., 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99%, of sequence identity with the amino acid sequence of SEQ ID NO:1, SEQ ID NO:3, SEQ ID NO:5, SEQ ID NO:7, SEQ ID NO:9, SEQ ID NO:11, SEQ ID NO:13, SEQ ID NO:15, SEQ ID NO:17, SEQ ID NO:19, SEQ ID NO:21, SEQ ID NO:22, SEQ ID NO:23, SEQ ID NO:24, SEQ ID NO:25, SEQ ID NO:26, SEQ ID NO:27, SEQ ID NO:28, SEQ ID NO:29, SEQ ID NO:30, SEQ ID NO:32, or SEQ ID NO:34.
âVariant nucleic acidsâ can include sequences that are complementary to sequences that are capable of hybridizing to the nucleotide sequences presented herein. For example, a variant sequence is complementary to sequences capable of hybridizing under stringent conditions, e.g., 50° C. and 0.2Ă SSC (1Ă SSC=0.15 M NaCl, 0.015 M sodium citrate, pH 7.0), to the nucleotide sequences presented herein. More particularly, the term variant encompasses sequences that are complementary to sequences that are capable of hybridizing under highly stringent conditions, e.g., 65° C. and 0.1Ă SSC, to the nucleotide sequences presented herein. The melting point (Tm) of a variant nucleic acid may be about 1, 2, or 3° C. lower than the Tm of the wild-type nucleic acid. The variant nucleic acids include a polynucleotide having a certain percent, e.g., 80%, 85%, 90%, 95%, or 99%, of sequence identity with the nucleic acid encoding SEQ ID NO:1, SEQ ID NO:3, SEQ ID NO:5, SEQ ID NO:7, SEQ ID NO:9, SEQ ID NO:11, SEQ ID NO:13, SEQ ID NO:15, SEQ ID NO:17, SEQ ID NO:19, SEQ ID NO:21, SEQ ID NO:22, SEQ ID NO:23, SEQ ID NO:24, SEQ ID NO:25, SEQ ID NO:26, SEQ ID NO:27, SEQ ID NO:28, SEQ ID NO:29, SEQ ID NO:30, SEQ ID NO:32, or SEQ ID NO:34, encoding the monomeric protein which can form the homodimeric protein according to invention.
A specific category of mutations are the mutations in E6 and E7:
The E6 protein may be detoxified by rendering the p53 binding impossible. Five positions in the full length HPV16 E6 protein are sites for mutations for inactivation of E6 functionality, F47, L50, C63, C106 and 1128. Any amino acid substitution in these positions may lead to inactivation of E6 and induces tumor suppression. Substitutions in any one of these positions with any one different amino acid may potentially be utilized. Sites for potential mutations are shown in SEQ ID NO:22.
In the E7 protein there are conserved regions associated with oncogenic properties (see Phelps et al 3. Virol. April 1992, vol. 66, no. 42418-242; Gulliver et al 3 Virol. 1997, August; 71(8)) including an N-terminal Rb (retinoblastoma binding protein) binding-site motif (LXCXE) and two conserved regions 3 (upstream and downstream) with a Zn-binding motif (CXXC). The preferred mutation sites in the LXCXE-motif are C24 and E26. Preferred sites in the two CXXC motifs are C58, C61, C91 and C94. However, any mutations in these regions can be envisaged to be substituted for the reduction of binding functions and thus abolish the oncogenic effects of E7. Sites for potential mutations are shown in SEQ ID NO:23.
Signal Peptide:
A signal peptide at the N-terminal end of the nascent polypeptide directs the molecule into the ER before transport to into the Golgi complex. The signal peptide is cleaved off by signal peptidase once it has served its purpose of targeting and importing the protein to the ER. These signal peptides are generally between 15 and 30 amino acids, but can have more than 50 residues (Martoglio, B. et al., Trends in Cell Biology, 1998, Knappskog, S. et al., J Biotechnol, 2007). The native signal peptide may be replaced by signal peptides from any mammalian, prokaryotic or marine origin. Commonly used signal peptides are e.g. humanlL-2 and human albumin due to their natural ability to secrete large amounts of protein. The choice of signal peptide can have a considerable impact on the amount of synthesized and secreted protein.
In some embodiments, the signal peptide used in the protein construct according to the present invention is derived from a chemokine protein, such as the signal sequence of LD78beta.
In some embodiments the signal peptide is not derived from pLNOH2 (B1-8 variable immunoglobulin leader) disclosed in the international application with International Application No: PCT/EP2011/060628.
In some embodiments the signal peptide is not derived from an immunoglobulin gene.
The term âhonnodinneric proteinâ as used herein refers to a protein comprising two individual identical strands of amino acids, or subunits held together as a single, dimeric protein by hydrogen bonding, ionic (charged) interactions, actual covalent disulfide bonding, or some combination of these interactions.
The term âdimerization motifâ, as used herein, refers to the sequence of amino acids between the antigenic unit and the targeting unit comprising the hinge region and the optional second domain that may contribute to the dimerization. This second domain may be an immunoglobulin domain, and optionally the hinge region and the second domain are connected through a linker. Accordingly the dimerization motif serves to connect the antigenic unit and the targeting unit, but also contain the hinge region that facilitates the dimerization of the two monomeric proteins into a homodimeric protein according to the invention.
The term âtargeting unitâ as used herein refers to a unit that delivers the protein with its antigen to mouse or human APC for MHC class II-restricted presentation to CD4+ T cells or for providing cross presentation to CD8+ T cells by MHC class I restriction. The targeting unit used in the constructs according to the present invention is derived from or identical to mature LD78-beta.
The term âantigenic unitâ as used herein refers to any molecule, such as a peptide which is able to be specifically recognized by an antibody or other component of the immune system, such as a surface receptor on T-cells. Included within this definition are also immunogens that are able to induce an immune response. The terms âepitopeâ or âantigenic epitopeâ is used to refer to a distinct molecular surface, such as a molecular surface provided by a short peptide sequence within an antigenic unit. In some embodiments the antigenic unit comprises two ore more antigenic epitopes. The antigenic unit used in the constructs according to the present invention is derived from or identical to the early gene products E6 and E7 from HPV, such as from HPV16 or HPV18.
The term âhinge regionâ refers to a peptide sequence of the homodimeric protein that facilitates the dimerization, such as through the formation of an interchain covalent bond(s), e.g. disulfide bridge(s). The hinge region may be Ig derived, such as hinge exons h1+h4 of an Ig, such as IgG3.
Specific Embodiments of the Invention:
As described above, the present invention relates to a homodimeric protein of two identical amino acid chains, each amino acid chain comprising (1) a signal peptide, (2) a targeting unit, (3) a dimerization motif, and (4) an antigenic unit, said targeting unit comprising an amino acid sequence having at least 80% sequence identity to the amino acid sequence 24-93 of SEQ ID NO:1, and an antigenic unit comprising an amino acid sequence of human papillomavirus (HPV), such as an antigenic unit comprising an amino acid sequence of HPV16 and/or HPV18, such as an antigenic unit derived from early proteins E6 and/or E7 of HPV16 and/or HPV18. In some embodiments according to the present invention, the targeting unit, dimerization motif and antigenic unit in the amino acid chain are in the N-terminal to C-terminal order of targeting unit, dimerization motif and antigenic unit.
In some embodiments, the antigenic unit used in the constructs according to the present invention is derived from HPV16, such as from early proteins E6 and/or E7.
In some embodiments, the antigenic unit used in the constructs according to the present invention is derived from E6 of HPV16.
In some embodiments, the antigenic unit used in the constructs according to the present invention is derived from E7 of HPV16.
In some embodiments, the antigenic unit used in the constructs according to the present invention is derived from HPV18, such as from early proteins E6 and/or E7.
In some embodiments, the antigenic unit used in the constructs according to the present invention is derived from E6 of HPV18.
In some embodiments, the antigenic unit used in the constructs according to the present invention is derived from E7 of HPV18.
In some embodiments according to the present invention, the signal peptide consists of an amino acid sequence having at least 80% sequence identity to the amino acid sequence 1-23 of SEQ ID NO:1.
In some embodiments according to the present invention, the signal peptide consists of an amino acid sequence having at least 85%, such as at least 86%, such as at least 87%, such as at least 88%, such as at least 89%, such as at least 90%, such as at least 91%, such as at least 92%, such as at least 93%, such as at least 94%, such as at least 95%, such as at least 96%, such as at least 97%, such as at least 98%, such as at least 99%, such as 100% sequence identity to the amino acid sequence 1-23 of SEQ ID NO:1.
In some embodiments according to the present invention, the targeting unit consists of an amino acid sequence having at least 85%, such as at least 86%, such as at least 87%, such as at least 88%, such as at least 89%, such as at least 90%, such as at least 91%, such as at least 92%, such as at least 93%, such as at least 94%, such as at least 95%, such as at least 96%, such as at least 97%, such as at least 98%, such as at least 99% sequence identity to the amino acid sequence 24-93 of SEQ ID NO:1.
In some embodiments according to the present invention, the dimerization motif comprises a hinge region and optionally another domain that facilitate dimerization, such as an immunoglobulin domain, optionally connected through a linker.
In some embodiments according to the present invention, the hinge region is Ig derived, such as derived from IgG3.
In some embodiments according to the present invention, the hinge region has the ability to form one, two, or several covalent bonds. In some embodiments according to the present invention, the covalent bond is a disulphide bridge.
In some embodiments according to the present invention, the immunoglobulin domain of the dimerization motif is a carboxyterminal C domain, or a sequence that is substantially identical to the C domain or a variant thereof.
In some embodiments according to the present invention, the carboxyterminal C domain is derived from IgG.
In some embodiments according to the present invention, the immunoglobulin domain of the dimerization motif has the ability to homodimerize.
In some embodiments according to the present invention, the immunoglobulin domain has the ability to homodimerize via noncovalent interactions. In some embodiments according to the present invention, the noncovalent interactions are hydrophobic interactions.
In some embodiments according to the present invention, the dimerization domain does not comprise the CH2 domain.
In some embodiments according to the present invention, the dimerization motif consists of hinge exons h1 and h4 connected through a linker to a CH3 domain of human IgG3.
In some embodiments according to the present invention, the dimerization motif consist of an amino acid sequence having at least 80% sequence identity to the amino acid sequence 94-237 of SEQ ID NO:3.
In some embodiments according to the present invention, the linker is a G3S2G3SG linker.
In some embodiments according to the present invention, the antigenic unit and the dimerization motif is connected through a linker, such as a GLGGL linker or a GLSGL linker.
In some embodiments according to the present invention, the targeting unit consists of amino acids 24-93 of SEQ ID NO:1, or a variant thereof.
In some embodiments according to the present invention, the homodimeric protein have increased affinity for any one chemokine receptor selected from CCR1, CCR3 and CCR5 as compared to the affinity of the same homodimeric protein with the targeting unit consisting of amino acids 24-93 of SEQ ID NO:1, or a variant thereof.
In some embodiments according to the present invention, the antigenic unit comprises an amino acid sequence having at least 80%, such as at least 81%, such as at least 82%, such as at least 83%, such as at least 84%, such as at least 85%, such as at least 86%, such as at least 87%, such as at least 88%, such as at least 89%, such as at least 90%, such as at least 91%, such as at least 92%, such as at least 93%, such as at least 94%, such as at least 95%, such as at least 96%, such as at least 97%, such as at least 98%, such as at least 99% sequence identity to the amino acid sequence 243-293 of SEQ ID NO:3.
In some embodiments according to the present invention, the antigenic unit consists of an amino acid sequence having at least 80%, such as at least 81%, such as at least 82%, such as at least 83%, such as at least 84%, such as at least 85%, such as at least 86%, such as at least 87%, such as at least 88%, such as at least 89%, such as at least 90%, such as at least 91%, such as at least 92%, such as at least 93%, such as at least 94%, such as at least 95%, such as at least 96%, such as at least 97%, such as at least 98%, such as at least 99% sequence identity to the amino acid sequence 243-293 of SEQ ID NO:3.
In some embodiments according to the present invention, the antigenic unit comprises one or more amino acid substitutions at a position selected from the list consisting of F47, L50, C63, C106 and 1128 of SEQ ID NO:22, or a deletion involving one or more amino acid selected from the list consisting of Y43-L50 of SEQ ID NO:22.
In some embodiments according to the present invention, the antigenic unit comprises not more than 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 12, 14, 16, 18 or 20 amino acid substitutions and/or deletions relative to SEQ ID NO:22.
In some embodiments according to the present invention, the antigenic unit comprises the amino acid sequence 243-293 of SEQ ID NO:3, SEQ ID NO:5, SEQ ID NO:7, or SEQ ID NO:9, or a variant or antigenic fragment thereof.
In some embodiments according to the present invention, the antigenic unit consists of the amino acid sequence 243-293 of SEQ ID NO:3, SEQ ID NO:5, SEQ ID NO:7, or SEQ ID NO:9, or a variant or antigenic fragment thereof.
In some embodiments according to the present invention, the antigenic unit comprises an amino acid sequence having at least 80%, such as at least 81%, such as at least 82%, such as at least 83%, such as at least 84%, such as at least 85%, such as at least 86%, such as at least 87%, such as at least 88%, such as at least 89%, such as at least 90%, such as at least 91%, such as at least 92%, such as at least 93%, such as at least 94%, such as at least 95%, such as at least 96%, such as at least 97%, such as at least 98%, such as at least 99% sequence identity to the amino acid sequence 243-340 of SEQ ID NO:11.
In some embodiments according to the present invention, the antigenic unit consists of an amino acid sequence having at least 80%, such as at least 81%, such as at least 82%, such as at least 83%, such as at least 84%, such as at least 85%, such as at least 86%, such as at least 87%, such as at least 88%, such as at least 89%, such as at least 90%, such as at least 91%, such as at least 92%, such as at least 93%, such as at least 94%, such as at least 95%, such as at least 96%, such as at least 97%, such as at least 98%, such as at least 99% sequence identity to the amino acid sequence 243-340 of SEQ ID NO:11.
In some embodiments according to the present invention, the antigenic unit comprises one or more amino acid substitutions at a position selected from the list consisting of C24, E26, C58, C61, C91, and C94 of SEQ ID NO:23, or a deletion involving one or more amino acid selected from the list consisting of L22-E26 and/or C58-C61 and/or C91-595 of SEQ ID NO:23.
In some embodiments according to the present invention, the antigenic unit comprises not more than 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 12, 14, 16, 18 or 20 amino acid substitutions and/or deletions relative to SEQ ID NO:23.
In some embodiments according to the present invention, the antigenic unit comprises the amino acid sequence 243-340 of SEQ ID NO:11, SEQ ID NO:13, SEQ ID NO:15, or SEQ ID NO:17, or a variant or antigenic fragment thereof.
In some embodiments according to the present invention, the antigenic unit consists of the amino acid sequence 243-340 of SEQ ID NO:11, SEQ ID NO:13, SEQ ID NO:15, or SEQ ID NO:17, or a variant or antigenic fragment thereof.
In some embodiments according to the present invention, the antigenic unit comprises an amino acid sequence having at least 80%, such as at least 81%, such as at least 82%, such as at least 83%, such as at least 84%, such as at least 85%, such as at least 86%, such as at least 87%, such as at least 88%, such as at least 89%, such as at least 90%, such as at least 91%, such as at least 92%, such as at least 93%, such as at least 94%, such as at least 95%, such as at least 96%, such as at least 97%, such as at least 98%, such as at least 99% sequence identity to the amino acid sequence 243-501 of SEQ ID NO:19, SEQ ID NO:21, SEQ ID NO:32, or SEQ ID NO:34.
In some embodiments according to the present invention, the antigenic unit consists of an amino acid sequence having at least 80%, such as at least 81%, such as at least 82%, such as at least 83%, such as at least 84%, such as at least 85%, such as at least 86%, such as at least 87%, such as at least 88%, such as at least 89%, such as at least 90%, such as at least 91%, such as at least 92%, such as at least 93%, such as at least 94%, such as at least 95%, such as at least 96%, such as at least 97%, such as at least 98%, such as at least 99% sequence identity to the amino acid sequence 243-501 of SEQ ID NO:19, SEQ ID NO:21, SEQ ID NO:32, or SEQ ID NO:34.
In some embodiments according to the present invention, the antigenic unit comprising an amino acid sequence of human papillomavirus 16 (HPV16) derived from both early proteins E6 and E7.
In some embodiments according to the present invention, the antigenic unit comprising an amino acid sequence of human papillomavirus 18 (HPV18) derived from both early proteins E6 and E7.
In some embodiments according to the present invention, the antigenic unit comprises one or more amino acid substitutions at a position selected from the list consisting of F47, L50G, C63, C106, I128T of SEQ ID NO:22 and C24, E26, C58, C61, C91, C94 of SEQ ID NO:23.
In some embodiments according to the present invention, the antigenic unit comprises not more than 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 12, 14, 16, 18 or 20 amino acid substitutions and/or deletions relative to SEQ ID NO:22 and SEQ ID NO:23.
In some embodiments according to the present invention, the antigenic unit consists of the amino acid sequence 243-501 of SEQ ID NO:19, SEQ ID NO:21, SEQ ID NO:32, or SEQ ID NO:34, or a variant or antigenic fragment thereof.
In some embodiments according to the present invention, the amino acid chain consists of an amino acid sequence selected from the list consisting of SEQ ID NO:3, SEQ ID NO:5, SEQ ID NO:7, SEQ ID NO:9, SEQ ID NO:11, SEQ ID NO:13, SEQ ID NO:15, SEQ ID NO:17, SEQ ID NO:19, SEQ ID NO:21, SEQ ID NO:32, and SEQ ID NO:34, or a variant or antigenic fragment thereof.
In some embodiments according to the present invention, the antigenic unit comprises an amino acid sequence having at least 80%, such as at least 81%, such as at least 82%, such as at least 83%, such as at least 84%, such as at least 85%, such as at least 86%, such as at least 87%, such as at least 88%, such as at least 89%, such as at least 90%, such as at least 91%, such as at least 92%, such as at least 93%, such as at least 94%, such as at least 95%, such as at least 96%, such as at least 97%, such as at least 98%, such as at least 99% sequence identity to any one amino acid sequence selected from SEQ ID NO:22, SEQ ID NO:23, SEQ ID NO:24, and SEQ ID NO:25.
In some embodiments according to the present invention, the antigenic unit consist of an amino acid sequence having at least 80%, such as at least 81%, such as at least 82%, such as at least 83%, such as at least 84%, such as at least 85%, such as at least 86%, such as at least 87%, such as at least 88%, such as at least 89%, such as at least 90%, such as at least 91%, such as at least 92%, such as at least 93%, such as at least 94%, such as at least 95%, such as at least 96%, such as at least 97%, such as at least 98%, such as at least 99% sequence identity to any one amino acid sequence selected from SEQ ID NO:22, SEQ ID NO:23, SEQ ID NO:24, and SEQ ID NO:25.
In some embodiments the homodimeric protein according to the present invention, is in its mature form without any signal peptide sequence.
In some embodiments the nucleic acid molecule according to the present invention is human codon optimized.
It is to be understood that a human codon optimized nucleic acid molecule according to the present invention comprises one or more nucleic acid substitution as compared to the wild type sequence, which substitution provides for a codon with higher frequency of usage in human coding regions. Frequency of codon usage in homo sapiens can be found at http://biowiki.edu-wiki.org/en/codon_table
In some embodiments the nucleic acid molecule according to the present invention is comprising any one of nucleotide sequences selected from the list consisting of SEQ ID NO:2, SEQ ID NO:4, SEQ ID NO:6, SEQ ID NO:8, SEQ ID NO:10, SEQ ID NO:12, SEQ ID NO:14, SEQ ID NO:16, SEQ ID NO:18, SEQ ID NO:20, SEQ ID NO:31 and SEQ ID NO:33, or a variant thereof.
In some embodiments the nucleic acid molecule according to the present invention is comprised by a vector.
In some embodiments the nucleic acid molecule according to the present invention is formulated for administration to a patient to induce production of the homodimeric protein in said patient.
In some embodiments the vaccine according to the present invention further comprises a pharmaceutically acceptable carrier and/or adjuvant.
In some embodiments, the method of treating or preventing a HPV induced disease or condition, such as a cancer or an infectious disease caused by HPV in a patient according to the present invention comprises administering to the patient in need thereof of a nucleic acid molecule, such as a DNA, according to the present invention with a subsequent step of electroporation. In some embodiments the administration is performed intra dermal or intra muscular.
Construction and Expression of the Vaccines.
Gene sequences were designed according to the following structure: 1: native leader sequence for human LD78 b, 2: full length LD78b sequence. 3: Human hinge-region 1 from IgG3. 4: Human hinge region 4 from IgG3. 5: Glycine-Serine linker. 6: Human CH3 domain from IgG3. 7: Glycine-Leucine linker. 8: wildtype and mutant Human papilloma virus oncogenes E6, E7 and fusion proteins of both E6 and E7 divided by a Glycine-Serine linker. The constructs are designated according to their E6 and or E7 composition as follows:
VB1001: Vaccibody-E6 wild type;
VB1005: Vaccibody-E7 wild type;
The mutants are designated according to the amino acid position in the corresponding native E6 or E7 sequence.
VB1002: Vaccibody-E6 C63R;
VB1003: Vaccibody-E6 C106R;
VB1004: Vaccibody-E6 F47R, C63R, C106R;
VB1006: Vaccibody-E7 C24G, E26G;
VB1007: Vaccibody-E7 C24G, E26G, C58G, C61G;
VB1008: Vaccibody-E7 C24G, E26G, C91G, C94G;
VB1009: Vaccibody-E7 C24G, E26G/E6 F47R, C63R, C106R;
VB1016: Vaccibody-E7 C24G, E26G/E6 C63R, C106R;
VB1020: Vaccibody-E7 C24G, E26G/E6 F47R, C63R, C106R human codon optimized
VB1021: Vaccibody-E7 C24G, E26G/E6 F47R, L50G, C106R, I128T human codon optimized
Control vaccines composed of only the antigens were included:
Control 1: E7 C24G, E26G/E6 F47R, C63R, C106R; Control 2: E7 C24G, E26G/E6 C63R, C106R
All gene sequences were ordered from Aldevron (Fargo ND, USA) or Eurofins MWG GmbH and cloned into the expression vector pUMVC4a.
All constructs were transfected in to 293E cells and verified expression of intact vaccibody proteins were performed by dot blot and ELISA (data not shown). All amino acid sequences except for Controls 1 and 2 are shown as SEQ IDs.
Immune Response Studies
VB 1009,VB1016, VB1020 and VB1021 were selected as vaccine candidates with their corresponding controls 1 and 2 respectively. As a negative control empty pUMVC4a vector was utilized.
25, 12.5 and 1.4 Îźg plasmid DNA of each candidate was injected intradermal in the lower back of C57B1/6 mice followed by electroporation, Dermavax, Cellectis (Paris, France). 7 days later the mice were boosted with similar amounts of vaccines and control plasmids. At day 21 the mice were killed and spleens were harvested.
The T cell responses were calculated by ELISPOT. (FIGS. 3a, b and c)
Therapeutic Effect
VB1016, VB1020 and VB1021 with the corresponding controls 1 and 2 were selected as the vaccine candidate for therapeutic vaccine studies.
5Ă104 or 5Ă105 TC-1 cells (Johns Hopkins University, Baltimore, USA, Lin K Y et al., Cancer Res, 1996) were injected in the neck or thigh region of C57B1/6 mice. After days 3 and 10 or day 3,7 and 10, the mice were vaccinated with 2 Îźg, 10 Îźg, 12.5 Îźg or 20 Îźg of plasmid DNA followed by electroporation, Dermavax, Cellectis France. Tumor size were measured two to three times a week up until day 49 after TC-1 cell injection (FIGS. 4, 5 and 6)
A therapeutic DNA vaccine to be used may be prepared by GMP manufacturing of the plasmid vaccine according to regulatory authorities' guidelines, including GMP cell banking, GMP manufacturing of drug substance and drug product, ICH stability studies and Fill & Finish of the DNA vaccine. The DNA vaccine may be formulated by dissolving in a saline solution, such as 10nM Tris, 1mM EDTA at a concentration of 2-5 mg/ml. The vaccine may be administered either intra-dermal or intra-muscular with or without following electroporation.
SEQUENCES:
C-C motif chemokine 3-like 1 precursor including signal peptide (aa 1-23 in bold) and mature peptide (LD78-beta), aa 24-93 (SEQ ID NO:1):
| MQVSTAALAVLLCTMALCNQVLSAPLAADTPTACCFSYTSRQIPQNFIAD |
| YFETSSQCSKPSVIFLTKRGRQVCADPSEEWVQKYVSDLELSA |
The specific DNA and corresponding amino acid sequences of vaccibody HPV constructs:
E6 or E7 single constructs:
For the purpose of illustration only, the different domains of the constructs are separated by an â|â with the domains in the following order: Signal peptide human MIP-1Îą|Hinge h1|Hinge h4|Gly-Ser Linker or Gly-Leu linkers|hCH3 IgG3|Gly-Ser Linker or Gly-Leu linkers|wildtype or mutant full length E6 or E7. Amino acids or nucleotides in bold illustrates sites of mutations.
| DNAâsequenceâofâVB1001â(SEQâIDâNO:â2): | |
| ATGCAGGTCTCCACTGCTGCCCTTGCCGTCCTCCTCTGCACCATGGCTCTCTGCAACCAGGTCCTCTCT|GCACCACTT | |
| GCTGCTGACACGCCGACCGCCTGCTGCTTCAGCTACACCTCCCGACAGATTCCACAGAATTTCATAGCTGACTACTTTG | |
| AGACGAGCAGCCAGTGCTCCAAGCCCAGTGTCATCTTCCTAACCAAGAGAGGCCGGCAGGTCTGTGCTGACCCCAGTGA | |
| GGAGTGGGTCCAGAAATACGTCAGTGACCTGGAGCTGAGTGCC|GAGCTCAAAACCCCACTTGGTGACACAACTCACAC | |
| A|GAGCCCAAATCTTGTGACACACCTCCCCCGTGCCCAAGGTGCCCA|GGCGGTGGAAGCAGCGGAGGTGGAAGTGGA| | |
| GGACAGCCCCGAGAACCACAGGTGTACACCCTGCCCCCATCCCGGGAGGAGATGACCAAGAACCAGGTCAGCCTGACCT | |
| GCCTGGTCAAAGGCTTCTACCCCAGCGACATCGCCGTGGAGTGGGAGAGCAGCGGGCAGCCGGAGAACAACTACAACAC | |
| CACGCCTCCCATGCTGGACTCCGACGGCTCCTTCTTCCTCTACAGCAAGCTCACCGTGGACAAGAGCAGGTGGCAGCAG | |
| GGGAACATCTTCTCATGCTCCGTGATGCATGAGGCTCTGCACAACCGCTTCACGCAGAAGAGCCTCTCCCTGTCTCCGG | |
| GTAAA|GGCCTCGGTGGCCTG|ATGTTTCAGGACCCACAGGAGCGACCCAGAAAGTTACCACAGTTATGCACAGAGCTG | |
| CAAACAACTATACATGATATAATATTAGAATGTGTGTACTGCAAGCAACAGTTACTGCGACGTGAGGTATATGACTTTG | |
| CTTTTCGGGATTTATGCATAGTATATAGAGATGGGAATCCATATGCTGTATGTGATAAATGTTTAAAGTTTTATTCTAA | |
| AATTAGTGAGTATAGACATTATTGTTATAGTTTGTATGGAACAACATTAGAACAGCAATACAACAAACCGTTGTGTGAT | |
| TTGTTAATTAGGTGTATTAACTGTCAAAAGCCACTGTGTCCTGAAGAAAAGCAAAGACATCTGGACAAAAAGCAAAGAT | |
| TCCATAATATAAGGGGTCGGTGGACCGGTCGATGTATGTCTTGTTGCAGATCATCAAGAACACGTAGAGAAACCCAGCT | |
| GTAA | |
| ProteinâsequenceâofâVB1001â(Homodimericâconstructâaccordingâtoâthe | |
| inventionâwithâE6,âSEQâIDâNO:â3):âAminoâacidâsequenceâ393âaminoâacids. | |
| MQVSTAALAVLLCTMALCNQVLS|APLAADTPTACCFSYTSRQIPQNFIAD | |
| YFETSSQCSKPSVIFLTKRGRQVCADPSEEWVQKYVSDLELSA|ELKTPLG | |
| DTTHT|EPKSCDTPPPCPRCP|GGGSSGGGSG|GQPREPQVYTLPPSREEM | |
| TKNQVSLTCLVKGFYPSDIAVEWESSGQPENNYNTTPPMLDSDGSFFLYSK | |
| LTVDKSRWQQGNIFSCSVMHEALHNRFTQKSLSLSPGK|GLGGL|MFQDPQ | |
| ERPRKLPQLCTELQTTIHDIILECVYCKQQLLRREVYDFAFRDLCIVYRDG | |
| NPYAVCDKCLKFYSKISEYRHYCYSLYGTTLEQQYNKPLCDLLIRCINCQK | |
| PLCPEEKQRHLDKKQRFHNIRGRWTGRCMSCCRSSRTRRETQL* | |
| DNAâsequenceâofâVB1002â(SEQâIDâNO:â4): | |
| ATGCAGGTCTCCACTGCTGCCCTTGCCGTCCTCCTCTGCACCATGGCTCTCTGCAACCAGGTCCTCTCT|GCACCACTT | |
| GCTGCTGACACGCCGACCGCCTGCTGCTTCAGCTACACCTCCCGACAGATTCCACAGAATTTCATAGCTGACTACTTTG | |
| AGACGAGCAGCCAGTGCTCCAAGCCCAGTGTCATCTTCCTAACCAAGAGAGGCCGGCAGGTCTGTGCTGACCCCAGTGA | |
| GGAGTGGGTCCAGAAATACGTCAGTGACCTGGAGCTGAGTGCC|GAGCTCAAAACCCCACTTGGTGACACAACTCACAC | |
| A|GAGCCCAAATCTTGTGACACACCTCCCCCGTGCCCAAGGTGCCCA|GGCGGTGGAAGCAGCGGAGGTGGAAGTGGA| | |
| GGACAGCCCCGAGAACCACAGGTGTACACCCTGCCCCCATCCCGGGAGGAGATGACCAAGAACCAGGTCAGCCTGACCT | |
| GCCTGGTCAAAGGCTTCTACCCCAGCGACATCGCCGTGGAGTGGGAGAGCAGCGGGCAGCCGGAGAACAACTACAACAC | |
| CACGCCTCCCATGCTGGACTCCGACGGCTCCTTCTTCCTCTACAGCAAGCTCACCGTGGACAAGAGCAGGTGGCAGCAG | |
| GGGAACATCTTCTCATGCTCCGTGATGCATGAGGCTCTGCACAACCGCTTCACGCAGAAGAGCCTCTCCCTGTCTCCGG | |
| GTAAA|GGCCTCGGTGGCCTG|ATGTTTCAGGACCCACAGGAGCGACCCAGAAAGTTACCACAGTTATGCACAGAGCTG | |
| CAAACAACTATACATGATATAATATTAGAATGTGTGTACTGCAAGCAACAGTTACTGCGACGTGAGGTATATGACTTTG | |
| CTTTTCGGGATTTATGCATAGTATATAGAGATGGGAATCCATATGCTGTACGAGATAAATGTTTAAAGTTTTATTCTAA | |
| AATTAGTGAGTATAGACATTATTGTTATAGTTTGTATGGAACAACATTAGAACAGCAATACAACAAACCGTTGTGTGAT | |
| TTGTTAATTAGGTGTATTAACTGTCAAAAGCCACTGTGTCCTGAAGAAAAGCAAAGACATCTGGACAAAAAGCAAAGAT | |
| TCCATAATATAAGGGGTCGGTGGACCGGTCGATGTATGTCTTGTTGCAGATCATCAAGAACACGTAGAGAAACCCAGCT | |
| GTAA | |
| ProteinâsequenceâofâVB1002â(Homodimericâconstructâaccordingâtoâthe | |
| invention,âSEQâIDâNO:â5):âAminoâacidâsequence,â393âaminoâacids. | |
| MQVSTAALAVLLCTMALCNQVLS|APLAADTPTACCFSYTSRQIPQNFIAD | |
| YFETSSQCSKPSVIFLTKRGRQVCADPSEEWVQKYVSDLELSA|ELKTPLG | |
| DTTHT|EPKSCDTPPPCPRCP|GGGSSGGGSG|GQPREPQVYTLPPSREEM | |
| TKNQVSLTCLVKGFYPSDIAVEWESSGQPENNYNTTPPMLDSDGSFFLYSK | |
| LTVDKSRWQQGNIFSCSVMHEALHNRFTQKSLSLSPGK|GLGGL|MFQDPQ | |
| ERPRKLPQLCTELQTTIHDIILECVYCKQQLLRREVYDFAFRDLCIVYRDG | |
| NPYAVRDKCLKFYSKISEYRHYCYSLYGTTLEQQYNKPLCDLLIRCINCQK | |
| PLCPEEKQRHLDKKQRFHNIRGRWTGRCMSCCRSSRTRRETQL* | |
| DNAâsequenceâofâVBâ1003â(SEQâIDâNO:â6): | |
| ATGCAGGTCTCCACTGCTGCCCTTGCCGTCCTCCTCTGCACCATGGCTCTCTGCAACCAGGTCCTCTCT|GCACCACTT | |
| GCTGCTGACACGCCGACCGCCTGCTGCTTCAGCTACACCTCCCGACAGATTCCACAGAATTTCATAGCTGACTACTTTG | |
| AGACGAGCAGCCAGTGCTCCAAGCCCAGTGTCATCTTCCTAACCAAGAGAGGCCGGCAGGTCTGTGCTGACCCCAGTGA | |
| GGAGTGGGTCCAGAAATACGTCAGTGACCTGGAGCTGAGTGCC|GAGCTCAAAACCCCACTTGGTGACACAACTCACAC | |
| A|GAGCCCAAATCTTGTGACACACCTCCCCCGTGCCCAAGGTGCCCA|GGCGGTGGAAGCAGCGGAGGTGGAAGTGGA| | |
| GGACAGCCCCGAGAACCACAGGTGTACACCCTGCCCCCATCCCGGGAGGAGATGACCAAGAACCAGGTCAGCCTGACCT | |
| GCCTGGTCAAAGGCTTCTACCCCAGCGACATCGCCGTGGAGTGGGAGAGCAGCGGGCAGCCGGAGAACAACTACAACAC | |
| CACGCCTCCCATGCTGGACTCCGACGGCTCCTTCTTCCTCTACAGCAAGCTCACCGTGGACAAGAGCAGGTGGCAGCAG | |
| GGGAACATCTTCTCATGCTCCGTGATGCATGAGGCTCTGCACAACCGCTTCACGCAGAAGAGCCTCTCCCTGTCTCCGG | |
| GTAAA|GGCCTCGGTGGCCTG|ATGTTTCAGGACCCACAGGAGCGACCCAGAAAGTTACCACAGTTATGCACAGAGCTG | |
| CAAACAACTATACATGATATAATATTAGAATGTGTGTACTGCAAGCAACAGTTACTGCGACGTGAGGTATATGACTTTG | |
| CTTTTCGGGATTTATGCATAGTATATAGAGATGGGAATCCATATGCTGTATGTGATAAATGTTTAAAGTTTTATTCTAA | |
| AATTAGTGAGTATAGACATTATTGTTATAGTTTGTATGGAACAACATTAGAACAGCAATACAACAAACCGTTGTGTGAT | |
| TTGTTAATTAGGTGTATTAACCGACAAAAGCCACTGTGTCCTGAAGAAAAGCAAAGACATCTGGACAAAAAGCAAAGAT | |
| TCCATAATATAAGGGGTCGGTGGACCGGTCGATGTATGTCTTGTTGCAGATCATCAAGAACACGTAGAGAAACCCAGCT | |
| GTAA | |
| ProteinâsequenceâofâVB1003â(Homodimericâconstructâaccordingâtoâthe | |
| invention,âSEQâIDâNO:â7):âAminoâacidâsequence,â393âaminoâacids. | |
| MQVSTAALAVLLCTMALCNQVLS|APLAADTPTACCFSYTSRQIPQNFIAD | |
| YFETSSQCSKPSVIFLTKRGRQVCADPSEEWVQKYVSDLELSA|ELKTPLG | |
| DTTHT|EPKSCDTPPPCPRCP|GGGSSGGGSG|GQPREPQVYTLPPSREEM | |
| TKNQVSLTCLVKGFYPSDIAVEWESSGQPENNYNTTPPMLDSDGSFFLYSK | |
| LTVDKSRWQQGNIFSCSVMHEALHNRFTQKSLSLSPGK|GLGGL|MFQDPQ | |
| ERPRKLPQLCTELQTTIHDIILECVYCKQQLLRREVYDFAFRDLCIVYRDG | |
| NPYAVCDKCLKFYSKISEYRHYCYSLYGTTLEQQYNKPLCDLLIRCINRQK | |
| PLCPEEKQRHLDKKQRFHNIRGRWTGRCMSCCRSSRTRRETQL* | |
| DNAâsequenceâofâVB1004â(SEQâIDâNO:â8): | |
| ATGCAGGTCTCCACTGCTGCCCTTGCCGTCCTCCTCTGCACCATGGCTCTCTGCAACCAGGTCCTCTCT|GCACCACTT | |
| GCTGCTGACACGCCGACCGCCTGCTGCTTCAGCTACACCTCCCGACAGATTCCACAGAATTTCATAGCTGACTACTTTG | |
| AGACGAGCAGCCAGTGCTCCAAGCCCAGTGTCATCTTCCTAACCAAGAGAGGCCGGCAGGTCTGTGCTGACCCCAGTGA | |
| GGAGTGGGTCCAGAAATACGTCAGTGACCTGGAGCTGAGTGCC|GAGCTCAAAACCCCACTTGGTGACACAACTCACAC | |
| A|GAGCCCAAATCTTGTGACACACCTCCCCCGTGCCCAAGGTGCCCA|GGCGGTGGAAGCAGCGGAGGTGGAAGTGGA| | |
| GGACAGCCCCGAGAACCACAGGTGTACACCCTGCCCCCATCCCGGGAGGAGATGACCAAGAACCAGGTCAGCCTGACCT | |
| GCCTGGTCAAAGGCTTCTACCCCAGCGACATCGCCGTGGAGTGGGAGAGCAGCGGGCAGCCGGAGAACAACTACAACAC | |
| CACGCCTCCCATGCTGGACTCCGACGGCTCCTTCTTCCTCTACAGCAAGCTCACCGTGGACAAGAGCAGGTGGCAGCAG | |
| GGGAACATCTTCTCATGCTCCGTGATGCATGAGGCTCTGCACAACCGCTTCACGCAGAAGAGCCTCTCCCTGTCTCCGG | |
| GTAAA|GGCCTCGGTGGCCTG|ATGTTTCAGGACCCACAGGAGCGACCCAGAAAGTTACCACAGTTATGCACAGAGCTG | |
| CAAACAACTATACATGATATAATATTAGAATGTGTGTACTGCAAGCAACAGTTACTGCGACGTGAGGTATATGACTTTG | |
| CTCGACGGGATTTATGCATAGTATATAGAGATGGGAATCCATATGCTGTACGAGATAAATGTTTAAAGTTTTATTCTAA | |
| AATTAGTGAGTATAGACATTATTGTTATAGTTTGTATGGAACAACATTAGAACAGCAATACAACAAACCGTTGTGTGAT | |
| TTGTTAATTAGGTGTATTAACCGACAAAAGCCACTGTGTCCTGAAGAAAAGCAAAGACATCTGGACAAAAAGCAAAGAT | |
| TCCATAATATAAGGGGTCGGTGGACCGGTCGATGTATGTCTTGTTGCAGATCATCAAGAACACGTAGAGAAACCCAGCT | |
| GTAA | |
| ProteinâsequenceâofâVB1004â(Homodimericâconstructâaccordingâtoâthe | |
| invention,âSEQâIDâNO:â9):âAminoâacidâsequence,â393âaminoâacids. | |
| MQVSTAALAVLLCTMALCNQVLSAPLAADTPTACCFSYTSRQIPQNFIAD | |
| YFETSSQCSKPSVIFLTKRGRQVCADPSEEWVQKYVSDLELSAELKTPLG | |
| DTTHTEPKSCDTPPPCPRCPGGGSSGGGSGGQPREPQVYTLPPSREEMTK | |
| NQVSLTCLVKGFYPSDIAVEWESSGQPENNYNTTPPMLDSDGSFFLYSKL | |
| TVDKSRWQQGNIFSCSVMHEALHNRFTQKSLSLSPGKGLGGLMFQDPQER | |
| PRKLPQLCTELQTTIHDIILECVYCKQQLLRREVYDFARRDLCIVYRDGN | |
| PYAVRDKCLKFYSKISEYRHYCYSLYGTTLEQQYNKPLCDLLIRCINRQK | |
| PLCPEEKQRHLDKKQRFHNIRGRWTGRCMSCCRSSRTRRETQL* | |
| DNAâsequenceâofâVB1005â(SEQâIDâNO:â10): | |
| ATGCAGGTCTCCACTGCTGCCCTTGCCGTCCTCCTCTGCACCATGGCTCTCTGCAACCAGGTCCTCTCT|GCACCACTT | |
| GCTGCTGACACGCCGACCGCCTGCTGCTTCAGCTACACCTCCCGACAGATTCCACAGAATTTCATAGCTGACTACTTTG | |
| AGACGAGCAGCCAGTGCTCCAAGCCCAGTGTCATCTTCCTAACCAAGAGAGGCCGGCAGGTCTGTGCTGACCCCAGTGA | |
| GGAGTGGGTCCAGAAATACGTCAGTGACCTGGAGCTGAGTGCC|GAGCTCAAAACCCCACTTGGTGACACAACTCACAC | |
| A|GAGCCCAAATCTTGTGACACACCTCCCCCGTGCCCAAGGTGCCCA|GGCGGTGGAAGCAGCGGAGGTGGAAGTGGA| | |
| GGACAGCCCCGAGAACCACAGGTGTACACCCTGCCCCCATCCCGGGAGGAGATGACCAAGAACCAGGTCAGCCTGACCT | |
| GCCTGGTCAAAGGCTTCTACCCCAGCGACATCGCCGTGGAGTGGGAGAGCAGCGGGCAGCCGGAGAACAACTACAACAC | |
| CACGCCTCCCATGCTGGACTCCGACGGCTCCTTCTTCCTCTACAGCAAGCTCACCGTGGACAAGAGCAGGTGGCAGCAG | |
| GGGAACATCTTCTCATGCTCCGTGATGCATGAGGCTCTGCACAACCGCTTCACGCAGAAGAGCCTCTCCCTGTCTCCGG | |
| GTAAA|GGCCTCGGTGGCCTG|ATGCATGGAGATACACCTACATTGCATGAATATATGTTAGATTTGCAACCAGAGACA | |
| ACTGATCTCTACTGTTATGAGCAATTAAATGACAGCTCAGAGGAGGAGGATGAAATAGATGGTCCAGCTGGACAAGCAG | |
| AACCGGACAGAGCCCATTACAATATTGTAACCTTTTGTTGCAAGTGTGACTCTACGCTTCGGTTGTGCGTACAAAGCAC | |
| ACACGTAGACATTCGTACTTTGGAAGACCTGTTAATGGGCACACTAGGAATTGTGTGCCCCATCTGTTCTCAGAAACCA | |
| TAA | |
| ProteinâsequenceâofâVB1005â(Homodimericâconstructâaccordingâtoâthe | |
| inventionâwithâE7,âSEQâIDâNO:â11):âAminoâacidâsequence,â340âaminoâacids. | |
| MQVSTAALAVLLCTMALCNQVLS|APLAADTPTACCFSYTSRQIPQNFIAD | |
| YFETSSQCSKPSVIFLTKRGRQVCADPSEEWVQKYVSDLELSA|ELKTPLG | |
| DTTHT|EPKSCDTPPPCPRCP|GGGSSGGGSG|GQPREPQVYTLPPSREEM | |
| TKNQVSLTCLVKGFYPSDIAVEWESSGQPENNYNTTPPMLDSDGSFFLYSK | |
| LTVDKSRWQQGNIFSCSVMHEALHNRFTQKSLSLSPGK|GLGGL|MHGDTP | |
| TLHEYMLDLQPETTDLYCYEQLNDSSEEEDEIDGPAGQAEPDRAHYNIVTF | |
| CCKCDSTLRLCVQSTHVDIRTLEDLLMGTLGIVCPICSQKP* | |
| DNAâsequenceâofâVB1006â(SEQâIDâNO:â12): | |
| ATGCAGGTCTCCACTGCTGCCCTTGCCGTCCTCCTCTGCACCATGGCTCTCTGCAACCAGGTCCTCTCT|GCACCACTT | |
| GCTGCTGACACGCCGACCGCCTGCTGCTTCAGCTACACCTCCCGACAGATTCCACAGAATTTCATAGCTGACTACTTTG | |
| AGACGAGCAGCCAGTGCTCCAAGCCCAGTGTCATCTTCCTAACCAAGAGAGGCCGGCAGGTCTGTGCTGACCCCAGTGA | |
| GGAGTGGGTCCAGAAATACGTCAGTGACCTGGAGCTGAGTGCC|GAGCTCAAAACCCCACTTGGTGACACAACTCACAC | |
| A|GAGCCCAAATCTTGTGACACACCTCCCCCGTGCCCAAGGTGCCCA|GGCGGTGGAAGCAGCGGAGGTGGAAGTGGA| | |
| GGACAGCCCCGAGAACCACAGGTGTACACCCTGCCCCCATCCCGGGAGGAGATGACCAAGAACCAGGTCAGCCTGACCT | |
| GCCTGGTCAAAGGCTTCTACCCCAGCGACATCGCCGTGGAGTGGGAGAGCAGCGGGCAGCCGGAGAACAACTACAACAC | |
| CACGCCTCCCATGCTGGACTCCGACGGCTCCTTCTTCCTCTACAGCAAGCTCACCGTGGACAAGAGCAGGTGGCAGCAG | |
| GGGAACATCTTCTCATGCTCCGTGATGCATGAGGCTCTGCACAACCGCTTCACGCAGAAGAGCCTCTCCCTGTCTCCGG | |
| GTAAA|GGCCTCGGTGGCCTG|ATGCATGGAGATACACCTACATTGCATGAATATATGTTAGATTTGCAACCAGAGACA | |
| ACTGATCTCTACGGATATGGACAATTAAATGACAGCTCAGAGGAGGAGGATGAAATAGATGGTCCAGCTGGACAAGCAG | |
| AACCGGACAGAGCCCATTACAATATTGTAACCTTTTGTTGCAAGTGTGACTCTACGCTTCGGTTGTGCGTACAAAGCAC | |
| ACACGTAGACATTCGTACTTTGGAAGACCTGTTAATGGGCACACTAGGAATTGTGTGCCCCATCTGTTCTCAGAAACCA | |
| TAA | |
| ProteinâsequenceâofâVB1006â(Homodimericâconstructâaccordingâtoâthe | |
| invention,âSEQâIDâNO:â13):âAminoâacidâsequence,â340âaminoâacids. | |
| MQVSTAALAVLLCTMALCNQVLSAPLAADTPTACCFSYTSRQIPQNFIAD | |
| YFETSSQCSKPSVIFLTKRGRQVCADPSEEWVQKYVSDLELSAELKTPLG | |
| DTTHTEPKSCDTPPPCPRCPGGGSSGGGSGGQPREPQVYTLPPSREEMTK | |
| NQVSLTCLVKGFYPSDIAVEWESSGQPENNYNTTPPMLDSDGSFFLYSKL | |
| TVDKSRWQQGNIFSCSVMHEALHNRFTQKSLSLSPGKGLGGLMHGDTPTL | |
| HEYMLDLQPETTDLYGYGQLNDSSEEEDEIDGPAGQAEPDRAHYNIVTFC | |
| CKCDSTLRLCVQSTHVDIRTLEDLLMGTLGIVCPICSQKP* | |
| DNAâsequenceâofâVB1007â(SEQâIDâNO:â14): | |
| ATGCAGGTCTCCACTGCTGCCCTTGCCGTCCTCCTCTGCACCATGGCTCTCTGCAACCAGGTCCTCTCT|GCACCACTT | |
| GCTGCTGACACGCCGACCGCCTGCTGCTTCAGCTACACCTCCCGACAGATTCCACAGAATTTCATAGCTGACTACTTTG | |
| AGACGAGCAGCCAGTGCTCCAAGCCCAGTGTCATCTTCCTAACCAAGAGAGGCCGGCAGGTCTGTGCTGACCCCAGTGA | |
| GGAGTGGGTCCAGAAATACGTCAGTGACCTGGAGCTGAGTGCC|GAGCTCAAAACCCCACTTGGTGACACAACTCACAC | |
| A|GAGCCCAAATCTTGTGACACACCTCCCCCGTGCCCAAGGTGCCCA|GGCGGTGGAAGCAGCGGAGGTGGAAGTGGA| | |
| GGACAGCCCCGAGAACCACAGGTGTACACCCTGCCCCCATCCCGGGAGGAGATGACCAAGAACCAGGTCAGCCTGACCT | |
| GCCTGGTCAAAGGCTTCTACCCCAGCGACATCGCCGTGGAGTGGGAGAGCAGCGGGCAGCCGGAGAACAACTACAACAC | |
| CACGCCTCCCATGCTGGACTCCGACGGCTCCTTCTTCCTCTACAGCAAGCTCACCGTGGACAAGAGCAGGTGGCAGCAG | |
| GGGAACATCTTCTCATGCTCCGTGATGCATGAGGCTCTGCACAACCGCTTCACGCAGAAGAGCCTCTCCCTGTCTCCGG | |
| GTAAA|GGCCTCGGTGGCCTG|ATGCATGGAGATACACCTACATTGCATGAATATATGTTAGATTTGCAACCAGAGACA | |
| ACTGATCTCTACGGATATGGACAATTAAATGACAGCTCAGAGGAGGAGGATGAAATAGATGGTCCAGCTGGACAAGCAG | |
| AACCGGACAGAGCCCATTACAATATTGTAACCTTTGGATGCAAGGGAGACTCTACGCTTCGGTTGTGCGTACAAAGCAC | |
| ACACGTAGACATTCGTACTTTGGAAGACCTGTTAATGGGCACACTAGGAATTGTGTGCCCCATCTGTTCTCAGAAACCA | |
| TAA | |
| ProteinâsequenceâofâVB1007â(Homodimericâconstructâaccordingâtoâthe | |
| invention,âSEQâIDâNO:â15):âAminoâacidâsequence,â340âaminoâacids. | |
| MQVSTAALAVLLCTMALCNQVLSAPLAADTPTACCFSYTSRQIPQNFIAD | |
| YFETSSQCSKPSVIFLTKRGRQVCADPSEEWVQKYVSDLELSAELKTPLG | |
| DTTHTEPKSCDTPPPCPRCPGGGSSGGGSGGQPREPQVYTLPPSREEMTK | |
| NQVSLTCLVKGFYPSDIAVEWESSGQPENNYNTTPPMLDSDGSFFLYSKL | |
| TVDKSRWQQGNIFSCSVMHEALHNRFTQKSLSLSPGKGLGGLMHGDTPTL | |
| HEYMLDLQPETTDLYGYGQLNDSSEEEDEIDGPAGQAEPDRAHYNIVTFG | |
| CKGDSTLRLCVQSTHVDIRTLEDLLMGTLGIVCPICSQKP* | |
| DNAâsequenceâofâVB1008â(SEQâIDâNO:â16): | |
| ATGCAGGTCTCCACTGCTGCCCTTGCCGTCCTCCTCTGCACCATGGCTCTCTGCAACCAGGTCCTCTCT|GCACCACTT | |
| GCTGCTGACACGCCGACCGCCTGCTGCTTCAGCTACACCTCCCGACAGATTCCACAGAATTTCATAGCTGACTACTTTG | |
| AGACGAGCAGCCAGTGCTCCAAGCCCAGTGTCATCTTCCTAACCAAGAGAGGCCGGCAGGTCTGTGCTGACCCCAGTGA | |
| GGAGTGGGTCCAGAAATACGTCAGTGACCTGGAGCTGAGTGCC|GAGCTCAAAACCCCACTTGGTGACACAACTCACAC | |
| A|GAGCCCAAATCTTGTGACACACCTCCCCCGTGCCCAAGGTGCCCA|GGCGGTGGAAGCAGCGGAGGTGGAAGTGGA| | |
| GGACAGCCCCGAGAACCACAGGTGTACACCCTGCCCCCATCCCGGGAGGAGATGACCAAGAACCAGGTCAGCCTGACCT | |
| GCCTGGTCAAAGGCTTCTACCCCAGCGACATCGCCGTGGAGTGGGAGAGCAGCGGGCAGCCGGAGAACAACTACAACAC | |
| CACGCCTCCCATGCTGGACTCCGACGGCTCCTTCTTCCTCTACAGCAAGCTCACCGTGGACAAGAGCAGGTGGCAGCAG | |
| GGGAACATCTTCTCATGCTCCGTGATGCATGAGGCTCTGCACAACCGCTTCACGCAGAAGAGCCTCTCCCTGTCTCCGG | |
| GTAAA|GGCCTCGGTGGCCTG|ATGCATGGAGATACACCTACATTGCATGAATATATGTTAGATTTGCAACCAGAGACA | |
| ACTGATCTCTACGGATATGGACAATTAAATGACAGCTCAGAGGAGGAGGATGAAATAGATGGTCCAGCTGGACAAGCAG | |
| AACCGGACAGAGCCCATTACAATATTGTAACCTTTTGTTGCAAGTGTGACTCTACGCTTCGGTTGTGCGTACAAAGCAC | |
| ACACGTAGACATTCGTACTTTGGAAGACCTGTTAATGGGCACACTAGGAATTGTGGGACCCATCGGATCTCAGAAACCA | |
| TAA | |
| ProteinâsequenceâofâVB1008â(Homodimericâconstructâaccordingâtoâthe | |
| invention,âSEQâIDâNO:â17):âAminoâacidâsequence,â340âaminoâacids. | |
| MQVSTAALAVLLCTMALCNQVLSAPLAADTPTACCFSYTSRQIPQNFIAD | |
| YFETSSQCSKPSVIFLTKRGRQVCADPSEEWVQKYVSDLELSAELKTPLG | |
| DTTHTEPKSCDTPPPCPRCPGGGSSGGGSGGQPREPQVYTLPPSREEMTK | |
| NQVSLTCLVKGFYPSDIAVEWESSGQPENNYNTTPPMLDSDGSFFLYSKL | |
| TVDKSRWQQGNIFSCSVMHEALHNRFTQKSLSLSPGKGLGGLMHGDTPTL | |
| HEYMLDLQPETTDLYGYGQLNDSSEEEDEIDGPAGQAEPDRAHYNIVTFC | |
| CKCDSTLRLCVQSTHVDIRTLEDLLMGTLGIVGPIGSQKP* |
Constructs with E6 and E7:
For the purpose of illustration only, the different domains of the constructs are separated by an â|â with the domains in the following order: Signal peptide|human MIP-1Îą|Hinge h1|Hinge h4|Gly-Ser Linker or Gly-Leu linker|hCH3 IgG3|Gly-Ser Linker or Gly-Leu linker|E7 mutant|Gly-Ser Linker or Gly-Leu linker|E6 mutant. Amino acids or nucleotides in bold illustrates sites of mutations.
| DNAâsequenceâofâVB1009â(SEQâIDâNO:â18): | |
| ATGCAGGTCTCCACTGCTGCCCTTGCCGTCCTCCTCTGCACCATGGCTCTCTGCAACCAGGTCCTCTCT|GCACCACTT | |
| GCTGCTGACACGCCGACCGCCTGCTGCTTCAGCTACACCTCCCGACAGATTCCACAGAATTTCATAGCTGACTACTTTG | |
| AGACGAGCAGCCAGTGCTCCAAGCCCAGTGTCATCTTCCTAACCAAGAGAGGCCGGCAGGTCTGTGCTGACCCCAGTGA | |
| GGAGTGGGTCCAGAAATACGTCAGTGACCTGGAGCTGAGTGCC|GAGCTCAAAACCCCACTTGGTGACACAACTCACAC | |
| A|GAGCCCAAATCTTGTGACACACCTCCCCCGTGCCCAAGGTGCCCA|GGCGGTGGAAGCAGCGGAGGTGGAAGTGGA| | |
| GGACAGCCCCGAGAACCACAGGTGTACACCCTGCCCCCATCCCGGGAGGAGATGACCAAGAACCAGGTCAGCCTGACCT | |
| GCCTGGTCAAAGGCTTCTACCCCAGCGACATCGCCGTGGAGTGGGAGAGCAGCGGGCAGCCGGAGAACAACTACAACAC | |
| CACGCCTCCCATGCTGGACTCCGACGGCTCCTTCTTCCTCTACAGCAAGCTCACCGTGGACAAGAGCAGGTGGCAGCAG | |
| GGGAACATCTTCTCATGCTCCGTGATGCATGAGGCTCTGCACAACCGCTTCACGCAGAAGAGCCTCTCCCTGTCTCCGG | |
| GTAAA|GGCCTCGGTGGCCTG|ATGCATGGAGATACACCTACATTGCATGAATATATGTTAGATTTGCAACCAGAGACA | |
| ACTGATCTCTACGGATATGGACAATTAAATGACAGCTCAGAGGAGGAGGATGAAATAGATGGTCCAGCTGGACAAGCAG | |
| AACCGGACAGAGCCCATTACAATATTGTAACCTTTTGTTGCAAGTGTGACTCTACGCTTCGGTTGTGCGTACAAAGCAC | |
| ACACGTAGACATTCGTACTTTGGAAGACCTGTTAATGGGCACACTAGGAATTGTGTGCCCCATCTGTTCTCAGAAACCA | |
| |GGCGGTGGAAGCAGCGGAGGTGGAAGTGGA|ATGTTTCAGGACCCACAGGAGCGACCCAGAAAGTTACCACAGTTATG | |
| CACAGAGCTGCAAACAACTATACATGATATAATATTAGAATGTGTGTACTGCAAGCAACAGTTACTGCGACGTGAGGTA | |
| TATGACTTTGCTCGACGGGATTTATGCATAGTATATAGAGATGGGAATCCATATGCTGTACGAGATAAATGTTTAAAGT | |
| TTTATTCTAAAATTAGTGAGTATAGACATTATTGTTATAGTTTGTATGGAACAACATTAGAACAGCAATACAACAAACC | |
| GTTGTGTGATTTGTTAATTAGGTGTATTAACCGACAAAAGCCACTGTGTCCTGAAGAAAAGCAAAGACATCTGGACAAA | |
| AAGCAAAGATTCCATAATATAAGGGGTCGGTGGACCGGTCGATGTATGTCTTGTTGCAGATCATCAAGAACACGTAGAG | |
| AAACCCAGCTGTAA | |
| ProteinâsequenceâofâVB1009â(Homodimericâconstructâaccordingâtoâthe | |
| invention,âSEQâIDâNO:â19):âAminoâacidâsequence,â501âaminoâacids. | |
| MQVSTAALAVLLCTMALCNQVLS|APLAADTPTACCFSYTSRQIPQNFIAD | |
| YFETSSQCSKPSVIFLTKRGRQVCADPSEEWVQKYVSDLELSA|ELKTPLG | |
| DTTHT|EPKSCDTPPPCPRCP|GGGSSGGGSG|GQPREPQVYTLPPSREEM | |
| TKNQVSLTCLVKGFYPSDIAVEWESSGQPENNYNTTPPMLDSDGSFFLYSK | |
| LTVDKSRWQQGNIFSCSVMHEALHNRFTQKSLSLSPGK|GLGGL|MHGDTP | |
| TLHEYMLDLQPETTDLYGYGQLNDSSEEEDEIDGPAGQAEPDRAHYNIVTF | |
| CCKCDSTLRLCVQSTHVDIRTLEDLLMGTLGIVCPICSQKP|GGGSSGGGS | |
| G|MFQDPQERPRKLPQLCTELQTTIHDIILECVYCKQQLLRREVYDFARRD | |
| LCIVYRDGNPYAVRDKCLKFYSKISEYRHYCYSLYGTTLEQQYNKPLCDLL | |
| IRCINRQKPLCPEEKQRHLDKKQRFHNIRGRWTGRCMSCCRSSRTRRETQL* | |
| DNAâsequenceâofâVB1016â(SEQâIDâNO:â20): | |
| ATGCAGGTCTCCACTGCTGCCCTTGCCGTCCTCCTCTGCACCATGGCTCTCTGCAACCAGGTCCTCTCT|GCACCACTT | |
| GCTGCTGACACGCCGACCGCCTGCTGCTTCAGCTACACCTCCCGACAGATTCCACAGAATTTCATAGCTGACTACTTTG | |
| AGACGAGCAGCCAGTGCTCCAAGCCCAGTGTCATCTTCCTAACCAAGAGAGGCCGGCAGGTCTGTGCTGACCCCAGTGA | |
| GGAGTGGGTCCAGAAATACGTCAGTGACCTGGAGCTGAGTGCC|GAGCTCAAAACCCCACTTGGTGACACAACTCACAC | |
| A|GAGCCCAAATCTTGTGACACACCTCCCCCGTGCCCAAGGTGCCCA|GGCGGTGGAAGCAGCGGAGGTGGAAGTGGA| | |
| GGACAGCCCCGAGAACCACAGGTGTACACCCTGCCCCCATCCCGGGAGGAGATGACCAAGAACCAGGTCAGCCTGACCT | |
| GCCTGGTCAAAGGCTTCTACCCCAGCGACATCGCCGTGGAGTGGGAGAGCAGCGGGCAGCCGGAGAACAACTACAACAC | |
| CACGCCTCCCATGCTGGACTCCGACGGCTCCTTCTTCCTCTACAGCAAGCTCACCGTGGACAAGAGCAGGTGGCAGCAG | |
| GGGAACATCTTCTCATGCTCCGTGATGCATGAGGCTCTGCACAACCGCTTCACGCAGAAGAGCCTCTCCCTGTCTCCGG | |
| GTAAA|GGCCTCGGTGGCCTG|ATGCATGGAGATACACCTACATTGCATGAATATATGTTAGATTTGCAACCAGAGACA | |
| ACTGATCTCTACGGATATGGACAATTAAATGACAGCTCAGAGGAGGAGGATGAAATAGATGGTCCAGCTGGACAAGCAG | |
| AACCGGACAGAGCCCATTACAATATTGTAACCTTTTGTTGCAAGTGTGACTCTACGCTTCGGTTGTGCGTACAAAGCAC | |
| ACACGTAGACATTCGTACTTTGGAAGACCTGTTAATGGGCACACTAGGAATTGTGTGCCCCATCTGTTCTCAGAAACCA | |
| 1GGCGGTGGAAGCAGCGGAGGTGGAAGTGGA|ATGTTTCAGGACCCACAGGAGCGACCCAGAAAGTTACCACAGTTATG | |
| CACAGAGCTGCAAACAACTATACATGATATAATATTAGAATGTGTGTACTGCAAGCAACAGTTACTGCGACGTGAGGTA | |
| TATGACTTTGCTTTTCGGGATTTATGCATAGTATATAGAGATGGGAATCCATATGCTGTACGAGATAAATGTTTAAAGT | |
| TTTATTCTAAAATTAGTGAGTATAGACATTATTGTTATAGTTTGTATGGAACAACATTAGAACAGCAATACAACAAACC | |
| GTTGTGTGATTTGTTAATTAGGTGTATTAACCGACAAAAGCCACTGTGTCCTGAAGAAAAGCAAAGACATCTGGACAAA | |
| AAGCAAAGATTCCATAATATAAGGGGTCGGTGGACCGGTCGATGTATGTCTTGTTGCAGATCATCAAGAACACGTAGAG | |
| AAACCCAGCTGTAA | |
| ProteinâsequenceâofâVB1016â(Homodimericâconstructâaccordingâtoâthe | |
| invention,âSEQâIDâNO:â21):âAminoâacidâsequence,â501âaminoâacids | |
| MQVSTAALAVLLCTMALCNQVLSAPLAADTPTACCFSYTSRQIPQNFIAD | |
| YFETSSQCSKPSVIFLTKRGRQVCADPSEEWVQKYVSDLELSAELKTPLG | |
| DTTHTEPKSCDTPPPCPRCPGGGSSGGGSGGQPREPQVYTLPPSREEMTK | |
| NQVSLTCLVKGFYPSDIAVEWESSGQPENNYNTTPPMLDSDGSFFLYSKL | |
| TVDKSRWQQGNIFSCSVMHEALHNRFTQKSLSLSPGKGLGGLMHGDTPTL | |
| HEYMLDLQPETTDLYGYGQLNDSSEEEDEIDGPAGQAEPDRAHYNIVTFC | |
| CKCDSTLRLCVQSTHVDIRTLEDLLMGTLGIVCPICSQKPGGGSSGGGSG | |
| MFQDPQERPRKLPQLCTELQTTIHDIILECVYCKQQLLRREVYDFAFRDL | |
| CIVYRDGNPYAVRDKCLKFYSKISEYRHYCYSLYGTTLEQQYNKPLCDLL | |
| IRCINRQKPLCPEEKQRHLDKKQRFHNIRGRWTGRCMSCCRSSRTRRETQ | |
| L* | |
| SEQâIDâNO:â22: | |
| >tr|Q778I6|Q778I6_HPV16âE6âproteinâOSâ= Humanâpapillomavirusâtypeâ16â | |
| GNâ= E6âPEâ= 4âSVâ= 1;â(Underlinedâaminoâacidsâdenotesâaminoâacidsâ | |
| thatâmayâbeâdeleted;âPotentialâaminoâacidsâthatâmayâbeâmutated | |
| areâhighlighted) | |
| MFQDPQERPRKLPQLCTELQTTIHDIILECVYCKQQLLRREVYDFAFRDLCIVYRDGNPYAVCDKCLKFY | |
| SKISEYRHYCYSLYGTTLEQQYNKPLCDLLIRCINCQKPLCPEEKQRHLDKKQRFHNIRGRWTGRCMSCC | |
| RSSRTRRETQL | |
| SEQâIDâNO:â23: | |
| >sp|P03129|VE7_HPV16âProteinâE7âOSâ=âHumanâpapillomavirusâtypeâ16â | |
| GNâ= E7âPEâ= 1âSVâ= 1;â(Underlinedâaminoâacidsâdenotesâaminoâacids | |
| thatâmayâbeâdeleted;âPotentialâaminoâacidsâthatâmayâbeâmutated | |
| areâhighlighted) | |
| MHGDTPTLHEYMLDLQPETTDLYCYEQLNDSSEEEDEIDGPAGQAEPDRAHYNIVTFCCKCDSTLRLCVQ | |
| STHVDIRTLEDLLMGTLGIVCPICSQKP | |
| SEQâIDâNO:â24: | |
| >sp|P06463|VE6_HPV18âProteinâE6âOSâ= Humanâpapillomavirusâ | |
| typeâ18âGNâ= E6âPEâ= 1âSVâ= 1 | |
| MARFEDPTRRPYKLPDLCTELNTSLQDIEITCVYCKTVLELTEVFEFAFKDLFVVYRDSI | |
| PHAACHKCIDFYSRIRELRHYSDSVYGDTLEKLTNTGLYNLLIRCLRCQKPLNPAEKLRH | |
| LNEKRRFHNIAGHYRGQCHSCCNRARQERLQRRRETQV | |
| SEQâIDâNO:â25: | |
| >sp|P06788|VE7_HPV18âProteinâE7âOSâ= Humanâpapillomavirusâ | |
| typeâ18âGNâ= E7âPEâ= 3âSVâ= 2 | |
| MHGPKATLQDIVLHLEPQNEIPVDLLCHEQLSDSEEENDEIDGVNHQHLPARRAEPQRHT | |
| MLCMCCKCEARIKLVVESSADDLRAFQQLFLNTLSFVCPWCASQQ | |
| SEQâIDâNO:â26: | |
| Hingeâregionsâ(IgG3âUHâhinge),â12âaminoâacids:â | |
| ELKTPLGDTTHT | |
| SEQâIDâNO:â27: | |
| Hingeâregionâ(IgG3,âMHâhinge,â15âaminoâacids):â | |
| EPKSCDTPPPCPRCP | |
| SEQâIDâNO:â28: | |
| Gly-SerâLinker:â | |
| GGGSSGGGSG | |
| SEQâIDâNO:â29:âhCH3âIgG3: | |
| GQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESSGQPENNYNTTPPMLDSDGSFFLYSKL | |
| TVDKSRWQQGNIFSCSVMHEALHNRFTQKSLSLSPGK | |
| SEQâIDâNO:â30:âLinker:â | |
| GLGGL | |
| SEQâIDâNO:â31:âDNAâsequenceâofâVB1020: | |
| ATGCAGGTCTCCACTGCTGCCCTTGCCGTCCTCCTCTGCACCATGGCTCTCTGCAACCAGGTCCTCTCT|GCACCACTT | |
| GCTGCTGACACGCCGACCGCCTGCTGCTTCAGCTACACCTCCCGACAGATTCCACAGAATTTCATAGCTGACTACTTTG | |
| AGACGAGCAGCCAGTGCTCCAAGCCCAGTGTCATCTTCCTAACCAAGAGAGGCCGGCAGGTCTGTGCTGACCCCAGTGA | |
| GGAGTGGGTCCAGAAATACGTCAGTGACCTGGAGCTGAGTGCC|GAGCTCAAAACCCCACTTGGTGACACAACTCACAC | |
| AIGAGCCCAAATCTTGTGACACACCTCCCCCGTGCCCAAGGTGCCCAIGGCGGTGGAAGCAGCGGAGGTGGAAGTGGA| | |
| GGACAGCCCCGAGAACCACAGGTGTACACCCTGCCCCCATCCCGGGAGGAGATGACCAAGAACCAGGTCAGCCTGACCT | |
| GCCTGGTCAAAGGCTTCTACCCCAGCGACATCGCCGTGGAGTGGGAGAGCAGCGGGCAGCCGGAGAACAACTACAACAC | |
| CACGCCTCCCATGCTGGACTCCGACGGCTCCTTCTTCCTCTACAGCAAGCTCACCGTGGACAAGAGCAGGTGGCAGCAG | |
| GGGAACATCTTCTCATGCTCCGTGATGCATGAGGCTCTGCACAACCGCTTCACGCAGAAGAGCCTCTCCCTGTCTCCGG | |
| GTAAA|GGCCTCGGTGGCCTG/ATGCATGGCGATACCCCAACACTCCATGAGTACATGCTGGACCTTCAGCCCGAGAC | |
| TACGGATCTGTATGGCTATGGGCAGTTGAATGACTCATCTGAGGAGGAGGACGAAATAGACGGCCCAGCTGGTCAAGCC | |
| GAACCGGATAGAGCCCACTACAACATTGTGACCTTTTGCTGTAAGTGTGACAGCACTCTGAGACTGTGTGTTCAGTCCA | |
| CTCATGTCGACATACGCACATTGGAGGATCTCCTGATGGGAACACTGGGAATTGTGTGTCCCATCTGTTCCCAAAAGCC | |
| T/GGAGGTGGAAGCAGTGGAGGCGGTTCAGGC/ATGTTCCAAGATCCTCAAGAACGTCCTCGTAAGCTGCCACAGCTGT | |
| GTACCGAGCTTCAGACCACCATTCACGACATCATCCTGGAGTGCGTCTATTGCAAACAGCAGCTCCTTAGAAGGGAAGT | |
| GTACGATTTTGCACGGAGGGACCTCTGCATCGTGTATCGGGACGGCAATCCCTATGCGGTACGGGATAAATGCCTGAAG | |
| TTCTACAGCAAAATCTCCGAGTACCGGCACTACTGCTACTCTCTCTATGGGACGACTCTGGAACAGCAGTACAACAAGC | |
| CCTTGTGCGATCTGCTGATTCGCTGCATTAATCGCCAGAAACCTCTGTGCCCAGAAGAGAAGCAAAGACACCTGGACAA | |
| GAAACAGCGATTCCACAACATCCGAGGGAGATGGACAGGGAGGTGTATGAGCTGCTGTCGGAGTTCTAGGACAAGGCGC | |
| GAAACCCAGCTTTGA | |
| SEQâIDâNO:â32:âProteinâsequenceâofâVB1020â(Homodimericâconstruct | |
| accordingâtoâtheâinventionâAminoâacidâsequence,â501âaminoâacids: | |
| MQVSTAALAVLLCTMALCNQVLS|APLAADTPTACCFSYTSRQIPQNFIAD | |
| YFETSSQCSKPSVIFLTKRGRQVCADPSEEWVQKYVSDLELSA|ELKTPLG | |
| DTTHT|EPKSCDTPPPCPRCP|GGGSSGGGSG|GQPREPQVYTLPPSREEM | |
| TKNQVSLTCLVKGFYPSDIAVEWESSGQPENNYNTTPPMLDSDGSFFLYSK | |
| LTVDKSRWQQGNIFSCSVMHEALHNRFTQKSLSLSPGK|GLGGL|MHGDTP | |
| TLHEYMLDLQPETTDLYGYGQLNDSSEEEDEIDGPAGQAEPDRAHYNIVTF | |
| CCKCDSTLRLCVQSTHVDIRTLEDLLMGTLGIVCPICSQKP|GGGSSGGGS | |
| G|MFQDPQERPRKLPQLCTELQTTIHDIILECVYCKQQLLRREVYDFARRD | |
| LCIVYRDGNPYAVRDKCLKFYSKISEYRHYCYSLYGTTLEQQYNKPLCDLL | |
| IRCINRQKPLCPEEKQRHLDKKQRFHNIRGRWTGRCMSCCRSSRTRRETQL* | |
| SEQâIDâNO:â33:âDNAâsequenceâofâVB1021: | |
| ATGCAGGTCTCCACTGCTGCCCTTGCCGTCCTCCTCTGCACCATGGCTCTCTGCAACCAGGTCCTCTCT|GCACCACTT | |
| GCTGCTGACACGCCGACCGCCTGCTGCTTCAGCTACACCTCCCGACAGATTCCACAGAATTTCATAGCTGACTACTTTG | |
| AGACGAGCAGCCAGTGCTCCAAGCCCAGTGTCATCTTCCTAACCAAGAGAGGCCGGCAGGTCTGTGCTGACCCCAGTGA | |
| GGAGTGGGTCCAGAAATACGTCAGTGACCTGGAGCTGAGTGCC|GAGCTCAAAACCCCACTTGGTGACACAACTCACAC | |
| A|GAGCCCAAATCTTGTGACACACCTCCCCCGTGCCCAAGGTGCCCA|GGCGGTGGAAGCAGCGGAGGTGGAAGTGGA| | |
| GGACAGCCCCGAGAACCACAGGTGTACACCCTGCCCCCATCCCGGGAGGAGATGACCAAGAACCAGGTCAGCCTGACCT | |
| GCCTGGTCAAAGGCTTCTACCCCAGCGACATCGCCGTGGAGTGGGAGAGCAGCGGGCAGCCGGAGAACAACTACAACAC | |
| CACGCCTCCCATGCTGGACTCCGACGGCTCCTTCTTCCTCTACAGCAAGCTCACCGTGGACAAGAGCAGGTGGCAGCAG | |
| GGGAACATCTTCTCATGCTCCGTGATGCATGAGGCTCTGCACAACCGCTTCACGCAGAAGAGCCTCTCCCTGTCTCCGG | |
| GTAAA/GGCCTCGGTGGCCTG/ATGCATGGTGACACACCAACCCTGCACGAATACATGCTCGATCTGCAGCCAGAGACT | |
| ACCGACCTTTACGGCTATGGGCAGTTGAACGACAGCTCTGAGGAGGAGGACGAGATCGATGGTCCTGCTGGACAAGCAG | |
| AACCAGACAGAGCCCACTACAACATCGTAACCTTTTGCTGCAAGTGTGACAGTACCCTTCGTTTGTGCGTTCAGAGCAC | |
| GCATGTCGACATTCGGACACTGGAGGATCTGCTCATGGGGACTCTGGGGATTGTGTGTCCTATTTGCAGCCAGAAACCA | |
| /GGCGGAGGATCTTCAGGAGGCGGGAGTGGC/ATGTTCCAAGACCCTCAGGAACGCCCTCGGAAACTGCCCCAATTGTG | |
| TACTGAGCTCCAGACAACGATACACGACATAATCCTGGAGTGCGTGTATTGCAAGCAGCAGCTTCTGAGGAGGGAAGTG | |
| TACGATTTTGCCAGGAGAGATGGCTGCATTGTCTACCGAGATGGCAATCCCTATGCGGTGTGTGATAAGTGTCTGAAGT | |
| TCTATTCCAAAATCAGCGAATATCGGCATTATTGCTACTCACTGTACGGAACTACCCTCGAACAGCAGTACAACAAACC | |
| GCTCTGTGATCTGCTGATCAGATGCATCAATCGGCAGAAACCCCTTTGTCCCGAAGAGAAGCAAAGACACCTGGACAAG | |
| AAGCAGAGGTTCCACAATACCCGAGGTCGTTGGACTGGGCGCTGCATGTCCTGTTGTCGCTCCTCTCGCACAAGGAGAG | |
| AGACACAACTGTGA | |
| SEQâIDâNO:â34:âProteinâsequenceâofâVB1021â(Homodimericâconstructâ | |
| accordingâtoâtheâinvention.âAminoâacidâsequence,â501âaminoâacids: | |
| MQVSTAALAVLLCTMALCNQVLS|APLAADTPTACCFSYTSRQIPQNFIAD | |
| YFETSSQCSKPSVIFLTKRGRQVCADPSEEWVQKYVSDLELSA|ELKTPLG | |
| DTTHT|EPKSCDTPPPCPRCP|GGGSSGGGSG|GQPREPQVYTLPPSREEM | |
| TKNQVSLTCLVKGFYPSDIAVEWESSGQPENNYNTTPPMLDSDGSFFLYSK | |
| LTVDKSRWQQGNIFSCSVMHEALHNRFTQKSLSLSPGK|GLGGL|MHGDTP | |
| TLHEYMLDLQPETTDLYGYGQLNDSSEEEDEIDGPAGQAEPDRAHYNIVTF | |
| CCKCDSTLRLCVQSTHVDIRTLEDLLMGTLGIVCPICSQKP|GGGSSGGGS | |
| G|MFQDPQERPRKLPQLCTELQTTIHDIILECVYCKQQLLRREVYDFARRD | |
| GCIVYRDGNPYAVCDKCLKFYSKISEYRHYCYSLYGTTLEQQYNKPLCDLL | |
| IRCINRQKPLCPEEKQRHLDKKQRFHNTRGRWTGRCMSCCRSSRTRRETQL* |
1. A homodimeric protein of two identical amino acid chains, each amino acid chain comprising (1) a signal peptide, (2) a targeting unit, (3) a dimerization motif, and (4) an antigenic unit, said targeting unit comprising an amino acid sequence having at least 80% sequence identity to the amino acid sequence 24-93 of SEQ ID NO:1, and an antigenic unit comprising an amino acid sequence of human papillomavirus (HPV), such as an antigenic unit comprising an amino acid sequence of HPV 16 and/or HPV18, such as an antigenic unit derived from early proteins E6 and/or E7 of HPV 16 and/or HPV18.
2. (canceled)
3. The homodimeric protein according to claim 1, wherein said signal peptide consists of an amino acid sequence having at least 80% sequence identity to the amino acid sequence 1-23 of SEQ ID NO:l.
4. (canceled)
5. The homodimeric protein according to claim 1, wherein said targeting unit consists of an amino acid sequence having at least 85%, such as at least 86%, such as at least 87%, such as at least 88%, such as at least 89%, such as at least 90%, such as at least 91%, such as at least 92%, such as at least 93%, such as at least 94%, such as at least 95%, such as at least 96%, such as at least 97%, such as at least 98%, such as at least 99% sequence identity to the amino acid sequence 24-93 of SEQ ID NO:l.
6. The homodimeric protein according to claim 1, wherein the dimerization motif comprises a hinge region and optionally another domain that facilitate dimerization, such as an immunoglobulin domain, optionally connected through a linker.
7. The homodimeric protein according to claim 6, wherein the hinge region is Ig derived, such as derived from IgG3.
8-21. (canceled)
22. The homodimeric protein according to claim 1, wherein said antigenic unit comprises an amino acid sequence having at least 80%, such as at least 81%, such as at least 82%, such as at least 83%, such as at least 84%, such as at least 85%, such as at least 86%, such as at least 87%, such as at least 88%, such as at least 89%, such as at least 90%, such as at least 91%, such as at least 92%, such as at least 93%, such as at least 94%, such as at least 95%, such as at least 96%, such as at least 97%, such as at least 98%, such as at least 99% sequence identity to the amino acid sequence 243-293 of SEQ ID NO:3.
23-39. (canceled)
40. The homodimeric protein according to claim 1, in its mature form without any signal peptide sequence.
41. An amino acid chain comprising (1) a signal peptide, (2) a targeting unit, (3) a dimerization motif, and (4) an antigenic unit, said targeting unit comprising an amino acid sequence having at least 80% sequence identity to the amino acid sequence 24-93 of SEQ ID NO:1, and an antigenic unit comprising an amino acid sequence of human papillomavirus (HPV), such as an antigenic unit comprising an amino acid sequence of HPV 16 and/or HPV18, such as an antigenic unit derived from early proteins E6 and/or E7 of HPV 16 and/or HPV18, which amino acid chain is able to form a homodimeric protein according to claim 1.
42. A nucleic acid molecule, such as a DNA, encoding the amino acid chain according to claim 41.
43. The nucleic acid molecule according to claim 42, which nucleic acid molecule is human codon optimized.
44. A nucleic acid molecule comprising any one of nucleotide sequences selected from the list consisting of SEQ ID NO:2, SEQ ID NO:4, SEQ ID NO:6, SEQ ID NO:8, SEQ ID NO:10, SEQ ID NO:12, SEQ ID NO:14, SEQ ID NO:16, SEQ ID NO:18, SEQ ID NO:20, SEQ ID NO:31 and SEQ ID NO:33, or a variant thereof.
45. (canceled)
46. The nucleic acid molecule according to claim 42 formulated for administration to a patient to induce production of the homodimeric protein in said patients.
47. The homodimeric protein according to claim 1, for use as a medicament,
48. A pharmaceutical composition comprising the homodimeric protein according to claim 1.
49. A host cell comprising the nucleic acid molecule according to claim 42.
50. A method for preparing a homodimeric protein, or an amino acid chain, the method comprising a) transfecting the nucleic acid molecule according to claim 42 into a cell population;
b) culturing the cell population;
c) collecting and purifying the homodimeric protein, or amino acid chain expressed from the cell population.
51. A method for preparing a vaccine, such as a DNA vaccine, comprising an immunologically effective amount of a nucleic acid molecule, the method comprising
a) preparing a nucleic acid molecule according to claim 42;
b) dissolving the nucleic acid molecule obtained under step a) in a pharmaceutically acceptable carrier, diluent, or buffer.
52. A vaccine against HPV comprising an immunologically effective amount of a homodimeric protein according to claim 1, wherein said vaccine is able to trigger both a T-cell- and B-cell immune response.
53. (canceled)
54. A method of treating or preventing a HPV induced disease or condition, such as a cancer or an infectious disease caused by HPV in a patient, the method comprising administering to the patient in need thereof, a homodimeric protein according to claim 1.
55. The method according to claim 54, wherein the method comprises administering to the patient in need thereof of a nucleic acid molecule, with a subsequent step of electroporation.
56. (canceled)