Patent application title:

AVIAN COLONY STIMULATING FACTOR 1 RECEPTOR BINDING PROTEINS

Publication number:

US20170002051A1

Publication date:
Application number:

15/206,627

Filed date:

2016-07-11

Abstract:

The present invention provides avian CSF1 genes encoding proteins which bind avian colony stimulating factor 1 receptor (CSF1R) and which exhibit immunomodulatory properties.

Inventors:

Interested in similar patents?

Get notified when new applications in this technology area are published.

Classification:

C12Q1/6888 »  CPC further

Measuring or testing processes involving enzymes, nucleic acids or microorganisms ; Compositions therefor; Processes of preparing such compositions involving nucleic acids; Nucleic acid products used in the analysis of nucleic acids, e.g. primers or probes for detection or identification of organisms

A61K2039/55527 »  CPC further

Medicinal preparations containing antigens or antibodies characterised by a specific combination antigen/adjuvant; Organic adjuvants; Cytokines; Lymphokines; Interferons Interleukins

C07K14/53 »  CPC main

Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans; Cytokines; Lymphokines; Interferons Colony-stimulating factor [CSF]

C12Q1/68 IPC

Measuring or testing processes involving enzymes, nucleic acids or microorganisms ; Compositions therefor; Processes of preparing such compositions involving nucleic acids

C07K14/54 »  CPC further

Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans; Cytokines; Lymphokines; Interferons Interleukins [IL]

A61K39/39 »  CPC further

Medicinal preparations containing antigens or antibodies characterised by the immunostimulating additives, e.g. chemical adjuvants

Description

RELATED APPLICATIONS

This application is a continuation of U.S. application Ser. No. 13/380,185, filed Mar. 12, 2012, now allowed, which is a 35 U.S.C. §371 national phase entry of PCT Application PCT/GB2010/001221, filed Jun. 22, 2010, and published in English on Dec. 29, 2010, as International Publication No. WO 2010/149960 A1, and which claims the priority to United Kingdom Application No. 0910833.3, filed Jun. 23, 2009, the disclosure of each of which is incorporated herein by reference in its entirety.

STATEMENT REGARDING ELECTRONIC FILING OF A SEQUENCE LISTING

A Sequence Listing in ASCII text format, submitted under 37 C.F.R. §1.821, entitled 9013-115TSCT_ST25.txt, 18,021 bytes in size, generated on Jul. 8, 2016, and filed via EFS-Web, is provided in lieu of a paper copy. This Sequence Listing is hereby incorporated by reference into the specification for its disclosures.

FIELD OF THE INVENTION

The present invention relates to newly identified avian genes which encode proteins which bind avian colony stimulating factor 1 receptor (CSF1R). Through binding to CSF1R, these proteins exhibit immunomodulatory properties which may be exploited to modulate the avian immune system as well as effects on cell growth, differentiation and/or proliferation, organ/tissue development and vaccine efficacy.

BACKGROUND OF THE INVENTION

Mononuclear phagocytes are derived from progenitor cells in the bone marrow which differentiate into blood monocytes and then enter the tissues to occupy specific niches (Hume et al. 2002). They constitute the first line of defense against pathogens, maintain homeostasis, and have trophic functions ranging from bone morphogenesis to neuronal patterning in sexual development, from angiogenesis to adipogenesis (Pollard 2009). Macrophage colony-stimulating factor (CSF1) is required for normal differentiation, proliferation and survival of macrophage lineage cells (Sweet and Hume 2003; Chitu and Stanley 2006; Bonifer and Hume 2008). Mice and rats bearing mutations in the CSF1 gene (i.e. op/op mice and tl/tl rats) show a mononuclear phagocyte deficiency, and their important developmental abnormalities, such as reduced somatic growth, perinatal mortality, osteopetrosis, neurological and reproductive defects, highlight many of the macrophage trophic roles mentioned above (Marks et al. 1992; Pollard 1997, 2009; Ryan et al. 2001).

Although CSF-1 exists in a number of isoforms, most biochemical studies have focused on the minimal biologically active fragment i.e. the 154 N-terminal amino acids, common to all isoforms. In a full-length CSF1 molecule, this receptor-binding region is preceded by a 32-amino-acid signal peptide, and followed by a variable spacer region, a 24-amino-acid transmembrane region and a 35-amino-acid cytoplasmic tail. The tertiary structure of the active fragment of CSF1 forms a short-chain four-helical bundle (A, B, C and D) with small regions of beta-sheet (1 and 2). The helices are paired into A-C and B-D by intrachain disulfide bonds, while one interchain disulfide bond generates a mature homodimer with a two-fold rotation axis (Pandit et al. 1992). The crystal structure of mouse CSF1 bound to its receptor, CSF1R, was recently solved to a resolution of 2.4 ā„«, showing that CSF1 N-terminal segment (residues 6-15), helix B (residues 55-66) and helix C (residues 79-85) are implicated in receptor binding. (PDB code 3EJJ) (Chen et al. 2008).

All CSF1 effects are mediated through binding to the CSF1 receptor (CSF1R), a glycoprotein of 165 kDa that is encoded by the c-fms proto-oncogene (Dai et al. 2002). CSF1R is a member of the type III protein tyrosine kinase family, along with PDGFRA, PDGFRB and c-kit, and shares with other family members a characteristic extracellular region of five immunoglobulin-like domains (D1 to D5), a single transmembrane helix and a intracellular tyrosine kinase domain (Rosnet and Birnbaum 1993). CSF-1 associates tightly with the receptor (KD=0.4 nM at 37° C.) in a 2:2 stoichiometry (Guilbert and Stanley 1986). This binding involves the CD loop (residues 141-151) and the EF loop (residues 168-173) of D2, as well as the BC and DE loops (residues 231-232 and 250-257 respectively) of D3 (Chen et al. 2008).

The expression of CSF1R on the cell surface is amongst the earliest events in macrophage lineage commitment, and is mostly restricted to these cells throughout embryonic development as well as in adults (Lichanska et al. 1999) Like other myeloid promoters, the proximal CSF1R promoter lacks the classic TATA box and GC-rich sequences but contains recognition sites for AML1 transcription factors, and for transcription factors of the C/EBP and Ets families, including the myeloid-restricted transcription factor PU.1 (Reddy et al. 1994; Himes et al. 2005; Bonifer and Hume 2008). Expression of CSF1R is also controlled by FIRE (Fms Intronic Regulatory Element) a highly-conserved enhancer element in the first intron (Himes et al. 2001; Sasmono et al. 2003).

Most of the phenotypic defects seen in the op/op mice including reproductive defects and perturbations in organ development, are even more severe in the CSF1R knockout mice (Dai et al. 2002). First attributed to the availability of maternal-derived CSF1, these observations can now be explained by the recent discovery of a second ligand for the human CSF1R, designated IL34, with an activity on monocyte viability. IL34 was purified as a homodimer composed of 241-amino acid monomers, and shown to be expressed mostly in the brain but also in many other tissues including heart, spleen, lung, liver, kidney and thymus (Lin et al. 2008).

WO2008/031172 describes the use of CSF1 to promote organ development in warm-blooded animals and in particular premature human foetuses/embryos. Furthermore, WO03/028752 describes methods and compositions for modulating immune responses in animals, said methods comprising modulating CSF1 activity.

The chicken has been used widely in studies of early embryonic myelopoiesis (Lichanska et al. 1999; Lichanska and Flume 2000), but compared to our knowledge of the mammalian mononuclear phagocyte system, our knowledge of avian systems is rather limited and neither WO2008/031172 or WO03/028752 describe the existence of an avian CSF1 gene. Indeed, there are only two characterized colony-stimulating factors in chickens. Chicken GM-CSF (CSF2) has been cloned and shown to drive the proliferation of chicken bone marrow cells (Avery et al. 2004). The other described chicken CSF, myelomonocytic growth factor, has recently been shown to be the chicken ortholog of G-CSF (CSF3) (Gibson et al. 2009). Apparent orthologs of the GM-CSF receptor alpha chain, and the beta chain, shared with the IL3 receptor, are annotated in the chicken genome (Ensembl). So far, no function for the CSF1R has been demonstrated in birds, CSF1 was believed to be absent from avian genomes and IL34 had not been recognized (Kaiser 2007).

CSF1 and IL34 in humans were reported to have little obvious homology, and in mammals at least, CSF1 has evolved rather rapidly. The existence of two ligands for a single receptor is difficult to maintain across evolution if they evolve independently of each other and of the receptor.

SUMMARY OF THE INVENTION

The present invention concerns the identification of novel avian genes encoding proteins which bind avian colony stimulating factor 1 receptor (CSF1R). In particular, the invention describes, for the first time, the existence of avian genes encoding colony stimulating factor 1 (CSF1) and interleukin 34 (IL34). It should be noted that these findings contradict the statement by Kaiser (2007) that there is no CSF1 equivalent present in the avian genome.

Furthermore, the inventors have surprisingly discovered that the avian CSF1R is expressed by macrophages—this is in contrast to other species, for example fish, where the CSF1R is expressed in other cell types.

In view of the avian CSF1R expression profile, the inventors have discovered that through binding to CSF1R, avian CSF1 and IL34 exhibit immunomodulatory properties which may be exploited to modulate the avian immune system as well as effects on cell growth, differentiation and/or proliferation, organ/tissue development and vaccine efficacy.

It should be understood that references to the terms ā€œavianā€ or ā€œavian speciesā€ should be taken to encompass all species within the Class, Ayes and in particular those species classified as belonging to the Order, Galliformes and/or the Genus, Gallus. Avian species now known to harbour CSF1 and IL34 genes may include, for example, Gallus gallus otherwise known as the domestic chicken and/or other poultry or fowl species. In other embodiments, the term ā€œavianā€ may be construed as including species classified within the Order, Passeriformes, such as, for example, finches, in particular, the zebra finch. In general, the terms ā€œavian CSF1 geneā€, ā€œavian IL34 geneā€, ā€œavian IL34 proteinā€ and ā€œavian CSF1 proteinā€ encompass CSF1 and/or IL34 genes, proteins (and fragments thereof) present in, or encoded by, the genomes of the avian species described herein.

The inventors have ascertained the sequences of certain avian forms of CSF1 and the cDNA sequence of an exemplary CSF1 gene, present in the Gallus gallus genome, is given below as SEQ ID NO: 1:

SEQā€ƒIDā€ƒNO:ā€ƒ1
ATAAAGGGCAGCGCGGCGGCGACGGCGGACTCAGCCCGGCCCCGCTCCGC
CGCCTTCTCCCGCACCGCCCGACCCGCCGCAGCCCCGGCCCCACGGCAGC
CCCCATGCCCCGCCTCGGATCCCAGGTGTCCCTGTTCCGCTGCACCCTGC
TCTCGTCCCTCCTCCTCGTCTGCAGCATCCATGAGACGGAGCAGAACAGC
TACTGCCAGCAGATCATCACCGAGCGGCACCTGGACCACCTGCAGGAGCT
GGCGGACACGCAGATGCAGCAGCCGGGCACAGTGTCCTTCAGATTCATCA
GCAAGATGCGGCTGAGCGACTCTGTCTGCTACGTGAAAGCCGCCTTCCCT
TTGCTGGGCACCATCCTGAACAGGACGACGTTCAAGGAGAACTCAACAAA
CGCCAACAAGATGAAGACGGTGCGCAAGATGTACGAAAACATCGATGAGA
ACGTGGACCCCTGCATCAGGGACGAGGATGACAAGGAGCACGCGCTGTCC
GAAATGTGCTTTGAGGAGTTCACCACGTCCCCCTACGAGATGCTGGTGCT
GGTGAGGCAGTTCTTCCAGGACATCAAACAGCTGCTGCAGAACAAGGAGA
CCTTCGAGAAGGACTGCAGCCAGGTGTACCGCAGTGCGTGCGCGGGGCCC
CGGCAGCACAGCTCCTCCCCAGGTGTGGGGACAGATCCTGACTGCAATTG
CCTGTCCCCTGCCCTCCCTTCTGCCACCCAGCCCTCCCTCTCCGCTGCCA
CCCGTGCCGGCAGGGACGTGGCGCCCGCTAGCACCAGGGTCCCTTACCGC
CAGCTCGGTGGCATCCTGGCTGAGTTAGGCAGCAGTGCCCCGTCCGAGCC
CCCCAGTAGCGTGGAGGGCAGCTCGGGGGCCGAGGAACTGCCAGGAGCCG
GGCTCGGCGACGCGTCGGCGCCGTCCCCCACCATGCAGCAGACGCTTGGA
GCCCTCCTGGATCCAGCCGCGAGCGCCGGCCCGAAGGCTGAGGACGTATC
CATCCCGTCCCACGGGATGCCGGAGGAGGGCGCCGGGACCCCCGCCCTCC
CACATCGGCTCCCTTCGCCGCGAGGGATCAGCGCGGCGATGCCGGCGGCG
GTCCCCAGCAGCGGCTCTGCGCAGCGCCGCGGGGTCGGGCGCCGTCCCAC
CGAGAGCCCCGAGCGGGTCACGCAGCTCCGCTTCCCCAGGATGGCTCCGC
CGTTGCGGGGCCGGGCGGAGGGCGGCCCCGGGGACGGGGCGAGGGCGCGA
GGCTGGGGGCTGAGCCGGCTGCGGGAGCCCGAGGACGGCGGGGCCGGACC
CAGCTTTGATTCGAGCTTTGTTCTGAGCGCAGAGCAGCGCAGGAAGGAGC
CGCCAGCCGCCAGCGGGGGGCACCGGGAGCTCCTGGTGTACGTCACGGTG
GCCAGCGTGGTGGCCGTGCTGCTGGCCATGGGCGGGCTGCTCTTCTACAA
GTATAAGTCCAAGGTCCTGCAGCGGGGAGCAGCGCTAAAAGAGGGGGGCT
GCGACCCCGAGGAGCCGGAGAGCAGGGCGCTGCAGGGAGCGCAGGGCTGC
GCGGAGCTGGAGACGCAGGAGCTGTGAGGGCCCCCTGCGGGACGTGATGC
TGCTCGGGGGGACGGACGGGGACGCTCCTCGCTGGGCGACGGACGGCTGC
TGCTCGGCCTCCCCCCGCCGCGATGACCCCCAGGCCCTGTCCTGCAGCTG
CAACCCACGGGTGAGGATGGCAGGACGGGGCGGTGCAGCCCTGCAGGACC
CCGGCGATGGGGCGGATGGCACCGAGGGGCTCCACGGGGACGGCATTGGG
TGCCGCGAGTGGAACATCTCCCCCCACCCATCCACGGTTCCCGTTGCTCC
TCTCCCACCCCTGGCACGGGGGGACCCCCGGCGCCCCATGGGGGGACCCC
TCCCGCATCCCACCGGTGCCGAGGACCCAACGCCCGGCCTGCAAAGGGGG
AAACCCTCACACTGTGAATATTTAAGACCCGTGGTGCCGTCCCCATCCCG
CGATCCCAAGCTGGCCTTGGGAGCTGCCCGGCGCCGCTCTGCGCAGGAAG
GCTCTCCACGAACGCGGTGGATAAACGCTTTTATCCAACAAATGCACTTG
GGGGGGGGGGTTCCCCCCTCCCTGCAGGGTTATTGCTGCGAGCTGGCCTC
GCCCCAGACTGGATTTTGTTGCTGGAGCACAGCACGGCAATGGGGCCGTG
GCTGCAGTGTGGGGTTTGGGGGCTCAGCGGTACCCGGACTGCGTCCCACC
CCACACGGCATCCCTGCCCAGCGCCGCTCCCGGGGGGTCGGAAGTGTTAT
TTTTATATTACATGAGATGCAAACGGGACGGAGCACATTGGGGTGTGGTG
GGGTTTTGTTTTTTAAAGCATTAGTATTGATTTTGGGGTTTTTTTTTCTA
TGCGTATTTATGGACTGCCAAAAAAAGAGGCGTTTCCTGGGGGTGATGGG
GGGGGGGGTGGAAGTGGGGTGCAGAGCCGGGCTGGGGCCGGAGCTGGTGC
TGGCTCAGTATGTGGGGTGTGGGTGAGGGGGGTTGGGGGGGGGGCAGCTT
TTGGAGCTCTTTCTGCCTCTGTTGTCTCATTTTTTGTACAGTGAAATGGT
GAAATATTTTATACAAAGTCATTTAAAGAAGTCTATTTAAGGAAAATAAT
AGAAAACAGCTTGTATATTTAATATTATTAATAAAGATGGACGTGCAAAA
AAAAAAAAAAA

The native CSF1 Gallus gallus sequence, comprises eight exons and yields two transcripts, one encoding a protein of 490 amino acids, the other a protein of 270 amino acids. The transcript encoding the longer, 490 amino acid protein is provided below as SEQ ID NO: 2

SEQā€ƒIDā€ƒNO:ā€ƒ2
ATGCCCCGCCTCGGATCCCAGGTGTCCCTGTTCCGCTGCACCCTGCTCTC
GTCCCTCCTCCTCGTCTGCAGCATCCATGAGACGGAGCAGAACAGCTACT
GCCAGCAGATCATCACCGAGCGGCACCTGGACCACCTGCAGGAGCTGGCG
GACACGCAGATGCAGCAGCCGGGCACAGTGTCCTTCAGATTCATCAGCAA
GATGCGGCTGAGCGACTCTGTCTGCTACGTGAAAGCCGCCTTCCCTTTGC
TGGGCACCATCCTGAACAGGACGACGTTCAAGGAGAACTCAACAAACGCC
AACAAGATGAAGACGGTGCGCAAGATGTACGAAAACATCGATGAGAACGT
GGACCCCTGCATCAGGGACGAGGATGACAAGGAGCACGCGCTGTCCGAAA
TGTGCTTTGAGGAGTTCACCACGTCCCCCTACGAGATGCTGGTGCTGGTG
AGGCAGTTCTTCCAGGACATCAAACAGCTGCTGCAGAACAAGGAGACCTT
CGAGAAGGACTGCAGCCAGGTGTACCGCAGTGCGTGCGCGGGGCCCCGGC
AGCACAGCTCCTCCCCAGGTGTGGGGACAGATCCTGACTGCAATTGCCTG
TCCCCTGCCCTCCCTTCTGCCACCCAGCCCTCCCTCTCCGCTGCCACCCG
TGCCGGCAGGGACGTGGCGCCCGCTAGCACCAGGGTCCCTTACCGCCAGC
TCGGTGGCATCCTGGCTGAGTTAGGCAGCAGTGCCCCGTCCGAGCCCCCC
AGTAGCGTGGAGGGCAGCTCGGGGGCCGAGGAACTGCCAGGAGCCGGGCT
CGGCGACGCGTCGGCGCCGTCCCCCACCATGCAGCAGACGCTTGGAGCCC
TCCTGGATCCAGCCGCGAGCGCCGGCCCGAAGGCTGAGGACGTATCCATC
CCGTCCCACGGGATGCCGGAGGAGGGCGCCGGGACCCCCGCCCTCCCACA
TCGGCTCCCTTCGCCGCGAGGGATCAGCGCGGCGATGCCGGCGGCGGTCC
CCAGCAGCGGCTCTGCGCAGCGCCGCGGGGTCGGGCGCCGTCCCACCGAG
AGCCCCGAGCGGGTCACGCAGCTCCGCTTCCCCAGGATGGCTCCGCCGTT
GCGGGGCCGGGCGGAGGGCGGCCCCGGGGACGGGGCGAGGGCGCGAGGCT
GGGGGCTGAGCCGGCTGCGGGAGCCCGAGGACGGCGGGGCCGGACCCAGC
TTTGATTCGAGCTTTGTTCTGAGCGCAGAGCAGCGCAGGAAGGAGCCGCC
AGCCGCCAGCGGGGGGCACCGGGAGCTCCTGGTGTACGTCACGGTGGCCA
GCGTGGTGGCCGTGCTGCTGGCCATGGGCGGGCTGCTCTTCTACAAGTAT
AAGTCCAAGGTCCTGCAGCGGGGAGCAGCGCTAAAAGAGGGGGGCTGCGA
CCCCGAGGAGCCGGAGAGCAGGGCGCTGCAGGGAGCGCAGGGCTGCGCGG
AGCTGGAGACGCAGGAGCTGTGA

The inventors have ascertained that SEQ ID NO: 2 encodes the following amino acid sequence (given as SEQ ID NO: 3).

SEQā€ƒIDā€ƒNO:ā€ƒ3
MPRLGSQVSLFRCTLLSSLLLVCSIHETEQNSYCQQIITERHLDHLQELA
DTQMQQPGTVSFRFISKMRLSDSVCYVKAAFPLLGTILNRTTFKENSTNA
NKMKTVRKMYENIDENVDPCIRDEDDKEHALSEMCFEEFTTSPYEMLVLV
RQFFQDIKQLLQNKETFEKDCSQVYRSACAGPRQHSSSPGVGTDPDCNCL
SPALPSATQPSLSAATRAGRDVAPASTRVPYRQLGGILAELGSSAPSEPP
SSVEGSSGAEELPGAGLGDASAPSPTMQQTLGALLDPAASAGPKAEDVSI
PSHGMPEEGAGTPALPHRLPSPRGISAAMPAAVPSSGSAQRRGVGRRPTE
SPERVTQLRFPRMAPPLRGRAEGGPGDGARARGWGLSRLREPEDGGAGPS
FDSSFVLSAEQRRKEPPAASGGHRELLVYVTVASVVAVLLAMGGLLFYKY
KSKVLQRGAALKEGGCDPEEPESRALQGAQGCAELETQEL

The second transcript encoding the shorter, 270 amino acid protein is given below as SEQ ID NO: 4:

SEQā€ƒIDā€ƒNO:ā€ƒ4
ATGCCCCGCCTCGGATCCCAGGTGTCCCTGTTCCGCTGCACCCTGCTCTC
GTCCCTCCTCCTCGTCTGCAGCATCCATGAGACGGAGCAGAACAGCTACT
GCCAGCAGATCATCACCGAGCGGCACCTGGACCACCTGCAGGAGCTGGCG
GACACGCAGATGCAGCAGCCGGGCACAGTGTCCTTCAGATTCATCAGCAA
GATGCGGCTGAGCGACTCTGTCTGCTACGTGAAAGCCGCCTTCCCTTTGC
TGGGCACCATCCTGAACAGGACGACGTTCAAGGAGAACTCAACAAACGCC
AACAAGATGAAGACGGTGCGCAAGATGTACGAAAACATCGATGAGGACGT
GGACCCCTGCATCAGGGACGAGGATGACGAGGAGCACGCGCTGTCCGAAA
TGTGCTTTGAGGAGTTCACCACGTCCCCCTACGAGATGCTGGTGCTGGTG
AGGCAGTTCTTCCAGGACATCAAACAGCTGCTGCAGAACAAGGAGACCTT
CGAGAAGGACTGCAGCCAGGTGTACCGCAGTGCGTGCGCGGGGCCCCGGC
AGCACAGCTCCTCCCCAGAGCAGCGCAGGAAGGAGCCGCCAGCCGCCAGC
GGGGGGCACCGGGAGCTCCTGGTGTACGTCACGGTGGCCAGCGTGGTGGC
CGTGCTGCTGGCCATGGGCGGGCTGCTCTTCTACAAGTATAAGTCCAAGG
TCCTGCAGCGGGGAGCAGCGCTAAAAGAGGGGGGCTGCGACCCCGAGGAG
CCGGAGAGCAGGGCGCTGCAGGGAGCGCAGGGCTGCGCGGAGCTGGAGAC
GCAGGAGCTGTGA

SEQ ID NO: 4 encodes the following amino acid sequence (given as SEQ ID NO: 5):

SEQā€ƒIDā€ƒNO:ā€ƒ5
MPRLGSQVSLFRCTLLSSLLLVCSIHETEQNSYCQQIITERHLDHLQELA
DTQMQQPGTVSFRFISKMRLSDSVCYVKAAFPLLGTILNRTTFKENSTNA
NKMKTVRKMYENIDEDVDPCIRDEDDEEHALSEMCFEEFTTSPYEMLVLV
RQFFQDIKQLLQNKETFEKDCSQVYRSACAGPRQHSSSPEQRRKEPPAAS
GGHRELLVYVTVASVVAVLLAMGGLLFYKYKSKVLQRGAALKEGGCDPEE
PESRALQGAQGCAELETQEL

In addition to the above, the inventors have ascertained the sequences of the avian IL34 gene and the sequence of an exemplary IL34 gene, present in the Gallus gallus genome, is given below as SEQ ID NO: 6:

SEQā€ƒIDā€ƒNO:ā€ƒ6
ATGCACCAGGGCTGCGCGGCTGTCCTCTGTGTCCTGGCCGTGCTGGGGCT
GGAGGTGGCTGCGCTGGGGGAATGCGAGCTCGCCCGCCTGCTGCAGGACA
AGCTGCGGTATGAGATGCGCCTGCAGTACATGAAGCACAACTTCCCCATT
GACTACACTCTCCGGGTGCAGCACGAGGAGGTGCTGCGGACCGCCAACGT
CACCCGCCTGCGTGATGGGAAGGTGTCGGAGGCGTCGCTGCGCTACCTGT
GGTTCCACGCCTGCTCCCAGGCGGTGCTGCACATCCTCGAGGTGCTGCCG
GAGAAGCACCCGTCCCGTGGGTACACGCAGGAGCTGAGCCAGCTTTTGGA
TGCCCTGGGCGTGGAGTACAGTGGGTACCGGCAGAGCGATGTGGACGCGG
TGGTGGCCGACCTGGTGAAGCAGCTGCACAGCGGCGATAGCCGGCAGAAG
GCCGTGCGCCCCAAAGCACTGCTGGACAACTGCCTCAAGGTCCTGCGGAT
GCTCTTCGGGGCACACTGTCGGTGGGACTCCGCT

SEQ ID NO: 6 encodes the following amino acid sequence (given as SEQ ID NO: 7):

SEQā€ƒIDā€ƒNO:ā€ƒ7
MHQGCAAVLCVLAVLGLEVAALGECELARLLQDKLRYEMRLQYMKHNFPI
DYTLRVQHEEVLRTANVTRLRDGKVSEASLRYLWFHACSQAVLHILEVLP
EKHPSRGYTQELSQLLDALGVEYSGYRQSDVDAVVADLVKQLHSGDSRQK
AVRPKALLDNCLKVLRMLFGAHCRWDSA

As such, in a first aspect, the present invention relates to the sequences designated SEQ ID NOS: 1-7, encoding avian CSF1 genes (SEQ ID NOS: 1, 2 and 4), the avian IL34 gene (SEQ ID NO: 6), avian CSF1 proteins (SEQ ID NOS: 3 and 5) and the avian IL34 protein (SEQ ID NO: 7). In a further embodiment, the present invention provides fragments, analogues, portions, mutants, variants, derivatives and/or homologues/orthologues of any of the sequences described herein. Advantageously, the fragments, analogues, portions, mutants, variants, derivatives and/or homologues/orthologues provided by this invention might be functional or active—that is, they retain the function of the wild type avian CSF1 and IL34 genes/proteins.

The term ā€œmutantsā€ may encompass naturally occurring nucleic acid or protein mutants or those artificially created by the introduction of one or more nucleic acid or amino acid additions, deletions, substitutions or inversions.

Sequences homologous to the avian CSF1 and IL34 nucleic acid/protein sequences detailed above may be found in a number of different avian species, including each of those species belonging to the various Classes and Orders described above. One of skill will appreciate that homologous sequences may exhibit as little as approximately 20 or 30% sequence homology or identity however, in other cases, homologous sequences may exhibit at least 40, 50, 60, 65 70, 75, 80, 85, 90, 91, 92, 93, 94, 95, 96, 97, 98, 99% homology or identity to the various sequences given above. As such, homologous forms of other avian species are to be included within the scope of this invention.

Using the various nucleic acid and amino acid sequences described herein, one of skill in the art could readily identify related sequences in other avian species. For example, nucleic acid obtained from a particular species may be probed using the fragments or portions of the sequences described herein, for homologous or closely related sequences. In other methods, antibodies specific to or selective for the CSF1 or IL34 proteins described herein may be used to probe for or bind homologous proteins in other avian species. Such antibodies are described in more detail below.

Natural variations due to, for example, polymorphisms, may exist between the sequences of CSF1 and IL34 genes or proteins isolated from any given species; these variants may manifest as proteins and/or genes which exhibit one or more amino acid/nucleic acid substitutions, additions, deletions and/or inversions relative to a reference sequence (for example any of the sequences described above). It is to be understood that all such variants, especially those which are functional and/or display the desired activity, are to be included within the scope of this invention.

Additionally, or alternatively, analogues of the various amino acid sequences (i.e. proteins or peptides) described herein may be made by introducing one or more conservative amino acid substitutions into the primary sequence. One of skill in this field will understand that the term ā€œconservative substitutionā€ is intended to embrace the act of replacing one or more amino acids of a protein or peptide with an alternate amino acid with similar properties and which does not substantially alter the physio-chemical properties and/or structure or function of the native (or wild type) protein. Analogues of this type are also encompassed with the scope of this invention.

As is well known in the art, the degeneracy of the genetic code permits substitution of one or more bases in a codon without changing the primary amino acid sequence. Consequently, although the sequences described in this application are known to encode avian CSF1 and IL34 proteins, the degeneracy of the code may be exploited to yield variant nucleic acid sequences which encode the same primary amino acid sequences.

The provision of certain avian CSF1 and IL34 gene and/or protein sequences renders it possible for one skilled in this field to express and/or purify avian CSF1 and IL34 genes and/or proteins. By way of example, standard laboratory techniques may be used to express and/or purify recombinant avian CSF1 and IL34 genes and/or proteins. In one embodiment, the CSF1 and IL34 nucleic acid sequences described herein (or indeed any fragments or portions thereof) may be introduced into vector systems which can, inturn, be introduced into prokaryotic and/or eukaryotic cells for expression—such vectors may be known as eukaryotic/prokaryotic expression vectors. The methods and vectors which may be used in such techniques are described in detail by Sambrook et al., (Molecular Cloning: A Laboratory Manual, CSHL, 1989). By way of example, the avian CSF1 and IL34 genes (or fragments thereof) described herein may be cloned into a variety of vectors including, for example, plasmids, bacteriophages, cosmids, viral vectors, yeast artificial chromosomes and/or bacterial artificial chromosomes.

CSF1 and IL34 genes and/or proteins can be expressed with or without a fused heterologous sequence. CSF1 or IL34 fusion proteins may be generated and expressed using pET and pGEX type vectors which comprise short nucleic acid sequences encoding heterologous peptide sequences, such as, for example, peptide tags, immediately downstream of the cloning site. Vectors of this type are particularly useful for generating tagged CSF1 and IL34 proteins which can easily be removed, isolated or purified from heterogeneous protein mixtures by, for example, affinity purification procedures. Suitable methods for isolating tagged (fusion) proteins, such as, for example, those tagged or fused to short peptides comprising, for example histidine or glutathione s-transferase moieties, include the use of nickel columns or glutathione-sephaprose substrates. Other techniques are detailed in Sambrook et al., (1989).

Vectors into which CSF1 or IL34 genes (or fragments thereof) have been cloned, may be introduced or transfected into cells using a variety of techniques—such techniques may otherwise be referred to as transfection protocols. Transfection protocols utilise conditions which render cell membranes permeable to compounds such as nucleic acids. By way of example, it may be possible to facilitate the transfection of vectors, including expression vectors, into cells using electroporation, heat shock, chemical compounds such, for example, calcium phosphate, stronitium phosphate, microinjection techniques and/or gene guns.

As such, in a second aspect, the present invention provides a vector comprising an avian CSF1 and/or IL34 gene or a fragment thereof. In one embodiment, the vector may be an expression vector containing elements for driving expression in a host cell.

In a third aspect, the invention provides a cell transfected with a vector according to this invention. By way of example, the host cell may be a prokaryotic or a eukaryotic cell such as, for example a bacterial cell such as one selected from the group consisting of E. coli, Pseudomonas sp. and Bacillus sp. or, in another embodiment, a yeast, fungal, insect, plant or animal cell.

In certain embodiments, the fused or unfused recombinant avian CSF1 and/or IL34 proteins provided by this invention may be used to generate antibodies which exhibit an affinity for, or are specific to, or selective for, a recombinant avian CSF1/IL34 or a fragment thereof. In particular, the recombinant avian CSF1 and IL34 proteins may be used to immunize animals (for example rodents and the like) to generate polyclonal sera, or with hybridomas to generate monoclonal antibodies. As such, a fourth aspect of this invention provides binding agents, for example antibodies, that bind specifically (or selectively) to one or more epitopes present in an avian CSF1 or IL34 protein, such as, for example, those described herein.

The avian CSF1/IL34 genes/proteins described herein may be exploited to execute a variety of immunological effects in the avian host. For example, methods or compounds which modulate avian CSF1/IL34 gene expression and/or protein levels may be used to modulate avian cell, for example monocyte/macrophage, production, proliferation, survival and/or differentiation. In addition, methods or compounds which modulate avian CSF1/IL34 gene expression and/or protein levels may be used to modulate the growth, proliferation and/or survival of tissues and/organs.

Modulation of CSF1/IL34 genes/proteins may result in modulation of mature avian macrophage/monocyte function. In particular, avian macrophage phagocytic and our tumoricidal activity may be enhanced by the methods or compounds described herein.

In other embodiments, methods or compositions which modulate avian CSF1/IL34 gene/protein expression/levels may be used to regulate primary avian immune responses and/or prime immune system cells for subsequent activation stimuli. By way of example, the production of cytokines, for example, pro-inflammatory cytokines, may be modulated by the methods/uses which exploit the avian CSF1/IL34 genes/proteins described herein or compounds which modulate the expression or levels of CSF1/IL34 genes/proteins.

In view of the above, a fifth aspect of this invention provides a method of modulating avian growth and/or organ development, said method comprising the step of modulating the expression of the avian CSF1 or IL34 genes and/or the level of CSF1 or IL34 protein.

In a sixth aspect, the present invention provides the use of an avian CSF1 or IL34 gene and/or protein for modulating avian growth and/or organ development.

In mammalian systems, the production of circulating monocytes and tissue macrophages from the bone marrow is dependent upon the activity of CSF1 and IL34. The discovery that the avian genome also encodes CSF1 and IL34 genes, provides a means by which avian monocyte/macrophage development may be modulated.

As such, in a seventh aspect, the present invention provides a method of modulating the avian immune system, said method comprising the step of modulating the expression of the avian CSF1 and/or IL34 genes and/or the level of the CSF1 and/or IL34 proteins.

In an eighth aspect, the present invention provides the use of an avian CSF1 and/or IL34 gene and/or avian CSF1 and/or IL34 protein for modulating the avian immune system.

One of skill in this field will appreciate that by increasing the level of avian CSF1 or IL34 gene expression, it may be possible to increase macrophage development. Similarly, by increasing the in vivo level of CSF1 or IL34, it may be possible to modulate monocyte/macrophage development.

Commercial and domestic farming is reliant on effective vaccines to ensure avian stocks, for example poultry/fowl species, remain healthy while farmed. It is well established that the efficacy of a vaccine can be enhanced or improved with the use of an adjuvant. Adjuvants which can be used in combination with vaccines for use in farming are particularly useful and in this regard, avian CSF1 and IL34 proteins, for example the Gallus gallus CSF1 and IL34 proteins (or fragments thereof) described herein, may be used as vaccine adjuvants.

As such, a ninth aspect of this invention provides avian CSF1 and IL34 proteins, or fragments thereof, for use as vaccine adjuvants.

In a tenth aspect, the present invention provides immunogenic compositions, potentially useful as avian vaccines, said immunogenic compositions comprising an avian CSF1 and/or IL34 protein.

The ability of CSF1 or IL34 proteins to promote the development of myeloid cells provides a further use for the avian CSF1 and/or IL34 proteins described herein as agents which can be used to induce or promote the growth of macrophages and/or other myeloid cells in vitro. By using avian CSF1 or IL34 proteins to facilitate the generation of populations of myeloid cells, it may be possible to produce populations of myeloid cells for use in research.

One of skill will appreciate that levels of gene expression can be modulated by administering one or more copies of the gene to a subject. By way of example, copies of the avian CSF1 and/or IL34 genes (or functional fragments thereof) may be administered to an avian subject in the form of an expressible vector such as those described above. In other embodiments, purified avian CSF1 and/or IL34 proteins (perhaps a recombinant avian CSF1 or IL34 proteins) may be administered to avians to increase the amount of circulating CSF1 and/or IL34. In one embodiment, an avian CSF1 or IL34 protein or gene (or functional fragment thereof) may be added or administered directly to a particular cell type, tissue or organ. For example, an avian CSF1 or IL34 protein or gene may be administered directly to avian bone marrow.

It should be understood that the terms ā€œmodulateā€ or ā€œmodulatingā€ refer to an increase or decrease in the level of CSF1 or IL34 gene expression and/or CSF1 or IL34 protein levels, relative to, for example, the level of expression or protein observed in a normal, healthy (wild-type) avian subject. In one embodiment, the level of CSF1 or IL34 gene expression or levels of CSF1 or IL34 protein, may be modulated in vivo.

In other embodiments, compounds which modulate the expression of the avian CSF1 and/or IL34 genes and/or level of CSF1/IL34 proteins may be used to achieve any of the effects detailed above or in any of the described methods. Such compounds may include, for example, small organic molecules, nucleic acids (including sense and antisense DNA/RNA sequences) and antibodies and/or antigen binding fragments thereof. In one embodiment, compounds capable of inhibiting lactoferrin concentration and/or expression may include, for example, DNA or RNA oligonucleotides, preferably antisense oligonucleotides. Oligonucleotides useful as modulators of avian CSF1/IL34 gene and/or protein expression may be RNA molecules known to those skilled in this field as small/short interfering and/or silencing RNA and which will be referred to hereinafter as siRNA. Such siRNA oligonucleotides may take the form of native RNA duplexes or duplexes which have been modified in some way (for example by chemical modification) to be nuclease resistant. Additionally, or alternatively, the siRNA oligonucleotides may take the form of short hairpin RNA (shRNA) expression or plasmid constructs.

The skilled man will readily understand that antisense oligonucleotides may be used to modulate (for example, inhibit, down-regulate or substantially ablate) the expression of any given gene. Accordingly, (antisense) oligonucleotides provided by this invention may be designed to modulate, i.e. inhibit or neutralize, the expression and/or function of avian CSF1/IL34 genes and/or the protein products thereof.

By analysing native or wild-type lactoferrin sequences and with the aid of algorithms such as BIOPREDsi, one of skill in the art could easily determine or computationally predict nucleic acid sequences that have an optimal knockdown effect for these genes. Accordingly, the skilled man may generate and test an array or library of different oligonucleotides to determine whether or not they are capable of modulating the expression or function of avian CSF1/IL34 lactoferrin genes and/or proteins.

The identification of genes which bind the avian CSF1R to bring about increased myeloid cell production, proliferation and/or differentiation, may be exploited in methods for screening avians for individuals which exhibit increased levels of CSF1 and/or IL34 gene expression or increased levels of CSF1 and/or IL34 protein. Avians with these phenotypes may be particularly useful in, for example, breeding programs.

As such, an eleventh aspect the present invention provides a method of screening avian species, particularly agriculturally significant or important avian species (such as, for example, those classified as poultry or fowl) for potential inclusion in breeding programs said method comprising the steps of:

    • a) providing a nucleic acid sample from an avian species; and
    • b) comparing the level of expression of the CSF1 and/or IL34 gene(s) with a reference nucleic acid sample or value;

wherein avian species which exhibit and increased level of CSF1 and/or IL34 gene expression relative to a that present in a reference nucleic acid sample or value, may be selected for inclusion in breeding programs.

In one embodiment, the reference nucleic acid sample may be derived from an avian individual which exhibits normal or wild type CSF1/IL34 gene expression. In other embodiments, the reference nucleic acid value may represent the mean, average or median level of avian CSF1/IL34 gene expression.

In a twelfth aspect, the present invention provides a compound capable of inhibiting CSF1/IL34 gene expression or protein production for treating conditions, such as inflammatory diseases, resulting from or associated with aberrant CSF1/IL34 gene/protein expression. The present invention may also extend to uses of such compounds for the manufacture of medicaments and methods of treating avian diseases resulting from or associated with aberrant CSF1/IL34 gene/protein expression. The term ā€œcompoundsā€ may include small organic molecules, fragments of native avian CSF1/IL34 proteins, CSF1/IL34 binding agents (for example antibodies or antigen binding fragments thereof) or nucleic acids, for example antisense sequences designed to inhibit the expression of avian CSF1/IL34 genes.

The present invention will now be described in more detail with reference to the following Figures which show:

BRIEF DESCRIPTION OF THE DRAWINGS

FIGS. 1A and 1B: Structure-based sequence analysis of chicken CSF1. FIG. 1A—Ribbons representation of the chicken (left) and mouse (right) CSF1 structures. The PDB file for the chicken CSF1 was generated using 3D-Jigsaw with the mouse CSF1 structure as template (PDB 3ejj). The figures were rendered by PyMol in Polyview-3D. Residues are colored according to hydrophilicity where yellow is used for hydrophobic residues (A, C, F, G, I, L, M, P, V), dark yellow for amphipathic residues (H, W, Y), orange for polar residues (N, Q, S, T), red for residues charged negatively (D, E) and brown for residues charged positively (R, K). The cysteine forming the inter-chain disulfide bond is labelled on the mouse structure. The loop created by the presence of additional amino acids in the chicken sequence is marked by a black arrow. The red arrows show non-conserved substitutions within the binding site 1 to CSF1R as described in the mouse (Chen et al. 2008). FIG. 1B—Dimer interface of chicken CSF1 (left) and SCF (right). Residues are colored as in A. Amino acids present at the homodimer interface are highlighted by rendering their atoms as spheres.

FIGS. 2A and 2B: Structure-based sequence analysis of the chicken IL34. FIG. 2A—Ribbons representation of the chicken IL34 (left). Structures of the chicken CSF1 (center) and chicken SCF (right) are shown for comparison. The PDB file for the chicken IL34 was generated using 3D-Jigsaw with the mouse CSF1 structure as template (PDB 3ejj). The PDB file for the chicken SCF was generated using 3D-Jigsaw with the human SCF structure as template (PDB 1exz). The figures were rendered by PyMol in Polyview-3D. Residues are colored as in FIG. 1A. The red arrows highlight the corresponding residues composing the receptor binding site 1 in CSF1. FIG. 2B—Dimer interface of chicken IL34. Residues are colored as in FIG. 1A. Amino acids present at the homodimer interface are highlighted by rendering their atoms as spheres.

FIGS. 3A-3F: Characterization of the avian CSF1R. FIG. 3A—Ribbons representation of CSF1-binding site 1 of the zebra finch (left) and chicken (right) CSF1R. The PDB files for the chicken and zebra finch CSF1R were created with 3D-Jigsaw using the mouse CSF1R structure as template (PDB 3ejj). The figures were rendered by PyMol in Polyview-3D. Residues are colored as in FIG. 1A. Arrows point at some of the non-conserved amino acid substitutions. FIG. 3B—Superimposition of the zebra finch (left) and chicken (right) D1-D3 domains of CSF1R with their respective CSF1 ligand. The two CSF1R structures are viewed from the same angle as in FIG. 3A. The chicken CSF1 structure from FIG. 1A is here rendered as surface in Polyview-3D. The PDB file for the zebra finch CSF1 structure was created with 3D-Jigsaw using the mouse CSF1 as template (PDB 3ejj) and rendered with Polyview-3D. Residues are colored as in FIG. 1A. FIG. 3C—Pustell DNA matrix alignment of the 5′ ends of the avian CSF1R genes. The two genes align up to 2.5 kb upstream and through the first intron. FIG. 3D—Sequence alignment of the promoter-exon 1 region of the zebra finch and chicken CSF1R gene. Alignment was performed using MacVector. Binding sites for PU.1, C/EBP and AML1 are identified. FIG. 3E—Alignment of the highly-conserved segment in the intron of the zebra finch and chicken CSF1R gene. Alignment was performed as in D. Binding sites for PU.1, C/EBP and AML1 are identified. FIG. 3F—Localization of CSF1R mRNA in chick embryo at 20HH by whole mount In Situ. The figure shows the antisense (left) and the sense control ISH (right).

FIGS. 4A and 4B: Expression and activity of the chicken CSF1 and IL34. FIG. 4A—Expression and secretion of chicken CSF1 and IL34 by HEK293T transfected with pEF6-cCSF1, pEF6-cIL34 or empty pEF6 vector. The cells were transfected using Lipofectamine and incubated for 72 hours. The cell lysates and supernatants were run on SDS-page gel in non-reducing and reducing conditions, and probed with an anti-V5 tag antibody. The arrows show the double bands for the chicken CSF1 (ca. 60 kD) and IL34 (ca. 25 kDa) in which the upper bands are the glycosylated forms of these proteins, whereas the lower bands constitute de non-glycosylated forms. FIG. 4B—Chicken bone marrow derived macrophages at Day 10 of differentiation using 20% supernatant from pEF6 (left), pEF6-cCSF1 (centre) and pEF6-cIL34 (right) transfected HEK293T.

FIGS. 5A and 5B: Co-evolution of CSF1, IL34 and CSF1R. FIG. 5A—Diagram summarizing the main results of the co-evolution analyses performed by CAPS, a PERL-based software (Fares and McNally 2006a). The co-evolving residues between IL34 (left, in pink) and CSF1R extracellular domain (right, in blue) are shown as identified by CAPS 2Q (Fares and McNally 2006a). The correlation coefficient is indicated by the color of the line between two coevolving amino acids, and measures the correlated evolutionary variation at these sites. The residue numbers refer to the human sequences. FIG. 5B—Speculated IL34 binding mode of CSF1R based on the co-evolution analysis. The ribbons representation of the chicken CSF1R D1-D5 was created by superimposing the chicken CSF1R D1-D3 model produced for FIG. 3 and a chicken CSF1R D4-D5 model made using the human KIT D1-D5 (PDB 2e9w) as template in 3D-Jigsaw. The chicken IL34 model is the same as in FIG. 2 in a slightly different angle. All the models were rendered in Polyview-3D. The residues are colored as in FIG. 1A with the co-evolving homologous residues in chicken highlighted in blue.

FIG. 6: Bis-Tris NuPAGE analysis of IPTG induced protein expression

FIG. 7: SDS-PAGE analysis of the concentrated monomeric chicken CSF-1 protein

FIG. 8: Dose-Reponses data for all three CSF1 preparation on the parental BaF/3 cell line.

FIG. 9: Dose-Reponses data for all three CSF1 preparation on chicken CSF1R-expressing BaF/3 cells.

FIG. 10: Dose-Reponses data for all three CSF1 preparation on Porcine CSF1R-expressing BaF/3 cells.

DETAILED DESCRIPTION

Methods

Bioinformatic Analysis

Sequences were identified using the databases at NCBI and the genome resources from the University of Santa Cruz and Ensemble. The translation of the zebra finch CSF1R gene was predicted using the GeneWise program and the chicken IL34 EST was analysed using ESTscan

Cloning of Chicken and Zebra Finch cDNA Genes

RNA from chicken stage 20 embryo and zebra finch brain was extracted using TRIzol reagent, as described by the manufacturers (Invitrogen, Paisley, UK). cDNAs were cloned via RT-PCR using Superscript III reverse transcriptase and the TOPO TA cloning kit for sequencing (Invitrogen, Paisley, UK). 5′ Rapid amplification of cDNA ends (5′ RACE) of chicken and zebra finch CSF1, and zebra finch IL34, was carried out using the First Choice RLM-RACE Kit (Ambion, Warrington, UK). PCR products were cloned using the TOPO TA cloning kit for sequencing (Invitrogen, Paisley, UK). The 3′ end of chicken CSF1 was cloned using a modified 3′ Rapid amplification of cDNA ends (3′ RACE) technique, 3′ RACE LaNe (Park 2004).

Isolation of Chicken BACs Containing CSF1

A chicken probe for CSF1 was prepared using the Prime-a-gene kit (Promega, Southampton, UK) and hybridized to the chicken CHORI-261 BAC library overnight at 65° C. in 10% PEG8000; 7% SDS; 1.5ƗSSC. Filters were then washed twice in 2ƗSSC; 0.1% SDS and once in 0.5ƗSSC; 0.1% SDS at 65° C. and exposed to autoradiographic film for 1 week at room temperature. Six positive clones were identified: 44-116, 68-D10, 22-M13, 171-K3, 171-N10 and 172-O23. 44-116, 68-D10 and 171-N10 were confirmed by PCR. These clones were all end-sequenced and shown by Blat to map to Chr26.

Sequence Analysis

Clones were sequenced using BigDye Terminator v3.1 Cycle sequencing kit (Applied Biosystems, Foster City, Calif., USA) on an ABI 3730x1 sequencer.

Genetic Mapping of Chicken CSF1

A 437 by genomic fragment of chicken CSF1 was amplified by the primers: ckcsfex4-for1: GCGACTCTGTCTGCTACGTG (SEQ ID NO: 8) and ckcsfex5-rev1: CGAAGGTCTCCTTGTTCTGC (SEQ ID NO: 9). Sequencing of the parental DNA from the East Lansing reference population (Crittenden et al. 1993) identified a SNP in exon4 (G/A in Red Jungle Fowl male; A/A in White Leghorn female) and sequencing of 52 backcross DNAs from confirmed CSF1 as mapping to Chr26. Linkage analysis was carried out using the Map Manager program (Manly and Olsen, 1999).

Phylogenetic Analyses

Amino acid sequences of annotated CSF1, IL34 and CSF1R genes from various taxa were aligned using the ClustalW software (Thompson et al. 1994) (Gonnet protein weight matrix, no ends gaps inactivated, default parameters). The secondary structures shown in the structure-based alignments were predicted using PSIPRED (Jones 1999), and the alignments performed by Domain Fishing (Contreras-Moreira and Bates 2002).

Whole Mount In Situ Hybridization

Fertilized White Leghorn eggs were collected weekly and incubated at 38° C. for between 3-6 days of development. Embryos were dissected into cold DEPC-PBS, staged as per (Hamburger and Hamilton 1992), and fixed immediately in 4% PFA/DEPC-PBS overnight, dehydrated into 100% methanol through graded methanol/PBS steps and stored at āˆ’20° C. Whole-mount ISH on embryos were carried out as per (Nieto et al. 1996). The CSF1R probe was made using the Ark-Genomics (Roslin, UK) clone 654 for template.

Chicken CSF1 and IL34 Expression

HEK293T cells (ATCC) and were cultured in DMEM (Sigma) supplemented with 10% heat inactivated (HI)-FCS, 2 mM L-glutamine, 0.1 mM non-essential amino acids and antibiotics (100 ug/ml penicillin, 100 ug/ml streptomycin). One day before transfection, 8Ɨ105 HEK293T cells were plated in 2 ml growth medium without antibiotics in a 6-well plate. The cells were transfected with Lipofectamoine 2000 as per product instructions. Cells were then incubated at 37° C. in a CO2 incubator for 24 hr and transferred into 25 cm2 dishes each containing 7 ml of growth medium (without antibiotics) for another 48 hr prior to harvesting the supernatant and lysing the cells in 2% SDS-10 mM Tris buffer. The cell extracts and supernatants were then mixed with Laemli buffer with or without DTT (5 mM final) or B-mercaptoethanol (5% final), run on a 4-12% gradient SDS-PAGE gel and transferred on PVDF membrane as per Bio-Rad apparatus instructions. The membrane was blotted using a mouse anti-v5 tag antibody (AbD Serotec) and an anti-mouse IgG HRP-conjugated (Cell Signaling Technology).

Bone Marrow Differentiation

Chicken bone marrow cells were obtained by flushing the marrow from 2 femurs and 2 tibias with PBS using a syringe and a blunt needle. For each condition, 1/250 of total cells was pelleted and resuspended in 4 ml of complete RPMI (supplemented with 10% heat inactivated (HI)-FCS, 2 mM L-glutamine, 100 ug/ml penicillin, 100 ug/ml streptomycin) containing 20% supernatant from empty pEF6-, pEF6-cCSF1- or pEF6-cIL34-transfected HEK293T. Cells were plated in 60 mm Bacteriological plates and incubated at 37° C. in a CO2 incubator for 12 days.

Intra- and Inter-Molecular Co-Evolution Analysis

To identify co-evolutionary patterns we used the parametric method based on correlated evolutionary patterns among amino acid sites previously published (Fares and Travers 2006b). To perform the analysis we used the software implementing this method CAPS version 1.0 (Fares and McNally 2006b). This method has proved to be successful in yielding meaningful results in several case studies, including those aimed at identifying co-evolution of membrane proteins (Fuchs et al. 2007), HIV gp120 and gp41 proteins (Travers et al. 2007) as well as Hsp70-Hop-Hsp90 system (Travers and Fares 2007). To estimate the probabilities and significance of the correlated evolutionary patterns among amino acid sites we used a large number of random samplings (1 million and 10 million random samples) and a small alpha value (0.001) to minimize false positive rate (type I error). CAPS also implements the step-down permutational procedure as described previously (Westfall and Young 1993; Travers and Fares 2007) to correct for multiple testing. The scores for the amino acid substitutions were obtained using the appropriate blocks substitution matrix (BLOSUM80) (Henikoff and Henikoff 1992) depending on the similarity of our protein sequences. All amino acid sites reported in the co-evolutionary analyses present the positions in the protein from the reference sequence (human).

Visualization of Co-Evolutionary Networks

We used the software Cytoscape (version 2.6.1) (Shannon et al. 2003) to visualize the co-evolutionary networks identified by CAPS. Cytoscape was originally designed to visualize bimolecular interaction networks. This tool however can be used to visualize any data that describes interactions between objects. CAPS can produce four files containing information of co-evolutionary networks and compensatory mutations. We used this program to generate the networks of correlation between co-evolving amino acids and used the correlation coefficients generated in CAPS to determine the coloring patterns of the linking lines between nodes (amino acid residues).

Cloning of Chicken CSF-1 Gene

The sequence corresponding to the active fragment of chicken CSF-1 (NSYCQQIITERHLDHLQELADTQMQQPGTVSFRFTSKMRLSDSVCYVKAAFPLLGTI LNRTTFKENSTNANKMKTVRKMYENIDENVDPCIRDEDDKEHALSEMCFEEFTTSPY EMLVLVRQFFQDIKQLLQNKETFEKDCSQVYRSACAGPRQHSSSP, SEQ ID NO: 10) was codon optimized for expression in E. coli and synthesized by Blue Heron Biotechnologies (WA, USA). The sequence was engineered with a BspHI restriction site at the 5′ end and an EcoRI restriction site at the 3′ end and cloned into the expression plasmid pET-28(b) using the complimentary restriction sites NcoI and EcoRI. The resulting plasmid, pTLW54, was transformed into MAX EfficiencyĀ® DH5α™ Chemically Competent E. coli according to the manufacturer's protocol (Invitrogen, CA, USA). A kanamycin resistant transformant was selected and the plasmid sequenced to verify the error-free ORF. The pTLW54 plasmid was isolated via QIAprepĀ® spin miniprep kit (Qiagen, CA, USA) according to the manufacturer's recommendations and transformed into One ShotĀ® BL21 Starā„¢ Chemically Competent E. coli (Invitrogen, CA, USA). The chicken CSF-1 gene within pTLW54 was again sequenced to verify error-free ORF.

Expression of Chicken CSF-1 Protein

An overnight LB/Kan50 broth of pTLW54/One ShotĀ® BL21 Starā„¢ E. coli incubating at 37° C. with 225 rpm shaking was refreshed 1:10 into 1 L of LB/Kan50 broth. The refreshed culture was incubated with 225 rpm shaking at 37° C. for two hours to ensure mid-log phase growth. Protein expression was induced with 1 mM IPTG, final concentration, with incubation conditions continued at 37° C. and 225 rpm shaking. After 2 hours induction, the culture was centrifuged and the E. coli pellet was stored at āˆ’80° C. Prior to centrifugation, aliquots were analyzed for expression of protein compared to a non-induced control. Soluble and non-soluble protein fractions were analyzed on a 4-12% Bis-Tris NuPAGE gel run in MES buffer. As shown in the FIG. 6, the induced culture produced a band of approximately 18.7 kDa in the non-soluble protein as expected.

Purification and Processing of Chicken CSF-1 Protein

Frozen cell pellets were broken and inclusion bodies were washed to near homogeneity. Monomeric chicken CSF-1 protein was purified using a 2.6Ɨ60 cm Superose 12 size exclusion chromatography column (SEC) in a 50 mM Tris, pH 8.5, 5 mm EDTA, 7M guanidine. The eluted chicken CSF-1 was diluted 10-fold in the 7M guanidine buffer and allowed to refold via sequential dialysis by addition of 50 mM Tris, pH 8.5, 100 mM NaCl, 5 mM EDTA, 1 mM oxidized glutathione, 2 mM reduced glutathione buffer through 8 steps resulting in a final guanidine concentration of 0.15 M. The refolded chicken CSF-1 was concentrated and the monomeric species was purified using a 1Ɨ30 cm Superose SEC column run in PBS. The monomeric protein was concentrated to 0.58 mg/ml and analyzed by 16% SDS-PAGE with and without BME as shown in the FIG. 7. Aliquots of purified chicken CSF-1 were stored at āˆ’80° C.

Results

Identification of Avian CSF1 Genes

There is currently no annotated CSF1 gene in the chicken genome, but the region containing the mouse CSF1 gene displayed synteny with the chicken suggesting there was a gap in the chicken genome assembly. Based upon privileged access to the zebra finch genomic sequence, it was possible to identify a clear CSF1 ortholog (starts in exon3) [Chr26:24187-27419, July 2008 assembly] (GQ249405). This, in turn, led to the identification of a partial CSF1 sequence in the chicken EST collection at the Roslin Institute. A complete ORF was obtained by 5′ and 3′ RACE to determine the full CDS. CSF1—containing BACs were also identified and end-sequenced to confirm mapping to Chr.26. The CSF1 locus is indeed predicted to be in a gap in the chicken genome assembly, since in the zebra finch the flanking gene order is the same as in mammals. The newly-identified avian CSF1 genes each contain 8 exons. The zebra finch gene encodes a protein of 489 amino acids. Two transcripts have been identified in the chicken—one encoding a protein of 490 amino acids, and the other comprising 270 amino acids (GQ249403 and GQ249404). The shorter transcript is missing a substantial part of Exon 6. In mammals, this exon encodes a large domain that contains a proteolytic cleavage site which permits the release of CSF1 from a membrane-anchored precursor. The shorter transcript would encode the membrane-anchored cell surface form of CSF1, which cannot be cleaved. The exon 6 of chicken CSF1 also contains the unique glycosaminoglycan (chondroitin sulfate) addition site (SGXG/A, SEQ ID NO: 11) found in the mammalian genes. Hence, the basic biology of CSF1, involving secreted and membrane-anchored forms with variable post-translational modification and distinct functions (Dai et al. 2004; Jang et al. 2006; Nandi et al. 2006) appears to be conserved in the chicken.

Conserved Structure of Avian CSF1

In order to assess whether the avian CSF1 sequences identified are functional orthologs of mammalian CSF1, a multiple alignment of deduced amino acid sequences across species was performed using the ClustalW software (Thompson et al. 1994) (Table 1). The six cysteine residues responsible for the three intra-molecular disulfide bonds (Pandit et al. 1992) are conserved in birds, but the cysteine forming the inter-chain disulfide bond that is located at the dimer interface and conserved through all species including zebrafish and gold fish (Hanington et al. 2007) is not conserved in birds. The alignment of the cysteines and predicted helices highlight the contact residues for CSF1 bound to CSF1R deduced from the co-crystal in mouse (Chen et al. 2008), some of which are clearly divergent in birds. In particular, the Asp91 and 94, Gln113, Glu114, and Asn117 (position numbers referring to the mouse sequence in Table 1) are not conserved or have semi-conservative substitutions. Immediately downstream of these binding sites, the bird sequences have additional amino acids that are not present in the mammalian sequences. This alignment also highlights the substitution of R111 in mouse, with Q in human, which could explain why the human ligand works on mouse cells, but not vice versa (Bonifer and Hume 2008).

To verify avian CSF1 structure predictions, 3D-models in PDB format were generated with 3D-Jigsaw using structure-based alignments (performed by Domain Fishing) (Bates et al. 2001). The PDB files obtained were viewed in FirstGlance in Jmol and the models rendered by PyMol using Polyview-3D (Porollo and Meller 2007). The avian CSF1 are predicted to have the same four-helix bundle structure as the well described mammalian CSF1 (Pandit et al. 1992). In FIG. 1A, the chicken CSF1 model is compared with the published mouse structure (Chen et al. 2008). Although the overall topology is conserved from mammals through birds, all the differences found in the sequence alignment translate into structural changes. Hence, the CSF1R-binding site 1 of chicken CSF1 comprises different charges from the mouse binding site 1 as the non-conserved amino acid substitutions are precisely positioned to contact with the receptor (red arrows). Moreover, the extra residues found in the chicken sequence are predicted to create a protuberance making the positively charged Arg122 stick out between the binding sites 1 and 2 (black arrow). As previously mentioned, the cysteine forming the inter-chain disulfide bond in mammals (labelled Cys on the mouse structure) is absent from the chicken CSF1, resulting in non-covalently associated homodimers. This is also the case for the closely related Stem cell factor (SCF) in mammals as well as in birds (Arakawa et al. 1991). These proteins can form stable dimers and induce receptor dimerization because of the large contact surface area between the monodimers (Jiang et al. 2000). Interestingly, the contact surface between the chicken CSF1 dimers is very similar to that of chicken SCF. They both contain exposed hydrophobic residues, as shown in FIG. 1B where the amino acids present on the dimer interface were rendered as spacefill.

Identification of Avian IL34 Genes

There is an obvious chicken ortholog of human IL34 in the chicken genome, and we have identified a chicken cDNA within the Ark-Genomics (Roslin, UK) collection which maps to chromosome 11 and contains the full-length IL34 CDS (Genbank accession no. BX931154). This chicken sequence allowed for the identification of the orthologous zebra finch gene within the genome sequence [Chr11: 5,575,502-5,577,560; July 2008 assembly] (GQ249406). The avian genes each contain 6 exons, the chicken gene encoding a protein of 178 amino acids, and the zebra finch gene encoding 180 amino acids.

Conserved Structure of IL34

At the amino acid sequence level, IL34 is considerably better conserved across species than CSF1 (Table 2). Although the paper describing human IL34 claimed that it was structurally novel (Lin et al. 2008), our own analysis suggests that IL34 is a four-helix bundle protein just like the well-described CSF1 (Pandit et al. 1992; Taylor et al. 1994; Chen et al. 2008). It is true that IL34 and CSF1 can be aligned with each other with only weak primary homology but they have a very similar predicted topology. A 3D-model of the chicken IL34 was generated with 3D-Jigsaw using structure-based alignments (performed by Domain Fishing) (Bates et al. 2001). The resulting PDB file was viewed in FirstGlance in Jmol and the model rendered by PyMol using Polyview-3D (Porollo and Meller 2007) (FIG. 2A). For structural comparison, a model for the chicken SCF was created following the same procedure, and the chicken CSF1 model shown in FIG. 1 was also included in the figure. This structural analysis of the derived protein sequence predicts a molecule that lacks all the seven strategically positioned cysteines. IL34 contains some generally conserved cysteine residues, but these are not positioned and matched together in order to form intra-chain disfulfide bonds. The cysteine required for the formation of an inter-chain disulphide bridge is not found on the dimer interface as in mammalian CSF1, but that region contains exposed hydrophobic residues (FIG. 2B). The corresponding amino acids that constitute the receptor-binding site 1 on CSF1 are pointed out by red arrows. These residues are totally different from those in IL34, immediately suggesting an alternate binding mechanism from that of CSF1 protein.

Identification of the Zebra Finch CSF1R Gene

In the chicken genome on chromosome 13, there is an annotated CSF1R gene (Ensembl ID: ENSGALG00000005725), occupying the same position as in mammals, immediately 3′ of the closely-related PDGFRB gene (Ensembl ID: ENSGALG00000021313). The availability of the chicken sequence allowed us to identify the orthologous sequence in the zebra finch genome [Chr13: 6,954,381-6,972,446; July 2008 assembly] (GQ249407). This gene contains 21 exons like the chicken CSF1R, and codes for a protein of 967 amino acids, which again is the same length as the chicken CSF1R.

Evolutionary Conservation of CSF1R

A new multiple alignment of amino acid sequences across species was performed using the ClustalW software to examine the homology between the bird CSF1R and the mammalian orthologs (Table 3). As expected, the intracellular tyrosine kinase domain (aa 540 to 977) of the receptor is extremely conserved through all species, including birds. Amongst the residues that are not conserved however, is the cysteine 665 (indicated by an arrow in table 3) which is substituted for an arginine only in birds. This substitution may underlie our finding that chicken CSF1-induced macrophage growth is not blocked by a kinase inhibitor, GW580 (V Garceau, unpublished) that inhibits mammalian CSF1R activity (Irvine et al. 2006). Most of the residues composing the CSF1-binding sites 1 and 2 (labeled respectively with ā€œ+ā€ and ā€œĀ°ā€ symbols in table 3) deduced from the mouse CSF1R/CSF1 co-crystal are not conserved between the two birds. Some of the amino acid substitutions observed between the two birds are illustrated in FIG. 3A, where 3D-models of the CSF1-binding site 1 on the D2 domain of the zebra finch (left) and the chicken (right) CSF1R are presented. As with the ligands, the models were created using 3D-Jigsaw and Polyview-3D. A more general view of the D1-D3 domains of these same receptors with a superimposed structure of their respective CSF1 molecule is presented in FIG. 3B. The receptors are shown from the same angle as in FIG. 3A, and the chicken CSF1 structure is the same model as in FIG. 1A rendered as surface instead of cartoon, with the dimer interface labeled for orientation. The zebra finch CSF1 structure was produced using the same settings, and the superimposition angle is based on the co-structure of the mouse CSF1:CSF1R complex (Chen et al. 2008). In this figure, the amino acid substitutions in the zebra finch (left) and chicken (right) receptors are put in context with those present in their respective CSF1 ligand. This high level of divergence is not surprising since zebra finches and chickens are not part of the same taxonomic order. As with primate and rodent CSF1, we predict that the zebra finch CSF1 will not activate the chicken receptor, or vice versa, due to the substantial changes in charge density in the binding sites.

Transcriptional Regulation of Avian CSF1R

The mammalian CSF1R loci contain a conserved macrophage-specific promoter region, and a remarkably conserved enhancer (FIRE) in the first intron that is required for macrophage-specific expression of a transgene (Sasmono et al. 2003). These elements are not evidently conserved in birds. However, the transcription factors required for macrophage gene expression, such as PU.1, have clear chicken orthologs. To assess the likelihood of CSF-1R being a macrophage regulator in birds, we first assessed the transcriptional regulation of the chicken and zebrafinch genes. Passeriformes and galliformes are separated by around 100M years of evolution, about the same as rodents and humans. Because of this distance, evolutionary conserved, non-coding regions provide strong indications of the location of functional promoters and enhancers; in mammals the FIRE (fms intronic regulatory element) is more conserved than any of the exons (Himes et al. 2001). The intron-exon structure of avian CSF1R is the same as in mammals, with the ATG start codon located in the first exon. Like the mammalian CSF1R promoters, the two avian CSF1R proximal promoters are not highly conserved, but both are purine-rich and TATA-less. In both bird species, there are two very highly conserved regions, upstream and downstream of the promoter. This is shown in the Pustell DNA matrix alignment of FIG. 3C. The downstream element is in the same relative location within the first intron as the mammalian FIRE (Himes et al. 2001). The candidate avian FIRE sequence cannot be aligned with the mammalian FIRE, but contains the same basic elements. These regions contain multiple repeats of consensus sequences in common with mammalian CSF1R and FIRE, including candidate binding sites for PU.1 and other Ets factors, AP1, C/EBP, Sp1 and AML1 (FIGS. 3D and 3E). Each of these transcription factors is expressed in haematopoietic cells in chickens (Faust et al. 1999; Bakri et al. 2005). These findings suggest that avian CSF1R is controlled in basically the same manner as in mammals, despite the reassortment of the cis-acting individual elements.

Expression Pattern of CSF1R in Chick Embryo

The analysis of conserved regions identifies candidate enhancers of the chicken CSF1R locus, and suggests that the gene is likely to be expressed specifically in macrophages. To confirm that prediction, we carried out whole mount in situ hybridization of chicken embryos at 20HH or 3.5 days of development, the wing bud stage (FIG. 3F). This stage corresponds to 11.5 dpc in the mouse embryo. As in the mouse (Lichanska et al. 1999), and consistent with macrophage distributions in Xenopus (Tomlinson et al. 2008), the chicken csflr mRNA is expressed in a speckled pattern all over the embryo, consistent with restriction to the numerous macrophages in every organ of the body (left panel).

Activation of the Chicken CSF1R by CSF1 and IL34

The expression of CSF1R on the cell surface is amongst the earliest events in macrophage lineage commitment (Tagoh et al. 2002), and CSF1 is commonly used to grow pure populations of macrophages from mouse bone marrow (Bonifer and Hume 2008). Both ligands were therefore tested for differentiation of chicken bone marrow cells. The chicken CSF1 (first six exons) and IL34 genes were cloned in the pEF6 vector, providing them with a C-terminal tag for detection, and transfected into HEK293T cells. The expressed proteins within the cell and supernatant were detected by Western blotting (FIG. 4). In the case of CSF1, three apparent molecular entities are seen in the non-reduced supernatant, and the lowest apparent MR (ca. 60 kD) is mostly present in the cells; suggestive that the secreted protein is processed in the ER and glycosylated, maybe even as a proteoglycan. In the case of IL34, the protein was detected in the cells and supernatant as a doublet, with the higher apparent MR being more abundant than the lower MR, suggesting that IL34 is glycosylated in this system. The amount of epitope-tagged cIL34 detected in the supernatant was considerably less than in the cell lysates. This might be due to some proteolytic cleavage of the C-terminus by trypsin-like proteases in the secretory pathway or medium as a string of basic amino acids are found at the C-terminal of IL34, just upstream of the v5 tag. The supernatant from the transfected HEK293T cells, or cells transfected with the vector only, was added to bone marrow cells obtained by flushing the marrow from a chicken femur, and the cells were incubated for ten days. Around Day 3, cells growing in the presence of chicken CSF1 or IL34 became adherent, and by Day 12, the dishes were confluent. No bone marrow cells survived in the control dish containing supernatant from empty pEF6-transfected HEK. Hence, both CSF1 and IL34 offer the possibility of growing macrophages from chicken marrow for functional studies; bone marrow-derived macrophages have been a mainstay of macrophage functional studies in the mouse (Bonifer and Hume 2008). Together, the data indicate that the function of CSF1R and its two ligands is conserved in birds.

Co-Evolution of CSF1R, CSF1 and IL34

The extracellular domain of CSF1R is quite divergent among species, as is CSF1. Even between mice and rats, IL34 is considerably better conserved, and yet activates the same receptor as CSF1. The divergence of CSF1/CSF1R could be related to the fact that (a) CSF1 is massively inducible in the circulation in response to innate immune stimuli such as LPS, and (b) the CSF1R extracellular domain is cleaved from the cell surface in cells responding to a range of TLR agonist, through the actions of ADAM14/TACE (Sester et al. 1999; Rovida et al. 2001). So, one might argue that CSF1 is required for effective innate immune responses and is therefore under immune selection. Indeed, Epstein-Barr virus encodes a soluble CSF1R antagonist, BARF1 (Strockbine et al. 1998). This raises the interesting evolutionary question of exactly how two ligands could evolve with a single receptor. In theory, and provided the overall structure is conserved, alterations in contact residues in the ligand should be compensated by alterations in the receptor to preserve binding affinity, and within a sufficiently large sample, there should be a correlation matrix between amino acids on the partners. Incorporating the alignments presented in Tables 1, 2 and 3, and published PDB structures for CSF1/CSF1R it was possible to distinguish functional co-evolution from phylogenetic or random co-variation in order to calculate a correlation coefficient (Fares and Travers 2006a). The CAPS software was used to identify amino acid sites having a strong correlation coefficient (Fares and McNally 2006a), and the networks of these co-evolving residues arc shown in FIG. 5A. The strength of the correlation coefficient for specific site pairs is indicated by the color of the line connecting them, and the amino acid positions numbering follows the human sequences as reference. Unexpectedly, the only significant correlations were found between CSF1R and the more conserved of the two ligands, IL34. Moreover, no sign of intra-protein co-evolution was found in any of the three proteins.

IL34 Binding Mode of CSF1R

None of the co-evolving amino acid positions identified by CAPS in CSF1R are located within the CSF1-binding sites which are in D2 and D3 domains (Chen et al. 2008). Instead, they are concentrated at the junction between D3 and D4. In a similar manner, the co-evolving residue positions in IL34 are located outside the corresponding CSF1R-binding site of CSF1. All the co-evolving residues appearing in the networks of FIG. 5A were mapped on the chicken CSF1R and IL34 structures (FIG. 5B). The chicken CSF1R D1-D5 structure was generated as a chimera of two PDB files generated by 3D-Jigsaw for the chicken receptor: D1-D3 using the mouse CSF1R structure as template (3ejj), and D1-D5 using the human KIT structure as template (2e9w). The two models were then superimposed to create the chicken CSF1R D1-D5 structure. The chicken IL34 model is the same one as in FIG. 2, viewed in a slightly different angle. The corresponding co-evolving residue positions in chicken were deduced from the alignment in Table 2, then highlighted in blue using Polyview-3D. The co-evolution of specific sites on CSF1R and IL34 can be interpreted as a possible binding mode between this uncharacterized new ligand and the receptor. Hence, we can speculate that IL34:CSF1R binding site interface consists of the CD loop of IL34 and the region around the D3-D4 junction of CSF1R.

Assessment of Bioactivity Via BaF/3 Cell Based Assay

Recombinant chicken CSF1 has demonstrable specific bioactivity as demonstrated when titrated on to factor-dependent parental BaF/3 cells and BaF/3 cells expressing chicken CSF1R or porcine CSF1R. Parental BaF/3 cells, chicken CSF1R expressing BaF/3 cells or porcine CSF1R expressing BaF/3 cells that had been cultured in RPMI 1640 media+10% HI FBS+GlutaMax+pen/strep (20 U/mL and 20 micrograms/mL) and 10 ng/mL recombinant murine IL-3 were collected, washed and plated in 96-well microtitre plates at 20K cells per well and cultured overnight. The following day, recombinant chicken CSF1 was titrated against all three cell lines. As controls, recombinant porcine CSF1 and recombinant human CSF1 (Sigma 6518) were also titrated against all three cell lines. Cell assays were then incubated for a further 48 hrs afterwhich cell survival/proliferation was assessed using the TireGlo assay system (Cell TiterGlo; Promega G7571). None of the CSF1 preparations promoted survival or proliferation in the BaF/3 parental line (FIG. 8). Whilst porcine and human CSF1 preparations did not promote survival/proliferation of BaF/3 cells expressing the chicken CSF1R, the chicken CSF1 preparation did show bioactivity (EC50=ca. 20 ng/mL) through the chicken CSF1R as demonstrated by robust survival and proliferation when titrated onto the chicken CSF1R expressing BaF/3 line (FIG. 9). Both Porcine and human CSF1 preparation were bioactive as they had equimolar bioactivity (EC50=30 ng/mL) on the porcine CSF1R-expressing BaF/3 cell line as demonstrated in FIG. 10.

DISCUSSION

The structural basis of the interaction between CSF-1, IL34 and CSF-1R presents a scientifically interesting phenomenon from an evolutionary point of view. Current genomics efforts now provide sequences from more than fifteen species for both ligands and the receptor. From these sequences, it is apparent that the interaction is conserved evolutionarily back as far as fish. By aligning the sequences, and examining the tolerance of different residues at significant positions, it is possible to identify particular amino acids in the receptor that vary in conjunction with a given residue of CSF-1 or IL34. The ability of CSF-1 from one species to induce growth and survival of macrophages (or cells transfected with the receptor) from another species adds weight to predictions based on evolutionary conservation. For instance, mouse CSF-1 cannot bind human CSF-1R, yet human CSF-1 can bind and activate mouse CSF-1R (Koths 1997). In fact, human CSF-1 can activate CSF-1R from all species for which it has been tested (human, mouse, feline, sheep and dog), whereas mouse CSF-1 can activate all non-primate CSF-1R tested (mouse, feline, sheep and pig), but not human CSF-1R (Stanley and Guilbert 1981; Woolford et al. 1988; Tamura et al. 1990; Francey et al. 1992; Ramsoondar et al. 1993; Yoshihara et al. 1998; Abrams et al. 2003). The only contact amino acid that is not conserved in mammals is mouse R111, which is Q in humans, and varies in other species. Bovine CSF-1 causes growth of murine bone marrow macrophages, presumably through activation of murine CSF-1R (Yoshihara et al. 1998). Chicken (or at last M-CSF bioactivity in chicken cell conditioned medium) and feline CSF-1, conversely, are unable to activate the human and mouse CSF-1R, and are restricted to activating the receptor of their own species (Tamura et al. 1990; Tamura et al. 1991).

Recent studies identified the CSF1 genes of several fish species, and provided evidence of primitive duplications of the gene in these species (Wang et al. 2008). All of the piscine CSF1 genes had almost complete divergence of the mammalian contact residues implied from the mouse CSF1/CSF1R co-crystal structure. In the current study, we have identified and expressed the chicken CSF1 and IL34 genes, provided evidence that CSF1R is expressed in chicken macrophages as it is in mammals (and most likely controlled in a similar manner (FIGS. 3C-3F), and that recombinant factors can produce pure macrophage cultures from bone marrow precursors. Hence, the biology of the CSF1/IL34/CSF1R triad is also conserved in another class of vertebrates, the birds. Molecular modeling suggests that CSF1 has a conserved structure in birds and mammals, and in contrast the published study (Lin et al. 2008) suggests that IL34 also shares that topology characterized by a four-helix bundle (Pandit et al. 1992). Although the fact that IL34 lacks all the cysteines forming the distinctive intra-chain disulfide bonds in CSF1, other growth factors such as SCF, GM-CSF and GH all have only one or two intra-chain bonds, and yet have that same four-helix topology (Pandit et al. 1992).

It was already known that IL34 binds CSF1R (Lin et al. 2008), and the finding of a structure similar to that of CSF1 could have lead to the conclusion that they were both sharing the same binding sites on CSF1R. This is not compatible with the sequence of IL34, wherein the contact points identified from the CSF1/CSF1R co-crystal structure are completely variant. The co-evolution study performed here revealed a new perspective. When identified on the 3D structure of the proteins, the co-evolving residue positions uncovered by CAPS are grouped together in distinctive regions. On IL34, most of them are located at the end distal to the dimer interface, in particular on a flexible loop between helix C and helix D. None of the co-evolving residues are situated in the corresponding binding site on CSF1. On CSF1R, the majority of them are positioned at the junction of D3 and D4. If brought together, these two binding sites would naturally fit with each other. Moreover, it is known that the CSF1R D4 lacks the characteristic disulfide bond of Ig-like domains that connects the beta-sheets, and is likely to have greater flexibility (Blechman et al. 1995). Even the recently published model for CSF1R dimerization and activation could accommodate such an alternative binding mode for IL34 (Chen et al. 2008). Interestingly, this binding mode is reminiscent of the binding of other 4-helix bundle factors (GH, GM-CSF, EPO) to their receptors, involving sites between helices, and binding within an intra-domain cleft that is rather closer to the plasma membrane than the domain D2/3 cleft of CSF1R. Activation models of CSF1/CSF1R suggest that dimerization permits interactions between the two domain D4s, leading to a conformational change that generates signaling (Chen et al. 2008). Could IL34 thereby generate a distinct signal? In the case of the GHR, distinct mutations in the extracellular domain that alter conformation can lead to selective loss of particular signaling pathways in transfected FDCP1 cells (Rowlinson et al. 2008). The extracellular domain of CSF1R linked to the intracellular domain of GHR can provide a CSF1-dependent growth-promoting signal to the same factor-dependent cells (M J Waters, D A Hume, unpublished). So, it is conceivable that the two ligands could signal through the same receptor to generate signals that only partly overlap.

The different binding mode of CSF1 and IL34 is implied by the fact that, even though changes of charge in CSF1 binding sites are matched by changes of opposite charges in the receptor binding sites, there is no significant correlation coefficient between them. The weak binding of CSF1 to CSF1R is based on salt bridges, and simply requires the presence of opposite charges at the site to occur. This does not have to involve a strict co-evolution of matching amino acids. The binding of IL34 to CSF1R, however, could be based on hydrogen bonds necessitating perfectly complementarity, thus co-evolving, residues.

In addition to suggesting alternative binding sites for IL34 and CSF1R, the co-evolution study gives us a hint about a functional difference between CSF1 and IL34. Indeed, the fact that a correlated evolutionary co-variation with CSF1R can only be detected for IL34 means that the latter is subjected to stronger selective constraints than CSF1. In other words, a change in the genetic composition of IL34 would necessarily involve a reciprocal evolutionary change in the receptor as the consequences of any loss of activity would be more dramatic than a similar loss for CSF1. Furthermore, it also suggests that CSF1 is free to evolve more quickly than IL34, and without the receptor coevolving with it. These interpretations, taken together with the better conservation of IL34 and the rather different expression pattern of IL34 compared to CSF1 suggest that IL34 might perform a more trophic role.

Macrophages have many apparent roles in embryonic development (Lichanska and Hume 2000; Rae et al. 2007) but studies of their function in mammals have been constrained by the inaccessibility of the embryo, and the fact that CSF1 is produced by the mother and transmitted across the placenta. We have now identified the key regulators that are likely to control avian myelopoiesis and will be able to take advantage of the accessibility of chicken development in ovo to manipulate expression and function of these genes.

REFERENCES

  • Abrams K, Yunusov M Y, Slichter S, Moore P, Nelp W B, Burstein S A, McDonough S, Durack L, Storer B, Storb R et al. 2003. Recombinant human macrophage colony-stimulating factor-induced thrombocytopenia in dogs. Br J Haematol 121(4): 614-622.
  • Arakawa T, Yphantis D A, Lary J W, Narhi L O, Lu H S, Prestrelski S J, Clogston C L, Zsebo K M, Mendiaz E A, Wypych J et al. 1991. Glycosylated and unglycosylated recombinant-derived human stem cell factors are dimeric and have extensive regular secondary structure. J Biol Chem 266(28): 18942-18948.
  • Avery S, Rothwell L, Degen W D, Schijns V E, Young J, Kaufman J, Kaiser P. 2004. Characterization of the first nonmammalian T2 cytokine gene cluster: the cluster contains functional single-copy genes for IL-3, IL-4, IL-13, and G M-CSF, a gene for IL-5 that appears to be a pseudogene, and a gene encoding another cytokinelike transcript, KK34. J Interferon Cytokine Res 24(10): 600-610.
  • Bakri Y, Sarrazin S, Mayer U P, Tillmanns S, Nerlov C, Boned A, Sieweke M H. 2005. Balance of MafB and PU.1 specifies alternative macrophage or dendritic cell fate. Blood 105(7): 2707-2716.
  • Bates P A, Kelley L A, MacCallum R M, Sternberg M J. 2001. Enhancement of protein modeling by human intervention in applying the automatic programs 3D-JIGSAW and 3D-PSSM. Proteins Suppl 5: 39-46.
  • Blechman J M, Lev S, Barg J, Eisenstein M, Vaks B, Vogel Z, Givol D, Yarden Y. 1995. The fourth immunoglobulin domain of the stem cell factor receptor couples ligand binding to signal transduction. Cell 80(1): 103-113.
  • Bonifer C, Hume D A. 2008. The transcriptional regulation of the Colony-Stimulating Factor 1 Receptor (csflr) gene during hematopoiesis. Front Biosci 13: 549-560.
  • Chen X, Liu H, Focia P J, Shim A K He X. 2008. Structure of macrophage colony stimulating factor bound to FMS: diverse signaling assemblies of class III receptor tyrosine kinases. Proc Natl Acad Sci USA 105(47): 18267-18272.
  • Chitu V, Stanley E R. 2006. Colony-stimulating factor-1 in immunity and inflammation. Curr Opin Immunol 18(1): 39-48.
  • Contreras-Moreira B, Bates P A. 2002. Domain fishing: a first step in protein comparative modelling. Bioinformatics 18(8): 1141-1142.
  • Dai X M, Ryan G R, Hapel A J, Dominguez M G, Russell R G, Kapp S, Sylvestre V, Stanley E R. 2002. Targeted disruption of the mouse colony-stimulating factor 1 receptor gene results in osteopetrosis, mononuclear phagocyte deficiency, increased primitive progenitor cell frequencies, and reproductive defects. Blood 99(1): 111-120.
  • Dai X M, Zong X H, Sylvestre V, Stanley E R. 2004. Incomplete restoration of colony-stimulating factor 1 (CSF-1) function in CSF-1-deficient Csf1op/Csf1op mice by transgenic expression of cell surface CSF-1. Blood 103(3): 1114-1123.
  • Fares M A, McNally D. 2006a. CAPS: coevolution analysis using protein sequences. Bioinformatics 22(22): 2821-2822.
  • -. 2006b. CAPS: coevolution analysis using protein sequences. Bioinformatics 22(22): 2821-2822.
  • Fares M A, Travers S A. 2006a. A novel method for detecting intramolecular coevolution: adding a further dimension to selective constraints analyses. Genetics 173(1): 9-23.
  • Fares M A, Travers S A A. 2006b. A novel method for detecting intramolecular coevolution: Adding a further dimension to selective constraints analyses. Genetics 173(1): 9-23.
  • Faust N, Bonifer C, Sippel A E. 1999. Differential activity of the āˆ’2.7 kb chicken lysozyme enhancer in macrophages of different ontogenic origins is regulated by C/EBP and PU.1 transcription factors. DNA Cell Biol 18(8): 631-642.
  • Francey T, Schalch L, Brcic M, Peterhans E, Jungi T W. 1992. Generation and functional characterization of ovine bone marrow-derived macrophages. Veterinary immunology and immunopathology 32(3-4): 281-301.
  • Fuchs A, Martin-Galiano A J, Kalman M, Fleishman S, Ben-Tal N, Frishman D. 2007. Co-evolving residues in membrane proteins. Bioinformatics 23: 3312-3319.
  • Gibson M S, Kaiser P, Fife M. 2009. Identification of chicken granulocyte colony-stimulating factor (G-CSF/CSF3): the previously described myelomonocytic growth factor is actually CSF3. J Interferon Cytokine Res 29(6): 339-343.
  • Guilbert L J, Stanley E R. 1986. The interaction of 125I-colony-stimulating factor-1 with bone marrow-derived macrophages. J Biol Chem 261(9): 4024-4032.
  • Hamburger V, Hamilton H L. 1992. A series of normal stages in the development of the chick embryo. 1951. Dev Dyn 195(4): 231-272.
  • Hanington P C, Wang T, Secombes C J, Belosevic M. 2007. Growth factors of lower vertebrates: characterization of goldfish (Carassius auratus L.) macrophage colony-stimulating factor-1. J Biol Chem 282(44): 31865-31872.
  • Henikoff S, Henikoff J G. 1992. Amino acid substitution matrices from protein blocks. Proceedings of the National Academy of Sciences of the United States of America 89(22): 10915-10919.
  • Himes S R, Cronau S, Mulford C, Hume D A. 2005. The Runx1 transcription factor controls CSF-1-dependent and -independent growth and survival of macrophages. Oncogene 24(34): 5278-5286.
  • Himes S R, Tagoh H, Goonetilleke N, Sasmono T, Oceandy D, Clark R, Bonifer C, Hume D A. 2001. A highly conserved c-fms gene intronic element controls macrophage-specific and regulated expression. J Leukoc Biol 70(5): 812-820.
  • Hume D A, Ross I L, Himes S R, Sasmono R T, Wells C A, Ravasi T. 2002. The mononuclear phagocyte system revisited. J Leukoc Biol 72(4): 621-627.
  • Irvine K M, Burns C J, Wilks A F, Su S, Hume D A, Sweet M J. 2006. A CSF-1 receptor kinase inhibitor targets effector functions and inhibits pro-inflammatory cytokine production from murine macrophage populations. FASEB J 20(11): 1921-1923.
  • Jang M H, Herber D M, Jiang X, Nandi S, Dai X M, Zeller G, Stanley E R, Kelley V R. 2006. Distinct in vivo roles of colony-stimulating factor-1 isoforms in renal inflammation. J Immunol 177(6): 4055-4063.
  • Jiang X, Gurel O, Mendiaz E A, Stearns G W, Clogston C L, Lu H S, Osslund T D, Syed R S, Langley K E, Hendrickson W A. 2000. Structure of the active core of human stem cell factor and analysis of binding to its receptor kit. EMBO J 19(13): 3192-3203.
  • Jones D T. 1999. Protein secondary structure prediction based on position-specific scoring matrices. J Mol Biol 292(2): 195-202.
  • Kaiser P. 2007. The avian immune genome—a glass half-full or half-empty? Cytogenetic and genome research 117(1-4): 221-230.
  • Koths K. 1997. Structure-function studies on human macrophage colony-stimulating factor (M-CSF). Mol Reprod Dev 46(1): 31-37; discussion 37-38.
  • Lemmon M A, Pinchasi D, Zhou M, Lax I, Schlessinger J. 1997. Kit receptor dimerization is driven by bivalent binding of stem cell factor. J Biol Chem 272(10): 6311-6317.
  • Lichanska A M, Browne C M, Henkel G W, Murphy K M, Ostrowski M C, McKercher S R, Maki R A, Hume D A. 1999. Differentiation of the mononuclear phagocyte system during mouse embryogenesis: the role of transcription factor PU.1. Blood 94(1): 127-138.
  • Lichanska A M, Hume D A. 2000. Origins and functions of phagocytes in the embryo. Exp Hematol 28(6): 601-611.
  • Lin H, Lee E, Hestir K, Leo C, Huang M, Bosch E, Halenbeck R, Wu G, Zhou A, Behrens D et al. 2008. Discovery of a cytokine and its receptor by functional screening of the extracellular proteome. Science 320(5877): 807-811.
  • Marks S C, Jr., Wojtowicz A, Szperl M, Urbanowska E, MacKay C A, Wiktor-Jedrzejczak W, Stanley E R, Aukerman S L. 1992. Administration of colony stimulating factor-1 corrects some macrophage, dental, and skeletal defects in an osteopetrotic mutation (toothless, tl) in the rat. Bone 13(1): 89-93.
  • Nandi S, Akhter M P, Seifert M F, Dai X M, Stanley E R. 2006. Developmental and functional significance of the CSF-1 proteoglycan chondroitin sulfate chain. Blood 107(2): 786-795.
  • Nieto M A, Patel K, Wilkinson D G. 1996. In situ hybridization analysis of chick embryos in whole mount and tissue sections. Methods Cell Biol 51; 219-235.
  • Pandit J, Bohm A, Jancarik J, Halenbeck R, Koths K, Kim S H. 1992. Three-dimensional structure of dimeric human recombinant macrophage colony-stimulating factor. Science 258(5086): 1358-1362.
  • Park D J. 2004. 3′ RACE LaNe: a simple and rapid fully nested PCR method to determine 3′-terminal cDNA sequence. Biotechniques 36(4): 586-588, 590.
  • Pollard J W. 1997. Role of colony-stimulating factor-1 in reproduction and development. Mol Reprod Dev 46(1): 54-60; discussion 60-51.
  • -. 2009. Trophic macrophages in development and disease. Nat Rev Immunol 9(4): 259-270.
  • Porollo A, Meller J. 2007. Versatile annotation and publication quality visualization of protein complexes using POLYVIEW-3D. BMC bioinformatics 8: 316.
  • Rae F, Woods K, Sasmono T, Campanale N, Taylor D, Ovchinnikov D A, Grimmond S M, Hume D A, Ricardo S D, Little M H. 2007. Characterisation and trophic functions of murine embryonic macrophages based upon the use of a Csf1r-EGFP transgene reporter. Dev Biol 308(1): 232-246.
  • Ramsoondar J, Christopherson R J, Guilbert L J, Wegmann T G. 1993. A porcine trophoblast cell line that secretes growth factors which stimulate porcine macrophages. Biol Reprod 49(4): 681-694.
  • Reddy M A, Yang B S, Yue X, Barnett C J, Ross I L, Sweet M J, Hume D A, Ostrowski M C. 1994. Opposing actions of c-ets/PU.1 and c-myb protooncogene products in regulating the macrophage-specific promoters of the human and mouse colony-stimulating factor-1 receptor (c-fms) genes. J Exp Med 180(6): 2309-2319.
  • Rosnet O, Birnbaum D. 1993. Hematopoietic receptors of class III receptor-type tyrosine kinases. Crit Rev Oncog 4(6): 595-613.
  • Rovida E, Paccagnini A, Del Rosso M, Peschon J, Dello Sbarba P. 2001. TNF-alpha-converting enzyme cleaves the macrophage colony-stimulating factor receptor in macrophages undergoing activation. J Immunol 166(3): 1583-1589.
  • Rowlinson S W, Yoshizato H, Barclay J L, Brooks A J, Behncken S N, Kerr L M, Millard K, Palethorpe K, Nielsen K, Clyde-Smith J et al. 2008. An agonist-induced conformational change in the growth hormone receptor determines the choice of signalling pathway. Nat Cell Biol 10(6): 740-747.
  • Ryan G R, Dai X M, Dominguez M G, Tong W, Chuan F, Chisholm O, Russell R G, Pollard J W, Stanley. E R. 2001. Rescue of the colony-stimulating factor 1 (CSF-1)-nullizygous mouse (Csf1(op)/Csf1(op)) phenotype with a CSF-1 transgene and identification of sites of local CSF-1 synthesis. Blood 98(1): 74-84.
  • Sasmono R T, Oceandy D, Pollard J W, Tong W, Pavli P, Wainwright B J, Ostrowski M C, Himes S R, Hume D A. 2003. A macrophage colony-stimulating factor receptor-green fluorescent protein transgene is expressed throughout the mononuclear phagocyte system of the mouse. Blood 101(3): 1155-1163.
  • Sester D P, Beasley S J, Sweet M J, Fowles L F, Cronau S L, Stacey K J, Hume D A. 1999. Bacterial/CpG DNA down-modulates colony stimulating factor-1 receptor surface expression on murine bone marrow-derived macrophages with concomitant growth arrest and factor-independent survival. J Immunol 163(12): 6541-6550.
  • Shannon P, Markiel A, Ozier O, Baliga N S, Wang J T, Ramage D, Amin N, Schwikowski B, Ideker T. 2003. Cytoscape: A software environment for integrated models of biomolecular interaction networks. Genome Research 13(11): 2498-2504.
  • Stanley E R, Guilbert L J. 1981. Methods for the purification, assay, characterization and target cell binding of a colony stimulating factor (CSF-1). J Immunol Methods 42(3): 253-284.
  • Strockbine L D, Cohen J I, Farrah T, Lyman S D, Wagener F, DuBose R F, Armitage R J, Spriggs M K. 1998. The Epstein-Barr virus BARF1 gene encodes a novel, soluble colony-stimulating factor-1 receptor. J Virol 72(5): 4015-4021.
  • Sweet M J, Hume D A. 2003. CSF-1 as a regulator of macrophage activation and immune responses. Arch Immunol Ther Exp (Warsz) 51(3): 169-177.
  • Tagoh H, Himes R, Clarke D, Leenen P J, Riggs A D, Hume D, Bonifer C. 2002. Transcription factor complex formation and chromatin fine structure alterations at the murine c-fms (CSF-1 receptor) locus during maturation of myeloid precursor cells. Genes Dev 16(13): 1721-1737.
  • Tamura T, Hadwiger-Fangmeier A, Boschek B, Niemann H. 1990. Transformation of chicken fibroblasts by the v-fms oncogene. Virology 178(2): 401-409.
  • Tamura T, Hadwiger-Fangmeier A, Simon E, Smola U, Geschwill H, Schutz B, Trouliaris S, Boscheck B, Niemann H, Bauer H. 1991. Transforming mechanism of the feline sarcoma virus encoded v-fms oncogene product. Behring Inst Mitt(89): 93-99.
  • Taylor E W, Fear A L, Bohm A, Kim S H, Koths K. 1994. Structure-function studies on recombinant human macrophage colony-stimulating factor (M-CSF). J Biol Chem 269(49): 31171-31177.
  • Thompson J D, Higgins D G, Gibson T J. 1994. CLUSTAL W: improving the sensitivity of progressive multiple sequence alignment through sequence weighting, position-specific gap penalties and weight matrix choice. Nucleic acids research 22(22): 4673-4680.
  • Tomlinson M L, Garcia-Morales C, Abu-Elmagd M, Wheeler G N. 2008. Three matrix metalloproteinases are required in vivo for macrophage migration during embryonic development. Mech Dev 125(11-12): 1059-1070.
  • Travers S A A, Fares M A. 2007. Functional coevolutionary networks of the Hsp70-Hop-Hsp90 system revealed through computational analyses. Molecular Biology and Evolution 24(4): 1032-1044.
  • Travers S A A, Tully D C, McCormack G P, Fares M A. 2007. A study of the coevolutionary patterns operating within the env gene of the HIV-1 group M subtypes. Molecular Biology and Evolution 24(12): 2787-2801.
  • Wang T, Hanington P C, Belosevic M, Secombes C J. 2008. Two macrophage colony-stimulating factor genes exist in fish that differ in gene organization and are differentially expressed. J Immunol 181(5): 3310-3322.
  • Westfall P H, Young S S. 1993. Resampling-based multiple testing. New York: John Wiley and Sons.
  • Woolford J, McAuliffe A, Rohrschneider L R. 1988. Activation of the feline c-fms proto-oncogene: multiple alterations are required to generate a fully transformed phenotype. Cell 55(6): 965-977.
  • Yoshihara K, Inumaru S, Hirota Y, Momotani E. 1998. Cloning and sequencing of cDNA encoding bovine macrophage colony-stimulating factor (bM-CSF) and expression of recombinant bM-CSF using baculovirus. Veterinary immunology and immunopathology 63(4): 381-391.

Claims

1-9. (canceled)

10. A method of modulating avian growth and/or organ development comprising administering an effective amount of an avian CSF1 and/or IL34 gene and/or protein to an avian subject.

11-15. (canceled)

16. A method of modulating the avian immune system comprising administering an immunomodulatory amount of an avian CSF1 and/or IL34 gene and/or protein to an avian subject.

17. A vaccine adjuvant comprising an avian CSF1 and IL34 protein.

18. The vaccine adjuvant of claim 17, wherein the avian CSF1 protein, comprises an amino acid sequence at least 60% identical or homologous to the amino acid sequences of SEQ ID NOS:3 or 5.

19. An immunogenic composition, comprising an avian CSF1 and/or IL34 protein.

20. A method of treating conditions, such as inflammatory diseases, resulting from or associated with aberrant CSF1/IL34 gene/protein expression, said method comprising an effective amount of a compound capable of inhibiting CSF1/IL34 gene expression or protein production to an avian subject.

21. The method of claim 20, wherein the compound is selected from the group consisting of: a sense or antisense nucleic acid molecule; a fragment, portion or derivative of an avian CSF1/IL34 gene; and an antibody.

22. A method of screening avian species, particularly agriculturally significant or important avian species for potential inclusion in breeding programs said method comprising the steps of:

a) providing a nucleic acid sample from an avian species; and

b) comparing the level of expression of the CSF1 and/or IL34 gene(s) with a reference nucleic acid sample or value;

wherein avian species which exhibit and increased level of CSF1 and/or IL34 gene expression relative to a that present in a reference nucleic acid sample or value, may be selected for inclusion in breeding programs.

23. An avian CSF1 gene comprising a nucleic acid sequence at least 60% identical or homologous to the nucleic acid sequences of SEQ ID NOS: 1, 2 or 4.

24. A fragment, analogue, portion, mutant, variant, derivative and/or homologue/orthologue of the gene of claim 23.

25. An avian IL34 gene comprising a nucleic acid sequence at least 60% identical or homologous to the nucleic acid sequence of SEQ ID NO:6.

26. A fragment, analogue, portion, mutant, variant, derivative and/or homologue/orthologue of the gene of claim 25.

27. A substantially purified avian CSF1 protein, comprising an amino acid sequence at least 60% identical or homologous to the amino acid sequences of SEQ ID NOS:3 or 5.

28. A fragment, analogue, portion, mutant, variant, derivative and/or homologue/orthologue of the protein of claim 27.

29. A substantially purified avian IL34 protein, comprising an amino acid sequence at least 60% identical or homologous to the amino acid sequence of SEQ ID NO:6.

30. A fragment, analogue, portion, mutant, variant, derivative and/or homologue/orthologue of the protein of claim 29.

31. An expression vector comprising an avian CSF1 gene sequence or fragment or portion thereof.

32. The expression vector of claim 31, wherein the avian gene sequence comprises a nucleic acid sequence at least 60% identical or homologous to the nucleic acid sequences of SEQ ID NOS:1, 2 or 4.

33. An expression vector comprising an avian IL34 gene sequence or fragment or portion thereof.

34. The expression vector of claim 33, wherein the avian IL34 gene sequence comprises a nucleic acid sequence at least 60% identical or homologous to the nucleic acid sequence of SEQ ID NO:6.

35. A host cell transformed with the expression vector of claim 31.

36. A host cell transformed with the expression vector of claim 32.

37. A host cell transformed with the expression vector of claim 33.

Resources

Images & Drawings included:

Sources:

Similar patent applications:

Recent applications in this class: