Patent application title:

METHOD FOR REJUVENATING CELLS

Publication number:

US20160376560A1

Publication date:
Application number:

15/262,031

Filed date:

2016-09-12

Abstract:

The invention relates to a method for reprogramming cells from aged donors or senescent cells to pluripotent cells that have lost marks of senescence. In particular, the invention relates to an ex vivo method for preparing induced pluripotent stein cells (iPSCs) from a target cell population comprising cells from aged donors or senescent cells, said method comprising the steps of culturing said target cell population under appropriate conditions for reprogramming said cells into iPSCs, wherein said appropriate conditions comprises increasing expression in said target cells, of at least the following reprogramming factors: Oct4, Klf4, Sox2, Myc, Lin28 and, optionally Nanog.

Inventors:

Assignee:

Interested in similar patents?

Get notified when new applications in this technology area are published.

Classification:

C12N5/0696 »  CPC main

Undifferentiated human, animal or plant cells, e.g. cell lines; Tissues; Cultivation or maintenance thereof; Culture media therefor; Animal cells or tissues; Human cells or tissues; Vertebrate cells Artificially induced pluripotent stem cells, e.g. iPS

C12N2501/602 »  CPC further

Active agents used in cell culture processes, e.g. differentation; Transcription factors Sox-2

C12N2501/603 »  CPC further

Active agents used in cell culture processes, e.g. differentation; Transcription factors Oct-3/4

C12N2501/604 »  CPC further

Active agents used in cell culture processes, e.g. differentation; Transcription factors Klf-4

C12N2501/605 »  CPC further

Active agents used in cell culture processes, e.g. differentation; Transcription factors Nanog

C12N2501/606 »  CPC further

Active agents used in cell culture processes, e.g. differentation; Transcription factors c-Myc

C12N2501/608 »  CPC further

Active agents used in cell culture processes, e.g. differentation; Transcription factors Lin28

Description

FIELD OF THE INVENTION

The invention relates to a method for reprogramming cells from aged donors or senescent cells to pluripotent cells that have lost marks of senescence. In particular, the invention relates to an ex vivo method for preparing induced pluripotent stem cells (iPSCs) from a target cell population from aged donors or senescent cells, said method comprising the steps of culturing said target cell population under appropriate conditions for reprogramming said cells into iPSCs, wherein said appropriate conditions comprises increasing expression in said target cells, of at least the following combination of reprogramming factors: Oct4, Klf4, Sox2, c-Myc, Lin28 and, optionally Nanog.

BACKGROUND OF THE INVENTION

The discovery of induced Pluripotent Stem Cells (iPSCs) by S. Yamanaka1,2, and very rapid progress in iPSC technology have opened up a new avenue in autologous regenerative medicine, whereby patient-specific pluripotent cells could potentially be derived from adult somatic cells. iPSCs have been reproducibly obtained in different cell types by forced expression of the OCT4, SOX2, c-MYC and KLF4 transcription factor cocktail or by an alternative combination of factors, substituting KLF4 and c-MYC by NANOG and LIN283.

Cellular senescence is linked to physiological aging, and is characterized by a stable cell cycle arrest in response to various forms of stress stimuli, including oncogene activation or extremely shortened telomeres called replicative senescence9,10. A common feature is the activation of the p53/p21CIP1 and pRb/p16INK4A tumor suppressor pathways in these cells, associated with alteration of morphology, increase in senescence-associated β-galactosidase (SA-β-Gal) activity, a specific SA secretome (SASP) and formation of senescence-associated heterochromatic foci (SAHF), which are thought to be involved in repression of genes that promote cell division11.

EP 2 096 169 discloses a process for generating induced pluripotent stem cells from somatic cells, comprising the step of introducing the following six genes: Oct family gene, Klf family gene, Sox family gene, Myc family gene, Lin28 and Nanog into somatic cells. However, this specific combination of reprogramming factors has never been applied to senescent cells or cells from aged donors.

It has been recently described by several groups, that cellular senescence is a barrier to reprogramming, due to up-regulation of p53, p16INK4A, and p21CIP1, suggesting that cellular aging might be an important limitation of this technology. Accordingly, ablation of different senescence effectors has been proposed as a potential solution to improve the efficiency of iPSCs generation4-8.

WO 2011/016588 suggests using functional inhibitors of p53 together with a cocktail of reprogramming factors consisting of Oct3/4, Sox2, Klf4, L-myc and Lin28. p53 shRNA were used as functional inhibitors of p53.

The inventors have now shown that using the specific combination of the six factors OCT4, NANOG, SOX2, KLF4, c-MYC and LlN28 allows efficient reprogramming of both proliferative centenarian and senescent fibroblasts into human iPSCs, without the need of ablating senescence effectors, contrary to the technical prejudice in the art related to reprogramming of senescent cells.

Moreover, the inventors showed that this reprogramming restores telomere size, gene expression profile, oxidative stress and mitochondrial metabolism as observed in human embryonic stem cells (hESCs). Surprisingly, iPSCs derived from aged and senescent cells do not retain detectable marks of the cellular aging phenotype, and are indistinguishable from hESCs. Finally, iPSCs re-differentiated into fibroblasts exhibit an increased potential to proliferate, and gene expression profile equivalent to young proliferative fibroblasts, demonstrating that the reprogramming strategy according to the present invention erases the hallmarks of the cellular aging phenotype, defining a new method to produce rejuvenated cells.

To the applicant's knowledge, the invention is the first description of a method for producing iPSCs with cells from aged donors or senescent cells, therefore the invention may be highly useful in particular in autologous regenerative medicine, whereby patient-specific pluripotent cells could potentially be derived from adult aged or senescent somatic cells, and will also find numerous applications in the research field. Moreover, the invention is useful as a general method to rejuvenating senescent cells or cells from aged donors, either in vitro or in vivo.

SUMMARY OF THE INVENTION

A first aspect of the invention relates to an ex vivo method for preparing induced pluripotent stem cells (iPSCs) from a target cell population comprising cells from aged donors or senescent cells or cells overexpressing p16INK4A or p21CIP senescence effectors, said method comprising the steps of:

    • a) providing said target cell population comprising cells from aged donors or senescent cells or cells overexpressing p16INK4A or p21CIP senescence effectors, and,
    • b) culturing said target cell population under appropriate conditions for reprogramming said target cell population into iPSCs, wherein said appropriate conditions comprises increasing expression in said target cell population of at least the following combination of reprogramming factors:
      • i. a reprogramming factor encoded by one gene of the Oct family gene,
      • ii. a reprogramming factor encoded by one gene of the Klf family gene,
      • iii. a reprogramming factor encoded by one gene of the Sox family gene,
      • iv. a reprogramming factor encoded by one gene of the Myc family gene, and
      • v. Lin28,
      • vi. and, optionally, Nanog.

In a preferred embodiment, said appropriate conditions comprise increasing expression in said target cell population of the following reprogramming factors: Oct4, Klf4, Sox2, c-Myc (or L-myc), Lin28 and, optionally Nanog. In a related embodiment, said appropriate conditions comprise increasing expression in said target cell population of the following reprogramming factors: Oct4, Klf4, Sox2, c-Myc (or L-myc), Lin28 and Nanog.

The inventors have shown that marks of senescence can be fully erased by the method of the invention. Thus, advantageously, the target cell population may be selected from cell population comprising adult somatic cells from aged donors or senescent cells such as senescent fibroblasts, or from any kind of cells harboring aged or senescent associated physiology, like premature aging syndrome,. In one specific embodiment, the target cell population is a human cell population obtained from an adult subject being at least 50 years old, with apparently no limits in aged as a 101 years old donor cell population was efficiently reprogrammed with this strategy, for example at least 60, 70, 80, 90, or 100 years old, for example in need of regenerative autologous cell therapy. Advantageously, the method may not comprise any step of direct silencing of senescence effectors, such as p21CIP1 and/or p16INK4a and or p53. In particular, the method may not comprise any use of functional inhibitors of p53, such as p53 shRNA.

In one embodiment, conditions for increasing expression of the reprogramming factors listed above comprise either

    • (a) introducing one or more expression vectors comprising the coding sequences of said reprogramming factors; or,
    • (b) directly delivering an effective amount of each reprogramming factor or their precursor RNA,
    • into said target cell population.

In one specific embodiment, the method of the invention comprises the step of transfecting said target cell population with a combination of viral vectors, each viral vector comprising the coding sequence of each of the reprogramming factors, Oct4, Klf4, Sox2, c-Myc (or L-myc), Lin28 and, optionally, Nanog.

The invention further relates to the induced pluripotent stem cells obtainable by the method described above, in particular to induced pluripotent stem cells obtainable by the method and obtained from aged or senescent cells.

The invention further relates to an in vitro method for rejuvenating cells from aged donors or senescent cells comprising reprogramming said cells from aged donors or senescent cells to induced pluripotent stem cells, by increasing expression in said cells from aged donors or senescent cells of at least a combination of the following reprogramming factors:

    • i. a reprogramming factor encoded by one gene of the Oct family gene,
    • ii. a reprogramming factor encoded by one gene of the Klf family gene,
    • iii. a reprogramming factor encoded by one gene of the Sox family gene,
    • iv. a reprogramming factor encoded by one gene of the Myc family gene, and,
    • v. Lin28,
    • vi. and, optionally, Nanog.

The invention further relates to a composition for in vivo use in rejuvenating cells from aged donors or senescent cells in a subject in need thereof, said composition comprising means for increasing expression of the following reprogramming factors Oct4, Klf4, Sox2, c-Myc, Lin28 and, optionally, Nanog into said aged or senescent cells.

In one embodiment, said means for increasing expression of said reprogramming factors comprise a combination of Oct4 protein, Klf4 protein, Sox2 protein, c-Myc protein, Lin28 protein and, optionally, Nanog protein, wherein each protein is associated to appropriate means for delivery of said protein into the nucleus of the cells to be rejuvenated.

Alternatively, said means for increasing expression of said reprogramming factors may comprise a combination of Oct4 precursor RNA, Klf4 precursor RNA, Sox2 precursor RNA, c-Myc precursor RNA, Lin28 precursor RNA and, optionally, Nanog precursor RNA, wherein each precursor RNA is associated to appropriate means for delivery of each precursor RNA into the cytoplasm of the cells to be rejuvenated.

The compositions of the invention as described above may advantageously be suitable for topical application.

DETAILED DESCRIPTION OF THE INVENTION

A first aspect of the invention relates to an ex vivo method for preparing induced pluripotent stem cells (iPSCs) from a target cell population comprising cells from aged donors or senescent cells or cells overexpressing p16INK4A or p21CIP senescence effectors, said method comprising the steps of:

    • a) providing said target cell population comprising cells from aged donors or senescent cells or cells overexpressing p16INK4A or p21CIP senescence effectors, and,
    • b) culturing said target cell population under appropriate conditions for reprogramming said target cell population into iPSCs, wherein said appropriate conditions comprises increasing expression in said target cell population, of at least the following combination of reprogramming factors:
      • i. a reprogramming factor encoded by one gene of the Oct family gene,
      • ii. a reprogramming factor encoded by one gene of the Klf family gene,
      • iii. a reprogramming factor encoded by one gene of the Sox family gene,
      • iv. a reprogramming factor encoded by one gene of the Myc family gene, and,
      • v. Lin28, and, optionally,
      • vi. Nanog.

As used herein, the term “pluripotent” refers to cells with the ability to give rise to progeny that can undergo differentiation, under appropriate conditions, into cell types that collectively exhibit characteristics associated with cell lineages from the three germ layers (endoderm, mesoderm, and ectoderm). Pluripotent stem cells can contribute to tissues of a prenatal, postnatal or adult organism. A standard art-accepted test, such as the ability to form a teratoma in 8-12 week old SCID mice, can be used to establish the pluripotency of a cell population. However, identification of various pluripotent stem cell characteristics can also be used to identify pluripotent cells.

More specifically, human pluripotent stem cells may express at least some, and optionally all, of the markers from the following non-limiting list: SSEA-3, SSEA-4, TRA-I -60, TRA-I-81, TRA-2-49/6E, ALP, Sox2, E-cadherin, UTF-I, Oct4, Lin28, Rexl, and Nanog.

As used herein, the term “induced pluripotent stem cell” refers to a pluripotent stem cell artificially derived from a non-pluripotent cell. A non-pluripotent cell can be a cell of lesser potency to self-renew and differentiate than a pluripotent stem cell. Cells of lesser potency can be, but are not limited to, somatic stem cells, tissue specific progenitor cells, primary or secondary cells. One remarkable advantage of the present method is that it enables the production of induced pluripotent stem cells from any somatic cells, including aged or senescent cells, previously believed as non inducible to pluripotency due to their aging phenotype.

The term “reprogramming” refers to the process of changing the fate of a target cell into that of a different cell type, caused by the expression of a small set of factors (or reprogramming factors) in the target cells. For example, methods for reprogramming fibroblast cells to induced pluripotent stem cells by expressing ectopically Oct3/4, Sox2, c-myc and Klf4 have been described by Takahashi and Yamanaka, 20061.

Accordingly, a “reprogramming factor” is a factor, for example, it may be a transcription factor, which can be used to reprogram a target cell. The term “reprogramming factor” further includes any analogue molecule that mimics the function of the factor with respect to reprogramming capacity.

The target Cell Population for Use in the Method of the Invention

The target cell population for use in the method of the present invention is advantageously a cell population comprising either cells from aged donors or senescent cells or cells overexpressing p16INK4A or p21CIP senescence effectors. These cells may be obtained from living of frozen tissues of animals.

The term “senescent cells” refers to cells that exhibit cell cycle arrest, generally during the G1 transition of the cell cycle or in few cases in G2, elicited by replicative exhaustion due to telomere attrition or in response to stresses such as DNA damage, chemotherapeutic drugs, or aberrant expression of oncogenes. This arrest is implemented primarily through activation of p53 and the up-regulation of the cyclin-dependent kinase (CDK) inhibitors p16INK4a and p21CIP1 (Collado et al. 2007, Cell, 130: 223-233).

“Senescent cells” may be characterized by at least one or more of the following characteristics:

    • activation of the p53/p21CIP1 and pRb/p16INK4A tumor suppressor pathways (hereafter referred as senescence effectors),
    • cells arrested irreversibly in G1,
    • shortening of telomere size,
    • expression of senescent-associated β-galactosidase activity (SA β-Gal),
    • Specific chromatin modification as senescence-associated heterochromatic foci (SAHF),
    • Specific secretome,
    • reduced/altered overall mitochondrial activity.

Irreversible cell arrest in G1 may be assessed by FACS as described in Matsuura et al25 and briefly summarized below:

To analyze the cell cycle, trypsinized cells are fixed with cooled 70% EtOH during at least 15 min at 4° C. Fixed cells are centrifuged and resuspended in PBS before staining with Propidium Iodide (10 βg/ml) plus RNase A (250 Οg/m) during 30 min and analysis by flow cytometry, using for example a FacsCalibur II (BD Biosciences).

Shortening of telomere size may be characterized by evaluating the mean terminal restriction fragment (TRF) length for example by Southern blot analysis, for example as described in the Examples below.

A method for detecting expression of senescent-associated β-galactosidase activity (SA β-Gal) is described in Matsuura et al25 and briefly summarized below: Cell cultures are stained as described (Dimri et al. Proc Natl Acad Sci USA. 1995 Sep 26;92(20):9363-7). Briefly, cells are washed with phosphate-buffered saline (PBS) and fixed with 1% paraformaldehyde for 3 minutes at roomvtemperature, then washed three times with PBS for 5 minutes each at room temperature. Staining is performed overnight in a non-CO2 enriched incubator at 37° C. using a solution pH 6 containing 40 mM sodium phosphate (dibasic), 40 mM citric acid, 150mM NaCl, 2 mM MgCl2, 5 mM potassium ferrocyanide, 5 mM potassium ferricyanide, 1 mg/ml X-gal (5-bromo-4-chloro-3-indolyl-b-D-galactoside, Pierce Chemical Co., Rockford, Ill). Cyanide salts and X-gal are added from freshly made 100 X_stocks in PBS and dimethylformamide, respectively. Cells are then washed three times with PBS for 5 minutes each at room temperature, before microscopic examination and photography.

A method for detecting expression of senescence-associated heterochromatic foci (SAHF) by indirect immunofluorescence is described in the Examples below.

Overall mitochondrial activity can be evaluated by measuring the transmembrane potential generated by the proton gradient. A method for measuring this parameter using the cationic dye JC-1 is for example described in the Examples below.

Cells from aged donors comprise a number of proliferative cells that exhibit certain characteristics of senescent cells, in particular

    • upregulation of the tumor suppressors p16INK4a and p21CIP1 (hereafter referred as senescence effectors) .
    • decreased ability to proliferate,
    • global genome CpG hypomethylation,
    • unscheduled heterochromatinization.

Upregulation of the tumor suppressors p16 INK4a and p21CP1 can be observed using usual techniques in the Art for measuring protein expression and/or mRNA expression, for example, Western Blot, Northern Blot or Real-Time PCR. Upregulation is observed when significant higher expression of p16INK4a and p21CIP1 is observed in the test cells compared to controlled (non senescent) cells, for example embryonic stem cells.

The inventors have shown that proliferative and senescent cells from aged donors (more than 70 yeasr old) have a different signature, for example in terms of gene expression or metabolism, from cells of young donors. The iPSCs obtained according to the method have a signature that is closer to the embryonic stem cells and distinguish in that respect with iPSCs obtained with the conventional cocktail of 4 reprogramming factors OCT4, SOX2, c-MYC and KLF4.

To applicant's knowledge, the method of the invention comprising the use of a combination of at least 5, preferably 6 specific reprogramming factors is the only method described in the art for generating induced pluripotent stem cells from senescent cells or cells of aged donors. Accordingly, the method of the invention is particularly useful for cell population susceptible to contain senescent cells in a high proportion.

In one preferred embodiment of the method of the invention, said target cell population comprises at least 10%, 20%, 30%, 40% or at least 50% of the cells displaying at least one or more (or all) of the following characteristics of the aging phenotype:

    • upregulation of the tumor suppressors p16INK4a and p21CIP1 (hereafter referred as senescence effectors),
    • cells arrested irreversibly in G1,
    • expression of senescent-associated β-galactosidase activity (SA β-Gal),
    • expression of senescence-associated heterochromatic foci (SAHF),
    • altered overall mitochondrial activity.

In another specific embodiment, said target cell population are cells, such as dermal cells or fibroblast cells, obtained from an adult subject being at least 50 years old, for example at least 60, 70, 80, 90 or at least 100 years old.

Such target cell population may be obtained from mammal species, and preferably from rodent, primate or human species, more preferably from human species.

The target cell population may be obtained from various tissues, preferably from a human aged patient in need of autologous regenerative treatment.

Methods to obtain samples from various tissues and methods to establish primary cells are well-known in the art (see e.g. Jones and Wise, Methods Mol Biol. 1997).

In one specific embodiment, said target cell population is obtained from primary cells from blood, bone marrow, adipose tissue, skin, hair, skin appendages, internal organs such as heart, gut or liver, mesenchymal tissues, muscle, bone, cartilage or skeletal tissues.

The Combination of Reprogramming Factors for Use in Rejuvenating or Generating iPSCs

One essential feature of the present invention is the use of the following combination of reprogramming factors for use in rejuvenating or inducing pluripotent stem cells from the target cell population:

    • i. a reprogramming factor encoded by one gene of the Oct family gene, preferably Oct4,
    • ii. a reprogramming factor encoded by one gene of the Klf family gene, preferably Klf4,
    • iii. a reprogramming factor encoded by one gene of the Sox family gene, preferably Sox2,
    • iv. a reprogramming factor encoded by one gene of the Myc family gene, preferably c-Myc,
    • v. Lin28, and, optionally,
    • vi. Nanog.

The combination of reprogramming factors for use in rejuvenating or inducing pluripotent stem cells from the target cell population such as senescent cells or cells from aged donors, may include for example the combination of the 5 reprogramming factors Oct4, Klf4, Sox2, c-Myc (or L-myc) and Lin28, or the 6 reprogramming factors Oct4, Klf4, Sox2, c-Myc (or L-myc), Lin28 and Nanog. In one preferred embodiment, no functional inhibitors of p53 are used.

As used, herein, a functional inhibitor of p53 is any substance capable of inhibiting either (a) the function of the p53 protein or (b) the expression of the p53 gene. Such substances are for example described in WO 2011/016588. Most specifically, the present method does not contain the use of any means for expressing siRNA or shRNA against p53 into the target cell population (e.g the senescent cells).

As used herein, the term “Oct family” refers to the family of octamer (“Oct”) transcription factors which play a crucial role in maintaining pluripotency. POU5F1 (POU domain, class 5, transcription factor 1) also known as Oct3/4 is one representative of Oct family. The absence of Oct3/4 in Oct-3/4+cells, such as blastomeres and embryonic stem cells, leads to spontaneous trophoblast differentiation, and presence of Oct-3/4 thus gives rise to the pluripotency and differentiation potential of embryonic stem cells. Exemplary Oct3/4 proteins are the proteins encoded by the murine Oct3/4 gene (Genbank accession number NM_013633) and the human Oct3/4 gene (Genbank accession number NM _002701)

The terms “Oct3/4”, “Oct4,” “OCT4,” “Oct4 protein,” “OCT4 protein” and the like thus refer to any of the naturally-occurring forms of the Octomer 4 transcription factor, or variants thereof that maintain Oct4 transcription factor activity (e.g. within at least 50%, 80%, 90% or 100% activity compared to wild type Oct4 as measured by methods known in the art). In some embodiments, variants have at least 90% amino acid sequence identity across their whole sequence compared to the naturally occurring Oct4 polypeptide. In other embodiments, the Oct4 protein is the protein as identified by the Genbank reference ADW77327.1.

As used herein, the term “Sox family” refers to Sox genes associated with maintaining pluripotency similar to Oct-3/4, although it is associated with multipotent and unipotent stem cells in contrast with Oct-3/4, which is exclusively expressed in pluripotent stem cells. While Sox2 was the initial gene used for induction1,3, other genes in the Sox family have been found to work as well in the induction process. Sox 1 yields iPSCs with a similar efficiency as Sox2, and genes Sox3, Sox15, and Sox 18 also generate iPSCs.

Exemplary Sox2 proteins are the proteins encoded by the murine Sox2 gene (Genbank accession number NM_011443) and the human Sox2 gene (Genbank accession number NM_003106).

The terms “Sox2,” “SOX2,” “Sox2 protein,” “SOX2 protein” and the like as referred to herein thus includes any of the naturally-occurring forms of the Sox2 transcription factor, or variants thereof that maintain Sox2 transcription factor activity (e.g. within at least 50%, 80%, 90% or 100% activity compared to wild type Sox2 as measured by methods known in the art). In some embodiments, variants have at least 90% amino acid sequence identity across their whole sequence compared to the naturally occurring Sox2 polypeptide. In other embodiments, the Sox2 protein is the protein as identified by the NCBI reference NP_003097.1.

As used herein, the term “Klf family” refers to Klf genes initially identified as a factor for the generation of mouse iPSCs and also demonstrated to be a factor for generation of human iPSCs. Exemplary Klf4 proteins are the proteins encoded by the murine klf4 gene (Genbank accession number NM_010637) and the human klf4 gene (Genbank accession number NM_004235).

The terms “KLF4,” “KLF4 protein” and the like as referred to herein thus includes any of the naturally-occurring forms of the KLF4 transcription factor, or variants thereof that maintain KLF4 transcription factor activity (e.g. within at least 50%, 80%, 90% or 100% activity compared to wild type KLF4 as measured by methods known in the art). In some embodiments, variants have at least 90% amino acid sequence identity across their whole sequence compared to the naturally occurring KLF4 polypeptide. In other embodiments, the KLF4 protein is the protein as identified by the NCBI reference NP_004226.3.

As used herein, factors of the Myc family refers to factors encoded by myc proto-oncogenes implicated in cancer. c-Myc was shown to be a factor implicated in the generation of mouse iPSCs and of human iPSCs. Exemplary c-Myc proteins are the proteins encoded by the murine c-myc gene (Genbank accession number NM_010849) and the human c-myc gene (Genbank accession number NM_002467). N-Myc or L-myc was also used as possible reprogramming factor replacing c-Myc

The terms “c-Myc,” C-MYC,” “c-Myc protein”, “C-MYC protein” and the like as referred to herein thus includes any of the naturally-occurring forms of the cMyc transcription factor, or variants thereof that maintain cMyc transcription factor activity (e.g. within at least 50%, 80%, 90% or 100% activity compared to wild type cMyc as measured by methods known in the art). In some embodiments, variants have at least 90% amino acid sequence identity across their whole sequence compared to the naturally occurring c-Myc polypeptide. In other embodiments, the c-Myc protein is the protein as identified by the NCBI reference NP_002458.2.

The term “Nanog” or “nanog” refers to a transcription factor critically involved with self-renewal of undifferentiated embryonic stem cells. In humans, this protein is encoded by the NANOG gene. Exemplary nanog is the protein encoded by murine gene (Genbank accession number XM13 132755) and human Nanog gene (Genbank accession number NM_024865).

The term “Nanog” or “nanog” and the like as referred to herein thus includes any of the naturally-ocurring forms of the Nanog transcription factor, or variants thereof that maintain Nanog transcription factor activity (e.g. within at least 50%, 80%, 90% or 100% activity compared to wild type Nanog as measured by methods known in the art). In some embodiments, variants have at least 90% amino acid sequence identity across their whole sequence compared to the naturally occurring Nanog polypeptide. In other embodiments, the Nanog protein is the protein as identified by the NCBI reference NP_079141.

The term “Lin28” or “Lin-28 homolog A” is a protein that is encoded by the LIN28 gene in humans. It is a marker of undifferentiated human embryonic stem cells and encodes a cytoplasmic mRNA-binding protein that binds to and enhances the translation of the IGF-2 (Insulin-like growth factor 2) mRNA. Lin28 has also been shown to bind to the let-7 pre-miRNA and block production of the mature let-7 microRNA in mouse embryonic stem cells. Yu et al. demonstrated that it is a factor in iPSCs generation, although it is not mandatory3. Exemplary Lin28 is the protein encoded by murine gene (Genbank accession number NM_145833) and human Lin28 gene (Genbank accession number NM_024674).

The term “Lin28” or “Lin28 homolog A” and the like as referred to herein thus includes any of the naturally-occurring forms of the Lin28 transcription factor, or variants thereof that maintain Lin28 transcription factor activity (e.g. within at least 50%, 80%, 90% or 100% activity compared to wild type Lin28 as measured by methods known in the art). In some embodiments, variants have at least 90% amino acid sequence identity across their whole sequence compared to the naturally occurring Lin28 polypeptide. In other embodiments, the Lin28 protein is the protein as identified by the NCBI reference NP_078950.

As used herein, the percent identity between the two amino-acid sequences is a function of the number of identical positions shared by the sequences (i.e., % identity=# of identical positions/total # of positions×100), taking into account the number of gaps, and the length of each gap, which need to be introduced for optimal alignment of the two sequences. The comparison of sequences and determination of percent identity between two sequences can be accomplished using a mathematical algorithm, as described below.

The percent identity between two amino-acid sequences can be determined using the algorithm of E. Meyers and W. Miller (Comput. Appl. Biosci., 4:11-17, 1988) which has been incorporated into the ALIGN program (version 2.0), using a PAM120 weight residue table, a gap length penalty of 12 and a gap penalty of 4.

The skilled person may select other corresponding reprogramming factors originating from other mammals, such as mice, rats, cows, horses, sheep, pigs, goats, camels, antelopes, and dogs. Advantageously the skilled person may select the corresponding reprogramming factor from the same species as the target cells used as starting material in the method of the invention.

The skilled person may also select analogues of one or more of the above reprogramming factors. As used herein the term “analogue” refers to a compound that has a different structure but provides the same result as the reprogramming factor for use in generating iPSCs, and can thus replace said reprogramming factor in a method for generating induced pluripotent stem cells.

For example, analogues of such reprogramming factors have been described in Wenlin Li and Sheng Ding. Trends in Pharmacological Sciences Volume 31, Issue 1, January 2010, Pages 36-45 or Feng et al. Cell Stem Cell. 2009 Apr 3;4(4):301-12 (see in particular analogues disclosed in Tables 1 and 2 of Feng et al., 2009).

Conditions for Increasing the Expression of Reprogamming Factor

Any conditions available in the art for increasing expression of a reprogramming factor can be used in the methods of the invention, as long as such conditions result in the presence of reprogramming factor in an appropriate amount for reprogramming said target cells to induced pluripotent stem cells.

Various methods for increasing expression of reprogramming factors have been described in the art. For a review, see Hanna J H, Saha K, Jaenisch R. Cell. 2010 Nov. 12; 143(4):508-25; or, Sheng Ding. Trends in Pharmacological Sciences Volume 31, Issue 1, January 2010, Pages 36-45; and, Feng et al. Cell Stem Cell. 2009 Apr. 3; 4(4):301-12.

In preferred embodiments, the following alternative may be used for increasing expression of the reprogramming factors:

    • (i) enhancing endogenous expression of the gene encoding said reprogramming factor,
    • (ii) allowing ectopic expression of said reprogramming factor by introducing an expression vector comprising a coding sequence of said reprogramming factor operably linked to control sequences into the target cell population, or
    • (iii) delivering into the cells an appropriate amount of said reprogramming factor or its precursor RNA.

In another embodiment, one or more expression vectors are used which comprise the coding sequence of the combination of reprogramming factors, for example, Oct4 coding sequence, Sox2 coding sequence, Klf4 coding sequence, c-Myc coding sequence, Lin28 coding sequence, and, optionally, Nanog coding sequence and/or coding sequences having at least 60%, 70%, 80%, 90% or 95% identity to the corresponding native coding sequences of Oct4, Sox2, Klf4, Lin28 and, optionally, Nanog.

As used herein, the term “coding sequence” relates to a nucleotide sequence that upon transcription gives rise to the encoded product. The transcription of the coding sequence in accordance with the present invention can readily be effected in connection with a suitable promoter. Preferably, the coding sequence corresponds to the cDNA sequence of a gene that gives rise upon transcription to a reprogramming factor.

The percent identity between two nucleotide sequences may be determined using for example algorithms such as the BLASTN program for nucleic acid sequences using as defaults a word length (W) of 11, an expectation (E) of 10, M=5, N=4, and a comparison of both strands.

Expression vectors for ectopic expression of the reprogramming factors may be, for example, plasmid vector, cosmid vector, bacterial artificial chromosome (BAC) vector, transposon-based vector (such as PiggyBac) or viral vector.

In one specific embodiment, the expression vectors used for increasing expression of said reprogramming factors are viral vectors. Examples of such viral vectors includes vectors originated from retroviruses such as HIV (Human Immunodeficiency Virus), MLV (Murine Leukemia Virus), ASLV (Avian Sarcoma/Leukosis Virus), SNV (Spleen Necrosis Virus), RSV (Rous Sarcoma Virus), MMTV (Mouse Mammary Tumor Virus), etc, lentivirus, Adeno-associated viruses, and Herpes Simplex Virus, but are not limited to.

Methods for generating induced pluripotent stem cells based on expression vectors encoding reprogramming factors have been described in the Art, see for example WO2007/69666, EP2096169-A1 or WO2010/042490.

Typically, the coding sequence of any reprogramming factors as used in the method of the invention, for example, Oct4 coding sequence, Sox2 coding sequence, Klf4 coding sequence, c-Myc coding sequence, Nanog coding sequence and/or Lin28 coding sequence, may be operably linked to control sequences, for example a promoter, capable of effecting the expression of the coding sequence in the target cell population. Such expression vector may further include regulatory elements controlling its expression, such as a promoter, an initiation codon, a stop codon, a polyadenylation signal and an enhancer. The promoter may be constitutive, or inducible. The vector may be self-replicable or may be integrated into the DNA of the host cell.

Alternatively, the vector for ectopic expression is a viral vector and viral particles are produced and used to introduce the coding sequence of said reprogramming factors into said target cell population comprising aged or senescent cells. The term <<viral particles>> is intended to refer to the particles containing viral structural proteins and a sequence coding said reprogramming factors.

Viral particles may be prepared by transforming or transfecting a packaging cell with a viral vector carrying the nucleotide coding sequences of said combination of reprogramming factors. In the examples below, viral particles are prepared from lentivirus.

The target cell population may then be transfected using the expression vectors as described above.

The term “transfection” or “transfecting” refers to a process of introducing nucleic acid molecules into a cell. The nucleic acid molecules may be gene sequences encoding complete proteins or functional portions thereof. Any appropriate transfection method is useful in the methods described herein.

Incorporating the coding sequence and its control sequences directly into the genome of the target cells may cause activating or inactivating mutations of oncogenes or tumor suppressor genes, respectively. For certain applications, in particular medical applications, it may be required to avoid any genetic modifications of the target cells.

In a third embodiment, the reprogramming factors, for example, Oct4, Sox2, Flk4, c-Myc, Nanog and Lin28, or corresponding coding DNA or RNA, are introduced into the target cells without integration of exogenous genetic material in the host DNA, i.e. without introduction of the nucleotide sequence in the cell's genome.

An expression vector such as a plasmid vector can be delivered into said cells for ectopic expression of the reprogramming factor, in the form of naked DNA. Alternatively, RNAs coding for said reprogramming factors either chemically modified or not, can be introduced into the cells to reprogram them (see for example Warren L, et al, 2010, Cell Stem Cell. November 5; 7(5):618-30).

Other expression vectors have been described for example in WO 2009115295.

These nucleic acids can be delivered into the target cells with the aid, for example, of a liposome or a cationic polymer, for example, using conventional transfection protocols in mammalian cells.

In particular, appropriate transfection methods that do not use viral DNA or viral particles as a delivery system to introduce the nucleic acid molecules into the target cell may be used in the methods described herein. Exemplary transfection methods include without limitation calcium phosphate transfection, liposomal transfection, nucleofection, sonoporation, transfection through heat shock, magnetofection and electroporation. In some embodiments, the nucleic acid molecules are introduced into the target cells using electroporation following standard procedures well known in the art.

Alternatively, the reprogramming factor protein or fragments thereof showing similar properties to the intact proteins with respect to the reprogramming of target cells can be delivered into said target cells with the aid of chemical carriers such as cell-penetrating peptides including, without limitation, penetratin or TAT-derived peptides.

Methods to improve efficiency of the generation of iPSCs have also been described in the Art. In particular, in the method of the invention, introduction and/or addition of various generation efficiency improving agents may be performed. Examples of substance for improving generation efficiency of iPSCs include, without limitation, histone deacetylase inhibitors (such as for example valproic acid, trichostatin A, sodium lactate, MC1293 and M344), and nucleic acid expression inhibitors such as siRNAs and shRNA for HDAC, and G9a histone methyltransferase inhibitors, and nucleic acid expression system inhibitors such as siRNA and shRNA for G9a (see also Feng et al., 2009, supra).

In one specific embodiment, the methods according to the invention do not comprise any step of direct silencing of senescence effectors, and in particular direct silencing of p53 effectors.

By “direct silencing”, it is meant to use a substance that will act directly on the expression of the gene of interest, for example, p53 gene, and not on a substance that will act on a factor upstream. One way to silence a gene is the use of siRNA or shRNA directly directed on the gene sequence to inhibit.

Compositions Comprising iPSCs Obtainable from the Methods of the Invention

The invention further relates to a cell-based composition comprising iPSCs obtainable from the method as described above (hereafter referred as “the iPSCs compositions”), and a pharmaceutically acceptable vehicle. Remarkably, iPSCs according to the present invention have no characteristics of the aging phenotype, though deriving from cells from aged donors or senescent cells.

These iPSCs compositions typically may comprise iPSCs obtained from a patient suffering from aged-related disorder such as disorders caused by defective helicase, including Werner Syndrome, Cockayne, Rothmund-Thomson, and Bloom syndromes, and xeroderma pigmentosa and trichothiodystrophy, or other disorders including without limitation, Hutchinson-Giford progeria or Wiedemann-Rautenstrauch syndrome.

Composition of Cells Obtained by Differentiation of iPSCs Obtainable from the Methods of the Invention and Uses Thereof

The iPSCs obtained from the methods of the invention, in particular from cells of aged donors, may advantageously be cultured in vitro under differentiation conditions, to generate differentiated cells, such as muscle, cartilage, bone, dermal tissue, cardiac or vascular tissue, or other tissues of interest.

Thus, the invention relates to the methods for preparing compositions comprising differentiated cells, said method comprising the steps of

    • (a) providing a composition comprising iPS cells obtained from the methods of the invention from target cells of aged donors; and,
    • (b) culturing said composition comprising iPS cells, under appropriate conditions for their differentiation into the desired cell lineages.

The skilled person may use known protocols for differentiating stem cells, such as induced pluripotent stem cells, ES cells or mesenchymal stem cells into the desired cell lineages.

Another aspect of the invention relates to the use of said composition comprising said cell lineages derived from differentiation of iPSC, hereafter referred as the Differentiated Cells of the Invention.

The Differentiated Cells of the Invention have the particularity to have a rejuvenated phenotype, for example, with respect to the size of the telomeres, gene expression profile, metabolism, and the number of cell cycle prior to appearance of senescence phenotype, while being derived from cells of aged donors, for example donors more than 70 years old. The Differentiated Cells of the Invention may thus be used in a variety of application, in particular, in research or therapeutic field. One major field of application is cell therapy or regenerative medicine. These iPSCs or Differentiated Cells composition may also be useful for generating cellular models of aged-related disorders as described above.

For example, primary cells, such as fibroblast cells obtained from a patient suffering from a genetic defect, may be cultured and genetically corrected according to methods known in the art, and subsequently reprogrammed and rejuvenated into iPSCs according to the methods of the present invention and differentiated into the suitable cell lineages for re-administration into the patient, for example the same patient as the cell donor (autologous treatment).

Similarly, regenerative medicine can be used to potentially cure any disease that results from malfunctioning, damaged or failing tissue by either regenerating the damaged tissues in vivo by direct in vivo implanting of a composition comprising iPSCs or their derivatives comprising appropriate progenitors or cell lineages or differentiated cells of the Invention. Preferably, such damaged tissues are tissue damaged from aged-related disorders or aged patients, being more than 50, 60, 70, 80, 90 or more than 100 years old.

In one aspect, the iPS cells or the Differentiated Cells of the Invention may be useful for autologous regenerative therapy of a patient suffering from aged related disorders or an aged patient in need of regenerative therapy due to specific disorders or treatments associated to such disorders, including without limitation, cancer disorders, inflammatory and autoimmune disorders, muscle and skeletal disorders, neurologic disorders, diabete and other metabolic disorders.

Therefore, in one aspect, the invention relates to the iPSCs compositions or Differentiated Cells of the Invention for use as a cell therapy product for implanting into mammal, for example a human patient, preferably, an aged patient being more than 50, 60, 70, 80, 90 or more than 100 years old, most preferably as an autologous graft (i.e. the cells have the same genotype as the patient's cells)

In another specific embodiment, the iPSCs compositions or Differentiated Cells of the Invention are used for the treatment of joint or cartilage, muscle or bone damages.

In another specific embodiment, the iPSCs compositions or Differentiated Cells of the

Invention may also be used advantageously for the production of dermal tissues, for example, skin tissues, for use in regenerative medicine (cell-based therapy) or in research.

In another specific embodiment, the iPSCs compositions or Differentiated Cells of the Invention may also be used advantageously for the production of, but not restricted to, dermal, muscle or skeletal cells from healthy or diseased patients for screening applications in the pharmaceutical industry. Such screening tests can be used to search for new drugs with clinical applications or for toxicology tests.

In another specific embodiment, the iPSCs compositions or Differentiated Cells of the Invention may also be used for regenerating cardiac or vascular tissue.

In another specific embodiment, the iPSCs compositions or Differentiated Cells of the Invention may also be used for regenerating brain tissue or neuronal tissue, for example in patient suffering from neurodegenerative disorders.

Methods for Rejuvenating Target Cells

In another aspect, the invention relates to a method for rejuvenating cells from aged donors or senescent cells.

In particular, the invention relates to an in vitro method for rejuvenating cells from aged donors or senescent cells, said method comprising reprogramming said target cells to induced pluripotent stem cell, by increasing expression in said target cells of at least the following reprogramming factors:

  • (i) a reprogramming factor encoded by one gene of the Oct family gene, for example Oct4,
  • (ii) a reprogramming factor encoded by one gene of the Klf family gene, for example Klf4,
  • (iii) a reprogramming factor encoded by one gene of the Sox family gene, for example Sox2,
  • (iv) a reprogramming factor encoded by one gene of the Myc family gene, for example, c-myc or L-myc, and,
  • (v) Lin28,
  • (vi) and, optionally, Nanog.

The term “rejuvenating” refers to the process of erasing epigenetic modifications participating in the cellular aging phenotype. The cellular aging phenotype can be characterized, inter alia by the following markers:

    • activation of the p53/p21CIP1 and pRb/p16INK4A tumor suppressor pathways (hereafter referred as senescence effectors),
    • cells arrested irreversibly in G1,
    • shortening of telomere size,
    • expression of senescent-associated β-galactosidase activity (SA β-Gal),
    • Specific chromatin modification as senescence-associated heterochromatic foci (SAHF),
    • Specific secretome,
    • reduced/altered overall mitochondrial activity.

A process of rejuvenation is observed when one or all of these markers of aging phenotype is reduced or suppressed in an aged or senescent cell type due to the rejuvenating process.

In one preferred embodiment, the in vitro method for rejuvenating cells from aged donors or senescent cells comprise culturing said cells from aged donors or senescent cells under appropriate conditions for increasing expression of the following combination of reprogramming factors consisting of Oct4, Klf4, Sox2, c-Myc, Lin28 and, optionally, Nanog.

The combination of reprogramming factors may be used in vivo for rejuvenating tissue of a subject in need thereof. Thus the invention further relates to a composition for in vivo use in rejuvenating senescent or aged cells in a subject in need thereof, said composition comprising means for increasing expression of the following combination of reprogramming factors consisting of Oct4, Klf4, Sox2, c-Myc, Lin28 and, optionally, Nanog.

In some embodiments, said means for increasing expression of said reprogramming factors comprises an appropriate amount of Oct4 protein, Klf4 protein, Sox2 protein, c-Myc protein, Lin28 protein and, optionally, Nanog protein, each protein being associated to appropriate means for delivery of said protein into the nucleus of the senescent cells to be rejuvenated.

Means for delivery of a protein into a cell includes, without limitation, the chemical carriers such as cell-penetrating peptides such as penetratin or TAT-derived peptides.

In other embodiments, said means for increasing expression of said reprogramming factors comprise an appropriate amount of Oct4 precursor RNA, Klf4 precursor RNA, Sox2 precursor RNA, c-Myc precursor RNA, Lin28 precursor RNA and, optionally, Nanog precursor RNA, associated to appropriate means for delivery of each precursor RNA into the cytoplasm of the senescent cells to be rejuvenated.

These compositions as described above are particularly suitable for topical application, for example for skin or dermal application, for example for treating skin disorders.

The invention will be further illustrated by the following examples. However, these examples should not be interpreted in any way as limiting the scope of the present invention.

EXAMPLES

Methods

Cells from aged donors were obtained from the Coriell Institute for Medical Research (N.J., USA). Replicative senescent cells were obtained by extensive cell culture until cell cycle growth arrest, assessed by FACS, and senescence-Associated (β-Galactosidase activity detected as previously described25.

H9 and H1 human embryonic stem cells were obtained from the WiCell Research Institute (Wis., USA). hESCs and iPSCs were either maintained using standard hESC procedures on Mitomycin-C treated OF-1 mouse embryonic fibroblasts (MEF) in KO DMEM culture medium (hESC medium) supplemented with 20% KnockOut serum replacement, 0.1 mM non-essential amino acids, 2 mM L-glutamine (all from Invitrogen), 0.1 mM β-mercaptoethanol and 10 ng/ml basic fibroblast growth factor (bFGF, Peprotech) or in feeder-free culture on matrigel (BD Biosciences) with chemically defined mTeSR medium (Stemcell Technologies) as previously described26.

For generation of human iPSCs, lentiviral vectors containing cDNAs of human OCT4, SOX2, NANOG and LIN28 genes were obtained from Addgene and previously described by Yu et al3. KLF4 and c-MYC cDNAs were subcloned into the same vector backbone from vectors described by Takahashi et al.2,3. The 293T cell line (Invitrogen) was used to produce transgene-expressing lentiviruses. Human primary fibroblasts were seeded at 2 105 cells per 35 mm dish one day before transduction. Equal amounts of supernatants containing each of the six lentiviruses were mixed, transferred to the fibroblast dish, and incubated overnight. Twenty-four hours after transduction, the lentivirus-containing medium was replaced with the second supernatant. Six days after transduction, fibroblasts were harvested by trypsinization and replated in a 100 mm dish on MEF feeder layer. Next day, the medium was replaced with hESCs medium supplemented with 10 ng/ml bFGF. The medium was changed every other day. Thirty at forty days after transduction, colonies were picked up and transferred into 35 mm dish on a feeder layer with 2 ml of hESCs medium supplemented with 10 ng/ml bFGF.

Results

74-year-old donor proliferative human diploid fibroblasts (hereafter 74P) were induced into replicative senescence by serial passaging (74S). Cellular senescence was assessed after 18 passages (51 population doublings) by FACS analysis, increase in SA-β-Gal activity, up-regulation of the CDK inhibitors p16INK4A and p21CIP1 and the formation of SAHFs. These senescent cells were also maintained more than 2 months in culture without any detectable increase in the cell number, confirming the robustness of cell cycle arrest. We initially tried to generate iPSCs from these senescent fibroblasts by overexpression of the LIN28-containing set of genes (OCT4, NANOG, SOX2, LIN28) to compare with previous experimental results published with the set of 4 reprogramming factors OCT4, SOX2, KLF4, c-MYC and originally described as inefficient for senescence bypass. All of these reprogramming factor genes were transduced by individual lentiviruses. After 40 days, we did not observe any new proliferation or formation of hESC colonies resembling iPSCs. This was confirmed by the absence of detectable expression of endogenous pluripotency genes in the infected cell population, whereas quantitative RT-PCR demonstrated efficient viral transduction. These results demonstrate that the LIN28-containing set of reprogramming factors is not able to reverse the replicative senescence state to generate iPSCs, as previously described with the OCT4, SOX2, KLF4, c-MYC combination.

Interestingly, NANOG overexpression has been described to accelerate reprogramming in a predominantly cell-division-rate-independent manner, and overexpression of LIN28, similar to inhibition of the p53/p21CIP1 pathway, increases the cell division rate, resulting in an accelerated kinetics of iPSCs production13,14. We therefore hypothesized that the senescence barrier might be overcome using a protocol optimized for an increased reprogramming efficiency based on the combination of the 6 reprogramming factors OCT4, NANOG, SOX2, KLF4, LIN28, and c-MYC introduced by individual lentiviral particles, without additional transient or permanent inhibition of senescence inductors.

To test our hypothesis, 74P and 74S cells were infected twice with a mix of the individual lentiviruses carrying each of the 6 genes. One week after infection, we observed disappearance of SAHFs in infected senescent fibroblasts (74S inf) revealing a first step of reprogramming. Then, cells were plated onto mouse fibroblast feeders in hESCs medium, and after 18-20 days, proliferation was recovered in infected senescent cells. Colonies resembling hESCs appeared at 35-40 days post-infection. iPSC-like colonies were produced from senescent fibroblasts (74S), with a mean reprogramming efficiency of 0.015-0.03%, similar to proliferative fibroblasts (74P), infected under the same conditions. We randomly selected 6 colonies from proliferative (iPSC 74P) and senescent (iPSC 74S) 74-year-old donor fibroblasts, and further characterized 3 clones, which were then successfully expanded in either regular hESCs feeder or feeder-free culture conditions. Long-term culture and assessment for the expression of stem cell markers confirmed successful maintenance and reprogramming of these cells, which have now been grown for more than 35 passages. Immunocytochemistry analysis demonstrated the continued presence of the cell surface markers SSEA-4 and TRA-1-60 that characterize human pluripotent stem cells. Quantitative RT-PCR analyses showed that the iPSCs re-expressed endogenous OCT4, SOX2, NANOG and the REX1 pluripotent marker genes at the same level as H1 and H9 hESC lines or the IMR90 clone 4 iPSC line generated in the Thomson Laboratory (iPSC IMR90 TH Cl 43) and grown in parallel, while no transcript was detected in the parental fibroblasts. In order to corroborate this reactivation of endogenous genes, we investigated the DNA methylation status of CpG dinucleotides in one described CpG-rich region in OCT4 and NANOG promoters. Bisulfite genomic sequencing analysis showed that both the OCT4 and NANOG promoters were demethylated either in iPSCs from senescent (iPSC 74S Cl F) or proliferative (iPSC 74P Cl H) cells, as efficiently as the previously published iPSC IMR90 TH Cl 43, when compared to the methylation status of hESC H9, whereas the same regions were highly methylated in parental fibroblasts.

To exclude any cell type-specific effects, we repeated the same protocol using the IMR90 human embryonic fibroblasts induced into replicative senescence by serial passaging. Similar to the 74-year-old donor fibroblasts, we did not succeed in generating iPSCs using both sets of 4 factors described previously, whereas we obtained similar reprogramming efficiency from proliferative or senescent IMR90 fibroblasts with the combination of the 6 factors.

Next we assessed the pluripotent state of our generated iPSCs by evaluating the differentiation abilities of iPSC 74S compared to the iPSC 74P clones. All iPSCs were able to differentiate into the three early embryonic lineages, endoderm, ectoderm and mesoderm, as demonstrated using immunostaining with specific antibodies against SMA, MAP2 and FOXA2 respectively. We obtained similar results with senescent IMR90 fibroblasts. Altogether, these results indicate that the combination of the 6 transcription factors, OCT4, NANOG, SOX2, KLF4, LIN28, and c-MYC is a successful reprogramming strategy for reversing the cellular senescence state leading to generation of iPSCs.

During aging, the number of senescent cells increases in the human body, and is thought to impair tissue homeostasis. However, increased expression of p16INK4A and p21CIP1 occurs in proliferative cells from aged donors, and is thought to decrease progressively their proliferative capacity15. Whether proliferative cells from centenarians might be efficiently reprogrammed towards pluripotency, and whether they retain some specific markers of the cellular aging phenotype, is an unresolved issue. To investigate this specific point, we used fibroblasts from 92-, 94-, 96- and 101-year-old donors for reprogramming experiments, by using the 6 factors in combination. As suggested by our previous experiments on senescent cells, we were able to generate iPSCs from all the aged donor fibroblasts, with similar efficiency to those obtained with senescent fibroblasts. All iPSC clones generated re-expressed endogenous pluripotency genes OCT4, SOX2, NANOG and REX1, as presented for two clones for each parental fibroblast line, that was also confirmed by demethylation of CpG in the OCT4 and NANOG promoter regions. Interestingly, we also observed partial demethylation of the NANOG promoter in parental fibroblasts from aged donors that is in accordance with the global demethylation of the genome already described in the elderly16, that might also have contributing effects in reprogramming. In addition, we detected re-expression of the pluripotency cell surface markers SSEA-4 and TRA-1-60, and finally, we demonstrated their ability to differentiate into endoderm, ectoderm and mesoderm derivatives as judged by immunostaining with SMA, MAP2 and FOXA2 antibodies respectively.

These results demonstrate the efficiency of our reprogramming procedure to successfully reinstate the pluripotent state and self-renewal from centenarian fibroblasts; thus, cellular aging and the frequently-associated senescent phenotype is not a limit to reprogramming towards pluripotency.

Although we succeeded in generating iPSCs using aged donors and senescent fibroblasts, an essential issue was to elucidate whether induction of a pluripotent state might erase the main markers of the cellular aging phenotype. We previously showed that reprogramming induced SAHF disappearance, demonstrating the genome organization plasticity of senescent cells. We then analyzed other hallmarks of aging and senescence in our iPSCs and found that iPSCs generated from replicative senescent fibroblasts from the 74-year-old donor did not retain increased expression of p21CIP1 and p16INK4A inherited from their previous senescent state, as shown by immunoblot analysis. Similar results were also obtained with IMR90 embryonic replicative senescent fibroblasts. In addition, all iPSCs generated from centenarians also have downregulated expression of p21CiP1 and p16INK4A proteins, similar to hESC lines. These results indicate that we were able to reset the expression of p21CIP1 and p16INK4A to the low level found in hESCs.

Proliferative fibroblasts from aged donors are usually characterized by telomeres of heterogeneous size, whose mean length depends on the parental inherited size and on the various number of divisions occurring during the lifespan, but which do not necessarily correlate with proliferation capacity. However replicative senescence is always associated with short telomeres. Short telomeres are recognized as damaged DNA, leading to activation of the DNA damage response signaling cascade and triggering senescence-associated cell cycle arrest. Although, iPSCs generally exhibit an increased telomere size compared to the parental differentiated cells17 , we wondered whether iPSCs obtained from senescent cells or from centenarian cells exhibited telomeres of increased length. To address this question, we used Southern blot analysis to examine the mean terminal restriction fragment (TRF) length of iPSCs obtained from replicative senescent cells, compared to proliferative cells. We found that telomere length of iPSCs from the aged 74 donor, both from proliferative or senescent cells, increased to a size equivalent to those observed in H9 hESC. Unlike parental fibroblasts, which entered into replicative senescence after 50 population doublings, and 60-63 doublings for embryonic fibroblasts IMR90, we were able, to culture all iPSC lines continuously, which remained stable after more than 110 population doublings. Similarly, telomeric DNA length was increased in iPSCs derived from senescent or proliferative IMR90 embryonic fibroblasts, after reprogramming. Although, telomeres from centenarians were shortened less in size than in senescent fibroblasts, we were able to reset their size to the same length as hESCs. Interestingly, in some iPSC clones, we found a longer upper size than found in H9 hESC, suggesting that telomere size in pluripotent cells does not have an inherited maximum size. It also suggests some possible additional developments in iPSC generation for increased proliferation ability of differentiated cells, suitable for cell-based therapy in regenerative medicine.

Collectively, these data highlight that our reprogramming protocol leads to erasure of the most common marks of senescence and aging in the generated iPSCs.

To further evaluate the pluripotent capacity of senescent and aged derived iPSCs, we selected 3 iPSC clones from aged proliferative and senescent fibroblasts, iPSC 74P CI H, iPSC 74S Cl F and iPSC 96 CI 1. We first confirmed the full capacity of these clones to progress into terminal differentiation by the formation of teratoma in mice, leading to appearance of organized organ-like structures in the three embryonic lineages. DNA fingerprinting analyses (short tandem repeat, STR) were also performed to confirm that iPSC clones were derived from their corresponding parental fibroblasts. We also verified that the 6 transgenes used for the reprogramming were almost completely downregulated.

Then, we performed transcriptome analysis of 3 selected clones and their parental counterpart, that we compared to a hESCs and iPSCs data set, built as a compendium (18). We first confirmed that the specific pluripotent genes were expressed in our iPSCs at a similar level as hESCs and iPSCs from the compendium (19). Then, we performed a hierarchical clustering of our 3 iPSC clones and their parental fibroblasts, combined with several hESCs, iPSCs and post-natal fibroblasts. Strikingly, we found that, proliferative, senescent and aged fibroblasts were clustered together compared to post-natal fibroblasts, suggesting that they share a general common aging signature. Further, the derived iPSCs from proliferative and senescent aged fibroblasts obtained using the infection of the 6 factors are significantly more similar to hESCs than previously described iPSCs derived from a 4 factor infection.

Since oxidative stress and mitochondrial dysfunction are well described in senescence and aging20,21, we wondered whether these functions were also specifically reprogrammed from senescent and aged cells. Transcriptome analysis allowed us to study genes involved in both processes, as previously described22. Again, clustering of transcriptomes with this subset of specific genes indicated that global modifications in expression profiles associated with these altered functions were specific to aged and senescent fibroblasts, when compared to young proliferative embryonic or post-natal fibroblasts, and that our derived iPSCs have reset these functions to an embryonic-like status. Next, we evaluated the overall mitochondrial activity in the derived iPSCs compared to hESCs, by measuring the (ΔΨm) transmembrane potential generated by the proton gradient, which is an indicator of healthy mitochondrial function. For this purpose, we used the cationic dye JC-1 and quantified the fluorescence intensity ratio of its two forms by confocal microscopy and flow cytometry analysis. As previously shown, the red/green ratio decreased with senescence20,21 and also seems associated with aging. Strikingly, we found an increased ratio in iPSCs to a level similar to that found in hESCs, confirming that reprogramming restored the mitochondrial activity of iPSCs derived from old and senescent fibroblasts. Similar results were obtained with iPSCs from proliferative or senescent IMR90 fibroblasts. Furthermore, we did not observe differences in distribution and morphology of mitochondria in iPSCs by electronic microscopy when compared to H1 hESC. Analysis of mitochondrial properties illustrates how nuclear reprogramming, in resetting gene expression programs, might rejuvenate to a healthy cell physiology through restoring impaired function of cellular organelles whose dysfunction is involved in cellular aging. Finally, using a fibroblasts differentiation assay23,24, we demonstrated that these cells did not enter prematurely into senescence. Indeed, fibroblasts derived from 74P, S and 96 iPSCs did not reveal SA-β-Gal activity after 10 population doublings, and exhibited a proliferation rate equivalent to young proliferative fibroblasts. To exclude the possibility that our reprogramming strategy was not associated with any mutations in the senescence induction pathways, we demonstrated the ability of re-differentiated fibroblasts to re-enter into replicative senescence. After extensive culture, these cells became senescent, as shown by increased SA-β-Gal activity associated with cell cycle arrest, the re-increased expression of p16INK4A, and p21CIP1and a re-shortened telomere size. More interestingly, the number of population doublings (PD) necessary to trigger replicative senescence was increased. While the age 74 parental fibroblasts entered into replicative senescence after 51 PD, the re-differentiated fibroblasts from iPSC 74S Cl F entered into replicative senescence only after 58 PD. This re-acquired proliferation potential is similar to iPSC 74P Cl H derived from the age 74 proliferative parental fibroblasts PD 60, which was infected at PD 12. These cells exhibited a population doubling potential of 39 PD before exhaustion by replicative senescence. A similar resetting of the proliferation ability of the age 96 fibroblasts was observed and explained by the lengthening of telomeres. We conclude that our reprogramming strategy, which overcame the senescent state, was also able to increase the cellular lifespan. Transcriptome analysis by hierarchical clustering, comparing parental fibroblasts with post-natal and differentiated H1 hESCs in fibroblasts, finally demonstrated that the global gene expression profile of early re-differentiated fibroblasts from our iPSCs generated from old donors and senescent fibroblasts are distinct from parental fibroblasts, and closer to embryonic fibroblasts derived from the H1 hESC line. This result was also confirmed by gene expression profiles associated with oxidative stress and mitochondrial activity, confirming the rejuvenated physiology of our aged and senescent cells.

Taken together, our results show that it is possible to reprogram replicative senescent cells and cells derived from centenarians into iPSCs using a specific combination of genes, demonstrating that aging and senescence are not a barrier to reprogramming towards pluripotency. It also improves our understanding of fundamental cell reprogramming and underlines the underestimated importance of epigenetic modifications participating in the cellular aging process, which is evidently susceptible to be reprogrammed as well. But most importantly, we also demonstrate that, using an adequate reprogramming strategy, it is possible to rejuvenate the cell physiology, suggesting the potential reversibility of major aspects of the aging phenotype. These results also promote the potential development of age-related disease models, and support the development of new therapeutic cell-based strategies to erase some pathologies related to aging.

Useful Nucleotide and Amino Acid Sequences for Practicing the Methods of the Invention

TABLE 1
NO: Description Sequence
Human Oct3/4 gene CCTTGCCAAGCGCTCATTTCACCAGGCCCCCCGCTTGCCGCGCCTT
sequence CCTTGCCCATGGCGGGACACCTGGCTTCGGATTTCGCCTTCTCGCC 
(NM_002701) CCCTGCAGGTGGTGGAGGTGATGGGGCAGGGGGGCCGGAGCCGGGC
TGGGTTGATCCTCGGACCTGGCTAAGCTTCCAAGGCCCTCCTGGAG
GGCCACGAATCCCCCCGGGGCTTGGGCCACGCTCTGAGGTGTGGGC
GATTCCCCCATGCCCCCCGCCGTATGAGTTCTGTGGGGGGATGGCG
TACTGTGGGCCCCAGGTTGGAGTGGGGCTAGTGCCCCAAGGCGGCT
TGGAGACCTCTCAGCCTGAGGGCGAAGCAGGAGTCGGGGTGGAGAG
CAACTCCGATGGGGCCTCCCCGGAGCCCTGCACCGTCACCCCTGGT
GCCGTGAAGCTGGAGAAGGAGAAGCTGGAGCAAAACCCGGAGGAGT
CCCACGACATCAAAGCTCTGCAGAAAGAACTCGAGCAATTTGCCAA
CCTCGCGAAGCAGAACACCATCACCCTCGCATACACACAGCCCCAT
GTGGGGCTCACCCTGGGGGTTCTATTTGGGAAGGTATTCAGCCAAA
CGACGATCTGCGGCTTTGAGGCTCTGCAGCTTAGCTTCAAGAACAT
GTGTAAGCTGCGGCCCTTGCTGCAGAAGTGGGTGGAGGAAGCTGAC
AACAATGAAAATCTTCAGGAGATATGCAAAGGAGAAACCCTCGTGC
AGGCCCGAAAGAGAAAGCGAACCAGTATCGAGAACCGAGTGAGAGG
CAACCTGGAGAATTTGTTCCTGCAGTGCCCGAAACCCACACTGCAG
CAGATCAGCCACATCGCCCAGCAGCTTGGGCTCGAGAAGGATGTGG
TCCGAGTGTGGTTCTGTAACCGGCGCCAGAAGGGCAAGCGATCAAG
CAGCGACTATGCACAACGAGAGGATTTTGAGGCTGCTGGGTCTCCT
TTCTCAGGGCCACCAGTGTGCTTTCCTCTGGCCCCAGGGCCCCATT
TTCGTACCCCAGGCTATGCGAGCCCTCACTTCACTCCACTCTACTC
CTCGCTCCCTTTCCCTGAGGGGGAAGCCTTTCCCCCTGTCTCCGTC
ACCACTCTGGGCTCTCCCATGCATTCAAACTGAGGTGCCTGCCCTT
CTAGGAATGGGGGACAGGGGGAGGGGAGGAGCTAGGGAAAGAAAAC
CTGGAGTTTGTGCCAGTGTTTTTGGCATTAAGTCCTTCATTCACTA
AGGAAGGAATTGGGAACACAAAGGGTGGGGGCAGGGGAGTTTGGGG
CAACTGGTTGGAGGGAAGGTGAAGTTCAATGATGCTCTTGAT
TTTAATCCCACATCATCTATCACTTTTTTCTTAAATAAAGAAGCCT
GGGACACAGTAGATAGACACACTTAAAAAAAAAAA
2 Human Oct4 amino MAGHLASDFAFSPPPGGGGDGPGGPEPGWVDPRTWLSFQGPPGGPG
acid sequence IGPGVGPGSEVWGIPPCPPPYEFCGGMAYCGPQVGVGLVPQGGLET
(ADW77327.1) SQPEGEAGVGVESNSDGASPEPCTVTPGAVKLEKEKLEQNPEESQD
TKALQKELEQFAKLLKQKRITLGYTQADVGLTLGVLEGKVESQTTI
CRFEALQLSFKNMCKLRPLLQKWVEEADNNENLQEICKAETLVQAR
KRKRTSIENRVRGNLENLFLQCPKPTLQQISHIAQQLGLEKDVVRV
WECNRRQKGKRSSSDYAQREDFEAAGSPFSGGPVSFPLAPGPHEGT
PGYGSPHFTALYSSVPFPEGEAFPPVSVTTLGSPMHSN
3 Human Sox2 gene CTATTAACTTGTTCAAAAAAGTATCAGGAGTTGTCAAGGCAGAGAA
sequence GAGAGTGTTTGCAAAAAGGGAAAAGTACTTTGTTGCCTCTTTAAGA
(NM_003106) CTAGGGCTGGGAGAAAGAAGAGGAGAGAGAAAGAAAGGAGAGAAGT
TTGGAGCCCGAGGCTTAAGCCTTTCCAAAAACTAATCACAACAATC
GCGGCGGCCCGAGGAGGAGAGCGCCTGTTTTTTCATCCCAATTGCA
CTTCGCCCGTCTCGACCTCCGCTTCCCCCCAACTATTCTCCGCCAG
ATCTCCCCGCAGGCCCGTGCACGCCGAGGCCCCCGCCCGCGCCCCC
TGGATCCCGCCCCGAGCGCGGCCCCCCGCACAGTCCCGGCGGGCCG
AGGGTTGGCGGCCGCGGGGGCCGCGCCCCCGCCCAGCGCCCGCATG
TATAACATGATCGAGACGCAGCTGAAGCCGCCCGGCCCGCAGCAAG
CTTCGGGGGGCCGCGGCGCAGGAGGCAACGCCACGGCGGCGGCGAC
CGGCGGCAACCAGAAGAACAGCCCGCACCGCGTCAAGAGGCCCATG
AACGCCTTCATGGTATCGTCCCGGGCGCAGCGCCGTAAGATGGCCC
AGGACAACCCCAAGATGCACAACTCGGAGATCAGCAAGCGCCTGGG
CGCGGAGTGCAAACTTTTCTCCGAGACCGAGAAGGGGCCCTTCATC
GAGGAGGCCAACCGGCTGCGCGCTCTGCACATCAAGGAGCACCCGG
ATTATAAATACCGGCCGCGGCGGAAAACCAAGACGCTCATGAAGAA
GGATAAGTACACGCTTCCCGGAGGCTTGCTGGCCCCCGGCGGGAAC
AGCATGGCGAGCGGGGTTCGGGTGGCCGCCGGCCTGGGTCCGGGCG
TGAACCAGCCATGGACAGCTACGCGGCACATGAACGGCTGGAGCAA
CGGCAGCTACAGCATGATGCAGGAGGAGCTGGGCTACCCGCAGCAC
CCCGCCCTCAACGCTCACGCCGCGGCACAGATCCAACCGATGCACC
GCTACGACGTCAGCGCCCTGCAGTACAACTCCATGACCAGCTCGCA
GACTACATGAACGGCTCGCCCACCTACAGCATGTCCTACTCGGCAG
CAGGGCACCCCCGGTATGGCGCTGGGCTCCATGGGCTCTGTGGTCA
AGTCCGAGGCCAGCTCCACCCCCCCCGTGCTTACCTCTTCCTCCCA
CTCCAGGGCGCCCTGCCAGGCCGGGGAGCTCCGGGACATGATCAGC
ATGTACCTCCGCGGCGCCGAGGTGCCGGAGCCCGCTGCGCCCAGTA
GACTGCACATGGCCCAGCACTACCAGAGCGGCCCGGTGCCCGGCAC
GGCCATTAACCCCACACTCCCCCTCTCGCACATCTGAGCCCTGGAC
TGCCAACTCGACAACGCCAGAGATTTTCAAACAGATACAAGGGAAT
TGGGAGGGGTGCAAAAAGAGGAGAGTAGGAAAAATCTGATAATGCT
CAAAAGGAAAAAAAATCTCCGCAGCGAAACGACAGCTGCCGAAAAA
AACCACCAATCCCATCCAAATTAACCCAAAAACCGTGATCCCGACT
AGAAAACTTTTATGAGAGATCTTGGGACTTCTTTTTGGGGGACTAT
TTTTCTACAGAGAAAACCTGAGGGCGGCGGGGAGGGCGGCGGAATC
GGACCATGTATAGATCTGGAGGAAAAAAACTACGCAAAACTTTTTT
TTAAAGTTCTACTCGTACCTTAGGCGCTTCCCAGGCAGTTCGCAAA
AGTCTTTACCAGTAATATTTAGAGCTAGACTCCGGGCGATGAAAAA
AAAGTTTTAATATTTGCAAGCAACTTTTGTACAGTATTTATCGAGA
TAAACATGGCAATCAAATGTCCATTGTTTATAAGCTGAGAATTTGC
CAATATTTTTCGAGGAAAGGGTTCTTGCTGGGTTTTGATTCTGCAG
CTTAAATTTAGGACCGTTACAAACAAGGAAGGAGTTTATTCGGATT
TGAACATTTTAGTTTTAAAATTGTACAAAAGGAAAACATGAGAGCA
AGTACTGGCAAGACCGTTTTCGTGGTCTTGTTTAAGGCAAACGTTC
TAGATTGTACTAAATTTTTAACTTACTCTTAAAGGCAAAAAAAAAA
TGTCCATGCAGGTTGATATCGTTGGTAATTTATAATAGCTTTTGTT
CAATCCTACCCTTTCATTTTGTTCACATAAAAAATATGGAATTACT
GTGTTTGAAATATTTTCTTATGGTTTGTAATATTTCTGTAAATTGT
GATATTTTAAGGTTTTTCCCCCCTTTTATTTTCCGTAGTTGTATTT
TAAAAGATTCGGCTCTGTTATTGGAATCAGGCTGCCGAGAATCCAT
GTATATATTTGAACTAATACCATCCTTATAACAGCTACATTTTCAA
CTTAAGTTTTTACTCCATTATGCACAGTTTGAGATAAATAAATTTT
TGAAATATGGACACTGAAA
4 Human Sox2 amino MYNMMETELKPPGPQQTSGGGGGNSTAAAAGGNQKNSPDRVKRPMN
acid sequence  AFMVWSRGQRRKMAQENPKMHNSEISKRLGAEWKLLSETEKRPFID
(NCBI ref  EAKRLRALHMKEHPDYKYRPRRKTKTLMKKDKYTLPGGLLAPGGNS
NP_003097.1) MASGVGVGAGLGAGVNQRMDSYAHMNGWSNGSYSMMQDQLGYPQMP
GLNAHGAAQMQPMHRYDVSALQYNSMTSSQTYMNGSPTYSMSYSQQ
GTPGMALGSMGSVVKSEASSSPPVVTSSSHSRAPCQAGDLRDMISM
YLPGAEVPEPAAPSRLHMSQHYQSGPVPGTAINGTLPLSHM
5 Human KLf4 gene AGTTTCCCGACCAGAGAGAACCAACCTGTCTGCGGGCGCGCCOGGA
sequence GCAGAGGCGGTGGCGGGCGGCGGCGGCACCGGGAGCCGCCGAGTGA
(NM_004235) CCCTCCCCCGCCCCTCTGGCCCCCCACCCTCCCACCCGCCCGTGGC
CCGCGCCCATGGCCGCGCGCGCTCCACACAACTCACCGGAGTCCGC
GCCTTGCGCCGCCGACCAGTTCGCAGCTCCGCGCCACGGCAGCCAG
TCTCACCTGGCGGCACCGCCCGCCCACCGCCCCGGCCACAGCCCCT
GCGCCCACGGCAGCACTCGAGGCGACCGCGACAGTGGTGGGGGACC
CTGCTGAGTGGAAGAGAGCGCAGCCCGGCCACCGGACCTACTTACT
CGCCTTGCTGATTGTCTATTTTTGCGTTTACAACTTTTCTAAGAAC
TTTTGTATAGAAAGGAACTTTTTAAAAAAGACGCTTCCAAGTTATA
TTTAATCCAAAGAAGAAGGATCTCGCGCCAATTTGGGGTTTGGGTT
TTGGCTTCGTTTCTTCTCTTCGTTGACTTTGGGGTTCAGGTGCCCC
AGCTGCTTCGGGCTGCCGAGGACCTTCTGGGCCCCCACATTAATGA
GGCAGCCACCTGGCGAGTCTGACATGGCTGTCAGCGACGCGCTGCT
CCCATCTTTCTCCACGTTCGCGTCTGGCCCGGCGGGAAGGGAGAAG
ACACTCCCTCAACCACGTGCCCCCAATAACCCGTCCCCCGACCACC
TCTCCCACATGAAGCGACTTCCCCCAGTGCTTCCCGGCCGCCCCTA
TGACCTGGCGGCGGCGACCGTGGCCACAGACCTGCAGAGCGGCGGA
GCCGGTGCGGCTTGCGGCGGTAGCAACCTGGCGCCCCTACCTCGGA
GAGAGACCGAGGAGTTCAACGATCTGCTGGACCTGG
ACTTTATTCTCTCCAATTCGCTGACCCATCCTCCGGAGTCAGTGGC
CCACCGTGTCCTCGTCAGCGTCAGCCTCCTCTTCGTCGTCGCCG
TCGACCAGCGGCCCTCCCAGCGCGCCCTCCACCTGCAGCTTCACCT
ATCCGATCCGGGCCGGGAACGACCCGGGCGTGGCGCCGGGCGGCAC
GGGCGGAGGCCTCCTCTATGGCAGGGAGTCCGCTCCCCCTCCGACG
GCTCCCTTCAACCTGGCGGACATCAACGACGTGAGCCCCTCGGGCG
GCTTCGTGGCCCAGCTCCTGCGGCCAGAATTGCACCCGGTGTACAT
TCCGCCGCAGCAGCCGCAGCCGCCAGGTGGCGGGCTGATGGGCAAG
TTGGTGCTGAAGGCGTGGCTGAGCGCCCCTGGCAGCGAGTACGGCA
GCCCGGCGGTCAGCAGCGTCAGCAAAGGCAGCCCTGACGGCAGCCA
CCCCGTCGTGGTCCCCCCCrACAACGCCCCCCCCCCCCCCACGTGC
CCCAACATCAACCACCACGCGCTCTGTTCCTCCACCCACTTGCGCC
CTGGACCCCCTCTCAGCAATGGCCACCGGCCGGCTGCACACGACTT
CCCCCTGGGGCGGCAGCTCCCCAGCAGGACTACCCCGACCCTGGGT
CTTGAGGAAGTGCTGAGCAGCAGGGACTGTCACCCTGCCCTGCCGC
TTCCTCCCGGCTTCCATCCCCACCCGGGGCCCAATTACCCATCCTT
CCTGCCCGATCAGATGCAGCCGCAAGTCCCGCCGCTCCATTTCCAA
GAGCTCATGCCACCCGGTTCCTGCATGCCAGAGGAGCCCAAGCCAA
AGAGGGCAAGACGATCGTGCCCCCGGAAAAGGACCCCCACCCACAC
TTGTGATTACGCGGGCTGCGGCAAAACCTACACAAAGAGTTCCCAT
CTCAAGGCACACCTGCGAACCCACACAGGTGAGAAACCTTACCACT
GTGACTGGGACGGCTGTGGATGGAAATTCGCCCGCTCAGATGAACT
GACCAGGCACTACCGTAAACACACGGGGCACCGCCCGTTCCAGTGC
CAAAAATGCGACCGAGCATTTTCCAGGTCGGAGCACCTCGCCTTAC
ACATGAAGAGGCATTTTTAAATCCCAGACAGTGGATATGACCCACA
CTGCCAGAAGAGAATTCAGTATTTTTTACTTTTCACACTGTCTTCC
CGATCACGGAAGCACCCCAGCCACAAACCACTACAATCATGGTCAA
GTTCCCAACTGAGTCATCTTGTGAGTGGATAATCAGGAAAAATGAG
GAATCCAAAAGACAAAAATCAAAGAACAGATGCGGTCTGTGACTGG
ATCTTCTATCATTCCAATTCTAAATCCGACTTGAATATTCCTGGAC
TTACAAAATGCCAAGGGGGTGACTGGAAGTTGTGGATATCAGGGTA
TAAATTATATCCGTGAGTTGGGGGAGGGAAGACCAGAATTCCCT
TGAATTGTGTATTGATGCAATATAAGCATAAAAGATCACCTTGTAT
TCTCTTTACCTTCTAAAAGCCATTATTATGATGTTAGAAGAACAGG
AAGAAATTCAGGTACAGAAAACATGTTTAAATAGCCTAAATGATGG
TGCTTGGTGAGTCTTGGTTCTAAAGGTACCAAACAAGGAAGCCAAA
GXTTTCAAACTGCTGCATACTTTGACAAGGAAAATCTATATTTGTC
TTCCCATCAACATTTATGACCTAAGTCACGTAATATACCTCCTTTA
CTTCTTTAGCATTTTTATGCAGACAGTCTGTTATGCACTGTGGTTT
CAGATGTGCAATAATTTGTACAATGGGTTATTCCCAAGTATGCCTT
AAGCAGAACAAATGTGTTTTTCTATATAGTTCCTTGCCTTAATAAA
TATCTAATATTTATTTAACCAAACCTCTATTTTGTATATTTGTAAA
CTACAAAGTAAAATGAACATTTTGTGGACTTTGTATTTTGCATACT
CAAGGTGAGAATTAAGTTTTAAATAAACCTATAATATTTTATCTGA
AAAAAAAAAAAAAAAAA
6 Human KLf4 amino MRQPPGESDMAVSDALLPSFSTFASGPAGREKTLRQAGAPNNRWRE
acid sequence ELSHMKRLPPVLPGRPYDLAAATVATDLESGGAGAACGGSNLAPLP
(NP_004226.3) RRETEEFNDLLDLDFILSNSLTHPPESVAATVSSSASASSSSSPSS
SGPASAPSTCSFTYPTRAGNDPGVAPGGTGGGLLYGRESAPPPTAP
FNLADINDVSPSGGFVAELLRPELDPVYIPPQQPQPPGGIAMGKFV
LKASLSAPGSEYGSPSVISVSKGSPDGSHPVVVAPYNGGPPRTCPK
IKQEAVSSOTHLGAGPPLSNGHRPAAHDFPLGROLPSRTTPTLGLE
EVLSSRDCHPALPLPPGFHPHPGPNYPSFLPDQMQPQVPPLHYQEL
MPPGSCMPEEPKPKRGRRSWPRKRTATHTCDYAGCGKTYTKSSHLK
AHLRTHTGEKPYHODWDGCGWKFARSDELTRHYRKHIGHRPFQCQK
CDRAFSRSDHLALHMKRHE
7 Human c-Myc gene GACCCCCGACTGTGCTGCTCGCGGCCGCCACCGCCGGGGCCCCGGC
sequence (NCBI Ref CGTCCCTGGCTCCCCTCCTGCCTCGAGAAGGGCAGGGCTTCTCAGA
NM_002467) GGCTTGGCGGGAAAAAGAACGGAGGGAGGGATCGCGCTGAGTATAA
AAGCCGGTTTTCGGGGCTTTATCTAACTCGCTGTAGTAATTCCAGC
GACAGGCAGAGCGAGCGACCGGGCGCCCGGCTAGGCTGGAAGAGCC
GGCGAGCAGACCTGCGCTGCGGGCCTCCTGGCAAGGGACATCCGG
AGCGAATAGGGGGCTTCGCCTCTGGCCCAGCCCTCCCGCTGATCCC
CCAGCCAGCGGTCCGCAACCCTTGCCGCATCCACGAAACTTTGCCC
ATAGCAGCGGGCGGGCACTTTGCACTGGAACTTACAACACCCGAGC
AAGGACGCGACTCTCCCGACGCGGGGAGGCTATTCTGCCCATTTGG
GGACACTTCCCCGCCGCTGCCAGGACCCGCTTCTCTGAAAGGCTCT
CCTTGCAGCTGCTTAGACGCTGGATTTTTTTCGGGTAGTCGAAAAC
CAGCAGCCTCCCGCGACGATGCCCCTCAACGTTAGCTTCACCAACA
GGAACTATGACCTCGACTACGACTCGGTGCAGCCGTATTTCTACTG
CGACGAGGAGGAGAACTTCTACCAGCAGCAGCAGCAGAGCGAGCTG
CAGCCCCCGGCGCCCAGCGAGGATATCTGGAAGAAATTCGAGCTGC
TGCCCACCCCGCCCCTGTCCCCTAGCCGCCGCTCCGGGCTCTGCTC
G000TCCTACGTTGCGGTCACACCCTTCTCCCTTCGGGGAGACAAC
GAGGGCGGTGGCGGGAGCTTCTCCAGGCCGACCCAGCTGGAGATGG
TGACCGAGCTGCTGGGAGGAGACATGGTGAACCAGAGTTTCATCTG
CGACCCGGACGACGAGACCTTCATCAAAAACATCATCATCCAGGAC
TCTATGTGGAGCGGCTTCTCGCCCGCCGCCAACCTCGTCTCAGAGA
AGCTGGCCTCCTACCAGGCTGCGCGCAAAGACAGCGGCAGCCCGAA
CCCCGCCCGGCCCACAGCGTCTGCTCCACCTCCAGCTGTGTACCTG
CAGGATCTGAGCGCCGCCGCCTCAGAGTGCATCGACCCCTCGGTGG
TCTTCCCCTACCCTCTCAACGACAGCAGCTCGCCAAGGTCCTGCGC
CTGCAAGACTCAGCGTTCTCTCCGTCCTCGGCAATTCGTCTCGCTC
TCCTCGACGGAGTCCTCCCCGCAGGGCAGCCCCGAGCCCCTGGTGC
TCCATGAGGAGACACCGCCCACCACCAGCAGCGACTCTGAGGAGGA
ACAAGAAGATGAGGAAGAAATCGATCTTGTTTCTGTGGAAAAGAGG
CACGCTCCTGGCAAAAGGTCAGAGTCTGGATCACCTTCTGCTGGAG
GCCACAGCAAACCTCCTCACAGCCCACTGGTCCTCAAGAGGTGCCA
CGTCTCCACACATCAGCACAACTACGCACCGCCTCCCTCCACTCCG
AAGGACTATCCTGCTGCAAGAGGGTCAAGTTGGACAGTGTCAGAGG
TCCTGAGACAGATCAGCAACAACCGAAAATGCACCAGCCCCAGGTC
CTCGGACACCGAGGAGAATGTCAAGAGGCGAACACACAACGTCTTG
GAGCGCCAGAGGAGGAACCAGCTAAAACGGAGCTTTTTTGCCCTGC
GTGACCAGATCCCGGAGTTGGAAAACAATGAAAAGGCCCCCAAGGT
AGTTATCCTTAAAAAAGCCACAGCATACATCCTGTCCGTCCAAGCA
GAGGAGCAAAACCTCATTTCTGAAGAGCACTTCTTGCGGAAACGAC
GAGAACAGTTGAAACACAAACTTGAACAGCTACGGAACTCTTGTGC
GTAAGGAAAAGTAAGGAAAACGATTCCTTCTAACAGAAATGTCCTG
AGCAATCACCTATGAACTTGTTTCAAATGCATGATCAAATGCAACC
TCACAACCTTGCCTGAGTCTTGAGACTGAAAGATTTAGCCATAATG
TAAACTGCCTCAAATTGGACTTTGGGCATAAAAGAACTTTTTTATG
CTTACCATCTTTTTTTTTTCTTTAACAGATTTGTATTTAAGAATTG
TTTTTAAAAAATTTTAAGATTTACACAATGTTTCTCTGTAAATATT
GCCATTAAATGTAAATAACTTTAATAAAACGTTTATAGCAGTTACA
CAGAATTTCAATCCTAGTATATAGTACCTAGTATTATAGGTACTAT
AAACCCTAATTTTTTTTATTTAAGTACATTTTGCTTTTTAAAGTTG
ATTTTTTTCTATTGTTTTTAGAAAAAATAAAATAACTGGCAAATAT
ATCATTGAGCCAAATCTTAAAAAAAAAAAAAAA
8 Human c-Myc amino MDFFRVVENQQPPATMPLNVSFTNRNYDLDYDSVQPYFYCDEEENF
acid sequence  YQQQQQSELQPPAPSEDIWKKFELLPTPPLSPSRRSGLCSPSYVAV
(NCBI ref  TPFSLRGDNDGGGGSFSTADQLEMVTELLGGDMVNQSFICDPDDET
NP_002458.2) FIKNIIIQDCMWSGFSAAAKLVSEKLASYQAARKDSGSPNPARGHS
VCSTSSLYLQDLSAAASECIDPSVVFPYPLNDSSSPKSCASQDSSA
FSPSSDSLLSSTESSPQGSPEPLVLHEETPPTTSSDSEEEQEDEEE
IDVVSVEKRQAPGKRSESGSPSAGGHSKPPHSPLVLKRCHVSTHQH
NYAAPPSTRKDYPAAKRVKLDSVRVLRQISNNRKCTSPRSSDTEEN
VKRRTHNVLERQRRNELKRSFEALRDQIPELENNEKAPKVVILKKA
TAYILSVQAEEQKLISEEDLLRKRREQLKHKLEQLRNSCA
9 Human Nanog gene ATTATAAATCTAGAGACTCCAGGATTTTAACGTTCTGCTGGACTGA
sequence GCTGGTTGCCTCATGTTATTATGCAGGCAACTCACTTTATCCCAAT
(NM_024865.2) TTCTTGATACTTTTCCTTCTGGAGGTCCTATTTCTCTAACATCTTC
CAGAAAAGTCTTAAAGCTGCCTTAACCTTTTTTCCAGTCCACCTCT
TAAATTTTTTCCTCCTCTTCCTCTATACTAACATGAGTGTCGATCC
AGCTTGTCCCCAAAGCTTCCCTTGCTTTGAAGCATCCGACTCTAAA
GAATCTTCACCTATGCCTGTGATTTGTGGGCCTGAAGAAAACTATC
CATCCTTGCAAATGTCTTCTGCTGAGATGCCTCACACGGAGACTGT
CTCCCTCTTCCTTCCTCCATGGATCTGCTTATTCAGGACCAGCCCT
GATTCTTCCACCAGTCCCAAAGGCAAACAACCCACTTCTGCAGAGA
AGAGTGTCGCAAAAAAGGAAGACAAGGTCCCGGTCAAGAAACAGAA
GACCAGAACTGTGTTCTCTTCCACCCAGCTGTGTGTACTCAATGAT
AGATTTCAGAGACAGAAATACCTCAGCCTCCAGCAGATGCAAGAAC
TCTCAACATCCTGAACCTCAGCTACAAACAGGTGAAGACCTCGGTT
CCAGAACCAGAGAATGAAATCTAAGAGGTGGCAGAAAAACAACTGG
CCGAAGAATAGCAATGGTGTGACGCAGAAGGCCTCAGCACCTACCT
ACCCCAGCCTTTACTCTTCCTACCACCAGGGATGCCTGGTGAACCC
GACTGGGAACCTTCCAATGTGGAGCAACCAGACCTGGAACAATTCA
ACCTGGAGCAACCAGACCCAGAACATCCAGTCCTGGAGCAACCACT
CCTGGAACACTCAGACCTGGTGCACCCAATCCTGGAACAATCAGGC
CTGGAACAGTCCCTTCTATAACTGTGGAGAGGAATCTCTGCAGTCC
TCCATGCAGTTCCAGCCAAATTCTCCTGCCAGTGACTTGGAGGCTG
CCTTGGAAGCTGCTGGGGAAGGCCTTAATGTAATACAGCAGACCAC
TAGGTATTTTAGTACTCCACAAACCATGGATTTATTCCTAAACTAC
TCCATGAACATGCAACGAAGACGTGTGAAGATGAGCTGAAACCTGA
TATTACTCAATTTCAGTCTCGACACTCGCTGAATCCTTCCTCTCCC
CTCCTCCCATCCCTCATAGGATTTTTCTTGTTTGGAAACCACGTGT
TCTGGTTTCGATGATGCCCATCCAGTCAATCTCATGGAGCGTGGAG
TATGGTTGGAGCCTAATCAGCGAGGTTTCTTTTTTTTTTTTTTTCC
TATTCGATCTTCCTGGAGAAAATACTTTTTTTTTTTTTTTTTTTGA
AACGGAGTCTTGCTCTGTCGCCCAGGCTGGAGTGCAGTGGCGCGGT
CTTGGCTCACTGCAAGCTCCGTCTCCCGGGTTCACGCCATTCTCCT
CCCTCAGCCTCCCGAGCACCTGCGACTACAGGCGCCCGCCACCTCG
CCCGGCTAATATTTTGTATTTTTAGTAGAGACGGGGTTTCACTGTG
TTAGCCAGGATGGTCTCGATCTCCTGACCTTGTGATCCACCCGCCT
CGGCCTCCCTAACAGGTGGGATTTACAGGCGTGAGCCACCGCGCCC
TGCCTAGAAAAGACATTTTAATAACCTTGGCTGCCGTCTCTGGCTA
TAGATAAGTAGATCTAATACTAGTTTGGATATCTTTAGGGTTTAGA
ATCTAACCTCAAGAATAAGAAATACAAGTACAAATTGGTGATGAAG
ATCTATTCGTATTGTTTCCGATTGGCACGCTTTGCTTATTTTTTAA
AAACTATTGAGGTAAAGGGTTAAGCTGTAACATACTTAATTGATTT
CTTACCGTTTTTGGCTCTGTTTTGCTATATCCCCTAATTTGTTGGT
TGTGCTAATCTTTGTAGAAAGAGGTCTCGTATTTGCTGCATCGTAA
TGACATGAGTACTCCTTTAGTTGGTTTAAGTTCAAATGAATGAAAC
AACTATTTTTCCTTTAGTTGATTTTACCCTGATTTCACCGAGTGTT
TCAATGAGTAAATATACAGCTTAAACAT
10 Human Nanog amino MSVDPACPQSLPCFEASDCKESSPMPVICGPEENYPSLQMSSAEMP
acid sequence HTETVSPLPSSMDLLIQDSPDSSTSPKGKQPTSAEKSVAKKEDKVP
(NP_079141) VKKQKTRTVFSSTQLCVLNDREQRQKYLSLQQMQELSNILNLSYKQ
VKTWFQNQRMKSKRWQKNNWPKNSNGVTQKASAPTYPSLYSSYHQG
CLVNPTGNLPMWSNQTWNNSTWSNQTQNIQSWSNHSWNTQTWCTQS
WNNQAWNSPFYNCGEESLQSCMQFQPNSPASDLEAALEAAGEGLNV
IQQTTRYFSTPQTMDLFLNYSMNMQPEDV
11 Human Lin28 gene GTGCGGGGGAAGATGTAGCAGCTTCTTCTCCGAACCAACCCTTTGC
sequence CTTCCGACTTCTCCGGCGCCAGGAGCCGCCCGACCAGGGCCCCGGG
(NM_024674) GCCACGGGCTCAGCCGACCACCATGCGCTCCGTGTCCAACCAGGAG
TTTGCAGGTGGCTGCGCCAAGGCGGCAGAAGAGGCGCCCGAGGAGG
CGCCGGAGGACGCGGCCCGGGCGGCGGACGAGCTCAGCTCGCTGCA
CGGTGCGGGCATCTGTAAGTGGTTCAACGTGCGCATGGGGTTCGGC
TTCCTGTCCATGACCGCCCGCGCCGCGGTCGCGCTCGACCCCCCAG
TGATGTCTTTGTGCACCAGAGTAAGCTGCACATGGAAGGGTCTCCG
GAGCTTGAAGGAGGGTGAGGCAGTGGAGTTCACCTTTAAGAAGTCA
GCCAAGGGTCTGGAATCCATCCGTGTCACCGGACCTGGTGGAGTAT
TCTGTATTGGGAGTGAGAGGCGGCCAAAAGGAAAGAGCATGCAGAA
GCGCAGATCAAAAGGAGACAGGTGCTACAACTGTGGAGGTCTAGAT
CATCATGCCAAGGAATGCAAGCTGCCACCCCAGCCCAAGAAGTGCC
ACTTCTGCCAGAGCATCAGCCATATGGTAGCCTCATGTCCGCTGAA
GGCCAGGAGGGCCCTAGTGCACAGGGAAAGCCAACCCTACTTTCGA
GAGGAAGAAGAAGAAATCCACAGCCCTACCCTGCTCCCGGAGGCAC
AGAATTGAGCCACAATGGGTGGGGGCTATTCTTTTGCTATCAGGAA
CTTTTGAGGACCAGGCAGAGTGGAGAAAGTGGCAATAGCCTGCATT
GGGGCTAGTTGGCACTCCCATGTATCTCAGGCTTGGGTTCACACCA
TCACCCTTTCTTCCCTTAGGTGGGGGGAAACGGGTGAGTCAAAGGA
ACTCCAACCATGCTCTGTCCAAATGCAAGTGAGGGTTCTGGGGGCA
ACCAGGAGGCGCCAATCACCCTACAACCTCCATACTTTGAGTCTCC
ATCCCCAGAATTTCCAGCTTTTGAAAGTGGCCTGGATAGGGAAGTT
GTTTTCCTTTTAAAGAAGGATATATAATAATTCCCATGCCAGAGTG
AAATGATTAAGTATAAGACCAGATTCATGGAGCCAAGCCACTACAT
TCTGTGGAAGGAGATCTCTCAGGAGTAAGCATTCTTTTTTTTTCAC
ATCTTGTATCCTCATACCCACTTTTGGGATAGGCTGCTGCCAGCTC
TCCCAAGCAATGGGTAATGATGATGGCAAAAAGGGTGTTTGGGGGA
ACAGCTGCAGACCTGCTGCTCTATGCTCACCCCCGCCCCATTCTGG
GCCAATGTGATTTTATTTATTTGCTCCCTTGGATACTGCACCTTGG
GTCCCACTTTCTCCAGGATGCCAACTGCACTAGCTGTGTGCGAATG
ACGTATCTTGTGCATTTTAACTTTTTTTCCTTAATATAAATATTCT
GGTTTTGTATTTTTGTATATTTTAATCTAAGGCCCTCATTTCCTGC
ACTGTGTTCTCAGGTACATGAGCAATCTCAGGCATAGCCAGGAGCA
GCTCCAGGTCTGCGCAGGAGGAATTACTTTTTGTTGTTTTTGCCAC
CGTGGAGAGCAACTATTTGGAGTGCACAGCCTATTGAACTACCTCA
TTTTTGCCAATAAGAGCTGGCTTTTCTGCCATAGTGTCCTCTTGAA
ACCCCCTCTGCCTTGAAAATGTTTTATGGGAGACTAGGTTTTAACT
GGGTGGCCCCATGACTTGATTGCCTTCTACTGGAAGATTGGGAATT
AGTCTAAACAGGAAATGGTGGTACACAGAGGCTAGGAGAGGCTGGG
CCCGGTGAAAAGGCCATAGAGCAAGCCAAGATTAGGTGAGGGTTGT
CTAATCCTATGCCACAGGACGTGCTTTACATCTCCAGATCTGTTCT
TCACCAGATTAGGTTAGGCCTACCATGTGCCACAGGGTGTGTGTGT
GTTTGTAAAACTAGAGTTGCTAAGGATAAGTTTAAAGACCAATACC
CCTGTACTTAATCCTGTGCTGTCGAGGGATGGATATATGAAGTAAG
GTGAGATCCTTAACCTTTCAAAATTTTCGGGTTCCAGGGAGACACA
CAAGCGAGGGTTTTGTGGTGCCTGGAGCCTGTGTCCTGCCCTGCTA
CAGTAGTGATTAATAGTGTCATGGTAGCTAAAGGAGAAAAAGGGGG
TTTCCTTTACACGCTGTGAGATCACCGCAAACCTACCTTACTGTCT
TGAAACGGGACAAATGAATAGAACGCATTGGGTGGTGTGTGTCTG
ATCCTGGGTTCTTGTCTCCCCTAAATGCTGCCCCCCAAGTTACTGT
ATTTGTCTGGGCTTTGTAGGACTTCACTACGTTGATTGCTAGGTGG
CCTACTTTCTCTAAATATAATCTATTGCTCTTTCTCCGTCTTCTTT
GGGGGTTTTGTTTACAAACTTCTTTTTGTATTGAGAGAAAAATAGC
CAAAGCATCTTTGACAGAAGGTTCTGCACCAGGCAAAAAGATCTGA
AACATTAGTTTGGGGGGCCCTCTTCTTAAAGTGGGGATCTTGAACC
ATCCTTTCTTTTGTATTCCCCTTCCCCTATTACCTATTACACCAGA
TCTTCTGTCCTAAAAACTTGTCTTCTACCCTCCCCTCTTTTCTGTT
CACCCCCAAAAGAAAACTTACACACCCACACACATACACATTTCAT
GCTTGGAGTGTCTCCACAACTCTTAAATGATGTATGCAAAAATACT
GAAGCTAGGAAAACCCTCCATCCCTTGTTCCCAACCTCCTAAGTCA
AGACCATTACCATTTCTTTCTTTCTTTTTTTTTCTTTTTTAAAATG
GAGTCTCACTGTGTCACCCAGGCTGGAGTGCAGTGGCATGATCGGC
TCACTGCAGCCTCTGCCTCTTGGGTTCAAGTGATTCTCCTGCCTCA
GCCTCCTGACTAGCTGGGATTTCAGCCACCCGCCACACTCAGCTAA
TTTTTGTATTTTTAGTAGAGACCCGCTTTCACCATGTTGTCCAGGC
TGGTC7GGAACTCCTGACC7CAGGTGATCTG000ACCTTGGCTTCC
CAAAGTGCTGGGATTACAGGCATGAGCCACCATGCTGGGCCAACCA
TTTCTTGGTGTATTCATGCCAAACACTTAAGACACTGCTGTAGCCC
AGGCGCGGTGGCTCACACCTGTAATCCCACCACTTTGGAAGGCTGA
GGCGGGCGGATCACAAGGTCACGAGTTCAAAACTATCCTGGCCAAC
ACACTGAAACCCCGTCTCTACTAAAATACAAAAAAATTAGCCGGGT
CTGGTGCTCCATGCCTTTAGTCCTAGCTATTCAGGAGCCTGAGGCA
GGGGAATCGCTTGAACCCGAGAGGCAGAGGTTGCACTGAGCTGAGA
TCGCACCACTGCACTCCAGCCTCGTTACACAGCAAGACTCTGTCTC
AAACAAAACAAAACAAAACAAAAACACACTACTGTATTTTGGATGG
ATCAAACCTCCTTAATTTTAATTTCTAATCCTAAAGTAAAGAGATG
CAATTGGGGGCCTTCCATGTAGAAAGTGGGGTCAGGAGGCCAAGAA
AGGGAATATGAATGTATATCCAAGTCACTCAGGAACTTTTATGCAG
GTCCTAGAAACTTTATCTCAAACTGCCCACAAGATTGTTTAATAGG
AGACGAACGAATGTAACTCCATGTTTACTGCTAAAAACCAAAGCTT
TGTCTAAAATCTTGAATTTATGGGGCCGGAGGGTAGGAAAGCCTGT
ACCTCTCTGTTTTTTTCCTGATCCTTTTCCCTCATTCCTGAACTGC
AGGAGACTGAGCCCCTTTGGCCTTTCGTGACCCCATCACTGCGCTG
TGTTTATTTGATGGTTGATTTTGCTGTACTGGCTACTTCCTTTCCC
ATTTTCTAATCATTTTTTAACACAAGCTGACTCTTCCCTTCCCTTC
TCCTTTCCCTGGGAAAATACAATGAATAAATAAAGACTTATTGGTA
CGCAAACTCTCA
12 Human Lin28 amino MGSVSNQQFACGCAKAAEHAPEEAPEDAARAADEPOLLHGAGICKW
acid sequence FNVRMCFGELSMTARAGVALDPPVDVFVHQSKEHMEGFRSLKEGEA
(NP_078950) VEFTFKKSAKGLESTRVTGPGGVECIGSERRPKGKSMQKRRSKGDR
CYNCGGLDHHAKECKLPPQPKKCHFCQSISHMVASCPLKAQQGPSA
QGKPTYFREEEEEIHSPTLLPEAQN

REFERENCES

  • 1. Takahashi, K. & Yamanaka, S., Induction of pluripotent stem cells from mouse embryonic and adult fibroblast cultures by defined factors. Cell 126 (4), 663-676 (2006).
  • 2. Takahashi, K. et al., Induction of pluripotent stem cells from adult human fibroblasts by defined factors. Cell 131 (5), 861-872 (2007).
  • 3. Yu, J. et al., Induced pluripotent stem cell lines derived from human somatic cells. Science 318 (5858), 1917-1920 (2007).
  • 4. Marion, R. M. et al., A p53-mediated DNA damage response limits reprogramming to ensure iPS cell genomic integrity. Nature 460 (7259), 1149-1153 (2009).
  • 5. Li, H. et al., The Ink4/Arf locus is a barrier for iPS cell reprogramming. Nature 460 (7259), 1136-1139 (2009).
  • 6. Banito, A. et al., Senescence impairs successful reprogramming to pluripotent stem cells. Genes Dev 23 (18), 2134-2139 (2009).
  • 7. Utikal, J. et al., Immortalization eliminates a roadblock during cellular reprogramming into iPS cells. Nature 460 (7259), 1145-1148 (2009).
  • 8. Kawamura, T. et al, Linking the p53 tumour suppressor pathway to somatic cell reprogramming. Nature 460 (7259), 1140-1144 (2009).
  • 9. Campisi, J. & d'Adda di Fagagna, F., Cellular senescence: when bad things happen to good cells. Nat Rev Mol Cell Blot 8 (9), 729-740 (2007).
  • 10. Collado, M., Blasco, M. A., & Serrano, M., Cellular senescence in cancer and aging. Cell 130 (2), 223-233 (2007).
  • 11. Zhang, R., Chen, W., & Adams, P. D., Molecular dissection of formation of senescence-associated heterochromatin foci. Mol Cell Blot 27 (6), 2343-2358 (2007).
  • 12. Liao, J. et al., Enhanced efficiency of generating induced pluripotent stem (iPS) cells from human somatic cells by a combination of six transcription factors. Cell Res 18 (5), 600-603 (2008).
  • 13. Hanna, J. et al., Direct cell reprogramming is a stochastic process amenable to acceleration. Nature 462 (7273), 595-601 (2009).
  • 14. Yu, J. et al., Human Induced Pluripotent Stem Cells Free of Vector and Transgene Sequences. Science (2009).
  • 15. Krishnamurthy, J. et al., Ink4a/Arf expression is a biomarker of aging. J Clin Invest 114 (9), 1299-1307 (2004).
  • 16. Zhang, W. et al., Comparison of global DNA methylation profiles in replicative versus premature senescence. Life Sci 83 (13-14), 475-480 (2008).
  • 17. Marion, R. M. et al., Telomeres acquire embryonic stem cell characteristics in induced pluripotent stem cells. Cell Stem Cell 4 (2), 141-154 (2009).
  • 18. Assou, S. et al., A meta-analysis of human embryonic stem cells transcriptome integrated into a web-based expression atlas. Stem Cells 25 (4), 961-973 (2007).
  • 19. Guenther, M. G. et al., Chromatin structure and gene expression programs of human embryonic and induced pluripotent stem cells. Cell Stem Cell 7 (2), 249-257.
  • 20. Passos, J. F. et al., Mitochondrial dysfunction accounts for the stochastic heterogeneity in telomere-dependent senescence. PLoS Biol 5 (5), el 10 (2007).
  • 21. Moiseeva, O., Bourdeau, V. Roux, A. Deschenes-Simard, X. & Ferbeyre, G. Mitochondrial dysfunction contributes to oncogene-induced senescence. Mol Cell Biol 29 (16), 4495-4507 (2009).
  • 22. Prigione, A., Fauler, B., Lurz, R., Lehrach, H., & Adjaye, J., The senescence-related mitochondrial/oxidative stress pathway is repressed in human induced pluripotent stem cells. Stem Cells 28 (4), 721-733 (2010).
  • 23. Park, I. H. et al., Reprogramming of human somatic cells to pluripotency with defined factors. Nature 451 (7175), 141-146 (2008).
  • 24. Assou, S. et al., A gene expression signature shared by human mature oocytes and embryonic stem cells. BMC Genomics 10, 10 (2009).
  • 25. Matsuura, F. et al., Senescent phenotypes of skin fibroblasts from patients with Tangier disease. Biochemical and biophysical research communications 357 (2), 493-498 (2007).
  • 26. Ludwig, T. E. et al., Feeder-independent culture of human embryonic stem cells. Nat Methods 3 (8), 637-646 (2006).
  • 27. Freberg, C. T., Dahl, J. A., Timoskainen, S., & Collas, P., Epigenetic Reprogramming of OCT4 and NANOG regulatory regions by embryonal carcinoma cell extract. Molecular biology of the cell 18 (5), 1543-1553 (2007).

Claims

1-15. (canceled)

16. Rejuvenated induced pluripotent stem cells (iPSCs) obtained by a method comprising the steps of:

a) providing a cell composition obtained from an adult human subject that is at least 50 years old and,

b) culturing said cell composition under appropriate conditions for reprogramming said cell composition into rejuvenated iPSCs, wherein said appropriate conditions comprise increasing expression in said cell composition of at least the following combination of reprogramming factors:

i. a reprogramming factor encoded by one gene of the Oct gene family,

ii. a reprogramming factor encoded by one gene of the Klf gene family,

iii. a reprogramming factor encoded by one gene of the Sox gene family,

iv. a reprogramming factor encoded by one gene of the Myc gene family,

v. Lin28,

vi. and Nanog,

thereby obtaining rejuvenated iPSC cells in which the expression of p21CIP1 and p16INK4A is downregulated to a level found in human embryonic stem cells (hESC).

17. The rejuvenated iPSCs of claim 16, wherein said combination of reprogramming factors comprises Oct4, Klf4, Sox2, c-Myc, Lin28 and Nanog.

18. The rejuvenated iPSCs of claim 16, wherein said cell composition comprises or consists of senescent cells.

19. The rejuvenated iPSCs of claim 18, wherein said senescent cells are obtained from a subject suffering from age-related disorders leading to a high proportion of senescent cells.

20. The rejuvenated iPSCs of claim 16, wherein said method does not further comprise a step of silencing senescence effectors in said cell composition.

21. The rejuvenated iPSCs of claim 20, wherein said senescence effectors include p21CIP and/or p16INK4a and/or p53.

22. The rejuvenated iPSCs of claim 16, wherein said conditions for increasing expression of the reprogramming factors comprise

a) introducing one or more expression vectors comprising coding sequences of said combination of reprogramming factors into said cell composition; or,

b) directly delivering an effective amount of each precursor RNA of the reprogramming factors into said cell composition.

23. The rejuvenated iPSCs of claim 22, wherein said step of introducing is performed by transfecting said cell composition with said one or more expression vectors.

24. Differentiated cells obtained by differentiation of the rejuvenated iPSCs of claim 16 into a desired cell lineage.

Resources

Sources:

Similar patent applications:

Recent applications in this class:

Recent applications for this Assignee: