US20160251683A1
2016-09-01
15/055,045
2016-02-26
US 9,938,542 B2
2018-04-10
-
-
Ganapathirama Raghu
Greenblum & Bernstein, P.L.C.
2036-02-26
Mixotrophic fermentation method performed to make one or more bioproducts such as alcohols, organic acids of less than 7 carbons, acetone, 2,3-butanediol and mixtures thereof with a microorganism. The mixotrophic fermentation method includes providing an isolated organism and providing a first feedstock and a second feedstock for use in a fermentation medium. The first feedstock includes a carbon source that is metabolized by the native form of the organism at a rate of less than 0.01 g/hr/g cell mass, and the second feedstock includes CO, CO2, carbonate, bicarbonate, H2, glycerol, methanol, formate, urea or mixtures thereof. The mixotrophic fermentation method also includes culturing the organism in the fermentation medium, whereby both feedstocks are metabolized and a fermentation broth is formed, the broth having at least one bioproduct. Optionally, the bioproduct may be separated from the broth.
Get notified when new applications in this technology area are published.
C12P7/16 » CPC further
Preparation of oxygen-containing organic compounds containing a hydroxy group acyclic Butanols
C12P7/24 » CPC further
Preparation of oxygen-containing organic compounds containing a carbonyl group
C12P7/28 » CPC main
Preparation of oxygen-containing organic compounds containing a carbonyl group; Ketones Acetone-containing products
C12P7/04 » CPC further
Preparation of oxygen-containing organic compounds containing a hydroxy group acyclic
C12P7/06 » CPC further
Preparation of oxygen-containing organic compounds containing a hydroxy group acyclic Ethanol, i.e. non-beverage
C12P7/56 » CPC further
Preparation of oxygen-containing organic compounds containing a carboxyl group including Peroxycarboxylic acids Lactic acid
Y02E50/10 » CPC further
Technologies for the production of fuel of non-fossil origin Biofuels, e.g. bio-diesel
Y02E50/10 » CPC further
Technologies for the production of fuel of non-fossil origin Biofuels, e.g. bio-diesel
C12P7/52 IPC
Preparation of oxygen-containing organic compounds containing a carboxyl group including Peroxycarboxylic acids Propionic acid; Butyric acids
C12P7/065 » CPC further
Preparation of oxygen-containing organic compounds containing a hydroxy group acyclic; Ethanol, i.e. non-beverage with microorganisms other than yeasts
C12P7/40 » CPC further
Preparation of oxygen-containing organic compounds containing a carboxyl group including Peroxycarboxylic acids
C12P7/54 » CPC further
Preparation of oxygen-containing organic compounds containing a carboxyl group including Peroxycarboxylic acids Acetic acid
C12P7/26 IPC
Preparation of oxygen-containing organic compounds containing a carbonyl group Ketones
C12N1/20 IPC
Microorganisms, e.g. protozoa; Compositions thereof ; Processes of propagating, maintaining or preserving microorganisms or compositions thereof; Processes of preparing or isolating a composition containing a microorganism; Culture media therefor Bacteria; Culture media therefor
C12P7/18 » CPC further
Preparation of oxygen-containing organic compounds containing a hydroxy group acyclic polyhydric
The instant application claims priority to U.S. Provisional Application No. 62/121,871, filed Feb. 27, 2015; U.S. Provisional Application No. 62/183,034, filed Jun. 22, 2015; U.S. Provisional Application No. 62/199,548, filed Jul. 31, 2015; U.S. Provisional Application No. 62/209,133, filed Aug. 24, 2015; and U.S. Provisional Application No. 62/265,239, filed Dec. 9, 2015, the disclosures of each of which is incorporated by reference herein in their entireties.
The instant application contains a Sequence Listing which has been submitted electronically in ASCII format and is hereby incorporated by reference in its entirety. Said ASCII copy, created on Feb. 24, 2016, is named P49168 SL.txt and is 104,007 bytes in size.
The invention relates to the field of production of bioproducts such as alcohols, organic acids of less than 7 carbons, acetone, and mixtures thereof with microorganisms.
The production costs for biofuels and certain other bioproducts via microbial fermentation is currently high, particularly compared to oil-derived fuels. Feedstock and feedstock pre-treatment costs for use in such methods can form 50-60% or more of total operating costs. Generally these costs relate to the carbohydrates used as the carbon source in the production of the biofuels. Because these costs are so high, they are one of the primary factors affecting the economic viability of cellulosic and other next generation biofuel manufacturing processes. There is therefore a strong need for lowering these costs and for producing desired products at high yield and high titers. One way to mitigate high feedstock costs is by maximizing feedstock conversion to the product of interest.
However, conventional methods for maximizing feedstock conversion are fraught with difficulties. For example, attempts to ferment gaseous substrates with autotrophic organisms have been hindered by difficulties in reaching suitable concentrations of the substrate and by low titers, which increase isolation-related operating costs. Autotrophic fermentation has also been limited in the range of economically attainable products.
From a metabolic perspective, acetyl-CoA is a central building block and a link between glycolysis and fermentative alcohol production. Consequently acetyl-CoA serves as a focal point for biofuel production in microbial organisms. However, the ability to achieve metabolically efficient production of acetyl-CoA (and high mass yields) has historically been impeded by CO2 loss during decarboxylation reactions involved in classical Embden-Meyerhof-Parnas (EMP) glycolysis. For example, one molecule of glucose (where glucose is the carbon source) under heterotrophic growth conditions may be used to generate two molecules of acetyl-CoA and excess ATP, but this occurs at the “expense” of two CO2 molecules, which are lost in the conversion of pyruvate to acetyl-CoA. In contrast, two molecules of CO2 (where gaseous CO2 is the carbon source) under autotrophic growth conditions may generate one molecule of acetyl-CoA, but this scheme results in a net ATP formation of less than 1, and acetate production (from acetyl-CoA) is required to generate more ATP.
Accordingly, there is a need for fermentation methods and engineering metabolic pathways that minimize—or ideally eliminate—CO2 losses and result in complete conversion of a carbohydrate source into acetyl-CoA without having to sacrifice the acetyl-CoA produced for further generation of ATP.
Herein is provided a mixotrophic fermentation method comprising (i) providing an isolated naturally acetogenic organism, (ii) providing a first feedstock and a second feedstock wherein said first feedstock comprises a carbon source that is metabolized by the native form of the organism at a rate of less than 0.01 g/hr/g cell mass; and wherein said second feedstock comprises CO, CO2, carbonate, bicarbonate, H2, glycerol, methanol, formate, urea or a combination thereof; and (iii) culturing said organism in a fermentation medium, whereby both feedstocks are metabolized and a fermentation broth is formed, which broth comprises at least one bioproduct.
In an embodiment, the method yields a greater amount of the at least one bioproduct than the combined amounts of the at least on bioproduct produced by heterotrophic and autotrophic fermentation with the same organism under the same conditions.
In an embodiment, the method may comprise production of at least one bioproduct and acetic acid as a second bioproduct, wherein the amount of acetic acid produced per biomass unit weight is less than about 50% of that produced in autotrophic fermentation with the same organism under the same conditions.
In an embodiment, the carbon yield, based on the total amount of carbon in produced bioproducts divided by the total amount of carbon metabolized from said first feedstock, is at least 50%.
In an embodiment, the 13C/12C isotope ratio of the carbon present in the bioproduct may be less than that of atmospheric CO2.
In an embodiment, said carbon source may be selected from carbohydrates, glycerol, methanol, or a combination thereof.
In embodiment, said organism may be Clostridia.
In an embodiment, said organism may be genetically modified.
In an embodiment, said first feedstock and said second feedstock may be present in the fermentation medium at the same time.
In an embodiment, said fermentation medium may comprise a carbohydrate and at least one of CO, CO2, and hydrogen.
In an embodiment, said fermentation medium comprises a steel mill produced CO composition.
In an embodiment, the culturing may be performed in whole or in part at a super-atmospheric pressure.
In an embodiment, said bioproduct may be selected from the group consisting of even numbered primary alcohols, odd numbered secondary alcohols, organic acids of less than 7 carbons, C3 compounds, C4 compounds, and mixtures thereof.
In an embodiment, said bioproduct may be selected from the group consisting of acetic acid, acetone, propionic acid, butyric acid, hexanoic acid, 3-hydroxypropionic acid, 3-hydroxybutyric acid, crotonic acid, acetoacetic acid, lactic acid, 2-hydroxyisobutyric acid, 3-methylbutanoic acid, ethanol, butanol, crotyl alcohol, hexanol, acetone, isopropanol, 2,3-butanediol, acetoin, 1,3-propanediol, and combinations thereof.
In an embodiment, said bioproduct may be non-naturally occurring.
In an embodiment, said broth may comprise a first bioproduct and a second bioproduct, wherein said first bioproduct is selected from the group consisting of acetoacetic acid, acetone, isopropanol, 3-hydroxybutyric acid, 2-hydroxyisobutyric acid, and combinations thereof, said second bioproduct is selected from the group consisting of ethanol, butanol, crotyl alcohol, hexanol, and combinations thereof, and the molar ratio between said first bioproduct and said second bioproduct is in the range from 0.1 to 0.95.
In an embodiment, the second feedstock may comprise CO, CO2, carbonate, bicarbonate, methanol, or a combination thereof; and the 13C/12C isotope ratio of the carbon present in said second feedstock may be less than that of atmospheric CO2.
In an embodiment, the method may comprise providing said fermentation medium with a mixture of CO, and hydrogen at a molar ratio in the range from 1:0.1 to 1:5.
In an embodiment, the method may further comprise steam reforming of a hydrocarbon to form said mixture of CO2 and hydrogen.
In an embodiment, the first feedstock may comprise a sugar selected from glucose and sucrose, and the organism may metabolize CO2 produced on metabolizing the sugar.
In an embodiment, the first feedstock may comprise a sugar selected from glucose and sucrose, the second feedstock may comprise at least one of H2 and methanol, and the organism may metabolize CO2 produced on metabolizing the sugar.
In an embodiment, said at least one bioproduct is acetone. In such an embodiment, the first feedstock may comprise a sugar selected from glucose and sucrose, and the organism may metabolize CO2 produced on metabolizing the sugar.
In an embodiment, said at least one bioproduct is butyric acid. In such an embodiment, the first feedstock may comprise a sugar selected from glucose and sucrose, and the organism may metabolize CO2 produced on metabolizing the sugar.
In an embodiment, said at least one bioproduct is isopropanol. In such an embodiment, the first feedstock may comprise a sugar selected from glucose and sucrose, and the organism may metabolize CO2 produced on metabolizing the sugar.
In an embodiment, the metabolizing of the first feedstock does not inhibit the metabolizing of the second feedstock.
In an embodiment, the first feedstock may comprise a non-preferred sugar and the second feedstock may comprise CO, CO2, carbonate, bicarbonate, H2, glycerol, methanol, formate, urea or a combination thereof.
Herein is also provided a mixotrophic fermentation method comprising (i) providing an isolated naturally acetogenic organism, (ii) providing a fermentation medium comprising a first feedstock and a second feedstock wherein said first feedstock comprises a carbon source that is metabolized by the native form of the organism at a rate of less than 0.01 g/hr/g cell mass; and (iii) culturing said organism in said fermentation medium, whereby both feedstocks are metabolized and acetic acid is produced, wherein the amount of acetic acid produced per biomass unit weight is less than about 50% of that produced in autotrophic fermentation with the same organism under the same conditions.
Herein is also provided a mixotrophic fermentation method comprising (i) providing an isolated naturally acetogenic organism that has been genetically modified, (ii) providing a fermentation medium comprising a first feedstock and a second feedstock wherein said first feedstock comprises a sugar that is metabolized by the native form of the organism at a rate of less than 0.01 g/hr/g cell mass; and wherein said second feedstock comprises CO, CO2, carbonate, bicarbonate, H2, glycerol, methanol, formate, urea or a combination thereof; and (iii) culturing said organism in said fermentation medium, whereby both feedstocks are metabolized and a fermentation broth is formed, which broth comprises at least one bioproduct.
FIG. 1 shows 13C labeling of acetate in C. ljungdahlii grown under autotrophic (A-Acetate) and mixotrophic (M-Acetate) cultures.
FIG. 2 shows the percentage of 13C labeling of acetate in C. ljungdahlii over time.
FIG. 3 shows the percentage of 13C labeling of acetate in C. autoethanogenum over time.
FIG. 4 shows carbon yield with increasing amounts of H2 in the headspace in a C. ljungdahlii strain with a deleted secondary alcohol dehydrogenase gene (Clj ΔSADH) and transformed with a plasmid expressing the genes for thiolase, acetoacetate transferase subunit A (COAT A), acetoacetate transferase subunit B (COAT B), and acetoacetate decarboxylase (acetone strain).
FIG. 5 shows product distributions of the acetone strain grown with increasing amounts of H2 in the headspace. Carbon fraction is the amount of carbon in each bioproduct with the total being 1.0.
The particulars shown herein are by way of example and for purposes of illustrative discussion of the various embodiments of the present invention only and are presented in the cause of providing what is believed to be the most useful and readily understood description of the principles and conceptual aspects of the invention. In this regard, no attempt is made to show details of the invention in more detail than is necessary for a fundamental understanding of the invention, the description making apparent to those skilled in the art how the several forms of the invention may be embodied in practice.
The present invention will now be described by reference to more detailed embodiments. This invention may, however, be embodied in different forms and should not be construed as limited to the embodiments set forth herein. Rather, these embodiments are provided so that this disclosure will be thorough and complete, and will fully convey the scope of the invention to those skilled in the art.
Unless otherwise defined, all technical and scientific terms used herein have the same meaning as commonly understood by one of ordinary skill in the art to which this invention belongs. The terminology used in the description of the invention herein is for describing particular embodiments only and is not intended to be limiting of the invention. As used in the description of the invention and the appended claims, the singular forms “a,” “an,” and “the” are intended to include the plural forms as well, unless the context clearly indicates otherwise.
Unless otherwise indicated, all numbers expressing quantities of ingredients, reaction conditions, and so forth used in the specification and claims are to be understood as being modified in all instances by the term “about.” Accordingly, unless indicated to the contrary, the numerical parameters set forth in the following specification and attached claims are approximations that may vary depending upon the desired properties sought to be obtained by the present invention. At the very least, and not as an attempt to limit the application of the doctrine of equivalents to the scope of the claims, each numerical parameter should be construed in light of the number of significant digits and ordinary rounding approaches.
Notwithstanding that the numerical ranges and parameters setting forth the broad scope of the invention are approximations, the numerical values set forth in the specific examples are reported as precisely as possible. Any numerical value, however, inherently contains certain errors necessarily resulting from the standard deviation found in their respective testing measurements. Every numerical range given throughout this specification will include every narrower numerical range that falls within such broader numerical range, as if such narrower numerical ranges were all expressly written herein.
Additional advantages of the invention will be set forth in part in the description which follows, and in part will be obvious from the description, or may be learned by practice of the invention. It is to be understood that both the foregoing general description and the following detailed description are exemplary and explanatory only and are not restrictive of the invention, as claimed.
One way to mitigate high feedstock costs is by maximizing feedstock conversion to the product of interest.
The inventors provide herein a mixotrophic fermentation method comprising (i) providing an isolated naturally acetogenic organism, (ii) providing a first feedstock and a second feedstock wherein said first feedstock comprises a carbon source that is metabolized by the native form of the organism at a rate of less than 0.01 g/hr/g cell mass; and wherein said second feedstock comprises CO, CO2, carbonate, bicarbonate, H2, glycerol, methanol, formate, urea or a combination thereof; and (iii) culturing said organism in a fermentation medium, whereby both feedstocks are metabolized and a fermentation broth is formed, which broth comprises at least one bioproduct.
Herein is also provided a mixotrophic fermentation method comprising (i) providing an isolated organism capable of metabolizing CO2 into acetyl-CoA; (ii) providing a fermentation medium comprising a first feedstock and a second feedstock wherein said first feedstock comprises carbohydrates, glycerol, methanol, or combinations thereof; and wherein said second feedstock comprises CO, CO2, carbonate, bicarbonate, H2, glycerol, methanol, formate, urea or mixtures thereof; and (iii) culturing said organism in said fermentation medium, whereby both feedstocks are metabolized and a fermentation broth is formed, which broth comprises at least one bioproduct.
In an embodiment, the method may further comprise separating at least one bioproduct from said broth to form a separated bioproduct.
In an embodiment, also provided is a method as above, wherein the method achieves greater production of the at least one bioproduct than the combined amounts produced by heterotrophic and autotrophic fermentation with the same organism under the same conditions.
In an embodiment, also provided is a method as above, comprising production of at least one bioproduct and acetic acid.
In an embodiment, also provided is a method as above, wherein the amount of acetic acid produced per biomass unit weight is less than about 50% of that produced in autotrophic fermentation with the same organism under the same conditions.
In an embodiment, also provided is a method as above, wherein the carbon yield, based on the total amount of carbon in produced metabolites divided by the total amount of carbon metabolized from said first feedstock, is at least 50%.
In an embodiment, also provided is a method as above, wherein said bioproduct is characterized by a 13C/12C isotope ratio of less than that of atmospheric CO2.
In an embodiment, also provided is a method as above, wherein said first feedstock and said second feedstock are present in the fermentation medium at the same time.
In an embodiment, also provided is a method as above, wherein said fermentation medium comprises a carbohydrate and at least one of CO, CO2, and hydrogen.
In an embodiment, also provided is a method as above, wherein said fermentation medium comprises a steel mill produced CO composition.
In an embodiment, also provided is a method as above, wherein the first feedstock comprises juice extracted from at least one of sugarcane and sugarbeet.
In an embodiment, also provided is a method as above, wherein the culturing is performed in whole or in part at a super-atmospheric pressure.
In an embodiment, also provided is a method as above, wherein said bioproduct is selected from the group consisting of even numbered primary alcohols, odd numbered secondary alcohols, organic acids of less than 7 carbons, acetone, 2,3-butanediol, and mixtures thereof.
In an embodiment, also provided is a method as above, wherein said bioproduct is selected from the group consisting of acetic acid, propionic acid, butyric acid, hexanoic acid, 3-hydroxybutyric acid, crotonic acid, acetoacetic acid, lactic acid, 2-hydroxyisobutyric acid, 3-methylbutanoic acid, ethanol, butanol, crotyl alcohol, hexanol, acetone, isopropanol, 2,3-butanediol, acetoin, 1,3-propanediol and combinations thereof.
In an embodiment, also provided is a method as above, wherein said bioproduct is non-naturally occurring.
In an embodiment, also provided is a method as above, wherein said bioproduct is a C3 or a C4 compound.
In an embodiment, also provided is a method as above, wherein said bioproduct comprises a composition having multiple compounds and wherein one of said compounds is acetone.
In an embodiment, also provided is a method as above, wherein said broth comprises a first bioproduct and a second bioproduct, and wherein said first bioproduct is selected from the group consisting of acetoacetic acid, acetone, isopropanol, 3-hydroxybutyric acid, 2-hydroxyisobutyric acid, and combinations thereof. Also provided is such a method, wherein said second bioproduct is selected from the group consisting of ethanol, butanol, crotyl alcohol, hexanol, and combinations thereof. Also provided is such a method, wherein the molar ratio between said first bioproduct and said second bioproduct is in the range between 0.1 and 0.95.
In an embodiment, also provided is a method as above, wherein said second feedstock comprises CO, CO2, carbonate, bicarbonate methanol, and mixtures thereof; and wherein the 13C/12C isotope ratio of the carbon present in said second feedstock is less than that of atmospheric CO2.
In an embodiment, also provided is a method as above, wherein said second feedstock comprises at least one of ammonium carbonate and ammonium bicarbonate. Also provided is such a method, further comprising adding pressurized CO2 to said fermentation medium.
In an embodiment, also provided is a method as above, wherein providing a fermentation medium includes providing said fermentation medium with a mixture of CO2 and hydrogen at a molar ratio in the range between 1:0.1 and 1:5. Also provided is such a method further comprising steam reforming of a hydrocarbon to form said mixture of CO2 and hydrogen. Also provided is such a method, wherein said hydrocarbon comprises methane.
In an embodiment, also provided is a method as above, wherein the bioproduct comprises at least one of butanol, butyric acid, acetic acid, lactic acid, 3-hydroxypropionic acid, 3-hydroxybutyric acid, crotonic acid, ethanol, acetone, isopropanol, 2,3-butanediol, acetoin, or crotyl-alcohol.
Also provided is such a method, wherein the first feedstock comprises a sugar selected from glucose and sucrose, the second feedstock comprises at least one of H2 and methanol, and the organism assimilates or metabolizes CO, produced on metabolizing the sugar. In an embodiment, the organism may metabolize CO2 produced during glycolysis. In an embodiment, the organism may metabolize CO2 produced via other metabolic pathways, for example, via the acetoacetate pathway and/or the 2-keto acid pathway and/or the α-acetolactate pathway.
Also provided is such a method, wherein the first feedstock comprises methanol and the second feedstock comprises a bicarbonate supplemented with CO2. Also provided is such a method, wherein the first feedstock comprises at least one of glucose and sucrose and the second feedstock comprises glycerol. Also provided is such a method, wherein the first feedstock comprises at least one of glucose and sucrose and the second feedstock comprises CO2 and H2. Also provided is such a method, wherein the first feedstock comprises at least one of glucose and sucrose and the second feedstock comprises CO, and methanol. Also provided is such method, wherein the first feedstock comprises methanol or glycerol and the second feedstock comprises CO2 and
In an embodiment, also provided is a method as above, wherein said at least one bioproduct is acetone.
Also provided is such a method, wherein said organism is acetogenic.
Also provided is such a method, wherein said organism is acetogenic Clostridia.
In an embodiment, also provided is a method as above, wherein said organism expresses genes of the Wood-Ljungdahl pathway.
Also provided is such a method, wherein said organism is selected from the group consisting of Clostridium ljungdahlii, Clostridium autoethanogenum, Clostridium ragsdalei, Eubacterium limosum, Butyribacterium methylotrophicum, Moorella thermoacetica, Clostridium aceticum, Acetobacterium woodii, Clostridium carboxidivorans, Alkalibaculum bacchi, Clostridium drakei, Clostridium formicoaceticum, Clostridium scatologenes, Moorella thermoautotrophica, Acetonema longum, Blautia producta, Clostridium glycolicum, Clostridium magnum, Clostridium mayombei, Clostridium methoxybenzovorans, Oxobacter pfennigii, and Thermoanaerobacter kivui.
Also provided is such a method, wherein said organism is genetically modified to have a primary alcohol dehydrogenase gene or a secondary alcohol dehydrogenase gene deleted from its genome.
Also provided is such a method, wherein said organism is genetically modified to have a butanediol dehydrogenase gene deleted from its genome.
Also provided is such a method, wherein the first feedstock comprises a sugar selected from glucose and sucrose, and the second feedstock comprises at least one of H2, and methanol, and the organism assimilates CO2 produced during glycolysis.
Also provided is such a method, wherein the first feedstock comprises methanol and the second feedstock comprises a bicarbonate supplemented with CO2.
Also provided is such a method, wherein the first feedstock comprises at least one of glucose and sucrose and the second feedstock comprises glycerol.
Also provided is such a method, wherein the first feedstock comprises at least one of glucose and sucrose and the second feedstock comprises CO2 and H2.
Also provided is such a method, wherein the first feedstock comprises at least one of glucose and sucrose and the second feedstock comprises CO2 and methanol.
Also provided is such a method, wherein the first feedstock comprises at least one of glucose and sucrose and the second feedstock comprises CO2.
Also provided is such a method, wherein the first feedstock comprises glucose and the second feedstock comprises CO. According to an embodiment, a method as described above is provided, wherein the feedstock glucose and feedstock CO are present in a glucose/CO weight/weight ratio of from about 0.3 to about 0.8.
Also provided is such a method, wherein the first feedstock comprises methanol or glycerol and the second feedstock comprises CO2 and H2.
Also provided is such a method, wherein the first feedstock comprises a carbohydrate, wherein said fermentation medium comprises a non-fermentable impurity, and wherein the impurity and the carbohydrate are present in the fermentation medium in a weight/weight ratio of greater than 0.05. In an embodiment, said impurity may be a fermentation inhibitor.
Also provided is such a method, wherein said broth comprises a second bioproduct, wherein said second bioproduct is selected from isopropanol and 3-hydroxybutyric acid and the molar ratio between acetone and said second bioproduct is greater than 5.
Also provided is such a method, further comprising separating acetone from said broth to form separated acetone. In an embodiment, said separating comprises evaporation. In an embodiment, said method further comprises catalytically converting said separated acetone into at least one acetone derivative. For example, herein is provided such a method comprising catalytically converting said separated acetone into one or more of mesitylene (1-3-5-trimethylbenzene), isophthalic acid, uvitic acid, and meta-xylene.
Also provided is such a method, wherein the method achieves greater production of acetone than the combined amounts of acetone produced by heterotrophic and autotrophic fermentation with the same organism under the same conditions.
Also provided is such a method, wherein said acetone has a 13C/12C isotope ratio of less than that of atmospheric CO2.
Also provided is such a method, wherein said first feedstock and said second feedstock are present in the fermentation medium at the same time.
Also provided is such a method, comprising production of acetone and acetic acid. For example, in an embodiment, such a method is provided, wherein the amount of acetic acid formed per biomass unit weight is less than about 50% of that formed in autotrophic fermentation with the same organism under the same conditions.
Also provided is such a method, wherein said fermentation medium comprises at least one of CO, CO2, and hydrogen.
Also provided is such a method, wherein said fermentation medium comprises a steel mill produced composition.
Also provided is such a method, wherein said at least one bioproduct is butyric acid.
Also provided is such a method, wherein the first feedstock comprises glucose, and the second feedstock comprises methanol at a glucose/methanol molar ratio of about 1:6.
Also provided is such a method further comprising separating butyric acid from said broth to form separated butyric acid.
Also provided is such a method, wherein said separating comprises contacting said broth with an organic solvent comprising a C6-C12 alkanol.
Also provided is such a method, wherein said separating comprises contacting said broth with an organic solvent comprising an ester of butyric acid and a C4-C12 alkanol.
Also provided is such a method, wherein said fermentation medium has a pH of greater than 5.5 and comprises calcium carbonate for pH control.
Also provided is such a method, wherein said calcium carbonate is present in second feedstock and also serves as a carbon source.
Also provided is such a method, wherein said fermentation medium has a pH greater than 5.5, and comprises a calcium base for pH control and wherein said separating comprises acidulating with sulfuric acid.
Also provided is such a method, further comprising catalytically converting said separated butyric acid into at least one butyric acid derivative.
Also provided is such a method, wherein said catalytically converting comprises hydrogenation and wherein said at least one butyric acid derivative comprises butanol.
Also provided is such a method, wherein said at least one bioproduct is isopropanol.
Also provided is such a method, wherein said broth comprises a second bioproduct, said second bioproduct is selected from acetone and 3-hydroxybutyric acid, and the molar ratio of isopropanol to said second bioproduct in said broth is greater than 5.
Also provided is such a method, further comprising separating isopropanol from said broth to form in separated isopropanol.
Also provided is such a method, wherein said separating comprises evaporation.
Also provided is such a method, further comprising catalytically converting said separated isopropanol into at least one isopropanol derivative.
Also provided is such a method, wherein said broth comprises more than one bioproduct and at least one bioproduct is isopropanol and another is acetone.
Also provided is such a method, wherein said broth comprises a third bioproduct, said third bioproduct is 3-hydroxybutyric acid, and the molar ratio of the combination of isopropanol and acetone to said third bioproduct is greater than 5.
Also provided is such a method further comprising separating isopropanol and acetone from said broth to form a separated composition comprising isopropanol and acetone.
Also provided is such a method, wherein said separating comprises evaporation.
Also provided is such a method further comprising catalytically converting the isopropanol and/or acetone present in said separated composition into at least one derivative of isopropanol or acetone.
According to an embodiment, said organism is acetogenic and said first feedstock comprises at least one non-preferred sugar. According to an embodiment said first feedstock further comprises at least one preferred sugar.
According to an embodiment, said non-preferred sugar is metabolized by a genetically modified acetogenic organism at a rate of at least 0.02 g/hr/g cell mass.
According to an embodiment, CO2 is generated from metabolizing said non-preferred sugar and said generated CO2 comprises at least a fraction of said second feedstock.
According to an embodiment, said non-preferred sugar is selected from the group consisting of glucose, mannose, galactose, arabinose, ribose, maltose, sucrose, lactose, cellobiose and mixtures thereof. According to an embodiment, said non-preferred sugar comprises glucose.
According to an embodiment, said organism is genetically modified to express at least one component of a phosphotransferase system (PTS). According to an embodiment, said at least one component is selected from the group consisting of enzymes EIIA, EIIB, EIIC, and combinations thereof.
According to an embodiment, said organism is genetically modified to express a gene related to a sugar transport system other than genes associated with the phosphotransferase system. According to an embodiment, said gene is selected from the group consisting of a symporter system utilizing a sodium ion (Na+), a symporter system utilizing protons (H+), a permease system and a combination thereof.
According to an embodiment, the rate of metabolizing said non-preferred sugar by said genetically modified organism is greater than that of metabolizing said non-preferred sugar by the native form of the organism by a factor of at least 1.5.
According to an embodiment, said bioproduct is selected from the group consisting of acetic acid, propionic acid, 3-hydroxypropionic acid, butyric acid, hexanoic acid, 3-hydroxybutyric acid, crotonic acid, acetoacetic acid, lactic acid, 2-hydroxyisobutyric acid, 3-methylbutanoic acid, ethanol, butanol, crotyl alcohol, hexanol, acetone, isopropanol, 2,3-butanediol, acetoin, 1,3-propanediol and combinations thereof.
Provided is a mixotrophic fermentation method comprising (i) providing an isolated organism capable of metabolizing CO2 into acetyl-CoA; (ii) providing a first feedstock and a second feedstock for use in a fermentation medium, wherein said first feedstock comprises carbohydrates, glycerol, methanol or combinations thereof; and wherein said second feedstock comprises CO, CO2, carbonate, bicarbonate, H2, glycerol, methanol, formate, urea or mixtures thereof; (iii) culturing said organism in said fermentation medium, whereby both feedstocks are metabolized and a fermentation broth is formed, which broth comprises at least one bioproduct; and (iv) optionally separating said bioproduct from said broth.
According to an embodiment, the method provides a mixotrophic fermentation method that results in greater production of a target bioproduct or a combination of target bioproducts than the combined amounts produced by heterotrophic and autotrophic fermentation with the same organism under the same conditions. Said embodiment is exemplified by comparing three cases of fermenting with a given organism capable of and/or configured for use in the method. In the first case (referred to herein as heterotrophic fermentation), a microorganism is cultured in a fermentation medium comprising a first feedstock to form a heterotrophic fermentation broth. In the second case (referred to herein as autotrophic fermentation), the microorganism is cultured in a fermentation medium comprising a second feedstock to form an autotrophic fermentation broth. In the third case (referred to herein as mixotrophic fermentation), a microorganism is cultured in a fermentation medium comprising a mixture of the first feedstock and the second feedstock to form a mixotrophic fermentation broth. At the end of culturing time, the autotrophic fermentation broth is mixed with the heterotrophic fermentation broth to form a mixed fermentation broth. According to said embodiment, the mixotrophic fermentation method may achieve greater production of a target bioproduct or a combination of target bioproducts than the combined amounts produced by heterotrophic and autotrophic fermentation with the same microorganism under the same conditions. The nature of bioproducts in said mixotrophic fermentation and/or the molar ratio between the bioproducts (in case of forming multiple bioproducts), may differ from those of the mixed fermentation broth.
According to an embodiment, the method is characterized in that the amount of acetic acid formed per biomass unit weight is less than about 50% of that formed in autotrophic fermentation using the same organism, less than 40%, less than 30%, less than 20%, or less than 10%. Biomass refers to the total weight of solid biological material generated during fermentation. Biomass may be easily separated from the fermentation medium by, for example, centrifugation. Biomass does not include any solid biological material introduced into the fermentation medium by one or more feedstocks.
According to an embodiment, the method is characterized in carbon yield of at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, at least 100%, at least 110%, at least 120%, at least 130%, at least 140%, at least 150%, or at least 160%. As used herein carbon yield may be calculated by dividing the total amount of carbon in bioproducts produced during fermentation by the total amount of carbon metabolized from the first feedstock during fermentation.
The method comprises providing an isolated, naturally occurring or non-naturally occurring organism capable of metabolizing CO2. The organism may be autotrophic. In an embodiment, the organism may be capable of assimilating CO, CO2, methanol, etc., for growth. The organism may also be capable of utilizing glycolysis for growth. Any organism capable of metabolizing CO2 is suitable. According to an embodiment, said organism is acetogenic. In an embodiment, the organism is naturally acetogenic. An organism is “naturally acetogenic” if the wild-type (or native) organism is capable of metabolizing CO2 into acetate using the Wood-Ljungdahl pathway (or reductive acetyl-CoA pathway). A naturally acetogenic organism may be a wild-type organism or genetically modified.
According to an embodiment, said organism is acetogenic Clostridia. According to an embodiment, the organism may be selected from the group consisting of Clostridium ljungdahlii, Clostridium autoethanogenum, Clostridium ragsdalei, Eubacterium limosum, Butyribacterium methylotrophicum, Moorella thermoacetica, Clostridium aceticum, Acetobacterium woodii, Clostridium carboxidivorans, Alkalibaculum bacchi, Clostridium drakei, Clostridium formicoaceticum, Clostridium scatologenes, Moorella thermoautotrophica, Acetonema longum, Blautia producta, Clostridium glycolicum, Clostridium magnum, Clostridium mayombei, Clostridium methoxybenzovorans, Oxobacter pfennigii, and Thermoanaerobacter kivui.
The organism may be genetically modified. For example, the organism may be genetically modified to reduce or eliminate expression of a primary alcohol dehydrogenase or a secondary alcohol dehydrogenase. In an embodiment, the organism may be genetically modified to have a primary alcohol dehydrogenase gene or a secondary alcohol dehydrogenase gene deleted from its genome. While a genomic deletion is a preferred embodiment, any genomic mutation resulting in inactivation of the enzyme would be sufficient, including but not limited to partial gene deletion, nonsense mutation, transcriptional promoter deletion, etc. In another embodiment, the transcriptional expression of this gene can be reduced by using antisense RNA.
Similarly, the organism may be genetically modified to reduce or eliminate nucleic acid and/or protein expression of butanediol dehydrogenase. In an embodiment, the organism may be genetically modified to have a butanediol dehydrogenase gene deleted from its genome. In another embodiment, the organism may be genetically modified to have a secondary alcohol dehydrogenase gene and a butanediol dehydrogenase gene deleted from its genome.
As used herein, a “secondary alcohol dehydrogenase” is an enzyme that catalyzes the reduction of a ketone to a secondary alcohol, for example, the reduction of acetone into 2-propanol (a.k.a. isopropanol). An exemplary amino acid sequence of the secondary alcohol dehydrogenase gene is the following amino acid sequence from C. ljungdahlii DSM 13528:
| (SEQ ID NO: 2) |
| MKGFAMLGINKLGWIEKKNPVPGPYDAIVHPLAVSPCTSDIHTVFEGALG |
| NRENMILGHEAVGEIAEVGSEVKDFKVGDRVIVPCTTPDWRSLEVQAGFQ |
| QHSNGMLAGWKESNEKDGVFADYFHVNDADMNLAILPDEIPLESAVMMTD |
| MMTTGFHGAELADIKMGSSVVVIGIGAVGLMGIAGSKLRGAGRIIGVGSR |
| PVCVETAKFYGATDIVNYKNGDIVEQIMDLTHGKGVDRVIMAGGGAETLA |
| QAVTMVKPGGVISNINYHGSGDTLPIPRVQWGCGMAHKTIRGGLCPGGRL |
| RMEMLRDLVLYKRVDLSKLVTHVFDGAENIEKALLLMKNKPKDLIKSVVT |
| F. |
In an embodiment, an exemplary secondary alcohol dehydrogenase amino acid sequence may be an amino acid sequence which has at least 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identity to the above sequence, and which is capable of catalyzing the reduction of a ketone to a secondary alcohol.
As used herein, a “butanediol dehydrogenase” may be an oxidoreductase enzyme, with EC number 1.1.1.4, that catalyzes the reduction of a ketone group to an alcohol group, specifically converting acetoin into butanediol. An exemplary amino acid sequence encoded by the butanediol dehydrogenase gene is the following amino sequence from C. ljungdahlii DSM 13528:
| (SEQ ID NO: 4) |
| MKAVLWYDKKDVRVEEIEEPKVKENAVKIKVKWCGICGSDLHEYLGGPIF |
| IPVGTPHPLSKSTAPVVLGHEFSGEVVEIGSKVTKFKAGDRVIVEPIVAC |
| GKCPACLEGKYNLCEALGFHGLCGSGGGFAEYTVFPEDFVHKIPDTMDYE |
| QAALVEPMAVALHSLRVGNFTTGNTALVLGAGPIGLATIQCLKASGARIV |
| IVFQRKSVRQEYAKKFGADVVLDPNEVDVIEEIKKLTGGVGVDTSFETTG |
| ANVGINTAIQALKYEGTAVITSVWEKNAEINPNDLVFTEKKVVGTLAYRH |
| EFPSTIALMNDGRIKTDGYITKRIALEDIVKEGFETLTGPEKKKHVKIIV |
| TPDKSLL |
In an embodiment, an exemplary butanediol dehydrogenase amino acid sequence may be an amino acid sequence which has at least 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identity to the above sequence, and which is capable of catalyzing the reduction of a ketone to an alcohol, specifically acetoin to butanediol. An exemplary nucleic acid sequence that encodes a butanediol dehydrogenase, which is from C. ljungdahlii DSM 13528, is as follows:
| (SEQ ID NO: 3) |
| ATGAAAGCTGTATTGTGGTATGATAAAAAAGATGTAAGAGTAGAGGAAAT |
| TGAGGAACCTAAGGTAAAAGAAAATGCTGTAAAAATTAAAGTGAAATGGT |
| GTGGTATATGTGGTTCTGACTTGCATGAGTATTTAGGAGGACCTATATTT |
| ATTCCAGTAGGTACGCCACATCCTTTAAGCAAGAGTACTGCACCAGTAGT |
| TTTAGGACATGAGTTTTCAGGAGAAGTAGTAGAAATAGGAAGCAAGGTTA |
| CAAAATTTAAAGCAGGAGATAGAGTTATTGTAGAACCTATAGTTGCCTGT |
| GGAAAGTGTCCTGCTTGTCTTGAAGGAAAATATAATTTATGTGAAGCTTT |
| GGGATTTCATGGACTTTGTGGAAGCGGCGGCGGATTTGCTGAATACACAG |
| TATTTCCTGAAGATTTTGTCCATAAGATACCAGATACTATGGACTATGAG |
| CAGGCTGCACTTGTTGAGCCTATGGCAGTTGCCCTTCATTCTCTAAGAGT |
| TGGAAACTTTACTACAGGAAATACTGCTTTGGTTTTAGGTGCAGGACCTA |
| TAGGACTTGCAACTATTCAGTGTTTAAAGGCATCAGGGGCAAGAATTGTA |
| ATTGTATTTCAGAGAAAATCTGTAAGACAGGAATATGCTAAGAAATTTGG |
| AGCAGATGTAGTTTTAGATCCAAATGAGGTAGATGTAATTGAAGAAATTA |
| AAAAACTTACAGGCGGCGTAGGCGTGGATACATCTTTTGAAACAACAGGT |
| GCAAATGTAGGGATTAATACGGCAATTCAAGCTTTAAAATATGAAGGTAC |
| TGCGGTAATAACCAGCGTATGGGAGAAAAATGCAGAAATCAATCCAAATG |
| ATCTTGTATTTACAGAAAAGAAGGTAGTTGGTACTCTTGCCTACAGACAT |
| GAATTTCCTTCTACAATAGCACTTATGAATGATGGAAGAATAAAGACAGA |
| CGGATATATTACAAAGAGAATAGCACTTGAGGACATTGTAAAAGAAGGAT |
| TTGAAACACTTACAGGACCTGAAAAGAAAAAACATGTAAAAATAATTGTA |
| ACTCCTGACAAATCCTTATTGTAA. |
In an embodiment, an exemplary butanediol dehydrogenase nucleic acid sequence or an exemplary secondary alcohol dehydrogenase nucleic acid may be a nucleic acid sequence which has at least 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identity to a corresponding butanediol dehydrogenase or secondary alcohol dehydrogenase nucleic acid sequence as disclosed herein.
According to an embodiment, said organism expresses and/or comprises one or more biomolecules of the Wood-Ljungdahl pathway (or reductive acetyl-CoA pathway). Biomolecules of the Wood-Ljungdahl pathway include enzymes such as CO dehydrogenase and acetyl-CoA synthase, as well as genes encoding such enzymes. The Wood-Ljungdahl pathway metabolizes CO2, which can be produced during glycolysis or fed exogenously, into acetyl-CoA. The acetyl-CoA is then fed into downstream pathways for production of other or additional bioproducts.
Rates and/or efficiencies relating to bioproduct formation and metabolite consumption achieved by the organism during the mixotrophic fermentation method of the invention may be higher than those achieved by the organism exposed to feedstocks comprising the same nutrients in the wild.
The method further comprises providing a fermentation medium comprising a first feedstock and a second feedstock. According to an embodiment, providing a fermentation medium comprises preparing an aqueous solution comprising said first feedstock and said second feedstock. According to an embodiment, providing comprises supplementing at least one of said first feedstock and said second feedstock during culturing. According to an embodiment, the fermentation medium comprises initially only the first feedstock and then the second feedstock is supplemented. According to an embodiment, supplementing said second feedstock is done before the first feedstock is fully utilized, e.g., at the time the first feedstock is only 10%, 20%, 30% or 40% utilized.
According to an embodiment, the fermentation medium may further comprise a steel mill gas composition. For example, the fermentation medium may comprise a steel mill gas composition comprising 40-80% CO, 10-25% CO2, 2-5% H2, and 15-35% N2. In an embodiment, the fermentation medium may comprise a steel mill gas composition comprising 60-70% CO, 15-20% CO2, 3-4% H2, and 20-30% N2. In an embodiment, the fermentation medium may comprise a steel mill gas composition comprising 43-55% CO, 17-20% CO2, 2-3% H2, and 25-34% N2.
According to an embodiment, said fermentation medium comprises concurrently both said first feedstock and said second feedstock during at least a fraction of the culturing time, e.g., during at least 30% of the time, at least 40%, at least 50%, at least 60%, at least 70%, at least 80% or at least 90% of the time.
The first feedstock of the provided method may comprise carbohydrates, glycerol, methanol or combinations thereof. The second feedstock may comprise CO, CO2, carbonate, bicarbonate, H2, glycerol, methanol, formate, urea or mixtures thereof. When the first feedstock comprises glycerol or methanol, the second feedstock may or may not also comprise glycerol or methanol. In an embodiment, if methanol is present in the first feedstock, it need not be present in the second feedstock.
According to an embodiment, said carbohydrate comprises monosaccharides, such as glucose, fructose and xylose, disaccharides, such as sucrose, oligosaccharides, such as dextrins, polysaccharides, such as starch, xylan, cellulose and hemicellulose and combinations thereof. According to an embodiment, said carbohydrate comprises hexoses, such as glucose and fructose, pentoses, such as xylose and arabinose and combinations thereof.
According to an embodiment, said second feedstock comprises a gaseous compound and said gaseous compound is supplemented to the fermentation medium, e.g., via bubbling the gaseous compound through the medium. The methods for supplementing the fermentation medium and/or the feedstock with a carbon source are not limited, and include, for example, exogenously feeding a gaseous compound, such as CO or CO2 or adding a carbon source and/or feedstock and/or additional components to an initially provided fermentation medium or feedstock later in time during fermentation.
According to an embodiment, said fermentation medium is kept during at least a fraction of the culturing time at a super-atmospheric pressure, e.g., during at least 30% of the time, at least 40%, at least 50%, at least 60%, at least 70%, at least 80% or at least 90% of the time. According to an embodiment, said super-atmospheric pressure is in the range between about 1.1 bar and about 10 bar.
According to an embodiment, said second feedstock comprises CO2 and said CO2 results from another fermentation process. According to an embodiment, said another fermentation process produces ethanol. According to another embodiment, said first feedstock comprises a carbohydrate, and metabolizing said carbohydrate by said autotrophic organism results in generating at least one of CO2 and hydrogen, which then provides at least a fraction of said second feedstock, e.g., at least 50%, at least 60%, at least 70%, at least 80% or at least 90%.
According to an embodiment, said second feedstock comprises CO, CO2, carbonate, bicarbonate, methanol and mixtures thereof and the 13C/12C isotope ratio of said second feedstock is less than that of atmospheric CO2.
According to an embodiment, said second feedstock comprises at least one of ammonium carbonate and ammonium bicarbonate. According to a related embodiment, the method further comprises supplementing pressurized CO2 to said fermentation medium. According to an embodiment, providing said fermentation medium comprises dissolving ammonium bicarbonate and/or ammonium carbonate, and optionally other components, in water and adjusting the pH to a selected level by introducing CO2. According to a related embodiment, a fraction of the CO2 and/or carbonate is metabolized during said culturing and the method further comprises supplementing CO2 in order to maintain the selected pH. The pH of the fermentation medium may be greater than 4, 4.5, 5, 5.5, 6, 6.5, 7, 7.5, 8, 8.5, 9, or 9.5. The pH of the fermentation medium may be in the range from 4-9.5, 5-8.5, or 5.5-7.5. Calcium carbonate may also be used as an agent for controlling pH. In an embodiment calcium carbonate may serve as both a buffering agent and a source of carbon in a feedstock, including, for example, in the second feedstock.
According to an embodiment, said fermentation medium comprises a carbohydrate and carbon monoxide. According to an embodiment, said fermentation medium comprises a carbohydrate and carbon dioxide. According to an embodiment, said fermentation medium comprises a carbohydrate and hydrogen. According to an embodiment, said fermentation medium comprises a carbohydrate and at least one of carbon monoxide, carbon dioxide and hydrogen.
According to an embodiment, said first feedstock comprises a monosaccharide, said second feedstock comprises at least one of carbon monoxide and carbon dioxide and the weight ratio between said monosaccharide and said at least one of carbon monoxide and carbon dioxide is in the range from 0.1 to 10.
According to an embodiment, said providing a fermentation medium comprises providing said fermentation medium with a mixture of CO2 and hydrogen at molar ratio in the range from about 1:0.1 to about 1:5. According to an embodiment, said providing said mixture further comprises steam reforming a hydrocarbon to form said mixture of CO2 and hydrogen. According to an embodiment, said hydrocarbon comprises methane.
The provided method comprises culturing said organism in said fermentation medium, whereby both feedstocks are metabolized and a fermentation broth is formed, which broth comprises at least one bioproduct.
According to an embodiment, the consumption rate of said first feedstock is in the range from 0.01 to 10 mM/hr/OD600, where OD600 is the absorbance value of the culture read at a wavelength of 600 nm. According to an embodiment, the consumption rate of said second feedstock is in the range from 0.01 to 100 mM/hr/OD600, where OD600 is the absorbance value of the culture read at a wavelength of 600 nm.
According to an embodiment, the produced bioproduct is a metabolic derivative of acetyl-CoA.
According to an embodiment, said bioproduct is selected from the group consisting of even numbered primary alcohols, odd numbered secondary alcohols, organic acids of less than 7 carbons, C3 compounds, C4 compounds, and mixtures thereof.
According to an embodiment, said bioproduct is selected from the group consisting of acetic acid, propionic acid, butyric acid, hexanoic acid, 3-hydroxypropionic acid, 3-hydroxybutyric acid, crotonic acid, acetoacetic acid, lactic acid, 2-hydroxyisobutyric acid, 3-methylbutanoic acid, ethanol, isopropanol, butanol, crotyl alcohol, hexanol, acetone, isopropanol, 2,3-butanediol, acetoin, 1,3-propanediol and combinations thereof. In an embodiment, butanol may be n-butanol.
According to an embodiment, said bioproduct is non-naturally occurring. As used herein a non-naturally occurring bioproduct is a product which is unattainable by said organism when cultured in autotrophic conditions or is produced from a metabolic pathway not native to said organism.
According to an embodiment, said bioproduct is a C4 compound.
According to an embodiment, said bioproduct comprises multiple compounds and one of said compounds is acetone.
According to an embodiment, said broth comprises a first bioproduct and a second bioproduct, and said first bioproduct is selected from the group consisting of acetoacetic acid, acetone, isopropanol, 3-hydroxybutyric acid, 2-hydroxyisobutyric acid, and combinations thereof. According to an embodiment, said second bioproduct is selected from the group consisting of ethanol, butanol, crotyl alcohol, hexanol, and combinations thereof. According to an embodiment, the molar ratio between said first bioproduct and said second bioproduct is in a range from 0.1 to 0.95.
A 13C/12C isotope ratio may be used as an indicator of nutrient cycling. For example, according to an embodiment, said bioproduct is characterized by a 13C/12C isotope ratio of less than that of atmospheric CO2. In such a case, the 13C/12C isotope ratio would be indicative of production of the bioproduct from a non-atmospheric CO2 source, for example, CO, CO2, carbonate, bicarbonate, methanol or mixtures thereof present in the second feedstock.
Embodiments of the mixtotrophic fermentation method may include methods that advantageously utilize CO2 and/or H2 produced via sugar consumption (glycolysis) by the organism. Bioproducts produced by such methods may be any molecule that has a NAD(P)H to acetyl-CoA ratio of less than 2. These products include, for example, butanol, butyric acid, acetic acid, 3-hydroxypropionic acid, 3-hydroxybutyric acid, crotonic acid, ethanol, acetone, isopropanol, 2,3-butanediol, acetoin, and crotyl-alcohol.
As the sugar is metabolized, CO2 and H2 evolved by the organism may be exhausted into the fermentation broth at the molecular level. This molecular-scale gas dispersion may provide an excellent source of CO2 or H2 for re-assimilation. No input energy is required for dissolving these molecules into the fermentation broth. No gas dispersion technology known to the inventors can achieve molecular-scale gas dispersion with zero energy input. The components of the first and second feedstock and the ratio of the components of the first and second feedstock may depend on the nature of the bioproduct targeted for production.
In an embodiment, such methods may utilize CO2 produced via glycolysis in combination with supplemented H2 to produce bioproducts, such as butyric acid or butanol. Supplemented H2 may be required because, as in the case of n-butanol or butyric acid production, not enough electrons are released during fermentation to allow for complete re-assimilation of glycolysis-derived CO2. Thus, H2 may provide an electron source for re-assimilation of the glycolysis-derived CO2.
However, dispersion of gaseous hydrogen may be difficult and/or energy intensive. Accordingly, in an embodiment butyric acid or n-butanol may be produced utilizing a first feedstock comprising methanol and a second feedstock comprising a bicarbonate such as sodium bicarbonate or ammonium bicarbonate. The bicarbonate may be supplemented with CO2.
In an embodiment, the organism may consume sugar and methanol in a particular molar ratio. Sugar consumption during fermentation is generally too electron deficient to achieve complete re-assimilation of glycolysis-derived CO2. Thus, concurrent use of methanol and sugar in a given ratio may achieve complete CO2 assimilation without the need for external gas delivery to the fermentation medium. The sugar to methanol molar ratio may range depending on the bioproduct targeted for production. For example, the sugar to methanol molar ratio may range from 1/1 to 1/3 to 1/6 to 1/12. In an embodiment, butyric acid may be produced in a mixotrophic fermentation method comprising the use of a first feedstock comprising glucose and a second feedstock comprising methanol, wherein the molar ratio is 1 mole glucose to 6 moles methanol.
In another embodiment, a bioproduct may be generated by mixotrophic fermentation in a fermentation medium comprising a first feedstock comprising a sugar such as glucose and a second feedstock comprising glycerol.
In another embodiment, a bioproduct may be generated by mixotrophic fermentation in a fermentation medium comprising a first feedstock comprising glucose and a second feedstock comprising supplemented CO2 and H2.
In another embodiment, a bioproduct may be generated by mixotrophic fermentation in a fermentation medium comprising a first feedstock comprising glucose and a second feedstock comprising methanol and supplemented CO2.
In another embodiment, a bioproduct may be generated by mixotrophic fermentation in a fermentation medium comprising a first feedstock comprising methanol or glycerol and a second feedstock comprising supplemented CO2 and H2.
Optionally said method further comprises separating said bioproduct from said broth. Any separation method is suitable. According to various embodiments, separating comprises distillation, solvent extraction, crystallization, ion-exchange, membrane separation and combinations thereof. In an embodiment, the bioproduct may be separated by evaporation, wherein evaporation means any transfer into the vapor phase, e.g., distillation, stripping, etc. In another embodiment, the bioproduct may be, for example, acetone, and the method includes catalytically converting said separated acetone into at least one acetone derivative. In an embodiment, such a method may comprise catalytically converting said separated acetone into one or more of mesitylene (1-3-5-trimethylbenzene), isophthalic acid, uvitic acid, and meta-xylene.
Production of Acetone
Provided herein is a mixotrophic fermentation method for the production of acetone comprising (i) providing an isolated organism capable of metabolizing CO2 into acetyl-CoA; (ii) providing a fermentation medium comprising a first feedstock and a second feedstock wherein said first feedstock comprises carbohydrates, glycerol, methanol, or combinations thereof; and wherein said second feedstock comprises CO, CO2, carbonate, bicarbonate, H2, glycerol, methanol, formate, urea or mixtures thereof; and (iii) culturing said organism in said fermentation medium, whereby both feedstocks are metabolized and a fermentation broth is formed, which broth comprises at least one bioproduct that includes acetone.
Also provided is such a method, wherein said organism is acetogenic.
Also provided is such a method, wherein said organism is acetogenic Clostridia.
Also provided is such a method, wherein said organism is selected from the group consisting of Clostridium ljungdahlii, Clostridium autoethanogenum, Clostridium ragsdalei, Eubacterium limosum, Butyribacterium methylotrophicum, Moorella thermoacetica, Clostridium aceticum, Acetobacterium woodii, Clostridium carboxidivorans, Alkalibaculum bacchi, Clostridium drakei, Clostridium formicoaceticum, Clostridium scatologenes, Moorella thermoautotrophica, Acetonema longum, Blautia producta, Clostridium glycolicum, Clostridium magnum, Clostridium mayombei, Clostridium methoxybenzovorans, Oxobacter pfennigii, and Thermoanaerobacter kivui.
Also provided is such a method, wherein said organism is genetically modified to have a primary alcohol dehydrogenase gene or a secondary alcohol dehydrogenase gene deleted from its genome.
Also provided is such a method, wherein said organism is genetically modified to have butanediol dehydrogenase deleted from its genome.
Also provided is such a method, wherein the first feedstock comprises a sugar selected from glucose and sucrose, and the second feedstock comprises at least one of H2, and methanol, and the organism assimilates CO2 produced during glycolysis. Also provided is such a method, wherein the first feedstock comprises methanol and the second feedstock comprises a bicarbonate supplemented with CO2. Also provided is such a method, wherein the first feedstock comprises at least one of glucose and sucrose and the second feedstock comprises glycerol. Also provided is such a method, wherein the first feedstock comprises at least one of glucose and sucrose and the second feedstock comprises CO2 and H2. Also provided is such a method, wherein the first feedstock comprises at least one of glucose and sucrose and the second feedstock comprises CO2 and methanol. Also provided is such a method, wherein the first feedstock comprises at least one of glucose and sucrose and the second feedstock comprises CO2. Also provided is such a method, wherein the first feedstock comprises glucose and the second feedstock comprises CO. According to an embodiment, a method as described above is provided, wherein the feedstock glucose and feedstock CO are present in a glucose/CO weight/weight ratio of from about 0.3 to about 0.8, e.g., from about 0.25 to about 0.85, from about 0.4 to about 0.7, from about 0.5 to about 0.6. Also provided is such a method, wherein the first feedstock comprises methanol or glycerol and the second feedstock comprises CO2 and H2. Also provided is such a method, wherein the first feedstock comprises a carbohydrate, wherein said fermentation medium comprises a non-fermentable impurity and wherein the impurity and the carbohydrate are present in the fermentation medium in a weight/weight ratio of greater than 0.05. In an embodiment, said impurity may be a fermentation inhibitor.
Also provided is such a method, wherein said broth comprises a second bioproduct, wherein said second bioproduct is selected from isopropanol and 3-hydroxybutyric acid and the molar ratio between acetone and said second bioproduct is greater than 5.
Also provided is such a method, further comprising separating acetone from said broth to form separated acetone. In an embodiment, said separating comprises evaporation. In an embodiment, said method further comprises catalytically converting said separated acetone into at least one acetone derivative. For example, herein is provided such a method comprising catalytically converting said separated acetone into one or more of mesitylene (1-3-5-trimethylbenzene), isophthalic acid, uvitic acid, and meta-xylene.
Also provided is such a method, wherein the method achieves greater production of acetone than the combined amounts of acetone produced by heterotrophic and autotrophic fermentation with the same organism under the same conditions.
Also provided is such a method, wherein said second feedstock comprises CO, CO2, carbonate, bicarbonate, methanol, and mixtures thereof; and wherein the 13C/12C isotope ratio of the carbon present in said second feedstock is less than that of atmospheric CO2.
Also provided is such a method, wherein said acetone has a 13C/12C isotope ratio of less than that of atmospheric CO2.
Also provided is such a method, wherein said first feedstock and said second feedstock are present in the fermentation medium at the same time.
Also provided is such a method, wherein the culturing is performed in whole or in part at a super-atmospheric pressure.
Also provided is such a method, wherein providing a fermentation medium comprises providing said fermentation medium with a mixture of CO2 and hydrogen at a molar ratio in the range between 1:0.1 and 1:5.
Also provided is such a method, comprising production of acetone and acetic acid. For example, in an embodiment, such a method is provided, wherein the amount of acetic acid formed per biomass unit weight is less than about 50% of that formed in autotrophic fermentation with the same organism under the same conditions.
Also provided is such a method, wherein said fermentation medium comprises at least one of CO, CO2, and hydrogen.
Also provided is such a method, wherein said fermentation medium comprises a steel mill produced composition.
Production of Butyric Acid
Provided herein is a mixotrophic fermentation method for the production of butyric acid comprising (i) providing an isolated organism capable of metabolizing CO2 into acetyl-CoA; (ii) providing a fermentation medium comprising a first feedstock and a second feedstock wherein said first feedstock comprises carbohydrates, glycerol, methanol, or combinations thereof; and wherein said second feedstock comprises CO, CO2, carbonate, bicarbonate, H2, glycerol, methanol, formate, urea or mixtures thereof; and (iii) culturing said organism in said fermentation medium, whereby both feedstocks are metabolized and a fermentation broth is formed, which broth comprises at least one bioproduct that includes butyric acid.
Also provided is such a method wherein said organism is selected from the group consisting of Clostridium ljungdahlii, Clostridium autoethanogenum, Clostridium ragsdalei, Eubacterium limosum, Butyribacterium methylotrophicum, Moorella thermoacetica, Clostridium aceticum, Acetobacterium woodii, Clostridium carboxidivorans, Alkalibaculum bacchi, Clostridium drakei, Clostridium formicoaceticum, Clostridium scatologenes, Moorella thermoautotrophica, Acetonema longum, Blautia producta, Clostridium glycolicum, Clostridium magnum, Clostridium mayombei, Clostridium methoxybenzovorans, Oxobacter pfennigii, and Thermoanaerobacter kivui.
Also provided is such a method wherein the first feedstock comprises a sugar selected from glucose and sucrose, and the second feedstock comprises at least one of H2 and methanol and the organism assimilates CO2 produced during glycolysis.
Also provided is such a method wherein the first feedstock comprises glucose, and the second feedstock comprises methanol at a glucose/methanol molar ratio of about 1:6, e.g., in a range from about 1:3 to about 1:4, from about 1:5 to about 1:6, from about 1:7 to about 1:9.
Also provided is such a method wherein the first feedstock comprises methanol and the second feedstock comprises a bicarbonate supplemented with CO2.
Also provided is such a method wherein the first feedstock comprises at least one of glucose and sucrose and the second feedstock comprises glycerol.
Also provided is such a method wherein the first feedstock comprises at least one of glucose and sucrose and the second feedstock comprises CO7 and H2.
Also provided is such a method wherein the first feedstock comprises at least one of glucose and sucrose and the second feedstock comprises CO2 and methanol.
Also provided is such a method wherein the first feedstock comprises at least one of glucose and sucrose and the second feedstock comprises CO2.
Also provided is such a method wherein the first feedstock comprises glucose and the second feedstock comprises CO. In an embodiment, such a method is provided wherein the feedstock glucose and feedstock CO are present in a glucose/CO weight/weight ratio of from about 0.3 to about 0.8, e.g., from about 0.25 to about 0.85, from about 0.4 to about 0.7, from about 0.5 to about 0.6.
Also provided is such a method wherein the first feedstock comprises methanol or glycerol and the second feedstock comprises CO2 and H2.
Also provided is such a method wherein the first feedstock comprises a carbohydrate, wherein said fermentation medium comprises a non-fermentable impurity and wherein the impurity and the carbohydrate are present in the fermentation medium in a weight/weight ratio of greater than 0.05. In an embodiment, the impurity may be a fermentation inhibitor.
Also provided is such a method further comprising separating butyric acid from said broth to form separated butyric acid. The butyric acid may be separated by utilizing an organic solvent comprising a C6-C12 alkanol, a C4-C12 alkanol, and/or an ester of butyric acid.
Also provided is such a method wherein said fermentation medium has a pH of greater than 5.5 and comprises calcium carbonate for pH control. In an embodiment, the calcium carbonate is present in the said second feedstock and also serves as a carbon source. In another embodiment, said fermentation medium comprises a calcium base for pH control.
Also provided is such a method further comprising separating butyric acid from said broth wherein said separating comprises acidulating with sulfuric acid.
Also provided is such a method further comprising catalytically converting said separated butyric acid into at least one butyric acid derivative. In an embodiment, said catalytically converting comprises hydrogenation and said at least one butyric acid derivative comprises butanol.
Production of Isopropanol
Provided herein is a mixotrophic fermentation method for the production of isopropanol (also known a 2-propanol) comprising (i) providing an isolated organism capable of metabolizing CO2 into acetyl-CoA; (ii) providing a fermentation medium comprising a first feedstock and a second feedstock wherein said first feedstock comprises carbohydrates, glycerol, methanol, or combinations thereof; and wherein said second feedstock comprises CO, CO2, carbonate, bicarbonate, H2, glycerol, methanol, formate, urea or mixtures thereof; and (iii) culturing said organism in said fermentation medium, whereby both feedstocks are metabolized and a fermentation broth is formed, which broth comprises at least one bioproduct that includes isopropanol.
Also provided is such a method, wherein said organism is acetogenic.
Also provided is such a method, wherein said organism is acetogenic Clostridia.
Also provided is such a method, wherein said organism is selected from the group consisting of Clostridium ljungdahlii, Clostridium autoethanogenum, Clostridium ragsdalei, Eubacterium limosum, Butyribacterium methylotrophicum, Moorella thermoacetica, Clostridium aceticum, Acetobacterium woodii, Clostridium carboxidivorans, Alkalibaculum bacchi, Clostridium drakei, Clostridium formicoaceticum, Clostridium scatologenes, Moorella thermoautotrophica, Acetonema longum, Blautia producta, Clostridium glycolicum, Clostridium magnum, Clostridium mayombei, Clostridium methoxybenzovorans, Oxobacter pfennigii, and Thermoanaerobacter kivui.
Also provided is such a method, wherein the first feedstock comprises a sugar selected from glucose and sucrose, and the second feedstock comprises at least one of H2, and methanol, and the organism assimilates CO2 produced during glycolysis. Also provided is such a method, wherein the first feedstock comprises methanol and the second feedstock comprises a bicarbonate supplemented with CO2. Also provided is such a method, wherein the first feedstock comprises at least one of glucose and sucrose and the second feedstock comprises glycerol. Also provided is such a method, wherein the first feedstock comprises at least one of glucose and sucrose and the second feedstock comprises CO2 and H2. Also provided is such a method, wherein the first feedstock comprises at least one of glucose and sucrose and the second feedstock comprises CO2 and methanol. Also provided is such a method, wherein the first feedstock comprises at least one of glucose and sucrose and the second feedstock comprises CO2. Also provided is such a method, wherein the first feedstock comprises glucose and the second feedstock comprises CO. According to an embodiment, a method as described above is provided, wherein the feedstock glucose and feedstock CO are present in a glucose/CO weight/weight ratio of from about 0.3 to about 0.8, e.g., from about 0.25 to about 0.85, from about 0.4 to about 0.7, from about 0.5 to about 0.6. Also provided is such a method, wherein the first feedstock comprises methanol or glycerol and the second feedstock comprises CO2 and H2. Also provided is such a method, wherein the first feedstock comprises a carbohydrate, wherein said fermentation medium comprises a non-fermentable impurity and wherein the impurity and the carbohydrate are present in the fermentation medium in a weight/weight ratio of greater than 0.05. In an embodiment, said impurity may be a fermentation inhibitor.
Also provided is such a method, wherein said broth comprises a second bioproduct, wherein said second bioproduct is selected from acetone and 3-hydroxybutyric acid and the molar ratio between isopropanol and said second bioproduct is greater than 5.
Also provided is such a method, further comprising separating isopropanol from said broth to form separated isopropanol. In an embodiment, said separating comprises evaporation. In an embodiment, said method further comprises catalytically converting said separated isopropanol into at least one isopropanol derivative. For example, herein is provided such a method comprising catalytically converting said separated isopropanol into acetone.
Also provided is such a method, wherein the method achieves greater production of isopropanol than the combined amounts of isopropanol produced by heterotrophic and autotrophic fermentation with the same organism under the same conditions.
Also provided is such a method, wherein said second feedstock comprises CO, CO2, carbonate, bicarbonate, methanol, and mixtures thereof; and wherein the 13C/12C isotope ratio of the carbon present in said second feedstock is less than that of atmospheric CO2.
Also provided is such a method, wherein said isopropanol has a 13C/12C isotope ratio of less than that of atmospheric CO2.
Also provided is such a method, wherein said first feedstock and said second feedstock are present in the fermentation medium at the same time.
Also provided is such a method, wherein the culturing is performed in whole or in part at a super-atmospheric pressure.
Also provided is such a method, wherein providing a fermentation medium comprises providing said fermentation medium with a mixture of CO2 and hydrogen at a molar ratio in the range between 1:0.1 and 1:5.
Also provided is such a method, comprising production of isopropanol and acetic acid. For example, in an embodiment, such a method is provided, wherein the amount of acetic acid formed per biomass unit weight is less than about 50% of that formed in autotrophic fermentation with the same organism under the same conditions.
Also provided is such a method, wherein said fermentation medium comprises at least one of CO, CO2, and hydrogen.
Also provided is such a method, wherein said fermentation medium comprises a steel mill produced composition.
Production of Isopropanol and Acetone
Provided herein is a mixotrophic fermentation method for the production of acetone and isopropanol comprising (i) providing an isolated organism capable of metabolizing CO2 into acetyl-CoA; (ii) providing a fermentation medium comprising a first feedstock and a second feedstock wherein said first feedstock comprises carbohydrates, glycerol, methanol, or combinations thereof; and wherein said second feedstock comprises CO, CO2, carbonate, bicarbonate, H2, glycerol, methanol, formate, urea or mixtures thereof; and (iii) culturing said organism in said fermentation medium, whereby both feedstocks are metabolized and a fermentation broth is formed, which broth comprises more than one bioproduct and at least one bioproduct is isopropanol and another is acetone.
Also provided is such a method, wherein said organism is acetogenic.
Also provided is such a method, wherein said organism is acetogenic Clostridia.
Also provided is such a method, wherein said organism is selected from the group consisting of Clostridium ljungdahlii, Clostridium autoethanogenum, Clostridium ragsdalei, Eubacterium limosum, Butyribacterium methylotrophicum, Moorella thermoacetica, Clostridium aceticum, Acetobacterium woodii, Clostridium carboxidivorans, Alkalibaculum bacchi, Clostridium drakei, Clostridium formicoaceticum, Clostridium scatologenes, Moorella thermoautotrophica, Acetonema longum, Blautia producta, Clostridium glycolicum, Clostridium magnum, Clostridium mayombei, Clostridium methoxybenzovorans, Oxobacter pfennigii, and Thermoanaerobacter kivui.
Also provided is such a method, wherein the first feedstock comprises a sugar selected from glucose and sucrose, and the second feedstock comprises at least one of H2, and methanol, and the organism assimilates CO2 produced during glycolysis. Also provided is such a method, wherein the first feedstock comprises methanol and the second feedstock comprises a bicarbonate supplemented with CO2. Also provided is such a method, wherein the first feedstock comprises at least one of glucose and sucrose and the second feedstock comprises glycerol. Also provided is such a method, wherein the first feedstock comprises at least one of glucose and sucrose and the second feedstock comprises CO2 and H2. Also provided is such a method, wherein the first feedstock comprises at least one of glucose and sucrose and the second feedstock comprises CO2 and methanol. Also provided is such a method, wherein the first feedstock comprises at least one of glucose and sucrose and the second feedstock comprises CO2. Also provided is such a method, wherein the first feedstock comprises glucose and the second feedstock comprises CO. According to an embodiment, a method as described above is provided, wherein the feedstock glucose and feedstock CO are present in a glucose/CO weight/weight ratio of from about 0.3 to about 0.8, e.g., from about 0.25 to about 0.85, from about 0.4 to about 0.7, from about 0.5 to about 0.6. Also provided is such a method, wherein the first feedstock comprises methanol or glycerol and the second feedstock comprises CO2 and H2. Also provided is such a method, wherein the first feedstock comprises a carbohydrate, wherein said fermentation medium comprises a non-fermentable impurity and wherein the impurity and the carbohydrate are present in the fermentation medium in a weight/weight ratio of greater than 0.05. In an embodiment, said impurity may be a fermentation inhibitor. Also provided is such a method wherein said broth comprises a third bioproduct, said third bioproduct is 3-hydroxybutyric acid, and the molar ratio of the combination of isopropanol and acetone to said third bioproduct is greater than 5.
Also provided is such a method, further comprising separating acetone and isopropanol from said broth to form separated acetone and isopropanol. In an embodiment, said separating comprises evaporation. In an embodiment, said method further comprises catalytically converting said separated acetone and separated isopropanol into at least one acetone or isopropanol derivative.
Also provided is such a method, wherein the method achieves greater production of acetone and isopropanol than the combined amounts of acetone and isopropanol produced by heterotrophic and autotrophic fermentation with the same organism under the same conditions.
Also provided is such a method, wherein said second feedstock comprises CO, CO2, carbonate, bicarbonate, methanol, and mixtures thereof; and wherein the 13C/12C isotope ratio of the carbon present in said second feedstock is less than that of atmospheric CO2.
Also provided is such a method, wherein said isopropanol has a 13C/12C isotope ratio of less than that of atmospheric CO2.
Also provided is such a method, wherein said first feedstock and said second feedstock are present in the fermentation medium at the same time.
Also provided is such a method, wherein the culturing is performed in whole or in part at a super-atmospheric pressure.
Also provided is such a method, wherein providing a fermentation medium comprises providing said fermentation medium with a mixture of CO2 and hydrogen at a molar ratio in the range between 1:0.1 and 1:5.
Also provided is such a method, comprising production of acetone, isopropanol and acetic acid. For example, in an embodiment, such a method is provided, wherein the amount of acetic acid formed per biomass unit weight is less than about 50% of that formed in autotrophic fermentation with the same organism under the same conditions.
Also provided is such a method, wherein said fermentation medium comprises at least one of CO, CO2, and hydrogen.
Also provided is such a method, wherein said fermentation medium comprises a steel mill produced composition.
Production of Crotyl Alcohol
Provided herein is a method of producing crotyl alcohol, comprising culturing a microbial organism on a growth substrate under conditions to form a broth comprising crotyl alcohol, wherein the microbial organism is capable of converting acetyl-CoA into crotyl alcohol and comprises at least one exogenous nucleic acid encoding one or more of the following crotyl alcohol pathway enzymes:
A. Acetyl-CoA acetyltransferase (also known as thiolase) (THL)
B. 3-hydroxybutyryl-CoA dehydrogenase (HBD)
C. 3-hydroxybutyryl-CoA dehydratase (also known as crotonase) (CRT)
D. Acetaldehyde/alcohol dehydrogenase (ADHE)
E. Butanol dehydrogenase (BDH)
F. CoA-transferase subunit A (COAT-A)
G. CoA-transferase subunit B (COAT-B)
H. Aldehyde:ferredoxin oxidoreductase (AOR),
and wherein said microbial organism produces more crotyl alcohol compared with a naturally occurring microbial organism of the same genus and species lacking said exogenous nucleic acid.
Also provided herein is an acetogenic microbial organism or a microbial organism naturally capable of converting acetyl-CoA into crotonyl-CoA, the microbial organism comprising at least one exogenous nucleic acid encoding one or more of the following crotyl alcohol pathway enzymes:
A. Acetyl-CoA acetyltransferase (also known as thiolase) (THL)
B. 3-hydroxybutyryl-CoA dehydrogenase (HBD)
C. 3-hydroxybutyryl-CoA dehydratase (also known as crotonase) (CRT)
D. Acetaldehyde/alcohol dehydrogenase (ADHE)
E. Butanol dehydrogenase (BDH)
F. CoA-transferase subunit A (COAT-A)
G. CoA-transferase subunit B (COAT-B)
H. Aldehyde:ferredoxin oxidoreductase (AOR),
wherein said microbial organism produces more crotyl alcohol compared with a naturally occurring microbial organism of the same genus and species lacking said exogenous nucleic acid.
In an embodiment, provided is such a microbial organism, which is capable of converting acetyl-CoA into isopropanol, the microbial organism further comprising at least a second exogenous nucleic acid, the second exogenous nucleic acid encoding one or more isopropanol pathway enzymes. In an embodiment, the one or more isopropanol pathway enzymes comprises: A. THL, F. COAT-A, G. COAT-B, I. ADC, and/or J. secondary alcohol dehydrogenase (SADH). In an embodiment, said microbial organism may comprise exogenous nucleic acids encoding each of the enzymes A, B, C, D, F, G, I, J. In an embodiment, said microbial organism may comprise exogenous nucleic acids encoding each of the enzymes A, B, C, D, E, F, G, I, J. In an embodiment, said microbial organism may comprise exogenous nucleic acids encoding each of the enzymes A, B, C, E, F, G, H, I, J.
In an embodiment, a microbial organism as provided herein may comprise two, three, four, five, six, seven, eight, nine, or ten exogenous nucleic acids.
Also provided herein is such a microbial organism, wherein the exogenous nucleic acid is a heterologous nucleic acid.
Also provided is such a method for further producing acetone, comprising culturing said microbial organism comprising at least one exogenous nucleic acid on a growth substrate to form a broth comprising crotyl alcohol and acetone, wherein said microbial organism is capable of converting acetyl-CoA into acetone, the microbial organism further comprising at least a second exogenous nucleic acid, the second exogenous nucleic acid encoding one or more acetone pathway enzymes. In an embodiment, such a method may be performed, wherein a crotyl alcohol to acetone molar ratio in said broth is in the range from 5 to 10.
Also provided is such a method for further producing isopropanol, comprising culturing said microbial organism comprising at least one exogenous nucleic acid on a growth substrate to form a broth comprising crotyl alcohol and isopropanol, wherein said microbial organism is capable of converting acetyl-CoA into isopropanol, the microbial organism further comprising at least a second exogenous nucleic acid, the second exogenous nucleic acid encoding one or more isopropanol pathway enzymes. In an embodiment, such a method may be performed, wherein a crotyl alcohol to isopropanol molar ratio in said broth is in the range from 5 to 10.
Also provided is such a method, wherein said growth substrate comprises a carbohydrate.
Also provided is such a method, wherein said growth substrate comprises a one-carbon molecule. In an embodiment, such a method may be performed, wherein said one-carbon molecule is exogenously added. In an embodiment, said one-carbon molecule is selected from a group consisting of CO, CO2, CH3OH, carbonate, bicarbonate and combinations thereof.
Also provided is such a method, wherein said growth substrate comprises at least one gaseous compound. In an embodiment, said gaseous compound is exogenously added. In an embodiment, said at least one gaseous compound is selected from a group consisting of CO, CO2, H2 and combinations thereof.
Also provided herein is such a method, wherein said growth substrate comprises a carbohydrate in combination with at least one of a one-carbon molecule and a gaseous compound.
Also provided herein is such a method, wherein said growth substrate comprises a carbohydrate, exogenously added CO2 and exogenously added H2, and wherein at least 2 moles of H2 are added per mole of CO2.
Also provided herein is such a method, comprising steam reforming of a hydrocarbon, whereby CO2 and H2 are formed and used in said growth substrate.
Also provided herein is such a method, wherein carbon yield is at least 42 wt %.
Also provided herein is such a method, comprising providing pressurized CO2, pressurized CO, pressurized H2, or a combination thereof to said growth substrate.
Also provided herein is such a method, wherein said culturing is conducted at a pressure in the range between 1 atm and 5 atm.
Also provided herein is such a method, comprising providing at least one of ammonium carbonate and ammonium bicarbonate to said growth substrate.
Also provided herein is such a method, comprising at least partially separating crotyl alcohol from said broth.
Also provided herein is such a method, comprising at least partially separating acetone from said broth.
Also provided herein is such a method, comprising at least partially separating isopropanol from said broth.
Also provided herein is such a method, wherein said separating comprises liquid-liquid extraction. In an embodiment, the method may further comprise dehydrating said separated crotyl alcohol to form butadiene.
Also provided is such a method, which comprises culturing the microbial organism on a growth substrate for at least 1 hour under conditions to foul′ a broth comprising at least 1 g/L crotyl alcohol.
Also provided is such a method, which comprises culturing the microbial organism on a growth substrate for at least 1 hour under conditions to form a broth comprising at least 1 g/L crotyl alcohol and at least 0.1 g/L acetone.
Also provided is such a method, which comprises culturing the microbial organism on a growth substrate for at least 1 hour under conditions to form a broth comprising at least 1 g/L crotyl alcohol and at least 0.1 g/L isopropanol.
Provided herein is also a non-naturally occurring microbial organism capable of converting acetyl-CoA into crotyl alcohol, wherein butyryl-CoA dehydrogenase (BCD) nucleic acid expression and/or BCD protein translation in the microbial organism is disrupted or silenced. In an embodiment, said expression silencing comprises at least one of gene disruption, gene deletion and gene mutation. In an embodiment, said protein translation silencing comprises RNA interference. In an embodiment, such a microbial organism comprises at least one exogenous nucleic acid encoding one or more of the following crotyl alcohol pathway enzymes:
A. Acetyl-CoA acetyltransferase (also known as thiolase) (THL)
B. 3-hydroxybutyryl-CoA dehydrogenase (HBD)
C. 3-hydroxybutyryl-CoA dehydratase (also known as crotonase) (CRT)
D. Acetaldehyde/alcohol dehydrogenase (ADHE)
E. Butanol dehydrogenase (BDH)
F. CoA-transferase subunit A (COAT-A)
G. CoA-transferase subunit B (COAT-B)
H. Aldehyde:ferredoxin oxidoreductase (AOR),
wherein said microbial organism produces more crotyl alcohol compared with a naturally occurring microbial organism of the same genus and species lacking said exogenous nucleic acid.
Also provided herein is such a microbial organism, which is capable of converting acetyl-CoA into acetone, the microbial organism further comprising at least one exogenous nucleic acid encoding one or more acetone pathway enzymes. In an embodiment, said one or more acetone pathway enzymes comprises A. THL, F. COAT-A, G. COAT-B, and/or I. acetoacetate decarboxylase (ADC).
Also provided herein is such a microbial organism, which is capable of converting acetyl-CoA into isopropanol, the microbial organism further comprising at least one exogenous nucleic acid encoding one or more isopropanol pathway enzymes. In an embodiment, said one or more isopropanol pathway enzymes comprises: A. THL, F. COAT-A, G. COAT-B, I. ADC, and/or J. secondary alcohol dehydrogenase (SADH).
In an embodiment, said microbial organism may comprise two, three, four, five, six, seven, eight, nine or ten exogenous nucleic acids.
In an embodiment, said microbial organism may comprise exogenous nucleic acids encoding each of the enzymes A, B, C, D, F, G, I. In an embodiment, said microbial organism may comprise exogenous nucleic acids encoding each of the enzymes A, B, C, D, E, F, G, I. In another embodiment, said microbial organism may comprise exogenous nucleic acids encoding each of the enzymes A, B, C, E, F, G, H, I. In another embodiment, said microbial organism may comprise exogenous nucleic acids encoding each of the enzymes A, B, C, D, F, G, I, J.
Also provided herein is such a microbial organism, wherein at least one exogenous nucleic acid is a heterologous nucleic acid.
Also provided herein is such a microbial organism, wherein said organism is an acetogenic bacterium.
Herein is further provided a method of producing crotyl alcohol, comprising culturing a non-naturally occurring microbial organism on a growth substrate under conditions to form a broth comprising crotyl alcohol, wherein the microbial organism is capable of converting acetyl-CoA into crotyl alcohol and wherein butyryl-CoA dehydrogenase (BCD) nucleic acid expression and/or BCD protein translation in the microbial organism is disrupted or silenced.
Utilization of Non-Preferred Carbon Source
According to an embodiment, said organism is acetogenic and said first feedstock comprises at least one non-preferred carbon source, for example, a non-preferred sugar. As used herein, the term non-preferred carbon source refers to a carbon source that is metabolized by the native form of the organism at a rate of less than 0.01 g/hr/g cell mass. Such a carbon source may be a carbohydrate, a sugar (e.g., glucose) or glycerol. Such a non-preferred carbon source may also be methanol. The non-preferred carbon source may also be an oxygen-containing organic compound. According to an embodiment, said non-preferred carbon source comprises at least 50%, at least 60%, at least 70%, at least 80% or at least 90% of said first feedstock. According to an embodiment, the concentration of said non-preferred carbon source in said provided fermentation medium is in a range between 2 g/L and 50 g/L.
According to an embodiment, said non-preferred sugar is selected from the group consisting of glucose, mannose, galactose, arabinose, ribose, maltose, sucrose, lactose, cellobiose, and mixtures thereof. A non-preferred sugar is a sugar that is metabolized by the native form of the organism at a rate of less than 0.01 g/hr/g cell mass. According to an embodiment, said non-preferred sugar comprises glucose. According to an embodiment, said non-preferred sugar forms at least 50%, at least 60%, at least 70%, at least 80% or at least 90% of said first feedstock. According to an embodiment, the concentration of said non-preferred sugar in said provided fermentation medium is in a range between 2 g/L and 50 g/L.
According to an embodiment, said first feedstock further comprises at least one preferred sugar. As used herein, the term preferred sugar refers to a sugar that is metabolized by the native form of the organism at a rate greater than 0.01 g/hr/g cell mass.
According to an embodiment, said preferred sugar is selected from the group consisting of fructose, xylose, and mixtures thereof. According to an embodiment, said provided fermentation medium comprises said preferred sugar and said non-preferred sugar concurrently. According to an embodiment, said provided fermentation medium comprises first said preferred sugar and then said non-preferred sugar.
According to an embodiment, said non-preferred sugar is metabolized at a rate greater than 0.01 g/hr/g cell mass. Metabolism rates of a non-preferred sugar of greater than 0.01 g/hr/g cell mass may be achieved by an organism that has been genetically modified for increased non-preferred sugar metabolism. In an embodiment, said non-preferred sugar may be metabolized by a genetically modified organism at a rate greater than 0.02 g/hr/g, greater than 0.04 g/hr/g cell mass, greater than 0.06 g/hr/g, greater than 0.08 g/hr/g cell mass, greater than 0.1 g/hr/g, greater than 0.12 g/hr/g cell mass, greater than 0.14 g/hr/g, greater than 0.16 g/hr/g cell mass, greater than 0.18 g/hr/g, greater than 0.2 g/hr/g cell mass, or greater than 0.26 g/hr/g.
According to an embodiment, CO2 is generated from metabolism of said non-preferred sugar and said generated CO2 comprises at least a fraction of said fermentation medium second feedstock. According to an embodiment, said generated CO2 comprises at least 20% of said fermentation medium second feedstock, at least 40%, at least 60%, at least 80% or at least 90%.
According to an embodiment, said acetogenic organism metabolizing said non-preferred sugar is acetogenic Clostridia. According to an embodiment, said organism metabolizing said non-preferred sugar is selected from the group consisting of Clostridium ljungdahlii, Clostridium autoethanogenum, Clostridium ragsdalei, Eubacterium limosum, Butyribacterium methylotrophicum, Moorella thermoacetica, Clostridium aceticum, Acetobacterium woodii, Clostridium carboxidivorans, Alkalibaculum bacchi, Clostridium drakei, Clostridium formicoaceticum, Clostridium scatologenes, Moorella thermoautotrophica, Acetonema longum, Blautia producta, Clostridium glycolicum, Clostridium magnum, Clostridium mayombei, Clostridium methoxybenzovorans, Oxobacter pfennigii, and Thermoanaerobacter kivui.
According to an embodiment, said organism metabolizing said non-preferred sugar is genetically modified to express at least one component of a phosphotransferase system (PTS), also known as PEP group translocation. According to an embodiment, said at least one component is selected from the group consisting of enzymes EIIA, EIIB, EIIC, and combinations thereof.
According to an embodiment, said organism is genetically modified to express a gene related to a sugar transport system other than genes associated with the phosphotransferase system. According to an embodiment, said organism may be genetically modified to express a gene selected from the group consisting of a symporter system utilizing a sodium ion (Na+), a symporter system utilizing protons (H+), a permease system, and a combination thereof. For example, the organism may be transformed with a Gnt-II system transporter (gntP gene), a glycoside-pentoside-hexuronide (GPH):cation symporter family gene (GPH gene) or a fucose-galactose-glucose (FGH):H+ symporter family gene (FGH gene).
The sugar transport system is not particularly limited. For example, in an embodiment, said gntP gene may be obtained from one or more various organisms including Clostridium acetobutylicum ATCC 824 and Escherichia coli K-12. An exemplary nucleic acid sequence that encodes a gntP gene, from C. acetobutylicum, is as follows:
| (SEQ ID NO: 5) |
| ATGCCATTATTAATTGTTGTTATTGGCGTCGCATTACTATTACTACTTAT |
| GATTAAATTCAAAGTAAACGGATTCATATCCCTAATTCTTGTAGCTTTGG |
| TTGTTGGTATCGCCGAAGGTATGAATCCTGCAAAAGCTGTTTCTTCAATT |
| CAAAACGGTGTTGGAAGCACCTTAAGCAGTTTGGCACTAATTTTAGGTTT |
| TGGTGCTATGTTTGGAAAATTAATAGCTGATTCTGGTGCTGCTCAAAGGA |
| TTTCTAGAAGTTTAATTAATAAATTTGGTGTAAAAAAAATTCAATGGGCT |
| GTTGTATTAACGGGTTTCATAGTTGGCATTGCTATGTTCTATGAGGTAGG |
| TTTTGTTCTACTTATACCTCTTGTTTTTACTATTGCTGAATTCACAGAAC |
| TTCCTCTTTTATACATAGGCGTTCCTATGGCTGCAGCTTTATCTGTCACT |
| CACGGATTTTTACCTCCTCACCCTGGACCTGTTGCAATAGCTACAATATA |
| TGGTGCAAGCATTAGCATGACTCTTGTATATGGAATTGTAATAGCTATAC |
| CTACAGTAATAGTTGCAGGACCTGTTTTGACTAAGTTTTTAAAACGTTTT |
| GATCATAAATCTTCAAAAAACCTTTTTAAAACTAAGGTCTTTGATGAAGA |
| TGAAATGCCAAGTTTCTCATTAAGCGTATTAACTGCTATTGTTCCTCCTA |
| TTCTTATGGCCTTTTCAGCTGTTTGTGAAATCACACTACCAAAAACATCT |
| CCTATAAGACATTTTGCAGAATTCGTTGGAAGTCCTATGATGGCAATGTT |
| TATATCAATCATTGTAGCTATCTTTACTCTTGGTATAATGCGCGGAAAGA |
| AAATGGAAGAAATAATGAGAACTTTAGCTGAAGCCGCAAGTTCCATTGCA |
| ATGATCCTTTTAATAGTAGCTGGAGGTGGTGCCTTCAAGCAAGTACTAAT |
| AGACAGTGGTGTTGGAAAATATATCGCTTCTATTATGGTTGGAAGTAATA |
| TATCTCCTCTAATCTTGGCTTGGGCGATTGCAGCAATTTTAAGATTATCT |
| CTTGGTTCTGCCACTGTTTCTGCTATGACTACTGCCGGTATAGTACTTCC |
| TCTTATTCCTTCAACCCATGCAAACCCAGCATTAATGGTTTTAGCAACTG |
| GCGCAGGTAGTCTTATTTTCTCTCATGTAAACGATCCAGGTTTCTGGATG |
| TTCAAAGAATATTTTGGACTTAGCATAGGAGAAACAATGGCTTCATGGTC |
| TACTTTAGAAACTATAATTTCAATTATGGGGTTAATTGGTGTTTTAGCTT |
| TAAATATGGTTGGATAG. |
The encoded gntP amino acid sequence is as follows:
| (SEQ ID NO: 6) |
| MPLLIVVIGVALLLLLMIKFKVNGFISLILVALVVGIAEGMNPAKAVSSI |
| QNGVGSTLSSLALILGFGAMFGKLIADSGAAQRISRSLINKFGVKKIQWA |
| VVLTGFIVGIAMFYEVGFVLLIPLVFTIAEFTELPLLYIGVPMAAALSVT |
| HGFLPPHPGPVAIATIYGASISMTLVYGIVIAIPTVIVAGPVLTKFLKRF |
| DHKSSKNLFKTKVFDEDEMPSFSLSVLTAIVPPILMAFSAVCEITLPKTS |
| PIRHFAEFVGSPMMAMFISIIVAIFTLGIMRGKKMEEIMRTLAEAASSIA |
| MILLIVAGGGAFKQVLIDSGVGKYIASIMVGSNISPLILAWAIAAILRLS |
| LGSATVSAMTTAGIVLPLIPSTHANPALMVLATGAGSLIFSHVNDPGFWM |
| FKEYFGLSIGETMASWSTLETIISIMGLIGVLALNMVG. |
In an embodiment, an exemplary gntP amino acid sequence may be an amino acid sequence which has at least 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identity to the above sequence, and which is capable of transporting gluconate or glucose. In an embodiment, the corresponding gntP polynucleotide sequence may be a polynucleotide sequence encoding an amino acid sequence which has at least 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identity to the above sequence. The corresponding GPH polynucleotide sequence may also be a sequence which is 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identical to the above GPH polynucleotide sequence.
An exemplary nucleic acid sequence that encodes a GPH gene, from C. acetobutylicum, is as follows:
| (SEQ ID NO: 7) |
| ATGAAAAAGTTAAGCTTAAAGGAAAAAATCTCTTATGGACTTGGCGATTT |
| TGGAAATGGTTTCATGTTTGATTTGGGTCAATCATATCTGTTAAAATTCT |
| ATACAGACGTCGTAGGTATAGCTGCAGGAGCGGCGGGAGGAATATTCTTC |
| TTCACTAAAATATTTGATGCTTTCATGGATCCTATAGCTGGAACAATAAT |
| AGATTCAAGGAAACCAGGTAAAAACGGTAAATTCAAACCTATTATGTTCT |
| TTGCAAGTATAGTACTTGCTATATTGACAGTAATAACGTTTACTAACCCT |
| GGAAAAACTGCTACATCAAAACTATTATTTGCATATGCAACATATATGAT |
| ATGGGGACTTGGATACTCATTTACAAATGTTCCGTATGGATCTCTTGGAT |
| CAGTTATAACTCAAGATGTTCAAGAAAGAACTTCGTTGGCGACTTTTAGA |
| CAGATAGGTTCTTCAGGAGCTCTTCTTATAACAAGTGTTATATTTATGCC |
| TCTTGTTTTAGTATTTCATAACCCAGCAATAGGTTATCCAGTAGTTGCGG |
| GTATAATGGGGTTAATAGGAATATTATCATTCTACATGACATACAAAAAT |
| ACTAGAGAAGTTGTTGCGCCAGCTGAAAACGTTAAGAAGGAAAAAATAAC |
| ACCAAAGTCAATTGCGGTTACAATATTTACAAATAGAGCATTATTAACAT |
| TAATATTAATGACTATATTCTCTATTTCGGCTTACAATATTAGAAGTTCA |
| TTAATTGTTTATTACTGCCAATATAATCTTGGAAACGTTACTTTATTACC |
| ATATATAAATTTCTTCACTATAGGATGTGCTGTTTTAGGTGTTTCTTTCA |
| TGCCAAAGCTAGTTGGTAGATTTGGTAAAAAAAGAACTGCTATCATAGGA |
| TTTTTGATAAGTGTTATTGCAGATAGTATAAACTTTCTTCTTCCAGGAAA |
| TATATATACTTTCACAATATTATTAGCAATTGGATTTATAGGTATAAGCA |
| TTCCTAATGGAATAACTTGGGCTTTTGTATCAGACAGTATCGATTATGGT |
| GAGTGGAGAACAGGAACTAGAAGAGAAGGAATAACTTACTCTGTATTTAA |
| TTTCGCAAGAAAACTTGCTCAGTCAATAGCTGGATTATTATCAGGATGGG |
| GACTTGGATTTGTTGGTTATGTAGCTAACAAGAAACAAAGTGCACATGCA |
| TTATTTGGAATAAAAGCATTATTGATGGCTTATCCAGCGGTAGCGCTTTT |
| AGTAGCAGCATTAATAATTGGTTTATTGTACAACCTTTCAGATAAGAAAT |
| TTACTGAAATAATAGAAGAATTAGACGCTAGAAAAGGTAAAACAGTTTA |
| A. |
The encoded GPH amino acid sequence is as follows:
| (SEQ ID NO: 8) |
| MKKLSLKEKISYGLGDFGNGFMFDLGQSYLLKFYTDVVGIAAGAAGGIFF |
| FTKIFDAFMDPIAGTIIDSRKPGKNGKFKPIMFFASIVLAILTVITFTNP |
| GKTATSKLLFAYATYMIWGLGYSFTNVPYGSLGSVITQDVQERTSLATFR |
| QIGSSGALLITSVIFMPLVLVFHNPAIGYPVVAGIMGLIGILSFYMTYKN |
| TREVVAPAENVKKEKITPKSIAVTIFTNRALLTLILMTIFSISAYNIRSS |
| LIVYYCQYNLGNVTLLPYINFFTIGCAVLGVSFMPKLVGRFGKKRTAIIG |
| FLISVIADSINFLLPGNIYTFTILLAIGFIGISIPNGITWAFVSDSIDYG |
| EWRTGTRREGITYSVFNFARKLAQSIAGLLSGWGLGFVGYVANKKQSAHA |
| LFGIKALLMAYPAVALLVAALIIGLLYNLSDKKFTEIIEELDARKGKTV. |
In an embodiment, an exemplary GPH amino acid sequence may be an amino acid sequence which has at least 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identity to the above sequence, and which is capable of transporting glucose. In an embodiment, the corresponding GPH polynucleotide sequence may be a polynucleotide sequence encoding an amino acid sequence which has at least 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identity to the above sequence. The corresponding GPH polynucleotide sequence may also be a sequence which is 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identical to the above GPH polynucleotide sequence.
An exemplary nucleic acid sequence that encodes an FGH gene, from E. coli, is as follows:
| (SEQ ID NO: 9) |
| ATGGGAAACACATCAATACAAACGCAGAGTTACCGTGCGGTAGATAAAGA |
| TGCAGGGCAAAGCAGAAGTTACATTATTCCATTCGCGCTGCTGTGCTCAC |
| TGTTTTTTCTTTGGGCGGTAGCCAATAACCTTAACGACATTTTATTACCT |
| CAATTCCAGCAGGCTTTTACGCTGACAAATTTCCAGGCTGGCCTGATCCA |
| ATCGGCCTTTTACTTTGGTTATTTCATTATCCCAATCCCTGCTGGGATAT |
| TCATGAAAAAACTCAGTTATAAAGCAGGGATTATTACCGGGTTATTTTTA |
| TATGCCTTGGGTGCTGCATTATTCTGGCCCGCCGCAGAAATAATGAACTA |
| CACCTTGTTTTTAGTTGGCCTATTTATTATTGCAGCCGGATTAGGTTGTC |
| TGGAAACTGCCGCAAACCCTTTTGTTACGGTATTAGGGCCGGAAAGTAGT |
| GGTCACTTCCGCTTAAATCTTGCGCAAACATTTAACTCGTTTGGCGCAAT |
| TATCGCGGTTGTCTTTGGGCAAAGTCTTATTTTGTCTAACGTGCCACATC |
| AATCGCAAGACGTTCTCGATAAAATGTCTCCAGAGCAATTGAGTGCGTAT |
| AAACACAGCCTGGTATTATCGGTACAGACACCTTATATGATCATCGTGGC |
| TATCGTGTTACTGGTCGCCCTGCTGATCATGCTGACGAAATTCCCGGCAT |
| TGCAGAGTGATAATCACAGTGACGCCAAACAAGGATCGTTCTCCGCATCG |
| CTTTCTCGCCTGGCGCGTATTCGCCACTGGCGCTGGGCGGTATTAGCGCA |
| ATTCTGCTATGTCGGCGCACAAACGGCCTGCTGGAGCTATTTGATTCGCT |
| ACGCTGTAGAAGAAATTCCAGGTATGACTGCAGGCTTTGCCGCTAACTAT |
| TTAACCGGAACCATGGTGTGCTTCTTTATTGGTCGTTTCACCGGTACCTG |
| GCTCATCAGTCGCTTCGCACCACACAAAGTCCTGGCCGCCTACGCATTAA |
| TCGCTATGGCACTGTGCCTGATCTCAGCCTTCGCTGGCGGTCATGTGGGC |
| TTAATAGCCCTGACTTTATGCAGCGCCTTTATGTCGATTCAGTACCCAAC |
| AATCTTCTCGCTGGGCATTAAGAATCTCGGCCAGGACACCAAATATGGTT |
| CGTCCTTCATCGTTATGACCATTATTGGCGGCGGTATTGTCACTCCGGTC |
| ATGGGTTTTGTCAGTGACGCGGCGGGCAACATCCCCACTGCTGAACTGAT |
| CCCCGCACTCTGCTTCGCGGTCATCTTTATCTTTGCCCGTTTCCGTTCTC |
| AAACGGCAACTAACTGA. |
The encoded FGH amino acid sequence is as follows:
| (SEQ ID NO: 10) |
| MGNTSIQTQSYRAVDKDAGQSRSYIIPFALLCSLFFLWAVANNLNDI |
| LLPQFQQAFTLTNFQAGLIQSAFYFGYFIIPIPAGILMKKLSYKAGI |
| ITGLFLYALGAALFWPAAEIMNYTLFLVGLFIIAAGLGCLETAANPF |
| VTVLGPESSGHFRLNLAQTFNSFGAIIAVVFGQSLILSNVPHQSQDV |
| LDKMSPEQLSAYKHSLVLSVQTPYMIIVAIVLLVALLIMLTKFPALQ |
| SDNHSDAKQGSFSASLSRLARIRHWRWAVLAQFCYVGAQTACWSYLI |
| RYAVEEIPGMTAGFAANYLTGTMVCFFIGRFTGTWLISRFAPHKVLA |
| AYALIAMALCLISAFAGGHVGLIALTLCSAFMSIQYPTIFSLGIKNL |
| GQDTKYGSSFIVMTIIGGGIVTPVMGFVSDAAGNIPTAELIPALCFA |
| VIFIFARFRSQTATN. |
In an embodiment, an exemplary FGH amino acid sequence may be an amino acid sequence which has at least 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identity to the above sequence, and which is capable of transporting glucose. In an embodiment, the corresponding FGH polynucleotide sequence may be a polynucleotide sequence encoding an amino acid sequence which has at least 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identity to the above sequence. The corresponding FGH polynucleotide sequence may also be a sequence which is 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identical to the above FGH polynucleotide sequence.
According to an embodiment, said organism metabolizing said non-preferred sugar expresses genes of the Wood-Ljungdahl pathway.
According to an embodiment, said organism metabolizing said non-preferred sugar is genetically modified to have a primary alcohol dehydrogenase gene or a secondary alcohol dehydrogenase gene deleted from its genome.
According to an embodiment, said organism metabolizing said non-preferred sugar is genetically modified to have butanediol dehydrogenase deleted from its genome.
According to an embodiment, the rate of metabolizing said non-preferred sugar by said genetically modified organism is greater than that of metabolizing said non-preferred sugar by the native form of the organism by a factor of at least 1.5, at least 2, at least 5, at least 8, at least 10, at least 12, at least 15, or at least 20.
According to an embodiment, culturing said organism in said non-preferred sugar comprising fermentation medium, forms a fermentation broth comprising a bioproduct selected from the group consisting of even numbered primary alcohols, odd numbered secondary alcohols, organic acids of less than 7 carbons, C3 compounds, C4 compounds, and mixtures thereof.
According to an embodiment, culturing said organism in said non-preferred sugar comprising fermentation medium, forms a fermentation broth comprising a bioproduct selected from the group consisting of acetic acid, propionic acid, 3-hydroxypropionic acid, butyric acid, hexanoic acid, 3-hydroxybutyric acid, crotonic acid, acetoacetic acid, lactic acid, 2-hydroxyisobutyric acid, 3-methylbutanoic acid, ethanol, butanol, crotyl alcohol, hexanol, acetone, isopropanol, 2,3-butanediol, acetoin, 1,3-propanediol and combinations thereof.
According to an embodiment, culturing said organism in said non-preferred sugar comprising fermentation medium, foul's a fermentation broth comprising a non-naturally occurring bioproduct.
According to an embodiment, culturing said organism in said non-preferred sugar comprising fermentation medium achieves greater production of the at least one bioproduct than the combined amounts produced by heterotrophic and autotrophic fermentation with the same organism under the same conditions.
According to an embodiment, in culturing said organism in said non-preferred sugar comprising fermentation medium, the carbon yield, based on the total amount of carbon in produced bioproducts divided by the total amount of carbon metabolized in said first feedstock, is at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, at least 100%, at least 110%, at least 120%, at least 130%, at least 140%, at least 150%, or at least 160%.
According to an embodiment, providing a non-preferred sugar comprising fermentation medium includes providing said fermentation medium with a mixture of CO2 and hydrogen at a molar ratio in the range from 1:0.1 to 1:5.
In an embodiment, provided herein is a mixotrophic fermentation method comprising (i) providing an isolated naturally acetogenic organism, (ii) providing a first feedstock and a second feedstock wherein said first feedstock comprises a carbon source that is metabolized by the native form of the organism at a rate of less than 0.01 g/hr/g cell mass; and wherein said second feedstock comprises CO, CO2, carbonate, bicarbonate, H2, glycerol, methanol, formate, urea or a combination thereof; and (iii) culturing said organism in a fermentation medium, whereby both feedstocks are metabolized and a fermentation broth is formed, which broth comprises at least one bioproduct.
In an embodiment, the method may comprise production of at least one bioproduct and acetic acid as a second bioproduct, wherein the amount of acetic acid formed per biomass unit weight is less than about 50% of that formed in autotrophic fermentation with the same organism under the same conditions.
In an embodiment, the carbon yield, based on the total amount of carbon in produced bioproducts divided by the total amount of carbon metabolized from said first feedstock, is at least 50%.
In an embodiment, the 13C/12C isotope ratio of the carbon present in the bioproduct may be less than that of atmospheric CO2.
In an embodiment, said carbon source may be selected from carbohydrates, glycerol, methanol, or a combination thereof.
In embodiment, said organism may be Clostridia.
In an embodiment, said organism may be genetically modified.
In an embodiment, said first feedstock and said second feedstock may be present in the fermentation medium at the same time.
In an embodiment, said fermentation medium may comprise a carbohydrate and at least one of CO, CO2, and hydrogen.
In an embodiment, said fermentation medium may comprise a steel mill produced CO composition.
In an embodiment, the culturing may be performed in whole or in part at a super-atmospheric pressure.
In an embodiment, said bioproduct may be selected from the group consisting of even numbered primary alcohols, odd numbered secondary alcohols, organic acids of less than 7 carbons, C3 compounds, C4 compounds, and mixtures thereof.
In an embodiment, said bioproduct may be selected from the group consisting of acetic acid, acetone, propionic acid, butyric acid, hexanoic acid, 3-hydroxypropionic acid, 3-hydroxybutyric acid, crotonic acid, acetoacetic acid, lactic acid, 2-hydroxyisobutyric acid, 3-methylbutanoic acid, ethanol, butanol, crotyl alcohol, hexanol, acetone, isopropanol, 2,3-butanediol, acetoin, 1,3-propanediol, and combinations thereof.
In an embodiment, said bioproduct may be non-naturally occurring.
In an embodiment, said broth may comprise a first bioproduct and a second bioproduct, wherein said first bioproduct is selected from the group consisting of acetoacetic acid, acetone, isopropanol, 3-hydroxybutyric acid, 2-hydroxyisobutyric acid, and combinations thereof, said second bioproduct is selected from the group consisting of ethanol, butanol, crotyl alcohol, hexanol, and combinations thereof, and the molar ratio between said first bioproduct and said second bioproduct is in the range from 0.1 to 0.95.
In an embodiment, the second feedstock may comprise CO, CO2, carbonate, bicarbonate, methanol, or a combination thereof; and the 13C/12C isotope ratio of the carbon present in said second feedstock may be less than that of atmospheric CO2.
In an embodiment, the method may comprise providing said fermentation medium with a mixture of CO2 and hydrogen at a molar ratio in the range from 1:0.1 to 1:5.
In an embodiment, the method may further comprise steam reforming of a hydrocarbon to form said mixture of CO2 and hydrogen.
In an embodiment, the first feedstock may comprise a sugar selected from glucose and sucrose, and the organism may metabolize CO2 produced during glycolysis.
In an embodiment, the first feedstock may comprise a sugar selected from glucose and sucrose, the second feedstock may comprise at least one of fl, and methanol, and the organism may metabolize CO2 produced during glycolysis.
In an embodiment, said at least one bioproduct is acetone. In such an embodiment, the first feedstock may comprise a sugar selected from glucose and sucrose, and the organism may metabolize CO2 produced during glycolysis.
In an embodiment, said at least one bioproduct is butyric acid. In such an embodiment, the first feedstock may comprise a sugar selected from glucose and sucrose, and the organism may metabolize CO2 produced during glycolysis.
In an embodiment, said at least one bioproduct is isopropanol. In such an embodiment, the first feedstock may comprise a sugar selected from glucose and sucrose, and methanol, and the organism may metabolize CO2 produced during glycolysis.
In an embodiment, the metabolizing of the first feedstock does not inhibit the metabolizing of the second feedstock. In such a case, inhibition is defined as a decrease in the metabolizing rate of the second feedstock in the presence of the first feedstock compared to the metabolizing rate of the second feedstock in the absence of the first feedstock. In an embodiment, the first feedstock may inhibit the metabolizing of the second feedstock by less than 10%. In an embodiment, the first feedstock may inhibit the metabolizing of the second feedstock by less than 1%, less than 5%, less than 15%, less than 20%, or less than 30%.
In an embodiment, the first feedstock may comprise a non-preferred sugar and the second feedstock may comprise CO, CO2, carbonate, bicarbonate, H2, glycerol, methanol, formate, urea or a combination thereof.
Additional Exemplary Polynucleotide and Amino Acids Sequences
Exemplary amino acid and nucleic acid sequences for performing methods are disclosed herein.
An exemplary acetyl-CoA acetyltransferase (also known as thiolase) (THL) for use in the present invention catalyzes the condensation of two (2) acetyl-CoA molecules into acetoacetyl-CoA and the release of one (1) coenzyme-A (CoA) molecule. Exemplary THL nucleic acid and amino acid sequences (from C. acetobutylicum ATCC 824) are set forth below:
EC number: 2.3.1.9
Example Nucleic Acid Sequence:
| (SEQ ID NO: 11) |
| ATGAAAGAAGTTGTAATAGCTAGTGCAGTAAGAACAGCGATTGGATC |
| TTATGGAAAGTCTCTTAAGGATGTACCAGCAGTAGATTTAGGAGCTA |
| CAGCTATAAAGGAAGCAGTTAAAAAAGCAGGAATAAAACCAGAGGAT |
| GTTAATGAAGTCATTTTAGGAAATGTTCTTCAAGCAGGTTTAGGACA |
| GAATCCAGCAAGACAGGCATCTTTTAAAGCAGGATTACCAGTTGAAA |
| TTCCAGCTATGACTATTAATAAGGTTTGTGGTTCAGGACTTAGAACA |
| GTTAGCTTAGCAGCACAAATTATAAAAGCAGGAGATGCTGACGTAAT |
| AATAGCAGGTGGTATGGAAAATATGTCTAGAGCTCCTTACTTAGCGA |
| ATAACGCTAGATGGGGATATAGAATGGGAAACGCTAAATTTGTTGAT |
| GAAATGATCACTGACGGATTGTGGGATGCATTTAATGATTACCACAT |
| GGGAATAACAGCAGAAAACATAGCTGAGAGATGGAACATTTCAAGAG |
| AAGAACAAGATGAGTTTGCTCTTGCATCACAAAAAAAAGCTGAAGAA |
| GCTATAAAATCAGGTCAATTTAAAGATGAAATAGTTCCTGTAGTAAT |
| TAAAGGCAGAAAGGGAGAAACTGTAGTTGATACAGATGAGCACCCTA |
| GATTTGGATCAACTATAGAAGGACTTGCAAAATTAAAACCTGCCTTC |
| AAAAAAGATGGAACAGTTACAGCTGGTAATGCATCAGGATTAAATGA |
| CTGTGCAGCAGTACTTGTAATCATGAGTGCAGAAAAAGCTAAAGAGC |
| TTGGAGTAAAACCACTTGCTAAGATAGTTTCTTATGGTTCAGCAGGA |
| GTTGACCCAGCAATAATGGGATATGGACCTTTCTATGCAACAAAAGC |
| AGCTATTGAAAAAGCAGGTTGGACAGTTGATGAATTAGATTTAATAG |
| AATCAAATGAAGCTTTTGCAGCTCAAAGTTTAGCAGTAGCAAAAGAT |
| TTAAAATTTGATATGAATAAAGTAAATGTAAATGGAGGAGCTATTGC |
| CCTTGGTCATCCAATTGGAGCATCAGGTGCAAGAATACTCGTTACTC |
| TTGTACACGCAATGCAAAAAAGAGATGCAAAAAAAGGCTTAGCAACT |
| TTATGTATAGGTGGCGGACAAGGAACAGCAATATTGCTAGAAAAGTG |
| CTAG |
Example Amino Acid Sequence:
| (SEQ ID NO: 12) |
| MKEVVIASAVRTAIGSYGKSLKDVPAVDLGATAIKEAVKKAGIKPED |
| VNEVILGNVLQAGLGQNPARQASFKAGLPVEIPAMTINKVCGSGLRT |
| VSLAAQIIKAGDADVIIAGGMENMSRAPYLANNARWGYRMGNAKFVD |
| EMITDGLWDAFNDYHMGITAENIAERWNISREEQDEFALASQKKAEE |
| AIKSGQFKDEIVPVVIKGRKGETVVDTDEHPRFGSTIEGLAKLKPAF |
| KKDGTVTAGNASGLNDCAAVLVIMSAEKAKELGVKPLAKIVSYGSAG |
| VDPAIMGYGPFYATKAAIEKAGWTVDELDLIESNEAFAAQSLAVAKD |
| LKFDMNKVNVNGGAIALGHPIGASGARILVTLVHAMQKRDAKKGLAT |
| LCIGGGQGTAILLEKC |
An exemplary 3-hydroxybutyryl-CoA dehydrogenase (HBD) for use in the present invention catalyzes the conversion of acetoacetyl-CoA into 3-hydroxybutyryl-CoA. 3-Hydroxybutyryl-CoA can be either the (S) or the (R) enantiomer. This reaction typically requires a coenzyme, such as NADH or NADPH. Exemplary HBD nucleic acid and amino acid sequences (from C. acetobutylicum ATCC 824) are set forth below:
EC number: 1.1.1.36 or 1.1.1.35 or 1.1.1.157
Example Nucleic Acid Sequence:
| (SEQ ID NO: 13) |
| ATGAAAAAGGTATGTGTTATAGGTGCAGGTACTATGGGTTCAGGAAT |
| TGCTCAGGCATTTGCAGCTAAAGGATTTGAAGTAGTATTAAGAGATA |
| TTAAAGATGAATTTGTTGATAGAGGATTAGATTTTATCAATAAAAAT |
| CTTTCTAAATTAGTTAAAAAAGGAAAGATAGAAGAAGCTACTAAAGT |
| TGAAATCTTAACTAGAATTTCCGGAACAGTTGACCTTAATATGGCAG |
| CTGATTGCGATTTAGTTATAGAAGCAGCTGTTGAAAGAATGGATATT |
| AAAAAGCAGATTTTTGCTGACTTAGACAATATATGCAAGCCAGAAAC |
| AATTCTTGCATCAAATACATCATCACTTTCAATAACAGAAGTGGCAT |
| CAGCAACTAAAAGACCTGATAAGGTTATAGGTATGCATTTCTTTAAT |
| CCAGCTCCTGTTATGAAGCTTGTAGAGGTAATAAGAGGAATAGCTAC |
| ATCACAAGAAACTTTTGATGCAGTTAAAGAGACATCTATAGCAATAG |
| GAAAAGATCCTGTAGAAGTAGCAGAAGCACCAGGATTTGTTGTAAAT |
| AGAATATTAATACCAATGATTAATGAAGCAGTTGGTATATTAGCAGA |
| AGGAATAGCTTCAGTAGAAGACATAGATAAAGCTATGAAACTTGGAG |
| CTAATCACCCAATGGGACCATTAGAATTAGGTGATTTTATAGGTCTT |
| GATATATGTCTTGCTATAATGGATGTTTTATACTCAGAAACTGGAGA |
| TTCTAAGTATAGACCACATACATTACTTAAGAAGTATGTAAGAGCAG |
| GATGGCTTGGAAGAAAATCAGGAAAAGGTTTCTACGATTATTCAAAA |
| TAA |
Example Amino Acid Sequence:
| (SEQ ID NO: 14) |
| MKKVCVIGAGTMGSGIAQAFAAKGFEVVLRDIKDEFVDRGLDFINKN |
| LSKLVKKGKIEEATKVEILTRISGTVDLNMAADCDLVIEAAVERMDI |
| KKQIFADLDNICKPETILASNTSSLSITEVASATKRPDKVIGMHFFN |
| PAPVMKLVEVIRGIATSQETFDAVKETSIAIGKDPVEVAEAPGFVVN |
| RILIPMINEAVGILAEGIASVEDIDKAMKLGANHPMGPLELGDFIGL |
| DICLAIMDVLYSETGDSKYRPHTLLKKYVRAGWLGRKSGKGFYDYSK |
An exemplary 3-hydroxybutyryl-CoA dehydratase (also known as crotonase) (CRT) for use in the present invention catalyzes the dehydration of 3-hydroxybutyryl-CoA into crotonyl-CoA and a water molecule. It can act upon either the (S) or the (R) enantiomer of 3-hydroxybutyryl-CoA. Exemplary CRT nucleic acid and amino acid sequences (from C. acetobutylicum ATCC 824) are set forth below:
EC number: 4.2.1.17 or 4.2.1.55
Example Nucleic Acid Sequence:
| (SEQ ID NO: 15) |
| ATGGAACTAAACAATGTCATCCTTGAAAAGGAAGGTAAAGTTGCTGT |
| AGTTACCATTAACAGACCTAAAGCATTAAATGCGTTAAATAGTGATA |
| CACTAAAAGAAATGGATTATGTTATAGGTGAAATTGAAAATGATAGC |
| GAAGTACTTGCAGTAATTTTAACTGGAGCAGGAGAAAAATCATTTGT |
| AGCAGGAGCAGATATTTCTGAGATGAAGGAAATGAATACCATTGAAG |
| GTAGAAAATTCGGGATACTTGGAAATAAAGTGTTTAGAAGATTAGAA |
| CTTCTTGAAAAGCCTGTAATAGCAGCTGTTAATGGTTTTGCTTTAGG |
| AGGCGGATGCGAAATAGCTATGTCTTGTGATATAAGAATAGCTTCAA |
| GCAACGCAAGATTTGGTCAACCAGAAGTAGGTCTCGGAATAACACCT |
| GGTTTTGGTGGTACACAAAGACTTTCAAGATTAGTTGGAATGGGCAT |
| GGCAAAGCAGCTTATATTTACTGCACAAAATATAAAGGCAGATGAAG |
| CATTAAGAATCGGACTTGTAAATAAGGTAGTAGAACCTAGTGAATTA |
| ATGAATACAGCAAAAGAAATTGCAAACAAAATTGTGAGCAATGCTCC |
| AGTAGCTGTTAAGTTAAGCAAACAGGCTATTAATAGAGGAATGCAGT |
| GTGATATTGATACTGCTTTAGCATTTGAATCAGAAGCATTTGGAGAA |
| TGCTTTTCAACAGAGGATCAAAAGGATGCAATGACAGCTTTCATAGA |
| GAAAAGAAAAATTGAAGGCTTCAAAAATAGATAG |
Example Amino Acid Sequence:
| (SEQ ID NO: 16) |
| MELNNVILEKEGKVAVVTINRPKALNALNSDTLKEMDYVIGEIENDS |
| EVLAVILTGAGEKSFVAGADISEMKEMNTIEGRKFGILGNKVFRRLE |
| LLEKPVIAAVNGFALGGGCEIAMSCDIRIASSNARFGQPEVGLGITP |
| GFGGTQRLSRLVGMGMAKQLIFTAQNIKADEALRIGLVNKVVEPSEL |
| MNTAKEIANKIVSNAPVAVKLSKQAINRGMQCDIDTALAFESEAFGE |
| CFSTEDQKDAMTAFIEKRKIEGFKNR |
An exemplary acetaldehyde/alcohol dehydrogenase (ADHE) for use in the present invention is a bifunctional enzyme that catalyzes two reactions sequentially. The first reaction is a CoA-acylating reaction in which crotonyl-CoA is converted into crotonaldehyde. The second reaction is a dehydrogenase reaction in which crotonaldehyde is converted into crotyl alcohol. Any similar substrates can also be used, such as acetyl-CoA, butyryl-CoA, and others. This reaction typically requires a coenzyme, such as NADH or NADPH. Exemplary ADHE nucleic acid and amino acid sequences (from C. acetobutylicum ATCC 824) are set forth below:
EC number: For the first reaction (1.2.1.10 or 1.2.1.57); for the second reaction (1.1.1.1)
Example Nucleic Acid Sequence:
| (SEQ ID NO: 17) |
| ATGAAAGTCACAACAGTAAAGGAATTAGATGAAAAACTCAAGGTAAT |
| TAAAGAAGCTCAAAAAAAATTCTCTTGTTACTCGCAAGAAATGGTTG |
| ATGAAATCTTTAGAAATGCAGCAATGGCAGCAATCGACGCAAGGATA |
| GAGCTAGCAAAAGCAGCTGTTTTGGAAACCGGTATGGGCTTAGTTGA |
| AGACAAGGTTATAAAAAATCATTTTGCAGGCGAATACATCTATAACA |
| AATATAAGGATGAAAAAACCTGCGGTATAATTGAACGAAATGAACCC |
| TACGGAATTACAAAAATAGCAGAACCTATAGGAGTTGTAGCTGCTAT |
| AATCCCTGTAACAAACCCCACATCAACAACAATATTTAAATCCTTAA |
| TATCCCTTAAAACTAGAAATGGAATTTTCTTTTCGCCTCACCCAAGG |
| GCAAAAAAATCCACAATACTAGCAGCTAAAACAATACTTGATGCAGC |
| CGTTAAGAGTGGTGCCCCGGAAAATATAATAGGTTGGATAGATGAAC |
| CTTCAATTGAACTAACTCAATATTTAATGCAAAAAGCAGATATAACC |
| CTTGCAACTGGTGGTCCCTCACTAGTTAAATCTGCTTATTCTTCCGG |
| AAAACCAGCAATAGGTGTTGGTCCGGGTAACACCCCAGTAATAATTG |
| ATGAATCTGCTCATATAAAAATGGCAGTAAGTTCAATTATATTATCC |
| AAAACCTATGATAATGGTGTTATATGTGCTTCTGAACAATCTGTAAT |
| AGTCTTAAAATCCATATATAACAAGGTAAAAGATGAGTTCCAAGAAA |
| GAGGAGCTTATATAATAAAGAAAAACGAATTGGATAAAGTCCGTGAA |
| GTGATTTTTAAAGATGGATCCGTAAACCCTAAAATAGTCGGACAGTC |
| AGCTTATACTATAGCAGCTATGGCTGGCATAAAAGTACCTAAAACCA |
| CAAGAATATTAATAGGAGAAGTTACCTCCTTAGGTGAAGAAGAACCT |
| TTTGCCCACGAAAAACTATCTCCTGTTTTGGCTATGTATGAGGCTGA |
| CAATTTTGATGATGCTTTAAAAAAAGCAGTAACTCTAATAAACTTAG |
| GAGGCCTCGGCCATACCTCAGGAATATATGCAGATGAAATAAAAGCA |
| CGAGATAAAATAGATAGATTTAGTAGTGCCATGAAAACCGTAAGAAC |
| CTTTGTAAATATCCCAACCTCACAAGGTGCAAGTGGAGATCTATATA |
| ATTTTAGAATACCACCTTCTTTCACGCTTGGCTGCGGATTTTGGGGA |
| GGAAATTCTGTTTCCGAGAATGTTGGTCCAAAACATCTTTTGAATAT |
| TAAAACCGTAGCTGAAAGGAGAGAAAACATGCTTTGGTTTAGAGTTC |
| CACATAAAGTATATTTTAAGTTCGGTTGTCTTCAATTTGCTTTAAAA |
| GATTTAAAAGATCTAAAGAAAAAAAGAGCCTTTATAGTTACTGATAG |
| TGACCCCTATAATTTAAACTATGTTGATTCAATAATAAAAATACTTG |
| AGCACCTAGATATTGATTTTAAAGTATTTAATAAGGTTGGAAGAGAA |
| GCTGATCTTAAAACCATAAAAAAAGCAACTGAAGAAATGTCCTCCTT |
| TATGCCAGACACTATAATAGCTTTAGGTGGTACCCCTGAAATGAGCT |
| CTGCAAAGCTAATGTGGGTACTATATGAACATCCAGAAGTAAAATTT |
| GAAGATCTTGCAATAAAATTTATGGACATAAGAAAGAGAATATATAC |
| TTTCCCAAAACTCGGTAAAAAGGCTATGTTAGTTGCAATTACAACTT |
| CTGCTGGTTCCGGTTCTGAGGTTACTCCTTTTGCTTTAGTAACTGAC |
| AATAACACTGGAAATAAGTACATGTTAGCAGATTATGAAATGACACC |
| AAATATGGCAATTGTAGATGCAGAACTTATGATGAAAATGCCAAAGG |
| GATTAACCGCTTATTCAGGTATAGATGCACTAGTAAATAGTATAGAA |
| GCATACACATCCGTATATGCTTCAGAATACACAAACGGACTAGCACT |
| AGAGGCAATACGATTAATATTTAAATATTTGCCTGAGGCTTACAAAA |
| ACGGAAGAACCAATGAAAAAGCAAGAGAGAAAATGGCTCACGCTTCA |
| ACTATGGCAGGTATGGCATCCGCTAATGCATTTCTAGGTCTATGTCA |
| TTCCATGGCAATAAAATTAAGTTCAGAACACAATATTCCTAGTGGCA |
| TTGCCAATGCATTACTAATAGAAGAAGTAATAAAATTTAACGCAGTT |
| GATAATCCTGTAAAACAAGCCCCTTGCCCACAATATAAGTATCCAAA |
| CACCATATTTAGATATGCTCGAATTGCAGATTATATAAAGCTTGGAG |
| GAAATACTGATGAGGAAAAGGTAGATCTCTTAATTAACAAAATACAT |
| GAACTAAAAAAAGCTTTAAATATACCAACTTCAATAAAGGATGCAGG |
| TGTTTTGGAGGAAAACTTCTATTCCTCCCTTGATAGAATATCTGAAC |
| TTGCACTAGATGATCAATGCACAGGCGCTAATCCTAGATTTCCTCTT |
| ACAAGTGAGATAAAAGAAATGTATATAAATTGTTTTAAAAAACAACC |
| TTAA |
Example Amino Acid Sequence:
| (SEQ ID NO: 18) |
| MKVTTVKELDEKLKVIKEAQKKFSCYSQEMVDEIFRNAAMAAIDARI |
| ELAKAAVLETGMGLVEDKVIKNHFAGEYIYNKYKDEKTCGIIERNEP |
| YGITKIAEPIGVVAAIIPVTNPTSTTIFKSLISLKTRNGIFFSPHPR |
| AKKSTILAAKTILDAAVKSGAPENIIGWIDEPSIELTQYLMQKADIT |
| LATGGPSLVKSAYSSGKPAIGVGPGNTPVIIDESAHIKMAVSSIILS |
| KTYDNGVICASEQSVIVLKSIYNKVKDEFQERGAYIIKKNELDKVRE |
| VIFKDGSVNPKIVGQSAYTIAAMAGIKVPKTTRILIGEVTSLGEEEP |
| FAHEKLSPVLAMYEADNFDDALKKAVTLINLGGLGHTSGIYADEIKA |
| RDKIDRFSSAMKTVRTFVNIPTSQGASGDLYNFRIPPSFTLGCGFWG |
| GNSVSENVGPKHLLNIKTVAERRENMLWFRVPHKVYFKFGCLQFALK |
| DLKDLKKKRAFIVTDSDPYNLNYVDSIIKILEHLDIDFKVFNKVGRE |
| ADLKTIKKATEEMSSFMPDTIIALGGTPEMSSAKLMWVLYEHPEVKF |
| EDLAIKFMDIRKRIYTFPKLGKKAMLVAITTSAGSGSEVTPFALVTD |
| NNTGNKYMLADYEMTPNMAIVDAELMMKMPKGLTAYSGIDALVNSIE |
| AYTSVYASEYTNGLALEAIRLIFKYLPEAYKNGRTNEKAREKMAHAS |
| TMAGMASANAFLGLCHSMAIKLSSEHNIPSGIANALLIEEVIKFNAV |
| DNPVKQAPCPQYKYPNTIFRYARIADYIKLGGNTDEEKVDLLINKIH |
| ELKKALNIPTSIKDAGVLEENFYSSLDRISELALDDQCTGANPRFPL |
| TSEIKEMYINCFKKQP |
An exemplary butanol dehydrogenase (BDH) for use in the present invention catalyzes the dehydrogenation of an aldehyde into an alcohol, particularly crotonaldehyde into crotyl alcohol, though any aldehyde can be a substrate. This reaction typically requires a coenzyme, such as NADH or NADPH. Exemplary butanol dehydrogenase nucleic acid and amino acid sequences (from C. acetobutylicum ATCC 824) are set forth below:
EC number: 1.1.1.1
Example Nucleic Acid Sequence:
| (SEQ ID NO: 19) |
| GTGGTTGATTTCGAATATTCAATACCAACTAGAATTTTTTTCGGTAA |
| AGATAAGATAAATGTACTTGGAAGAGAGCTTAAAAAATATGGTTCTA |
| AAGTGCTTATAGTTTATGGTGGAGGAAGTATAAAGAGAAATGGAATA |
| TATGATAAAGCTGTAAGTATACTTGAAAAAAACAGTATTAAATTTTA |
| TGAACTTGCAGGAGTAGAGCCAAATCCAAGAGTAACTACAGTTGAAA |
| AAGGAGTTAAAATATGTAGAGAAAATGGAGTTGAAGTAGTACTAGCT |
| ATAGGTGGAGGAAGTGCAATAGATTGCGCAAAGGTTATAGCAGCAGC |
| ATGTGAATATGATGGAAATCCATGGGATATTGTGTTAGATGGCTCAA |
| AAATAAAAAGGGTGCTTCCTATAGCTAGTATATTAACCATTGCTGCA |
| ACAGGATCAGAAATGGATACGTGGGCAGTAATAAATAATATGGATAC |
| AAACGAAAAACTAATTGCGGCACATCCAGATATGGCTCCTAAGTTTT |
| CTATATTAGATCCAACGTATACGTATACCGTACCTACCAATCAAACA |
| GCAGCAGGAACAGCTGATATTATGAGTCATATATTTGAGGTGTATTT |
| TAGTAATACAAAAACAGCATATTTGCAGGATAGAATGGCAGAAGCGT |
| TATTAAGAACTTGTATTAAATATGGAGGAATAGCTCTTGAGAAGCCG |
| GATGATTATGAGGCAAGAGCCAATCTAATGTGGGCTTCAAGTCTTGC |
| GATAAATGGACTTTTAACATATGGTAAAGACACTAATTGGAGTGTAC |
| ACTTAATGGAACATGAATTAAGTGCTTATTACGACATAACACACGGC |
| GTAGGGCTTGCAATTTTAACACCTAATTGGATGGAGTATATTTTAAA |
| TAATGATACAGTGTACAAGTTTGTTGAATATGGTGTAAATGTTTGGG |
| GAATAGACAAAGAAAAAAATCACTATGACATAGCACATCAAGCAATA |
| CAAAAAACAAGAGATTACTTTGTAAATGTACTAGGTTTACCATCTAG |
| ACTGAGAGATGTTGGAATTGAAGAAGAAAAATTGGACATAATGGCAA |
| AGGAATCAGTAAAGCTTACAGGAGGAACCATAGGAAACCTAAGACCA |
| GTAAACGCCTCCGAAGTCCTACAAATATTCAAAAAATCTGTGTAA |
Example Amino Acid Sequence:
| (SEQ ID NO: 20) |
| MVDFEYSIPTRIFFGKDKINVLGRELKKYGSKVLIVYGGGSIKRNGI |
| YDKAVSILEKNSIKFYELAGVEPNPRVTTVEKGVKICRENGVEVVLA |
| IGGGSAIDCAKVIAAACEYDGNPWDIVLDGSKIKRVLPIASILTIAA |
| TGSEMDTWAVINNMDTNEKLIAAHPDMAPKFSILDPTYTYTVPTNQT |
| AAGTADIMSHIFEVYFSNTKTAYLQDRMAEALLRTCIKYGGIALEKP |
| DDYEARANLMWASSLAINGLLTYGKDTNWSVHLMEHELSAYYDITHG |
| VGLAILTPNWMEYILNNDTVYKFVEYGVNVWGIDKEKNHYDIAHQAI |
| QKTRDYFVNVLGLPSRLRDVGIEEEKLDIMAKESVKLTGGTIGNLRP |
| VNASEVLQIFKKSV |
An exemplary CoA-transferase subunit A (COAT-A) for use in the present invention catalyzes the transfer of coenzyme-A (CoA) between two molecules. For example, from acetoacetyl-CoA to acetate to form acetoacetate and acetyl-CoA or from acetoacetyl-CoA to butyrate to form acetoacetate and butyryl-CoA. Exemplary COAT-A, i.e., subunit A nucleic acid and amino acid sequences (from C. acetobutylicum ATCC 824) are set forth below:
EC number: 2.8.3.8 or 2.8.3.9 or other related enzymes
Example Nucleic Acid Sequence:
| (SEQ ID NO: 21) |
| ATGAACTCTAAAATAATTAGATTTGAAAATTTAAGGTCATTCTTTAA |
| AGATGGGATGACAATTATGATTGGAGGTTTTTTAAACTGTGGCACTC |
| CAACCAAATTAATTGATTTTTTAGTTAATTTAAATATAAAGAATTTA |
| ACGATTATAAGTAATGATACATGTTATCCTAATACAGGTATTGGTAA |
| GTTAATATCAAATAATCAAGTAAAAAAGCTTATTGCTTCATATATAG |
| GCAGCAACCCAGATACTGGCAAAAAACTTTTTAATAATGAACTTGAA |
| GTAGAGCTCTCTCCCCAAGGAACTCTAGTGGAAAGAATACGTGCAGG |
| CGGATCTGGCTTAGGTGGTGTACTAACTAAAACAGGTTTAGGAACTT |
| TGATTGAAAAAGGAAAGAAAAAAATATCTATAAATGGAACGGAATAT |
| TTGTTAGAGCTACCTCTTACAGCCGATGTAGCATTAATTAAAGGTAG |
| TATTGTAGATGAGGCCGGAAACACCTTCTATAAAGGTACTACTAAAA |
| ACTTTAATCCCTATATGGCAATGGCAGCTAAAACCGTAATAGTTGAA |
| GCTGAAAATTTAGTTAGCTGTGAAAAACTAGAAAAGGAAAAAGCAAT |
| GACCCCCGGAGTTCTTATAAATTATATAGTAAAGGAGCCTGCATAA |
Example Amino Acid Sequence:
| (SEQ ID NO: 22) |
| MNSKIIRFENLRSFEKDGMTIMIGGFLNCGTPTKLIDFLVNLNIKNL |
| TIISNDTCYPNTGIGKLISNNQVKKLIASYIGSNPDTGKKLFNNELE |
| VELSPQGTLVERIRAGGSGLGGVLTKTGLGTLIEKGKKKISINGTEY |
| LLELPLTADVALIKGSIVDEAGNTFYKGTTKNFNPYMAMAAKTVIVE |
| AENLVSCEKLEKEKAMTPGVLINYIVKEPA |
An exemplary CoA-transferase subunit B (COAT-B) for use in the present invention catalyzes the transfer of coenzyme-A (CoA) between two molecules. For example, from acetoacetyl-CoA to acetate to form acetoacetate and acetyl-CoA or from acetoacetyl-CoA to butyrate to form acetoacetate and butyryl-CoA. Exemplary COAT-B, i.e., subunit B nucleic acid and amino acid sequences (from C. acetobutylicum ATCC 824) are set forth below:
EC number: 2.8.3.8 or 2.8.3.9 or other related enzymes
Example Nucleic Acid Sequence:
| (SEQ ID NO: 23) |
| ATGATTAATGATAAAAACCTAGCGAAAGAAATAATAGCCAAAAGAGT |
| TGCAAGAGAATTAAAAAATGGTCAACTTGTAAACTTAGGTGTAGGTC |
| TTCCTACCATGGTTGCAGATTATATACCAAAAAATTTCAAAATTACT |
| TTCCAATCAGAAAACGGAATAGTTGGAATGGGCGCTAGTCCTAAAAT |
| AAATGAGGCAGATAAAGATGTAGTAAATGCAGGAGGAGACTATACAA |
| CAGTACTTCCTGACGGCACATTTTTCGATAGCTCAGTTTCGTTTTCA |
| CTAATCCGTGGTGGTCACGTAGATGTTACTGTTTTAGGGGCTCTCCA |
| GGTAGATGAAAAGGGTAATATAGCCAATTGGATTGTTCCTGGAAAAA |
| TGCTCTCTGGTATGGGTGGAGCTATGGATTTAGTAAATGGAGCTAAG |
| AAAGTAATAATTGCAATGAGACATACAAATAAAGGTCAACCTAAAAT |
| TTTAAAAAAATGTACACTTCCCCTCACGGCAAAGTCTCAAGCAAATC |
| TAATTGTAACAGAACTTGGAGTAATTGAGGTTATTAATGATGGTTTA |
| CTTCTCACTGAAATTAATAAAAACACAACCATTGATGAAATAAGGTC |
| TTTAACTGCTGCAGATTTACTCATATCCAATGAACTTAGACCCATGG |
| CTGTTTAG |
Example Amino Acid Sequence:
| (SEQ ID NO: 24) |
| MINDKNLAKEIIAKRVARELKNGQLVNLGVGLPTMVADYIPKNFKIT |
| FQSENGIVGMGASPKINEADKDVVNAGGDYTTVLPDGTFFDSSVSFS |
| LIRGGHVDVTVLGALQVDEKGNIANWIVPGKMLSGMGGAMDLVNGAK |
| KVIIAMRHTNKGQPKILKKCTLPLTAKSQANLIVTELGVIEVINDGL |
| LLTEINKNTTIDEIRSLTAADLLISNELRPMAV |
An exemplary aldehyde:ferredoxin oxidoreductase (AOR) for use in the present invention catalyzes the reduction of a carboxylic acid into its corresponding aldehyde. For example, crotonic acid into crotonaldehyde. This reaction typically requires a coenzyme, such as ferredoxin. Exemplary AOR nucleic acid and amino acid sequences (from C. ljungdahlii DSM 13528) are set forth below:
EC number: 1.2.7.5
Example Nucleic Acid Sequence:
| (SEQ ID NO: 25) |
| ATGTACGGATATAAGGGTAAGGTATTAAGAATTAATCTAAGTAGTAAAAC |
| TTATATAGTGGAAGAATTGAAAATTGACAAAGCTAAAAAATTTATAGGTG |
| CAAGAGGGTTAGGCGTAAAAACCTTATTTGACGAAGTAGATCCAAAGGTA |
| GATCCATTATCACCTGATAACAAATTTATTATAGCAGCGGGACCACTTAC |
| AGGTGCACCTGTTCCAACAAGCGGAAGATTCATGGTAGTTACTAAATCAC |
| CTTTAACAGGAACTATTGCTATTGCAAATTCAGGTGGAAAATGGGGAGCA |
| GAATTCAAAGCAGCTGGATACGATATGATAATCGTTGAAGGTAAATCTGA |
| TAAAGAAGTTTATGTAAATATAGTAGATGATAAAGTAGAATTTAGGGATG |
| CTTCTCATGTTTGGGGAAAACTAACAGAAGAAACTACAAAAATGCTTCAA |
| CAGGAAACAGATTCGAGAGCTAAGGTTTTATGCATAGGACCAGCTGGGGA |
| AAAGTTATCACTTATGGCAGCAGTTATGAATGATGTTGATAGAACAGCAG |
| GACGTGGTGGTGTTGGAGCTGTTATGGGTTCAAAGAACTTAAAAGCTATT |
| GTAGTTAAAGGAAGCGGAAAAGTAAAATTATTTGATGAACAAAAAGTGAA |
| GGAAGTAGCACTTGAGAAAACAAATATTTTAAGAAAAGATCCAGTAGCTG |
| GTGGAGGACTTCCAACATACGGAACAGCTGTACTTGTTAATATTATAAAT |
| GAAAATGGTGTACATCCAGTAAAGAATTTTCAAAAATCTTATACAGATCA |
| AGCAGATAAGATCAGTGGAGAAACTTTAACTAAAGATTGCTTAGTTAGAA |
| AAAATCCTTGCTATAGGTGTCCAATTGCCTGTGGAAGATGGGTAAAACTT |
| GATGATGGAACTGAATGTGGAGGACCAGAATATGAAACATTATGGTCATT |
| TGGATCTGATTGTGATGTATACGATATAAATGCTGTAAATACAGCAAATA |
| TGTTGTGTAATGAATATGGATTAGATACCATTACAGCAGGATGTACTATT |
| GCAGCAGCTATGGAACTTTATCAAAGAGGTTATATTAAGGATGAAGAAAT |
| AGCAGCAGATGGATTGTCACTTAATTGGGGAGATGCTAAGTCCATGGTTG |
| AATGGGTAAAGAAAATGGGACTTAGAGAAGGATTTGGAGACAAGATGGCA |
| GATGGTTCATACAGACTTTGTGACTCATACGGTGTACCTGAGTATTCAAT |
| GACTGTAAAAAAACAGGAACTTCCAGCATATGACCCAAGAGGAATACAGG |
| GACATGGTATTACTTATGCTGTTAACAATAGGGGAGGATGTCACATTAAG |
| GGATATATGGTAAGTCCTGAAATACTTGGCTATCCAGAAAAACTTGATAG |
| ACTTGCAGTGGAAGGAAAAGCAGGATATGCTAGAGTATTCCATGATTTAA |
| CAGCTGTTATAGATTCACTTGGATTATGTATTTTTACAACATTTGGTCTT |
| GGTGCACAGGATTATGTTGATATGTATAATGCAGTAGTTGGTGGAGAATT |
| ACATGATGTAAATTCTTTAATGTTAGCTGGAGATAGAATATGGACTTTAG |
| AAAAAATATTTAACTTAAAGGCAGGCATAGATAGTTCACAGGATACTCTT |
| CCAAAGAGATTGCTTGAAGAACAAATTCCAGAAGGACCATCAAAAGGAGA |
| AGTTCATAAGTTAGATGTACTACTACCTGAATATTATTCAGTACGTGGAT |
| GGGATAAAAATGGTATTCCTACAGAGGAAACGTTAAAGAAATTAGGATTA |
| GATGAATACGTAGGTAAGCTTTAG |
Example Amino Acid Sequence:
| (SEQ ID NO: 26) |
| MYGYKGKVLRINLSSKTYIVEELKIDKAKKFIGARGLGVKTLFDEVDPKV |
| DPLSPDNKFIIAAGPLTGAPVPTSGRFMVVTKSPLTGTIAIANSGGKWGA |
| EFKAAGYDMIIVEGKSDKEVYVNIVDDKVEFRDASHVWGKLTEETTKMLQ |
| QETDSRAKVLCIGPAGEKLSLMAAVMNDVDRTAGRGGVGAVMGSKNLKAI |
| VVKGSGKVKLFDEQKVKEVALEKTNILRKDPVAGGGLPTYGTAVLVNIIN |
| ENGVHPVKNFQKSYTDQADKISGETLTKDCLVRKNPCYRCPIACGRWVKL |
| DDGTECGGPEYETLWSFGSDCDVYDINAVNTANMLCNEYGLDTITAGCTI |
| AAAMELYQRGYIKDEEIAADGLSLNWGDAKSMVEWVKKMGLREGFGDKMA |
| DGSYRLCDSYGVPEYSMTVKKQELPAYDPRGIQGHGITYAVNNRGGCHIK |
| GYMVSPEILGYPEKLDRLAVEGKAGYARVFHDLTAVIDSLGLCIFTTFGL |
| GAQDYVDMYNAVVGGELHDVNSLMLAGDRIWTLEKIFNLKAGIDSSQDTL |
| PKRLLEEQIPEGPSKGEVHKLDVLLPEYYSVRGWDKNGIPTEETLKKLGL |
| DEYVGKL |
An exemplary acetoacetate decarboxylase (ADC) for use in the present invention catalyzes the decarboxylation of acetoacetate into acetone and CO2. Exemplary ADC nucleic acid and amino acid sequences (from C. acetobutylicum ATCC 824) are set forth below:
EC number: 4.1.1.4
Example Nucleic Acid Sequence:
| (SEQ ID NO: 27) |
| ATGTTAAAGGATGAAGTAATTAAACAAATTAGCACGCCATTAACTTCGCC |
| TGCATTTCCTAGAGGACCCTATAAATTTCATAATCGTGAGTATTTTAACA |
| TTGTATATCGTACAGATATGGATGCACTTCGTAAAGTTGTGCCAGAGCCT |
| TTAGAAATTGATGAGCCCTTAGTCAGGTTTGAAATTATGGCAATGCATGA |
| TACGAGTGGACTTGGTTGTTATACAGAAAGCGGACAGGCTATTCCCGTAA |
| GCTTTAATGGAGTTAAGGGAGATTATCTTCATATGATGTATTTAGATAAT |
| GAGCCTGCAATTGCAGTAGGAAGGGAATTAAGTGCATATCCTAAAAAGCT |
| CGGGTATCCAAAGCTTTTTGTGGATTCAGATACTTTAGTAGGAACTTTAG |
| ACTATGGAAAACTTAGAGTTGCGACAGCTACAATGGGGTACAAACATAAA |
| GCCTTAGATGCTAATGAAGCAAAGGATCAAATTTGTCGCCCTAATTATAT |
| GTTGAAAATAATACCCAATTATGATGGAAGCCCTAGAATATGTGAGCTTA |
| TAAATGCGAAAATCACAGATGTTACCGTACATGAAGCTTGGACAGGACCA |
| ACTCGACTGCAGTTATTTGATCACGCTATGGCGCCACTTAATGATTTGCC |
| AGTAAAAGAGATTGTTTCTAGCTCTCACATTCTTGCAGATATAATATTGC |
| CTAGAGCTGAAGTTATATATGATTATCTTAAGTAA |
Example Amino Acid Sequence:
| (SEQ ID NO: 28) |
| MLKDEVIKQISTPLTSPAFPRGPYKEENREYFNIVYRTDMDALRKVVPEP |
| LEIDEPLVRFEIMAMHDTSGLGCYTESGQAIPVSENGVKGDYLHMMYLDN |
| EPAIAVGRELSAYPKKLGYPKLEVDSDTLVGTLDYGKLRVATATMGYKHK |
| ALDANEAKDQICRPNYMLKIIPNYDGSPRICELINAKITDVTVHEAWTGP |
| TRLQLFDHAMAPLNDLPVKEIVSSSHILADIILPRAEVIYDYLK |
An exemplary secondary alcohol dehydrogenase (SADH) for use in the present invention catalyzes the reduction of a ketone into a secondary alcohol. For example, acetone into 2-propanol (a.k.a. isopropanol). The exemplary SADH may have EC number 1.1.1.1. Exemplary SADH nucleic acid and amino acid sequences (from C. ljungdahlii DSM 13528) are set forth in SEQ ID NO: 1 and SEQ ID NO: 2, respectively.
An exemplary butyryl-CoA dehydrogenase (BCD) for use in the present invention catalyzes the reduction of crotonyl-CoA into butyryl-CoA by reducing the carbon-carbon double bond in crotonyl-CoA. This enzyme requires an electron-transfer flavoprotein. Exemplary BCD nucleic acid and amino acid sequences (from C. acetobutylicum ATCC 824) are set forth below:
EC number: 1.3.8.1
Example Nucleic Acid Sequence:
| (SEQ ID NO: 29) |
| ATGGATTTTAATTTAACAAGAGAACAAGAATTAGTAAGACAGATGGTTAG |
| AGAATTTGCTGAAAATGAAGTTAAACCTATAGCAGCAGAAATTGATGAAA |
| CAGAAAGATTTCCAATGGAAAATGTAAAGAAAATGGGTCAGTATGGTATG |
| ATGGGAATTCCATTTTCAAAAGAGTATGGTGGCGCAGGTGGAGATGTATT |
| ATCTTATATAATCGCCGTTGAGGAATTATCAAAGGTTTGCGGTACTACAG |
| GAGTTATTCTTTCAGCACATACATCACTTTGTGCTTCATTAATAAATGAA |
| CATGGTACAGAAGAACAAAAACAAAAATATTTAGTACCTTTAGCTAAAGG |
| TGAAAAAATAGGTGCTTATGGATTGACTGAGCCAAATGCAGGAACAGATT |
| CTGGAGCACAACAAACAGTAGCTGTACTTGAAGGAGATCATTATGTAATT |
| AATGGTTCAAAAATATTCATAACTAATGGAGGAGTTGCAGATACTTTTGT |
| TATATTTGCAATGACTGACAGAACTAAAGGAACAAAAGGTATATCAGCAT |
| TTATAATAGAAAAAGGCTTCAAAGGTTTCTCTATTGGTAAAGTTGAACAA |
| AAGCTTGGAATAAGAGCTTCATCAACAACTGAACTTGTATTTGAAGATAT |
| GATAGTACCAGTAGAAAACATGATTGGTAAAGAAGGAAAAGGCTTCCCTA |
| TAGCAATGAAAACTCTTGATGGAGGAAGAATTGGTATAGCAGCTCAAGCT |
| TTAGGTATAGCTGAAGGTGCTTTCAACGAAGCAAGAGCTTACATGAAGGA |
| GAGAAAACAATTTGGAAGAAGCCTTGACAAATTCCAAGGTCTTGCATGGA |
| TGATGGCAGATATGGATGTAGCTATAGAATCAGCTAGATATTTAGTATAT |
| AAAGCAGCATATCTTAAACAAGCAGGACTTCCATACACAGTTGATGCTGC |
| AAGAGCTAAGCTTCATGCTGCAAATGTAGCAATGGATGTAACAACTAAGG |
| CAGTACAATTATTTGGTGGATACGGATATACAAAAGATTATCCAGTTGAA |
| AGAATGATGAGAGATGCTAAGATAACTGAAATATATGAAGGAACTTCAGA |
| AGTTCAGAAATTAGTTATTTCAGGAAAAATTTTTAGATAA |
Example Amino Acid Sequence:
| (SEQ ID NO: 30) |
| MDFNLTREQELVRQMVREFAENEVKPIAAEIDETERFPMENVKKMGQYGM |
| MGIPFSKEYGGAGGDVLSYIIAVEELSKVCGTTGVILSAHTSLCASLINE |
| HGTEEQKQKYLVPLAKGEKIGAYGLTEPNAGTDSGAQQTVAVLEGDHYVI |
| NGSKIFITNGGVADTFVIFAMTDRTKGTKGISAFIIEKGFKGFSIGKVEQ |
| KLGIRASSTTELVFEDMIVPVENMIGKEGKGFPIAMKTLDGGRIGIAAQA |
| LGIAEGAFNEARAYMKERKQFGRSLDKFQGLAWMMADMDVAIESARYLVY |
| KAAYLKQAGLPYTVDAARAKLHAANVAMDVTTKAVQLEGGYGYTKDYPVE |
| RMMRDAKITEIYEGTSEVQKLVISGKIFR |
An exemplary trans-2-enoyl-CoA reductase (TER) for use in the present invention catalyzes the reduction of crotonyl-CoA into butyryl-CoA by reducing the carbon-carbon double bond in crotonyl-CoA. Exemplary TER nucleic acid and amino acid sequences from Euglena gracilis are set forth below:
EC number: 1.3.1.44
Example Nucleic Acid Sequence:
| (SEQ ID NO: 31) |
| ATGATAGTAAAAGCAAAGTTTGTAAAAGGATTTATCAGAGATGTACATCC |
| TTATGGTTGCAGAAGGGAAGTACTAAATCAAATAGATTATTGTAAGAAGG |
| CTATTGGGTTTAGGGGACCAAAGAAGGTTTTAATTGTTGGAGCCTCATCT |
| GGGTTTGGTCTTGCTACTAGAATTTCAGTTGCATTTGGAGGTCCAGAAGC |
| TCACACAATTGGAGTATCCTATGAAACAGGAGCTACAGATAGAAGAATAG |
| GAACAGCGGGATGGTATAATAACATATTTTTTAAAGAATTTGCTAAAAAA |
| AAAGGATTAGTTGCAAAAAACTTCATTGAGGATGCCTTTTCTAATGAAAC |
| CAAAGATAAAGTTATTAAGTATATAAAGGATGAATTTGGTAAAATAGATT |
| TATTTGTTTATAGTTTAGCTGCGCCTAGGAGAAAGGACTATAAAACTGGA |
| AATGTTTATACTTCAAGAATAAAAACAATTTTAGGAGATTTTGAGGGACC |
| GACTATTGATGTTGAAAGAGACGAGATTACTTTAAAAAAGGTTAGTAGTG |
| CTAGCATTGAAGAAATTGAAGAAACTAGAAAGGTAATGGGTGGAGAGGAT |
| TGGCAAGAGTGGTGTGAAGAGCTGCTTTATGAAGATTGTTTTTCGGATAA |
| AGCAACTACCATAGCATACTCGTATATAGGATCCCCAAGAACCTACAAGA |
| TATATAGAGAAGGTACTATAGGAATAGCTAAAAAGGATCTTGAAGATAAG |
| GCTAAGCTTATAAATGAAAAACTTAACAGAGTTATAGGTGGTAGAGCCTT |
| TGTGTCTGTGAATAAAGCATTAGTTACAAAAGCAAGTGCATATATTCCAA |
| CTTTTCCTCTTTATGCAGCTATTTTATATAAGGTCATGAAAGAAAAAAAT |
| ATTCATGAAAATTGTATTATGCAAATTGAGAGAATGTTTTCTGAAAAAAT |
| ATATTCAAATGAAAAAATACAATTTGATGACAAGGGAAGATTAAGGATGG |
| ACGATTTAGAGCTTAGAAAAGACGTTCAAGACGAAGTTGATAGAATATGG |
| AGTAATATTACTCCTGAAAATTTTAAGGAATTATCTGATTATAAGGGATA |
| CAAAAAAGAATTCATGAACTTAAACGGTTTTGATCTAGATGGGGTTGATT |
| ATAGTAAAGACCTGGATATAGAATTATTAAGAAAATTAGAACCTTAA |
Example Amino Acid Sequence:
| (SEQ ID NO: 32) |
| MIVKAKFVKGFIRDVHPYGCRREVLNQIDYCKKAIGFRGPKKVLIVGASS |
| GFGLATRISVAFGGPEAHTIGVSYETGATDRRIGTAGWYNNIFFKEFAKK |
| KGLVAKNFIEDAFSNETKDKVIKYIKDEFGKIDLFVYSLAAPRRKDYKTG |
| NVYTSRIKTILGDFEGPTIDVERDEITLKKVSSASIEEIEETRKVMGGED |
| WQEWCEELLYEDCFSDKATTIAYSYIGSPRTYKIYREGTIGIAKKDLEDK |
| AKLINEKLNRVIGGRAFVSVNKALVTKASAYIPTFPLYAAILYKVMKEKN |
| IHENCIMQIERMFSEKIYSNEKIQFDDKGRLRMDDLELRKDVQDEVDRIW |
| SNITPENFKELSDYKGYKKEFMNLNGFDLDGVDYSKDLDIELLRKLEP |
Exemplary secondary alcohol dehydrogenase (SADH) nucleic acid and amino acid sequences from Clostridium beijerinckii DSM 6423 are set forth below:
Example Nucleic Acid Sequence:
| (SEQ ID NO: 33) |
| ATGAAAGGTTTTGCAATGCTAGGTATTAATAAGTTAGGATGGATCGAAAA |
| AGAAAGGCCAGTTGCGGGTTCATATGATGCTATTGTACGCCCATTAGCAG |
| TATCTCCGTGTACATCAGATATACATACTGTTTTTGAGGGAGCTCTTGGA |
| GATAGGAAGAATATGATTTTAGGGCATGAAGCTGTAGGTGAAGTTGTTGA |
| AGTAGGAAGTGAAGTGAAGGATTTTAAACCTGGTGACAGAGTTATAGTTC |
| CTTGTACAACTCCAGATTGGAGATCTTTGGAAGTTCAAGCTGGTTTTCAA |
| CAGCACTCAAACGGTATGCTCGCAGGATGGAAATTTTCAAATTTCAAGGA |
| TGGAGTTTTTGGTGAATATTTTCATGTAAATGATGCGGATATGAATCTTG |
| CGATTCTACCTAAAGACATGCCATTAGAAAATGCTGTTATGATAACAGAT |
| ATGATGACTACTGGATTTCATGGAGCAGAACTTGCAGATATTCAAATGGG |
| TTCAAGTGTTGTGGTAATTGGCATTGGAGCTGTTGGCTTAATGGGAATAG |
| CAGGTGCTAAATTACGTGGAGCAGGTAGAATAATTGGAGTGGGGAGCAGG |
| CCGATTTGTGTTGAGGCTGCAAAATTTTATGGAGCAACAGATATTCTAAA |
| TTATAAAAATGGTCATATAGTTGATCAAGTTATGAAATTAACGAATGGAA |
| AAGGCGTTGACCGCGTAATTATGGCAGGCGGTGGTTCTGAAACATTATCC |
| CAAGCAGTATCTATGGTTAAACCAGGAGGAATAATTTCTAATATAAATTA |
| TCATGGAAGTGGAGATGCTTTACTAATACCACGTGTAGAATGGGGATGTG |
| GAATGGCTCACAAGACTATAAAAGGAGGTCTTTGTCCTGGGGGACGTTTG |
| AGAGCAGAAATGTTAAGAGATATGGTAGTATATAATCGTGTTGATCTAAG |
| TAAATTAGTTACACATGTATATCATGGATTTGATCACATAGAAGAAGCAC |
| TGTTATTAATGAAAGACAAGCCAAAAGACTTAATTAAAGCAGTAGTTATA |
| TTATAA |
Example Amino Acid Sequence:
| (SEQ ID NO: 34) |
| MKGFAMLGINKLGWIEKERPVAGSYDAIVRPLAVSPCTSDIHTVFEGALG |
| DRKNMILGHEAVGEVVEVGSEVKDFKPGDRVIVPCTTPDWRSLEVQAGFQ |
| QHSNGMLAGWKFSNFKDGVFGEYFHVNDADMNLAILPKDMPLENAVMITD |
| MMTTGFHGAELADIQMGSSVVVIGIGAVGLMGIAGAKLRGAGRIIGVGSR |
| PICVEAAKFYGATDILNYKNGHIVDQVMKLTNGKGVDRVIMAGGGSETLS |
| QAVSMVKPGGIISNINYHGSGDALLIPRVEWGCGMAHKTIKGGLCPGGRL |
| RAEMLRDMVVYNRVDLSKLVTHVYHGFDHIEEALLLMKDKPKDLIKAVVI |
| L |
Exemplary PTS nucleic acid and amino acid sequences (from C. acetobutylicum ATCC 824) are set forth below:
Example Nucleic Acid Sequence:
| (SEQ ID NO: 35) |
| ATGGGTAATAAGATATTTGCCGTACTTCAAAAAATCGGTAAATCTTTAAT |
| GCTTCCAGTATCTGTTCTACCGGCGGCTGGAATTCTATTGAGACTTGGAC |
| AGCCAGATTTGCTTAATATGCCTTATGTTCAAGCAGCAGGAAATGCTATT |
| TTTAATAATTTACCTTTAATTTTTGCGGTTGGAGTTGCTATAGGTTTTTC |
| AGGCGGAGAAGGTGTTGCAGCACTTGCAGCTGTAATTGGAGAACTAATAC |
| TTGAGGCGGTTGAAAAAACAGCAGGTGATACGGCAGCAGCAGCTTTAGCA |
| AAAACAGCGGCAGCTTCACATCATATGACGCTTGCAGCATTTCAAAAAAC |
| TCAAGAATACAGTAACATTGTAACTAAAACAACTATTAGTATGGGTGTTT |
| TTGGCGGTATAATAATCGGTCTTACAGCAGCTATTTTATATAATAAGTTC |
| CATGATATAAAGATGCCTCAAGTTTTGGGTTTCTTTGGTGGAAAACGTTT |
| CGTTCCAATTATAACTTCAATTTCAGCTCTTATTATTGCAACTATAGGAG |
| TAAATATTTGGTTGCCAATACAAGCTGGAATAAATTCACTAGCAGCATTT |
| GCAACTACATCACCAATTGGACCTGCAATGTATGCTGGAGGAAAAAGACT |
| TTTAATTCCACTAGGACTTCATCACATTTATTATCCATTGTTCTTATATC |
| AATTTGGTCACTTTGTTTCAAATGGAGTTACTTATGTAGGAGATACAGCA |
| AGATACTTCCATGGGGATCCTACTGCCGGAAACTTCATGGCAGCAGAGTA |
| TCCAATACTAATGTTTGGTCTTCCAGGAGCTGCTCTAGCTATGATTGCAG |
| CTGCTAAAAAAGAAAAGAGAAAAGAAATGGCTGGAATGATGATTTCAGCA |
| GCATTTGTAGCATTTGTAACAGGTATTACAGAGCCAATTGAATTCTCATT |
| CATATTTGTTGCTCCAGTATTATTTGTGTTCCACGTACTTGCTGCATTCG |
| CATCTGGTCTTATTACAAGTTATTTACACATAAGATTAGGGTATACTTTC |
| TCAGCATCCTTCATAGATTATGTTTTAGGATTCAAATATGCAGGTCATCC |
| ATTACTTATATGGCTTGTAGGTATAGGGTTCTTTGTATTGTACTTTGTTG |
| TATTCTACTTCACAATTAAAGCAATGAACATTAAGACACCAGGTAGAGAA |
| GATGATGATGCAGAAGGTGTTAAGAAGATAAATGTAAAAGGAAAAGCTAA |
| GGCAGCTAAGGTGCTTGAAGCTATAGGCGGAAAAGATAATATAAAAGTAC |
| TTGATGCATGTATAACAAGATTAAGACTTAACTTAAATGATCCTTCTTTG |
| GTTGATAAAGCTACACTTAAAGCTCTTGGAGCAGCTGGAGTAATGACAGC |
| AGAAGATAGTGTTCAAGTAGTTTTTGGAACTGAAGCTGAAAGAATAAAAG |
| ATGACATAAAAGCAATTATACAAAATGGTGGATATGTTGAAGATGATTCA |
| GATAAGGAAGAAGAAGTTCAAGAGGATAAGCAAATTTCTAAAGGTGCACA |
| CGAACTTTTAAGTCCAGCTGATGGAGAAGTAGTTGGTATTGAGAGTGTTC |
| CGGATAGTACATTTGCTGAAAAAATGCTTGGAGACGGTTTTGCAGTAATA |
| CCTTCAGGAAATGAAGTACACTCACCAGCTGATGGAGAAGTATCAGTTTT |
| ATTCCCAACTAAGCATGCATTTGCAATAACAACAGAAGGCGGACTTGAAC |
| TTTTAATACATGTTGGAATTGATACTGTAGCATTAAATGGTGAAGGTTTC |
| ACAGCACATGTAAAACAAGGAGATAAAGTTAAAAAAGGAGATTTGATTTT |
| AACTTTAGATACTGAGTTTATAAAGAGCAAAGGTAAAAACCTTATAACTC |
| CAGTGATTGTAACTAACATGGATGTTGTAGGAAATATAGATGTTAAATTA |
| GGAAACGTTAAAAATTCCGAGAAAGCTGCGGATGTTACCGTAAAATAA |
Example Amino Acid Sequence:
| (SEQ ID NO: 36) |
| MGNKIFAVLQKIGKSLMLPVSVLPAAGILLRLGQPDLLNMPYVQAAGNAI |
| FNNLPLIFAVGVAIGFSGGEGVAALAAVIGELILEAVEKTAGDTAAAALA |
| KTAAASHHMTLAAFQKTQEYSNIVTKTTISMGVFGGIIIGLTAAILYNKF |
| HDIKMPQVLGFFGGKRFVPIITSISALIIATIGVNIWLPIQAGINSLAAF |
| ATTSPIGPAMYAGGKRLLIPLGLHHIYYPLFLYQFGHFVSNGVTYVGDTA |
| RYFHGDPTAGNFMAAEYPILMFGLPGAALAMIAAAKKEKRKEMAGMMISA |
| AFVAFVTGITEPIEFSFIFVAPVLFVFHVLAAFASGLITSYLHIRLGYTF |
| SASFIDYVLGFKYAGHPLLIWLVGIGFFVLYFVVFYFTIKAMNIKTPGRE |
| DDDAEGVKKINVKGKAKAAKVLEAIGGKDNIKVLDACITRLRLNLNDPSL |
| VDKATLKALGAAGVMTAEDSVQVVFGTEAERIKDDIKAIIQNGGYVEDDS |
| DKEEEVQEDKQISKGAHELLSPADGEVVGIESVPDSTFAEKMLGDGFAVI |
| PSGNEVHSPADGEVSVLFPTKHAFAITTEGGLELLIHVGIDTVALNGEGF |
| TAHVKQGDKVKKGDLILTLDTEFIKSKGKNLITPVIVTNMDVVGNIDVKL |
| GNVKNSEKAADVTVK |
Exemplary PTS nucleic acid and amino acid sequences (from C. saccharobutylicum DSM 13864) are set forth below:
Example Nucleic Acid Sequence:
| (SEQ ID NO: 37) |
| ATGTTAGTTGATGCTTTTTTGCGCACAAAGCATCTAAAACATCCCTATAT |
| ACAAAAAATATTTAAAAAAGGGGAAAATGTTATGAAAGACAAAATTTTTG |
| GTATTTTACAGCGTGTAGGAAGATCTTTTATGCTTCCAATAGCTATTTTA |
| CCAGTAGCTGGATTATTTCTTGGTTTAGGTGGATCATTTACCAATGAAAC |
| AATGATTCAAGCTTATGGACTTACTGGGTTAATCGGACCTGGTACATTTA |
| TTTATTCAATCCTTTCTGTAATGAATGCAGCAGGAAATGTAGTGTTTGGC |
| AATTTGCCTTTATTATTTGCAATGGGTGTTGCAATTGGTATGGCTAAAAA |
| GGAAAAAGATGTTGCAGCTTTATCAGCAGCAATTGCATTCCTTATAATGC |
| ATGCATCAATAAGTGCTATGATTAATATTAATGGTGGAACTGATGCTCTT |
| CTTAGTGGTGCATCAACTTCAGTACTTGGTATTACTTCATTACAAATGGG |
| TGTTTTTGGTGGTATTATTGTAGGGCTTGGAGTAGCAGCGTTACATAATA |
| AATTCTATAAAATTGAATTACCACAGGTATTATCATTCTTTGGTGGAACT |
| AGATTTGTTCCAATTGTAAGTGCAATAACATATTTAATTGTTGGAATTTT |
| AATGTTTTATATTTGGCCTCCAATTCAAGGTGGTATTTATAAAGTTGGAG |
| ATCTTGTATTAAGATCAGGATATGCAGGAACATGGCTTTATGGTTTAATG |
| GAACGTTTATTAATACCTTTTGGTCTTCATCATGTATTTTACTTACCATT |
| CTGGCAAACAGCAGTTGGTGGTACAGCTACAGTAGGTGGGAAAGTTATTG |
| AAGGTGCTCAAAATATTTTCTTTGCTGAACTTGGAACTCCAGGAATAACA |
| CACTTTAGTGTTTCAGCAACAAGATTTATGTCAGGTAAATTCCCACTTAT |
| GATATTTGGTTTACCTGGAGCAGCGCTTGCGATGTACAGATGTGCAAAAC |
| CAGAAAAGAGAAAAGTAGTAGGTGGATTATTATTATCAGCAGCATTAACT |
| TCGATGTTAACTGGTATTACAGAACCAATTGAATTTACATTCTTATTTGT |
| TGCACCATTATTATATGGAATTCACTGCGTATTTGCTGGACTAGCTTATA |
| TGTTTATGCATATGTTAAATGTTGGAGTTGGTATGACTTTCTCTGGTGGA |
| TTTATAGATTTATTCTTATTTGGTATTTTACAAGGAAATGCTAAGACAAG |
| TTGGATTTGGGTTGCAGTTGTAGGTATTGCATATTTTGTAGTATACTATG |
| TATTGTTCTCTTTCTTAATTAAGAAGCTTGACTTAAAGACTCCAGGTCGT |
| GATGATTCTGAAGAAGTTAAACTTTATCGTAGAAGCGATTTAGATGCAAA |
| GAAAAAAGGTAATAATGCAGATAATGGAGAAAGTGAAAGTATAGATGAAT |
| TATCAGCTATGATCTGTCAAGGTCTTGGTGGTAAGAAGAATATTTCAGAT |
| GTTGACTGTTGCGCAACTAGATTACGTTGTACAGTTGTTAAATCAGAATT |
| AGTAAATGAAGCTTTATTAAAACAAACTGGAGCATCAGGAGTAGTTCATA |
| AAGGCGTAGGTGTTCAAATTATATATGGACCAAGAGTAACAGTTATAAAA |
| TCTAATTTAGAAGATTATTTAATTGCAGCACCTGATGAAGAAGTTGCTAT |
| AGATGCAGTAGAAGAAAAAGCACCTGAAATGCCAACTGAAAAGGAAGCGG |
| AAGGAAAAGTTGTTAATACAATAGTTTTAAGCAGTCCATTAACAGGAGAT |
| GCTAAAGATTTATCAGAAGCTCCAGATGAAGCATTTGCAAGCAAAATGAT |
| GGGAGACGGAGCGGTAGTAATTCCAAGTAATGGAGATGTTGTAGCACCAG |
| CAGATGGTGAGGTGAGTTTTGTATTCCCATCAAAACATGCAGTAGGATTA |
| ACAACAACTGATGGTCTTGAATTACTTATTCATATAGGAATAGATACAGT |
| AAAGCTTGATGGAAAAGGCTTTGAAACTTTCGTAAAAGAAGGAGACAAAG |
| TTAAAAAAGGTGATAAATTATTAAGCTTTGACTTAGAATTTATAAAAGAA |
| AATGCACCATCTATTGCATCACCATGCATTTGTACAGCATTAAGCAGCAA |
| ACAAAAAGTACGTTTGTTAAAAACAGGTGATATAAAGGCAGGAGAAGACT |
| TAATAGCAATTGATGTGCTTGAATAA |
Example Amino Acid Sequence:
| (SEQ ID NO: 38) |
| MLVDAFLRTKHLKHPYIQKIFKKGENVMKDKIFGILQRVGRSFMLPIAIL |
| PVAGLFLGLGGSFTNETMIQAYGLTGLIGPGTFIYSILSVMNAAGNVVEG |
| NLPLLFAMGVAIGMAKKEKDVAALSAAIAFLIMHASISAMININGGTDAL |
| LSGASTSVLGITSLQMGVFGGIIVGLGVAALHNKFYKIELPQVLSFEGGT |
| REVPIVSAITYLIVGILMFYIWPPIQGGIYKVGDLVLRSGYAGTWLYGLM |
| ERLLIPFGLHHVFYLPFWQTAVGGTATVGGKVIEGAQNIFFAELGTPGIT |
| HFSVSATRFMSGKFPLMIFGLPGAALAMYRCAKPEKRKVVGGLLLSAALT |
| SMLTGITEPIEFTFLEVAPLLYGIHCVFAGLAYMFMHMLNVGVGMTFSGG |
| FIDLFLEGILQGNAKTSWIWVAVVGIAYFVVYYVLFSFLIKKLDLKTPGR |
| DDSEEVKLYRRSDLDAKKKGNNADNGESESIDELSAMICQGLGGKKNISD |
| VDCCATRLRCTVVKSELVNEALLKQTGASGVVHKGVGVQIIYGPRVTVIK |
| SNLEDYLIAAPDEEVAIDAVEEKAPEMPTEKEAEGKVVNTIVLSSPLTGD |
| AKDLSEAPDEAFASKMMGDGAVVIPSNGDVVAPADGEVSFVFPSKHAVGL |
| TTTDGLELLIHIGIDTVKLDGKGFETFVKEGDKVKKGDKLLSFDLEFIKE |
| NAPSIASPCICTALSSKQKVRLLKTGDIKAGEDLIAIDVLE |
In an embodiment, amino acid sequences as disclosed herein may include amino acid sequences having at least 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identity the disclosed wild type sequences. In an embodiment, a corresponding polynucleotide sequence may be a polynucleotide sequence encoding a wild type amino acid sequence as disclosed herein, and may further include a polynucleotide sequence which encodes a protein having at least 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identity to a wild type amino acid sequence as disclosed herein. In an embodiment, a polynucleotide sequence as disclosed herein may include a sequence which has 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identity to the disclosed wild type polynucleotide sequence.
Acetogenic clostridia strain C. ljungdahlii was cultured under three conditions: 5 g/l of fructose (first feedstock) with a N2 headspace at 20 psig (referred to as heterotrophic fermentation), no fructose with a CO (second feedstock) headspace at 20 psig (autotrophic fermentation), and 5 g/l of fructose with a CO headspace at 20 psig (mixotrophic fermentation). Three biological replicates were prepared, grown at 37° C. and shaken at 225 rpm. Table 1 shows the metabolite profiles and carbon yields achieved. Carbon yield for this experiment is calculated by dividing the total amount of carbon in produced bioproducts by the total amount of carbon metabolized from the first feedstock during fermentation.
| TABLE 1 | ||
| Concentration (mM) | Carbon |
| Hour | Fructose | Acetate | Ethanol | 2,3-butanediol | Lactate | yield |
| 5 g/l fructose with N2 headspace |
| 0 | 27.52 | 3.74 | 0.29 | 0.11 | 0.00 | — |
| 41 | 25.36 | 8.28 | 1.98 | 0.13 | 0.00 | 67% |
| 49 | 19.06 | 16.58 | 5.77 | 0.19 | 0.00 | 65% |
| 56 | 10.19 | 29.27 | 8.29 | 0.36 | 0.00 | 62% |
| 65 | 0.62 | 44.19 | 12.63 | 0.63 | 0.00 | 64% |
| 73 | 0.05 | 45.07 | 13.60 | 0.66 | 0.00 | 65% |
| 80 | 0.03 | 45.11 | 14.81 | 0.72 | 0.00 | 67% |
| 5 g/l fructose with CO headspace |
| 0 | 27.23 | 3.74 | 0.00 | 0.11 | 0.00 | — |
| 49 | 25.86 | 4.16 | 0.48 | 0.19 | 0.16 | 32% |
| 56 | 25.12 | 4.30 | 0.75 | 0.19 | 0.12 | 26% |
| 65 | 25.07 | 5.14 | 1.49 | 0.35 | 0.14 | 55% |
| 73 | 22.39 | 5.85 | 2.15 | 0.39 | 0.17 | 35% |
| 80 | 22.32 | 7.96 | 4.19 | 0.55 | 0.23 | 65% |
| 85 | 20.36 | 9.76 | 5.62 | 1.77 | 0.21 | 74% |
| 89 | 19.69 | 12.14 | 5.24 | 2.46 | 0.49 | 84% |
| 97 | 16.56 | 17.62 | 9.26 | 4.49 | 1.00 | 104% |
| 104 | 9.68 | 19.22 | 14.75 | 8.70 | 1.38 | 94% |
| 113 | 3.07 | 27.38 | 23.10 | 16.53 | 2.59 | 115% |
| 121 | 0.00 | 29.65 | 22.65 | 17.85 | 2.63 | 108% |
| CO headspace (no fructose) |
| Concentration (mM) |
| Hour | Fructose | Acetate | Ethanol | 2,3-butanediol | Lactate |
| 0 | 0.00 | 3.72 | 0.00 | 0.12 | 0.00 |
| 41 | 0.00 | 4.02 | 0.47 | 0.14 | 0.00 |
| 49 | 0.00 | 4.17 | 0.78 | 0.11 | 0.00 |
| 56 | 0.00 | 4.32 | 0.46 | 0.10 | 0.25 |
| 65 | 0.00 | 4.65 | 0.64 | 0.00 | 0.22 |
| 73 | 0.00 | 4.71 | 0.52 | 0.08 | 0.20 |
| 80 | 0.00 | 4.94 | 0.69 | 0.14 | 0.19 |
| 89 | 0.00 | 5.63 | 0.74 | 0.14 | 0.18 |
| 97 | 0.00 | 7.12 | 1.03 | 0.20 | 0.00 |
| 104 | 0.00 | 8.26 | 1.07 | 0.24 | 0.19 |
| 113 | 0.00 | 13.50 | 1.81 | 0.51 | 0.75 |
| 121 | 0.00 | 17.62 | 2.51 | 0.93 | 0.32 |
These results exemplify the non-additive, i.e., synergistic nature of the mixotrophic fermentation. Combining the heterotrophic fermentation broth with the autotrophic fermentation broth, the molar ratios of acetate, ethanol, 2,3-butanediol and lactate are: 0.77, 0.20, 0.02, and 0.004, respectively. In comparison, those for the mixotrophic fermentation are 0.40, 0.31, 0.24, and 0.04, respectively. The proportion of the more reduced products, ethanol, lactic acid and 2.3-butanediol is increased, while that of acetate decreases. Thus, the fraction of 2,3-butanediol in the mixotrophic fermentation is more than 10 times greater than that in the combination and that of acetate is about one half. In comparison, in the autotrophic fermentation, the molecular fraction of acetate is 0.82.
Additionally, the results show that, by the time the carbohydrate is metabolized, the mixotrophic fermentation has a much greater carbon yield compared to the heterotrophic fermentation.
This example demonstrates the ability to increase carbon efficiencies and increase the yield of reduced product with mixotrophic fermentation.
Acetogenic clostridia strain C. ljungdahlii was cultured under two conditions: 10 g/l of fructose (first feedstock) with a headspace of the gas mixture of CO, CO2, H2, and N2 (55%, 10%, 20%, 15%, respectively) (second feedstock) at 30 psig (referred to as mixotrophic fermentation) and no fructose with a headspace of the gas mixture of CO, CO2, H2, and N2 (55%, 10%, 20%, 15%, respectively) (second feedstock) at 30 psig (referred to as autotrophic fermentation). Two biological replicates were prepared, grown at 37° C. and shaken at 225 rpm. The CO and CO2 were labeled with 13C, allowing the ability to track the uptake and incorporation of the carbon substrates.
FIG. 1 shows the percentage of 13C labeling of the metabolite acetate over time in both cultures. Average 13C labeling of acetate for autotrophic (A) and mixotrophic (M) cultures between two biological replicates is shown. For the mixotrophic cultures, fructose was never depleted over the time sampled. The final concentration of fructose at timepoint 168 hr was 7.9 g/l.
The only way acetate could be labeled with 13C is if the labeled gas, either 13C0 or 13CO2, was utilized by the Wood-Ljungdahl pathway and used to form acetyl-CoA. For the autotrophic cultures, >90% of the acetate was labeled with 13C, indicating that less than 10% of the carbon came from the inoculum culture and yeast extract in the medium. For the mixotrophic cultures, ˜80% of the acetate was labeled, even in the presence of excess fructose. This indicates that C. ljungdahlii is able to utilize and consume gas in the presence of excess sugar.
The test of Example 1 was repeated using the acetogenic clostridia strain C. autoethanogenum. Table 2 shows the metabolite profiles and carbon yields.
Similar to the first example, the cultures with both fructose and a CO headspace had greater carbon efficiencies, indicating gas consumption. In addition, the mixotrophic cultures produced greater amounts of 2,3-butanediol. Compared to the pure gas culture, the mixotrophic culture produced bioproducts at a much faster rate and produced less acetate, relative to other bioproducts.
| TABLE 2 | ||
| Concentration (mM) | Carbon |
| Hour | Fructose | Acetate | Ethanol | 2,3-butanediol | yield |
| 5 g/l fructose with N2 headspace |
| 0 | 27.55 | 6.71 | 3.46 | 0.00 | — |
| 84 | 26.89 | 9.15 | 4.74 | 0.00 | 120% |
| 94 | 23.43 | 12.69 | 7.14 | 0.38 | 77% |
| 120 | 3.80 | 42.39 | 23.84 | 0.79 | 80% |
| 170 | 0.00 | 46.77 | 25.92 | 0.96 | 77% |
| 5 g/l fructose with CO headspace |
| 0 | 24.62 | 7.08 | 3.81 | 0.19 | — |
| 53 | 23.75 | 9.11 | 6.26 | 0.19 | 170% |
| 58 | 22.35 | 10.62 | 10.09 | 0.36 | 149% |
| 63 | 20.73 | 12.69 | 14.25 | 0.64 | 145% |
| 68 | 17.37 | 15.67 | 25.45 | 1.51 | 151% |
| 77 | 9.78 | 43.77 | 27.77 | 4.68 | 156% |
| 84 | 3.98 | 69.20 | 20.78 | 5.18 | 144% |
| 94 | 0.00 | 79.86 | 21.54 | 5.55 | 137% |
| CO headspace (no fructose) |
| 0 | 0.00 | 6.82 | 3.68 | 0.00 | |
| 84 | 0.00 | 7.22 | 3.95 | 0.00 | |
| 94 | 0.00 | 8.07 | 4.35 | 0.00 | |
| 120 | 0.00 | 9.43 | 8.58 | 0.00 | |
| 170 | 0.00 | 60.24 | 1.12 | 1.82 | |
As in Example 1, the proportion of 2,3-butanediol is greater in the mixotrophic fermentation compared with that in either heterotrophic fermentation or autotrophic fermentation. The carbon yield at the time of carbohydrate exhausting in case of mixotrophic fermentation is nearly double that in autotrophic fermentation.
A strain of C. ljungdahlii was constructed with a recombinant pathway expressing a thiolase (also known as acetyl-CoA acetyltransferase) gene, an acetoacetate transferase subunit A (also known as CoA-transferase subunit A, or COAT A) gene, an acetoacetate transferase subunit B (also known as CoA-transferase subunit B, or COAT B) gene, an acetoacetate decarboxylase (ADC) gene, and a secondary alcohol dehydrogenase (SADH) gene. All genes were derived from C. acetobutylicum ATCC 824 except for the secondary alcohol dehydrogenase gene, which came from C. beijerinckii DSM 6423. Three biological replicates of this strain were grown anaerobically in media containing initially 5 g/l of fructose and were fed additional fructose over time. The headspace consisted of N2, CO2, and H2 (85%, 10%, 5%, respectively) at 1 atm.
These cultures produced three main metabolites: isopropanol, acetone, and acetate. Acetone is an intermediate metabolite of isopropanol, and so the titers and yields of these two metabolites are combined together. Table 3 shows the metabolite production of these cultures.
| TABLE 3 | ||||||
| Acetone & | ||||||
| isopropanol | ||||||
| Acetate in | Acetone & | yield if all | ||||
| Acetone & | metabolite | Sugar | isopropanol | acetate were | ||
| Biological | Isopropanol | Acetate | pool | metabolized | mass yield | re-assimilated |
| Replicate | titer (g/L) | titer (g/L) | (wt %) | (g/L) | (wt %) | (wt %) |
| #1 | 3.90 | 0.75 | 19.3% | 8.89 | 41.5% | 45.4% |
| #2 | 3.76 | 0.85 | 22.5% | 8.64 | 41.1% | 45.6% |
| #3 | 3.77 | 0.96 | 25.6% | 8.78 | 40.6% | 45.6% |
Mass yield is calculated by dividing total concentration of products produced by the total amount of sugar metabolized. As can be seen, a mass yield of ˜41% was achieved for acetone and isopropanol.
This mass yield is greater than could theoretically be from fructose alone. Table 4 outlines different theoretical mass yields based on different substrates.
| TABLE 4 | |||||
| Fructose | H2 | Full | Full | ||
| Mode of | only-no | Limited | supplemented | mixotrophy | mixotrophy |
| fermentation | mixotrophy | mixotrophy | mixotrophy | (CO only) | (CO2 & H2) |
| Acetone mass | 30.0% | 47.1% | 62.8% | 90% | 95.5% |
| yield on sugar | |||||
| (wt %) | |||||
If no gas was metabolized (fructose only—no mixotrophy) the maximum yield for acetone is only 30%, while the recombinant strain producing acetone/isopropanol had a mass yield of 41%. If all the acetate produced by the recombinant strain were reassimilated into acetone and isopropanol, the mass yields increase to 45%, close to the theoretical maximum of limited mixotrophy (47.1%). This limited mixotrophy is defined as sugar and gas consumption, where the only source of gas is the CO2 evolved during metabolism of the sugar, and potentially hydrogen generated from pyruvate ferredoxin oxidoreductase activity. There is no exogenous CO, CO2 or H2 fed to the fermentation. These mass yields can be further increased with other modes of mixotrophy, such as:
H2 Supplemented Mixotrophy—
H2 supplemented mixotrophy is defined as sugar and gas consumption, where the only source of CO2 comes from glycolysis, and H2 is minimally provided by pyruvate ferredoxin oxidoreductase activity and largely provided by exogenous H2.
Full Supplemented Mixotrophy—
Full supplemented mixotrophy is defined as sugar and gas consumption, where CO2, CO and/or H2 can be provided exogenously in addition to the gas evolved by glycolysis and/or pyruvate ferredoxin oxidoreductase activity.
C. ljungdahlii DSM 13528 has a native secondary alcohol dehydrogenase gene (accession number CLJU_c248601 with a nucleic acid sequence of:
| (SEQ ID NO: 1) |
| ATGAAAGGTTTTGCAATGTTAGGTATTAACAAATTAGGATGGATTGAAAA |
| GAAAAACCCAGTGCCAGGTCCTTATGATGCGATTGTACATCCTCTAGCTG |
| TATCCCCATGTACATCAGATATACATACGGTTTTTGAAGGAGCACTTGGT |
| AATAGGGAAAATATGATTTTAGGCCATGAAGCTGTAGGTGAAATAGCCGA |
| AGTTGGCAGCGAAGTTAAAGATTTTAAAGTTGGCGATAGAGTTATCGTAC |
| CATGCACAACACCTGACTGGAGATCTTTAGAAGTCCAAGCTGGTTTTCAG |
| CAGCATTCAAACGGTATGCTTGCAGGATGGAAGTTTTCCAATTTTAAAGA |
| TGGTGTATTTGCAGATTACTTTCATGTAAACGATGCAGATATGAATCTTG |
| CCATACTCCCAGATGAAATACCTTTAGAAAGTGCAGTTATGATGACAGAC |
| ATGATGACTACTGGTTTTCATGGAGCAGAACTTGCAGACATAAAAATGGG |
| CTCCAGCGTTGTAGTAATTGGTATAGGAGCTGTTGGATTAATGGGAATAG |
| CCGGTTCCAAACTTCGAGGAGCAGGCAGAATTATCGGTGTTGGAAGCAGA |
| CCTGTTTGTGTTGAAACAGCTAAATTTTATGGAGCAACTGATATTGTAAA |
| TTATAAAAATGGTGATATAGTTGAACAAATCATGGACTTAACTCATGGTA |
| AAGGTGTAGACCGTGTAATCATGGCAGGCGGTGGTGCTGAAACACTAGCA |
| CAAGCAGTAACTATGGTTAAACCTGGCGGCGTAATTTCTAACATCAACTA |
| CCATGGAAGCGGTGATACTTTACCAATACCTCGTGTTCAATGGGGCTGCG |
| GCATGGCTCACAAAACTATAAGAGGAGGATTATGCCCCGGCGGACGTCTT |
| AGAATGGAAATGCTAAGAGATCTTGTTCTATATAAACGTGTTGATTTGAG |
| TAAACTTGTTACTCATGTATTTGATGGTGCAGAAAATATTGAAAAGGCCC |
| TTTTGCTTATGAAAAATAAGCCAAAAGATTTAATTAAATCAGTAGTTACA |
| TTCTAA. |
This gene was deleted from the chromosome and replaced with a chloramphenicol acetyltransferase (CAT) gene, which confers resistance to the antibiotic chloramphenicol or thiamphenicol. This new strain is termed Clj ΔSADH.
A plasmid expressing the genes for thiolase (also known as acetyl-CoA acetyltransferase), acetoacetate transferase subunit A (COAT A), acetoacetate transferase subunit B (COAT B), and acetoacetate decarboxylase (ADC) was transformed into this deletion strain. All genes came from C. acetobutylicum ATCC 824.
The deletion strain with the plasmid was grown anaerobically in media containing 5 g/l of fructose. The headspace consisted of N2, CO2, and H2 (85%, 10%, 5%, respectively) at 1 atm.
This strain produced primarily acetone and acetate. Table 5 shows the metabolite production of this strain.
| TABLE 5 | |||||
| Acetone yield | |||||
| Acetate in | Acetone | if all acetate | |||
| Acetone | metabolite | Sugar | mass | were re- | |
| titer | Acetate | pool | metabolized | yield | assimilated |
| (g/L) | titer (g/L) | (wt %) | (g/L) | (wt %) | (wt %) |
| 2.65 | 0.77 | 22.0% | 6.79 | 39.1% | 45.6% |
Mass yield is calculated as in Example 4. The mass yield for this strain is 39.1% for acetone, which is greater than can be achieved on sugar alone (Table 4). This demonstrates the ability of this strain to produce enhanced mass yields over sugar alone.
A plasmid was constructed to overexpress a glucose-specific EIIABC gene from Clostridium acetobutylicum ATCC 824 (CA_C0570). This plasmid was transformed into Clostridium ljungdahlii DSM 13528 to make the strain Clj (pCAC-EIIABC). Biological replicates of this strain were grown in 10 ml of PETC medium with 5 g/l of fructose and thiamphenicol (5 μg/m1). Once the cultures reached an OD600 of 1.0, 1 ml (10% inoculum) was used to inoculate new tubes of 10 ml of PETC medium with 5 g/l of glucose and thiamphenicol (5 μg/m1). The metabolite profile of these glucose-grown cultures is shown in Table 6.
| TABLE 6 | |||
| Glucose | Rate of | ||
| Concentration (g/l) | metabolized | consumption |
| Replicate | Day | Glucose | Fructose | Acetate | Ethanol | (g/l) | (g/hr/g cell mass) |
| #1 | 0 | 5.19 | 0.33 | 0.32 | 0.98 | — | — |
| 3 | 4.62 | 0.00 | 1.71 | 0.67 | 0.57 | — | |
| 4 | 4.16 | 0.00 | 2.12 | 0.67 | 1.03 | — | |
| 6 | 3.09 | 0.00 | 3.11 | 0.70 | 2.10 | 0.07 | |
| #2 | 0 | 5.21 | 0.33 | 0.33 | 0.99 | — | — |
| 3 | 4.97 | 0.00 | 1.35 | 0.69 | 0.24 | — | |
| 4 | 4.73 | 0.00 | 1.60 | 0.70 | 0.47 | — | |
| 6 | 3.79 | 0.00 | 2.53 | 0.69 | 1.42 | 0.07 | |
Replicate #1 metabolized 2.1 g/l of glucose over 6 days, while replicate #2 metabolized 1.42 g/l of glucose over the same period. A plasmid control culture metabolized no glucose over this same time period. The strains also metabolized the residual fructose from the inoculum (0.33 g/l in each case) and some ethanol from the antibiotic (˜0.3 g/l). However, the majority of the carbon metabolized was glucose. The maximum rate of consumption of glucose was 0.07 g/hr/g cell mass. This was calculated between Days 4 and 6, after the cultures reached their maximum cell density (OD600≈1.0). Replicate #1 reached its maximum cell density by Day 3, while Replicate #2 reached this by Day 4. Thus Replicate #1 metabolized a greater amount of glucose than Replicate #2, though they both had the same maximum rate of consumption. In this particular example, the measured rate is about 65% less than the typical batch consumption rate of fructose.
Two acetogenic clostridial strains were tested for mixotrophic growth: Clostridium ljungdahlii DSM 13528 and Clostridium autoethanogenum DSM 10061. Both strains were cultured under three conditions: 10 g/l of fructose (first feedstock) with a N2 headspace at 20 psig (referred to as heterotrophic fermentation), no fructose with a syngas headspace (CO:CO2:H2:N2, 55:10:20:15, second feedstock) headspace at 30 psig (autotrophic fermentation), and 10 g/l of fructose with a syngas headspace (CO:CO2:H2:N2, 55:10:20:15, second feedstock) headspace at 30 psig (mixotrophic fermentation). In addition, a control culture of C. acetobutylicum ATCC 824, that cannot metabolize CO2, was prepared using the heterotrophic conditions to compare against the two acetogens. Three biological replicates of each strain were prepared, grown at 37° C. in standard PETC medium and shaken at 200 rpm. The pH was actively controlled with 6M NaOH to keep the pH between 5 and 6. Headspace volumes for the autotrophic and mixotrophic fermentations was replenished every 2-3 days.
Metabolite profiles and carbon yields are shown in the Tables below. Carbon yield is calculated in this example by dividing the total amount of carbon in produced bioproducts by the total amount of carbon metabolized from the sugar in the first feedstock. In the case for metabolites derived from acetyl-CoA, the theoretical maximum without CO2 fixation is 67%.
| TABLE 7 |
| Heterotrophic fermentation of C. ljungdahlii. |
| Heterotrophic culture (10 g/l fructose with N2 headspace) |
| Concentration (mM) |
| 2,3- | Carbon | |||||
| Hour | Fructose | Acetate | Ethanol | Butanediol | Lactate | yield |
| 0 | 55.78 | 0.00 | 0.00 | 0.00 | 0.14 | — |
| 29 | 50.08 | 10.69 | 3.87 | 0.00 | 0.12 | 86% |
| 47 | 40.57 | 34.45 | 5.82 | 0.00 | 0.07 | 88% |
| 70 | 27.47 | 68.20 | 4.78 | 0.00 | 0.12 | 86% |
| 97 | 13.98 | 98.18 | 5.09 | 0.10 | 0.16 | 83% |
| 121 | 4.80 | 120.33 | 6.21 | 0.17 | 0.23 | 83% |
| 144 | 0.25 | 129.28 | 7.51 | 0.19 | 0.33 | 83% |
| TABLE 8 |
| Mixotrophic fermentation of C. ljungdahlii. |
| Mixotrophic culture (10 g/l fructose with syngas headspace) |
| Concentration (mM) |
| 2,3- | Carbon | |||||
| Hour | Fructose | Acetate | Ethanol | Butanediol | Lactate | yield |
| 0 | 57.41 | 0.00 | 0.00 | 0.00 | 0.16 | — |
| 19 | 57.19 | 1.01 | 0.14 | 0.00 | 0.21 | 220% |
| 42 | 49.60 | 20.52 | 1.87 | 0.03 | 0.20 | 97% |
| 67 | 37.20 | 86.87 | 4.93 | 0.92 | 0.14 | 155% |
| 93 | 34.56 | 112.37 | 5.56 | 3.55 | 0.72 | 184% |
| 114 | 33.32 | 120.78 | 7.15 | 5.48 | 1.57 | 195% |
| 138 | 31.38 | 127.57 | 7.90 | 6.64 | 1.89 | 194% |
| 162 | 29.34 | 134.32 | 8.78 | 7.39 | 2.29 | 192% |
| TABLE 9 |
| Autotrophic fermentation of C. ljungdahlii. |
| Autotrophic culture (syngas headspace) |
| Concentration (mM) |
| 2,3- | Carbon | |||||
| Hour | Fructose | Acetate | Ethanol | Butanediol | Lactate | yield* |
| 0 | 0.00 | 0.00 | 0.00 | 0.00 | 0.16 | — |
| 25 | 0.00 | 0.43 | 0.00 | 0.00 | 0.16 | — |
| 41 | 0.00 | 1.18 | 0.10 | 0.00 | 0.17 | — |
| 65 | 0.00 | 8.15 | 0.98 | 0.18 | 0.32 | — |
| 90 | 0.00 | 38.05 | 4.17 | 1.86 | 0.51 | — |
| 113 | 0.00 | 39.85 | 3.43 | 1.85 | 0.36 | — |
| 138 | 0.00 | 39.25 | 7.27 | 1.98 | 0.29 | |
| 164 | 0.00 | 31.32 | 23.67 | 3.18 | 0.35 | — |
| 185 | 0.00 | 58.88 | 20.79 | 3.93 | 0.17 | — |
| 209 | 0.00 | 68.27 | 18.09 | 4.03 | 0.11 | — |
| 233 | 0.00 | 57.82 | 33.30 | 4.90 | 0.36 | — |
| *Carbon yield cannot be determined for autotrophic fermentations because there is no sugar substrate. |
| TABLE 10 |
| Heterotrophic fermentation of C. autoethanogenum. |
| Heterotrophic culture (10 g/l fructose with N2 headspace) |
| Concentration (mM) |
| 2,3- | Carbon | |||||
| Hour | Fructose | Acetate | Ethanol | Butanediol | Lactate | yield |
| 0 | 54.93 | 0.00 | 0.00 | 0.00 | 0.14 | — |
| 23 | 54.04 | 4.50 | 0.52 | 0.00 | 0.14 | 195% |
| 50 | 44.38 | 15.91 | 8.52 | 0.03 | 0.14 | 78% |
| 74 | 23.82 | 37.47 | 23.84 | 1.10 | 0.42 | 69% |
| 97 | 0.50 | 71.35 | 34.07 | 2.57 | 1.18 | 69% |
| 123 | 0.12 | 77.12 | 32.10 | 2.75 | 1.20 | 71% |
| TABLE 11 |
| Mixotrophic fermentation of C. autoethanogenum. |
| Mixotrophic culture (10 g/l fructose with syngas headspace) |
| Concentration (mM) |
| 2,3- | Carbon | |||||
| Hour | Fructose | Acetate | Ethanol | Butanediol | Lactate | yield |
| 0 | 58.11 | 0.00 | 0.00 | 0.00 | 0.16 | — |
| 19 | 58.27 | 0.20 | 0.00 | 0.00 | 0.16 | — |
| 42 | 52.92 | 8.23 | 3.60 | 0.00 | 0.21 | 78% |
| 67 | 35.95 | 69.41 | 17.77 | 0.63 | 0.25 | 134% |
| 93 | 26.40 | 92.50 | 31.13 | 3.10 | 0.76 | 138% |
| 114 | 14.39 | 121.79 | 44.71 | 8.18 | 2.44 | 142% |
| 138 | 6.71 | 164.11 | 50.85 | 13.05 | 3.86 | 160% |
| 162 | 1.16 | 168.14 | 67.42 | 17.04 | 4.98 | 162% |
| TABLE 12 |
| Autotrophic fermentation of C. autoethanogenum. |
| Autotrophic culture (syngas headspace) |
| Concentration (mM) |
| 2,3- | Carbon | |||||
| Hour | Fructose | Acetate | Ethanol | Butanediol | Lactate | yield* |
| 0 | 0.00 | 0.00 | 0.00 | 0.00 | 0.16 | — |
| 25 | 0.00 | 1.84 | 0.00 | 0.00 | 0.13 | — |
| 41 | 0.00 | 8.24 | 1.48 | 0.00 | 0.13 | — |
| 65 | 0.00 | 41.96 | 6.72 | 0.21 | 0.04 | — |
| 90 | 0.00 | 38.55 | 10.56 | 0.30 | 0.13 | — |
| 113 | 0.00 | 39.52 | 12.44 | 0.31 | 0.13 | — |
| 138 | 0.00 | 37.94 | 19.51 | 0.69 | 0.20 | |
| 164 | 0.00 | 25.02 | 39.80 | 3.27 | 0.55 | — |
| 185 | 0.00 | 69.78 | 26.19 | 5.00 | 0.13 | — |
| 209 | 0.00 | 72.45 | 25.86 | 5.12 | 0.12 | — |
| 233 | 0.00 | 67.61 | 32.90 | 5.29 | 0.19 | — |
| *Carbon yield cannot be determined for autotrophic fermentations because there is no sugar substrate. |
| TABLE 13 |
| Heterotrophic fermentation of C. acetobutylicum. |
| Heterotrophic culture (10 g/l fructose with N2 headspace) |
| Concentration (mM) |
| Glucose/ | Carbon | |||||||
| Hour | Fructose | Acetate | Butyrate | Ethanol | Butanol | Lactate | Acetoin | yield |
| 0 | 90.97 | 3.31 | 0.65 | 0.00 | 0.00 | 0.4 | 0.00 | — |
| 12 | 67.88 | 10.99 | 13.06 | 2.21 | 0.36 | 4.20 | 2.19 | 66% |
| 24 | 47.06 | 16.84 | 24.02 | 2.55 | 1.73 | 10.10 | 1.95 | 64% |
| 48 | 47.13 | 17.00 | 23.74 | 2.34 | 2.09 | 10.09 | 2.46 | 65% |
The results for the two acetogens exemplify the non-additive, i.e., synergistic nature of the mixotrophic fermentation. Combining the heterotrophic fermentation broth with the autotrophic fermentation broth, the mixotrophic fermentation broth is not achieved. For example, adding the endpoints of heterotrophic and autotrophic for C. ljungdahlii, the molar ratios of acetate, ethanol, 2,3-butanediol, and lactate are: 0.80, 0.18, 0.02, and 0.003, respectively. In comparison, the ratios for mixotrophic fermentation are 0.88, 0.06, 0.05, and 0.01, respectively. The fraction of both 2,3-butanediol and lactate increase, while the fraction of ethanol decreases. The same is true for C. autoethanogenum.
Additionally, the carbon efficiencies under mixotrophic fermentation demonstrate that both sugar and gases are being metabolized, since the efficiencies are >100%. Even under heterotrophic conditions for the two acetogens, the carbon efficiencies are greater than the theoretically possible 67%, demonstrating that some of the evolved CO2 from glycolysis is being metabolized into bioproducts. In comparison, the carbon efficiencies for C. acetobutylicum are only ˜65%, which is the maximum without being able to metabolize CO2.
To further demonstrate concurrent gas and sugar utilization, the acetogens Clostridium ljungdahlii DSM 13528 and Clostridium autoethanogenum DSM 10061 were again cultured under mixotrophic conditions: 10 g/l of fructose (first feedstock) with a headspace of the gas mixture of CO, CO2, H2, and N2 (55%, 10%, 20%, 15%, respectively) (second feedstock) at 30 psig. In this case though, both CO and CO2 were labeled with 13C, allowing the quantification of the amount of gas metabolized versus the amount of sugar, labeled with 12C, is metabolized. As a control, an autotrophic culture was also prepared with the 13C-labeled syngas at 30 psig. Two biological replicates for each strain were prepared, grown at 37° C. and shaken at 200 rpm.
FIG. 2 and FIG. 3 show the percentage of 13C labeling of the metabolite acetate over time under mixotrophic conditions in C. ljungdahlii and C. autoethanogenum, respectively.
For C. ljungdahlii, between 73% to 80% of acetate, the primary metabolite, exhibited 13C-labeling over the course of the fermentation. Even at the earliest time point (t=24 hr), when there is still 10.5 g/l fructose present in the media, over 70% of acetate was derived from the labeled syngas rather than fructose. The majority of growth occurred during the first 72 hours. After which, the low pH of the culture begins to inhibit growth. C. autoethanogenum displayed a similar 13C-incorporation profile, with over 50% of acetate being labeled with 13C even at 24 hr. In addition to acetate, C. autoethanogenum also produces ethanol, so that the pH does not drop as quickly, which allowed the culture consume the majority of fructose. The method for quantification of 13C-labeling prevents quantification of 13C-labeled ethanol.
The acetone strain created in Example 5 was grown on standard PETC medium with 5 g/l of fructose and with different amounts of H2 in the headspace: 0%, 20% or 40% (in triplicate). As seen in FIG. 4, increasing the amount of H2 in the headspace led to an increase in total carbon metabolized and converted into bioproducts. Carbon yield is the amount of carbon in the produced bioproducts divided by the amount of carbon metabolized.
The product distributions of these cultures shows that almost all CO2 is metabolized into bioproducts.
FIG. 5 shows distributions of the bioproducts produced by the acetone strain grown with increasing amounts of H2 in the headspace. Carbon fraction is the amount of carbon in each bioproduct with the total being 1.0.
In addition to metabolizing almost all the CO2, the increased reductant in the headspace led to an increased production of reduced products, particularly ethanol.
A plasmid was constructed to overexpress a glucose-specific EIIABC gene from C. acetobutylicum ATCC 824 (CA_C0570). This plasmid was transformed into C. ljungdahlii DSM 13528 to make the strain Clj (pCAC-EIIABC). Four biological replicates of this strain were grown in 10 ml of PETC medium with 5 g/l of fructose and thiamphenicol (5 μg/ml). Once the cultures reached an OD600 of 1.0, the cells were harvested, resuspended in 10 ml of PETC medium without any carbon source, and 1 ml (10% inoculum) was transferred to new tubes of 10 ml of PETC medium with 10 g/l of glucose and thiamphenicol (5 μg/m1). The average metabolite profile of these glucose-grown cultures is shown in Table 16.
| TABLE 16 | |||
| Glucose | Rate of | ||
| metabo- | consumption | ||
| Concentration (g/l) | lized | (g/hr/ |
| Day | Glucose | Fructose | Acetate | Ethanol | (g/l) | g cell mass) |
| 0 | 9.19 | 0.00 | 0.05 | 0.70 | — | — |
| 3 | 7.59 | 0.00 | 2.95 | 0.17 | 1.60 | 0.07 |
| 7 | 6.05 | 0.00 | 4.42 | 0.19 | 3.15 | 0.05 |
| 11 | 5.41 | 0.00 | 5.28 | 0.19 | 3.78 | 0.02 |
After 11 days, the average amount of glucose consumed was 3.78 g/l. A plasmid control culture metabolized no glucose over this same time period. The strains also metabolized some ethanol from the antibiotic (˜0.5 g/l), the majority of the carbon metabolized was glucose. The maximum rate of metabolism of glucose was 0.07 g/hr/g cell mass. This was calculated between Days 0 and 3, after the cultures reached their maximum cell density (OD600 1.0).
A plasmid was constructed to overexpress a glucose-specific EIIABC gene from C. saccharobutylicum DSM 13864 (CLSA_c10070). This plasmid was transformed into C. ljungdahlii DSM 13528 to make the strain Clj (pCSB-EIIABC). Four biological replicates of this strain were grown in 10 ml of PETC medium with 5 g/l of fructose and thiamphenicol (5 μg/ml). Once the cultures reached an OD600 of 1.0, the cells were harvested, resuspended in 10 ml of PETC medium without any carbon source, and 1 ml (10% inoculum) was transferred to new tubes of 10 ml of PETC medium with 10 g/l of glucose and thiamphenicol (5 μg/ml). The average metabolite profile of these glucose-grown cultures is shown in Table 17.
| TABLE 17 | |||
| Glucose- | Rate of | ||
| metabo- | consumption | ||
| Concentration (g/l) | lized | (g/hr/g cell |
| Day | Glucose | Fructose | Acetate | Ethanol | (g/l) | mass) |
| 0 | 9.15 | 0.00 | 0.04 | 0.68 | — | — |
| 3 | 8.69 | 0.00 | 1.79 | 0.11 | 0.47 | 0.02 |
| 7 | 6.82 | 0.00 | 3.82 | 0.15 | 2.33 | 0.06 |
| 11 | 5.68 | 0.00 | 5.16 | 0.14 | 3.47 | 0.04 |
After 11 days, the average amount of glucose metabolized was 3.47 g/l. A plasmid control culture metabolized no glucose over this same time period. The strains also metabolized some ethanol from the antibiotic (˜0.5 g/l), but as in Example 11, the majority of the carbon metabolized was glucose. The maximum rate of metabolism of glucose was 0.06 g/hr/g cell mass. This was calculated between Days 3 and 7, after the cultures reached their maximum cell density (OD600≈1.0).
Wild-type C. ljungdahlii does not produce crotyl alcohol. Wild-type C. ljungdahlii was therefore engineered to produce crotyl alcohol. A plasmid, called pTHCA, over expressing the genes thl (CA_C2783), hbd (CA_C2708), crt (CA_C2712), and adhEl (CA_P0162) was transformed into strain C. ljungdahlii DSM 13528.
C. ljungdahlii DSM 13528 [WT] and C. ljungdahlii (pTHCA) [Clj (pTHCA)] were then grown in standard PETC medium with 5 g/l of fructose anaerobically at 37° C. for 6 days. Metabolite concentrations are presented in Table 18.
| TABLE 18 |
| End point metabolite concentrations of crotyl alcohol |
| producing strains of C. ljungdahlii. |
| Concentration of crotyl alcohol | ||
| Strain | (mg/l) | |
| WT | 0.0 | |
| Clj (pTHCA) | 40.6 | |
As can be seen from Table 18, C. ljungdahlii was genetically engineered to overexpress thl, hbd, crt, and adhEl, and thereby exhibited the ability to produce at least 40.6 mg/l of crotyl alcohol under the appropriate fermentation conditions.
1. A mixotrophic fermentation method comprising
(i) providing an isolated naturally acetogenic organism;
(ii) providing a first feedstock and a second feedstock wherein said first feedstock comprises a carbon source that is metabolized by the native form of the organism at a rate of less than 0.01 g/hr/g cell mass; and wherein said second feedstock comprises CO, CO2, carbonate, bicarbonate, H2, glycerol, methanol, formate, urea or a combination thereof; and
(iii) culturing said organism in a fermentation medium, whereby both feedstocks are metabolized and a fermentation broth is formed, which broth comprises at least one bioproduct.
2. A method according to claim 1, wherein the method yields a greater amount of the at least one bioproduct than the combined amounts of the at least one bioproduct produced by heterotrophic and autotrophic fermentation with the same organism under the same conditions.
3. A method according to claim 1, comprising production of at least one bioproduct and acetic acid as a second bioproduct, wherein the amount of acetic acid produced per biomass unit weight is less than about 50% of that produced in autotrophic fermentation with the same organism under the same conditions.
4. A method according to claim 1, wherein the carbon yield, based on the total amount of carbon in produced bioproducts divided by the total amount of carbon metabolized from said first feedstock, is at least 50%.
5. A method according to claim 1, wherein the 13C/12C isotope ratio of the carbon present in the bioproduct is less than that of atmospheric CO2.
6. A method according to claim 1, wherein said carbon source is selected from carbohydrates, glycerol, methanol, or a combination thereof.
7. A method according to claim 1, wherein said organism is Clostridia.
8. A method according to claim 1, wherein said organism is genetically modified.
9. A method according to claim 1, wherein said first feedstock and said second feedstock are present in the fermentation medium at the same time.
10. A method according to claim 1, wherein said fermentation medium comprises a carbohydrate and at least one of CO, CO2, and hydrogen.
11. A method according to claim 1, wherein said fermentation medium comprises a steel mill produced CO composition.
12. A method according to claim 1, wherein the culturing is performed in whole or in part at a super-atmospheric pressure.
13. A method according to claim 1, wherein said bioproduct is selected from the group consisting of even numbered primary alcohols, odd numbered secondary alcohols, organic acids of less than 7 carbons, C3 compounds, C4 compounds, and mixtures thereof.
14. A method according to claim 1, wherein said bioproduct is selected from the group consisting of acetic acid, acetone, propionic acid, butyric acid, hexanoic acid, 3-hydroxypropionic acid, 3-hydroxybutyric acid, crotonic acid, acetoacetic acid, lactic acid, 2-hydroxyisobutyric acid, 3-methylbutanoic acid, ethanol, butanol, crotyl alcohol, hexanol, acetone, isopropanol, 2,3-butanediol, acetoin, 1,3-propanediol, and combinations thereof.
15. A method according to claim 1, wherein said bioproduct is non-naturally occurring.
16. A method according to claim 1, wherein said broth comprises a first bioproduct and a second bioproduct, wherein said first bioproduct is selected from the group consisting of acetoacetic acid, acetone, isopropanol, 3-hydroxybutyric acid, 2-hydroxyisobutyric acid, and combinations thereof, said second bioproduct is selected from the group consisting of ethanol, butanol, crotyl alcohol, hexanol, and combinations thereof, and the molar ratio between said first bioproduct and said second bioproduct is in the range from 0.1 to 0.95.
17. A method according to claim 1, wherein said second feedstock comprises CO, CO2, carbonate, bicarbonate, methanol, or a combination thereof; and wherein the 13C/12C isotope ratio of the carbon present in said second feedstock is less than that of atmospheric CO2.
18. A method according to claim 1, comprising providing said fermentation medium with a mixture of CO2 and hydrogen at a molar ratio in the range from 1:0.1 to 1:5.
19. A method according to claim 18, further comprising steam reforming of a hydrocarbon to form said mixture of CO2 and hydrogen.
20. A method according to claim 1, wherein the first feedstock comprises a sugar selected from glucose and sucrose, and the organism metabolizes CO2 produced on metabolizing the sugar.
21. A method according to claim 1, wherein the first feedstock comprises a sugar selected from glucose and sucrose, the second feedstock comprises at least one of H2 and methanol, and the organism metabolizes CO2 produced on metabolizing the sugar.
22. A method according to claim 1, wherein said at least one bioproduct is acetone.
23. A method according to claim 22, wherein the first feedstock comprises a sugar selected from glucose and sucrose, and the organism metabolizes CO2 produced on metabolizing the sugar.
24. A method according to claim 1, wherein said at least one bioproduct is butyric acid.
25. A method according to claim 24, wherein the first feedstock comprises a sugar selected from glucose and sucrose, and the organism metabolizes CO2 produced on metabolizing the sugar.
26. A method according to claim 1, wherein said at least one bioproduct is isopropanol.
27. A method according to claim 26, wherein the first feedstock comprises a sugar selected from glucose and sucrose, and the organism metabolizes CO2 produced on metabolizing the sugar.
28. A method according to claim 1, wherein the metabolizing of the first feedstock does not inhibit the metabolizing of the second feedstock.
29. A method according to claim 1, wherein the first feedstock comprises a non-preferred sugar and wherein said second feedstock comprises CO, CO2, carbonate, bicarbonate, H2, glycerol, methanol, formate, urea or a combination thereof.
30. A mixotrophic fermentation method comprising
(i) providing an isolated naturally acetogenic organism;
(ii) providing a fermentation medium comprising a first feedstock and a second feedstock wherein said first feedstock comprises a carbon source that is metabolized by the native form of the organism at a rate of less than 0.01 g/hr/g cell mass; and
(iii) culturing said organism in said fermentation medium, whereby both feedstocks are metabolized and acetic acid is formed,
wherein the amount of acetic acid produced per biomass unit weight is less than about 50% of that produced in autotrophic fermentation with the same organism under the same conditions.
31. A mixotrophic fermentation method comprising
(i) providing an isolated naturally acetogenic organism that has been genetically modified;
(ii) providing a fermentation medium comprising a first feedstock and a second feedstock wherein said first feedstock comprises a sugar that is metabolized by the native form of the organism at a rate of less than 0.01 g/hr/g cell mass; and
wherein said second feedstock comprises CO, CO2, carbonate, bicarbonate, H2, glycerol, methanol, formate, urea or mixtures thereof; and
(iii) culturing said organism in said fermentation medium, whereby both feedstocks are metabolized and a fermentation broth is formed, which broth comprises at least one bioproduct.