US20170037363A1
2017-02-09
15/304,151
2015-04-15
This disclosure provides, inter alia, an optimized strain of Nitrosomonas eutropha (N. eutropha) designated D23, D23-100, or AOB D23-100. N. eutropha bacteria disclosed in this application have desirable properties, e.g., optimized properties, such as the ability to suppress growth of pathogenic bacteria, and an enhanced ability to produce nitric oxide and nitric oxide precursors. The N. eutropha herein may be used, for instance, to treat diseases associated with low nitrite levels, skin diseases, and diseases caused by pathogenic bacteria.
Get notified when new applications in this technology area are published.
C12N1/20 » CPC main
Microorganisms, e.g. protozoa; Compositions thereof ; Processes of propagating, maintaining or preserving microorganisms or compositions thereof; Processes of preparing or isolating a composition containing a microorganism; Culture media therefor Bacteria; Culture media therefor
A61K35/747 » CPC further
Medicinal preparations containing materials or reaction products thereof with undetermined constitution; Microorganisms or materials therefrom; Bacteria; Probiotics; Lactic acid bacteria, e.g. enterococci, pediococci, lactococci, streptococci or leuconostocs Lactobacilli, e.g. L. acidophilus or L. brevis
A61K35/744 » CPC further
Medicinal preparations containing materials or reaction products thereof with undetermined constitution; Microorganisms or materials therefrom; Bacteria; Probiotics Lactic acid bacteria, e.g. enterococci, pediococci, lactococci, streptococci or leuconostocs
C12Q1/02 » CPC further
Measuring or testing processes involving enzymes, nucleic acids or microorganisms ; Compositions therefor; Processes of preparing such compositions involving viable microorganisms
A61K8/99 » CPC further
Cosmetics or similar toilet preparations characterised by the composition containing materials, or derivatives thereof of undetermined constitution from microorganisms other than algae or fungi, e.g. protozoa or bacteria
A61Q17/04 » CPC further
Barrier preparations; Preparations brought into direct contact with the skin for affording protection against external influences, e.g. sunlight, X-rays or other harmful rays, corrosive materials, bacteria or insect stings Topical preparations for affording protection against sunlight or other radiation; Topical sun tanning preparations
A01N63/00 » CPC further
Biocides, pest repellants or attractants, or plant growth regulators containing microorganisms, viruses, microbial fungi, animals or substances produced by, or obtained from, microorganisms, viruses, microbial fungi or animals, e.g. enzymes or fermentates
A61K35/74 » CPC further
Medicinal preparations containing materials or reaction products thereof with undetermined constitution; Microorganisms or materials therefrom Bacteria
A61K35/745 » CPC further
Medicinal preparations containing materials or reaction products thereof with undetermined constitution; Microorganisms or materials therefrom; Bacteria; Probiotics; Lactic acid bacteria, e.g. enterococci, pediococci, lactococci, streptococci or leuconostocs Bifidobacteria
This application claims priority to Greek Patent Application Number 20140100217, filed Apr. 15, 2014, U.S. Provisional Application No. 62/002,084, filed May 22, 2014, U.S. Provisional Application No. 62/012,811, filed Jun. 16, 2014, U.S. Provisional Application No. 62/053,588, filed Sep. 22, 2014, and Greek Patent Application Number 20150100115, filed Mar. 13, 2015, the contents of which are incorporated herein by reference in their entireties.
The instant application contains a Sequence Listing which has been submitted electronically in ASCII format and is hereby incorporated by reference in its entirety. Said ASCII copy, created on Apr. 13, 2015, is named N2060-7001WO.txt and is 3,590,980 bytes in size.
Beneficial bacteria can be used to suppress the growth of pathogenic bacteria. Bacteria and other microorganisms are ubiquitous in the environment. The discovery of pathogenic bacteria and the germ theory of disease have had a tremendous effect on health and disease states. Bacteria are a normal part of the environment of all living things. In the gut, these bacteria are not pathogenic under normal conditions, and in fact improve health by rendering the normal intestinal contents less hospitable for disease causing organisms. Disease prevention is accomplished in a number of ways: nutrients are consumed, leaving less for pathogens; conditions are produced, such as pH and oxygen tension, which are not hospitable for pathogens; compounds are produced that are toxic to pathogens; pathogens are consumed as food by these microorganisms; less physical space remains available for pathogens; and specific binding sites are occupied leaving fewer binding sites available for pathogens. The presence of these desirable bacteria is seen as useful in preventing disease states.
There is a need in the art for improved beneficial bacteria that can suppress the growth of pathogenic bacteria.
This disclosure provides, inter alia, an optimized strain of Nitrosomonas eutropha (N. eutropha) designated D23, D23-100 or AOB D23-100, the terms which may be used interchangeably throughout the disclosure.
Ammonia oxidizing bacterial of the genus Nitrosomonas are ubiquitous Gram-negative obligate chemolithoautotrophic bacteria with a unique capacity to generate energy exclusively from the conversion of ammonia to nitrite.
N. eutropha bacteria disclosed in this application have desirable, e.g. optimized, properties such as the ability to suppress growth of pathogenic bacteria, and an enhanced ability to produce nitric oxide (NO) and nitric oxide (NO2−) precursors. The N. eutropha, e.g., optimized N. eutropha, e.g., purified preparations of optimized N. eutropha herein may be used, for instance, to treat diseases, e.g., diseases associated with low nitrite levels, skin disorders, and diseases caused by pathogenic bacteria. When referring to N. eutropha throughout the disclosure, it may be referring to an optimized strain of N. eutropha or a purified preparation of optimized N. eutropha.
The present disclosure provides, inter alia, a Nitrosomonas eutropha (N. eutropha) bacterium, e.g., an optimized N. eutropha, e.g., a purified preparation of optimized N. eutropha, having at least one property selected from:
The bacterium is optionally axenic.
In embodiments, the optimized growth rate is a rate allowing a continuous culture of N. eutropha at an OD600 (optical density at 600 nm) of about 0.15-0.18 to reach an OD600 of about 0.5-0.6 in about 1-2 days. In embodiments, optimized growth rate is a doubling time of about 8 hours when cultured under batch culture conditions. In embodiments, the optimized NH4+ oxidation rate is a rate of at least about 125 micromoles per minute of oxidizing NH4+ to NO2−. In embodiments, the optimized resistance to NH4+ is an ability to grow in medium comprising about 200 mM NH4+ for at least about 48 hours.
In some embodiments, the purified preparation of optimized N. eutropha bacterium (which is optionally axenic) has at least two properties selected from an optimized growth rate, an optimized NH4+ oxidation rate, and an optimized resistance to NH4+. In some embodiments, the purified preparation of optimized N. eutropha bacterium (which is optionally axenic) has an optimized growth rate, an optimized NH4+ oxidation rate, and an optimized resistance to NH4+. In some embodiments, the purified preparation of optimized N. eutropha bacterium (which is optionally axenic) comprises a chromosome that hybridizes under very high stringency to SEQ ID NO: 1.
In some embodiments, the purified preparation of optimized N. eutropha bacterium (which is optionally axenic) comprises an AmoA protein having an identity to SEQ ID NO: 6 or 12 selected from at least about 80%, 85%, 90%, 95%, 98%, 99%, 99.5%, and 100% identical, an AmoB protein having an identity to SEQ ID NO: 8 or 14 selected from at least about 80%, 85%, 90%, 95%, 98%, 99%, 99.5%, and 100% identical, an amoC gene having an identity to SEQ ID NO: 4, 10, or 16 selected from at least about 80%, 85%, 90%, 95%, 98%, 99%, 99.5%, and 100% identical, a hydroxylamine oxidoreductase protein having an identity to SEQ ID NO: 18, 20, or 22 selected from at least 80%, 85%, 90%, 95%, 98%, 99%, 99.5%, and 100% identical, a cytochrome c554 protein having an identity to SEQ ID NO: 24, 26, or 28 selected from at least about 80%, 85%, 90%, 95%, 98%, 99%, 99.5%, and 100% identical, or a cytochrome cM552 protein having an identity to SEQ ID NO: 30 or 32 selected from at least about 80%, 85%, 90%, 95%, 98%, 99%, 99.5%, and 100% identical.
In some embodiments, the purified preparation of optimized N. eutropha bacterium (which is optionally axenic) comprises 1-5, 5-10, 10-15, 15-20, 20-25, 25-30, or all of the sequence characteristics of Table 2. For instance, in some embodiments, the bacterium or preparation comprises an AmoA1 or AmoA2 protein having (or gene encoding) a mutation relative to N. eutropha strain C91 at position 1, e.g., a V at position 1. In some embodiments, the bacterium or preparation comprises an AmoA1 or AmoA2 protein having (or gene encoding) a mutation relative to N. eutropha strain C91 at position 160, e.g., an L at position 160. In some embodiments, the bacterium or preparation comprises an AmoA1 or AmoA2 protein having (or gene encoding) a mutation relative to N. eutropha strain C91 at position 167, e.g., an A at position 167. In some embodiments, the bacterium or preparation comprises an AmoB1 or AmoB2 protein having (or gene encoding) a mutation relative to N. eutropha strain C91 at position 33, e.g., a V at position 33. In some embodiments, the bacterium or preparation comprises an AmoB1 or AmoB2 protein having (or gene encoding) a mutation relative to N. eutropha strain C91 at position 165, e.g., an I at position 165. In some embodiments, the bacterium or preparation comprises an AmoC3 protein having (or gene encoding) a mutation relative to N. eutropha strain C91 at position 79, e.g., an A at position 79. In some embodiments, the bacterium or preparation comprises an AmoC3 protein having (or gene encoding) a mutation relative to N. eutropha strain C91 at position 271, e.g., a V at position 271. In some embodiments, the bacterium or preparation comprises a Hao1, Hao2, or Hao3 protein having (or gene encoding) a mutation relative to N. eutropha strain C91 at position 85, e.g., an S at position 85. In some embodiments, the bacterium or preparation comprises a Hao1, Hao2, or Hao3 protein having (or gene encoding) a mutation relative to N. eutropha strain C91 at position 312, e.g., an E at position 312. In some embodiments, the bacterium or preparation comprises a Hao1 protein having (or gene encoding) a mutation relative to N. eutropha strain C91 at position 163, e.g., an A at position 163. In some embodiments, the bacterium or preparation comprises a c554 CycA1, c554 CycA2, or c554 CycA3 protein having (or gene encoding) a mutation relative to N. eutropha strain C91 at position 65, e.g., a T at position 65. In some embodiments, the bacterium or preparation comprises a c554 CycA1 protein having (or gene encoding) a mutation relative to N. eutropha strain C91 at position 186, e.g., a T at position 186. In some embodiments, the bacterium or preparation comprises a cM552 CycB1 or cM552 CycB2 protein having (or gene encoding) a mutation relative to N. eutropha strain C91 at position 63, e.g., a V at position 63. In some embodiments, the bacterium or preparation comprises a cM552 CycB1 or cM552 CycB2 protein having (or gene encoding) a mutation relative to N. eutropha strain C91 at position 189, e.g., a P at position 189. In some embodiments, the bacterium or preparation comprises a cM552 CycB1 or cM552 CycB2 protein having (or gene encoding) a mutation relative to N. eutropha strain C91 at position 206, e.g., an insE at position 206. In some embodiments, the bacterium or preparation comprises a cM552 CycB1 or cM552 CycB2 protein having (or gene encoding) a mutation relative to N. eutropha strain C91 at position 207, e.g., an insE at position 207. In some embodiments, the bacterium or preparation comprises a cM552 CycB1 protein having (or gene encoding) a mutation relative to N. eutropha strain C91 at position 195, e.g., an insD at position 195. In some embodiments, the bacterium or preparation comprises a cM552 CycB1 protein having (or gene encoding) a mutation relative to N. eutropha strain C91 at position 196, e.g., an insD at position 196. In some embodiments, the bacterium or preparation comprises a cM552 CycB1 protein having (or gene encoding) a mutation relative to N. eutropha strain C91 at position 197, e.g., an insD at position 197.
Combinations of two or more sequence characteristics of Table 2 are also described. The two or more sequence characteristics may be in the same gene or different genes. The two or more sequence characteristics may be in the same protein or different proteins. For instance, in some embodiments, the bacterium or preparation comprises an AmoA1 or AmoA2 protein having (or gene encoding) a mutation relative to N. eutropha strain C91 at position 1, e.g., a V at position 1 and a mutation relative to N. eutropha strain C91 at position 160, e.g., an L at position 160. In some embodiments, the bacterium or preparation comprises an AmoA1 or AmoA2 protein having (or gene encoding) a mutation relative to N. eutropha strain C91 at position 1, e.g., a V at position 1 and a mutation relative to N. eutropha strain C91 at position 167, e.g., an A at position 167. In some embodiments, the bacterium or preparation comprises an AmoA1 or AmoA2 protein having (or gene encoding) a mutation relative to N. eutropha strain C91 at position 160, e.g., an L at position 160 and a mutation relative to N. eutropha strain C91 at position 167, e.g., an A at position 167.
In some embodiments, the bacterium or preparation comprises an AmoB1 or AmoB2 protein having (or gene encoding) a mutation relative to N. eutropha strain C91 at position 33, e.g., a V at position 33 and a mutation relative to N. eutropha strain C91 at position 165, e.g., an I at position 165.
In some embodiments, the bacterium or preparation comprises an AmoC3 protein having (or gene encoding) a mutation relative to N. eutropha strain C91 at position 79, e.g., an A at position 79 and a mutation relative to N. eutropha strain C91 at position 271, e.g., a V at position 271.
In some embodiments, the bacterium or preparation comprises a Hao1, Hao2, or Hao3 protein having (or gene encoding) a mutation relative to N. eutropha strain C91 at position 85, e.g., an S at position 85 and a mutation relative to N. eutropha strain C91 at position 312, e.g., an E at position 312. In some embodiments, the bacterium or preparation comprises a Hao1 protein having (or gene encoding) a mutation relative to N. eutropha strain C91 at position 85, e.g., an S at position 85 and a mutation relative to N. eutropha strain C91 at position 163, e.g., an A at position 163. In some embodiments, the bacterium or preparation comprises a Hao1 protein having (or gene encoding) a mutation relative to N. eutropha strain C91 at position 312, e.g., an E at position 312 and a mutation relative to N. eutropha strain C91 at position 163, e.g., an A at position 163.
In some embodiments, the bacterium or preparation comprises a c554 CycA1 protein having (or gene encoding) a mutation relative to N. eutropha strain C91 at position 65, e.g., a T at position 65 and a mutation relative to N. eutropha strain C91 at position 186, e.g., a T at position 186.
In some embodiments, the bacterium or preparation comprises a cM552 CycB1 protein having (or gene encoding) mutations at any two or more of the following amino acid positions: 63, 189, 194, 195, 196, 197, 206, and 207. For instance, the two or more amino acid positions may comprise: 63 and 189, 63 and 194, 63 and 195, 63 and 196, 63 and 197, 63 and 206, 63 and 207, 189 and 194, 189 and 195, 189 and 196, 189 and 194, 189 and 195, 189 and 196, 189 and 197, 189 and 206, 189 and 207, 194 and 195, 194 and 196, 194 and 197, 194 and 206, 194 and 207, 195 and 196, 195 and 197, 195 and 206, 195 and 207, 196 and 197, 196 and 206, 196 and 207, 197 and 206, 197 and 207, or 206 and 207. In some embodiments, the bacterium or preparation comprises a cM552 CycB1 protein having (or gene encoding) any two or more mutations selected from the group consisting of: I63V, S189P, D194G, 195insD, 196insD, 197insD, 206insE, and 207insE. For instance, the two or more mutations can be selected from the group consisting of: I63V and S189P, I63V and D194G, I63V and 195insD, I63V and 196insD, I63V and 197insD, I63V and 206insE, I63V and 207insE, S189P and D194G, S189P and 195insD, S189P and 196insD, S189P and 197insD, S189P and 206insE, S189P and 207insE, D194G and 195insD, D194G and 196insD, D194G and 197insD, D194G and 206insE, D194G and 207insE, 195insD and 196insD, 195insD and 197insD, 195insD and 206insE, 195insD and 207insE, 196insD and 197insD, 196insD and 206insE, 196insD and 207insE, 197insD and 206insE, 197insD and 207insE, and 206insE and 207insE.
In some embodiments, the bacterium or preparation comprises a cM552 CycB2 protein having (or gene encoding) mutations at any two or more of the following amino acid positions: 63, 189, 206, and 207. For instance, the two or more amino acid positions may comprise: 63 and 189, 63 and 206, 63 and 207, 189 and 206, 189 and 207, or 206 and 207. In some embodiments, the bacterium or preparation comprises a cM552 CycB2 protein having (or gene encoding) any two or more mutations selected from the group consisting of: I63V, S189P, 206insE, and 207insE. For instance, the two or more mutations can be selected from the group consisting of: I63V and S189P, I63V and 206insE, I63V and 207insE, S189P and 206insE, S189P and 207insE, and 206insE and 207insE.
Combinations of three or more sequence characteristics of Table 2 are also described. For instance, in some embodiments, the bacterium or preparation comprises an AmoA1 or AmoA2 protein having (or gene encoding) a mutation relative to N. eutropha strain C91 at position 1, e.g., a V at position 1 and a mutation relative to N. eutropha strain C91 at position 160, e.g., an L at position 160, and a mutation relative to N. eutropha strain C91 at position 167, e.g., an A at position 167.
In some embodiments, the bacterium or preparation comprises a Hao1 protein having (or gene encoding) a mutation relative to N. eutropha strain C91 at position 85, e.g., an S at position 85 and a mutation relative to N. eutropha strain C91 at position 312, e.g., an E at position 312, and a mutation relative to N. eutropha strain C91 at position 163, e.g., an A at position 163.
In some embodiments, the bacterium or preparation comprises a cM552 CycB1 protein having (or gene encoding) mutations at any three or more (e.g., 4, 5, 6, 7, or all) of the following amino acid positions: 63, 189, 194, 195, 196, 197, 206, and 207. For instance, the three mutations may be at positions 195, 196, and 197. In some embodiments, the bacterium or preparation comprises a cM552 CycB1 protein having (or gene encoding) any three or more (e.g., 4, 5, 6, 7, or all) mutations selected from the group consisting of: I63V, S189P, D194G, 195insD, 196insD, 197insD, 206insE, and 207insE. For instance, the three mutations may be 195insD, 196insD, and 197insD.
In some embodiments, the bacterium or preparation comprises a cM552 CycB2 protein having (or gene encoding) mutations at any three or more (e.g., all) of the following amino acid positions: 63, 189, 206, and 207. In some embodiments, the bacterium or preparation comprises a cM552 CycB2 protein having (or gene encoding) any three or more (e.g., all) mutations selected from the group consisting of: I63V, S189P, 206insE, and 207insE.
In some embodiments, the bacterium or preparation comprises mutations relative to N. eutropha strain C91 in at least two genes, e.g., at least two genes listed in Table 2. The two genes may be, for instance, AmoA1 and AmoA2, AmoA1 and AmoB1, AmoA1 and AmoB2, AmoA1 and AmoC1, AmoA1 and AmoC2, AmoA1 and AmoC3, AmoA1 and Hao1, AmoA1 and Hao2, AmoA1 and Hao3, AmoA1 and c554 CycA1, AmoA1 and c554 CycA2, AmoA1 and c554 CycA3, AmoA1 and cM552 CycB1, AmoA1 and cM552 CycB2, AmoA2 and AmoB1, AmoA2 and AmoB2, AmoA2 and AmoC1, AmoA2 and AmoC2, AmoA2 and AmoC3, AmoA2 and Hao1, AmoA2 and Hao2, AmoA2 and Hao3, AmoA2 and c554 CycA1, AmoA2 and c554 CycA2, AmoA2 and c554 CycA3, AmoA2 and cM552 CycB1, AmoA2 and cM552 CycB2, AmoB1 and AmoB2, AmoB1 and AmoC1, AmoB1 and AmoC2, AmoB1 and AmoC3, AmoB1 and Hao1, AmoB1 and Hao2, AmoB1 and Hao3, AmoB1 and c554 CycA1, AmoB1 and c554 CycA2, AmoB1 and c554 CycA3, AmoB1 and cM552 CycB1, AmoB1 and cM552 CycB2, AmoB2 and AmoC1, AmoB2 and AmoC2, AmoB2 and AmoC3, AmoB2 and Hao1, AmoB2 and Hao2, AmoB2 and Hao3, AmoB2 and c554 CycA1, AmoB2 and c554 CycA2, AmoB2 and c554 CycA3, AmoB2 and cM552 CycB1, AmoB2 and cM552 CycB2, AmoC1 and AmoC2, AmoC1 and AmoC3, AmoC1 and Hao1, AmoC1 and Hao2, AmoC1 and Hao3, AmoC1 and c554 CycA1, AmoC1 and c554 CycA2, AmoC1 and c554 CycA3, AmoC1 and cM552 CycB1, AmoC1 and cM552 CycB2, AmoC2 and AmoC3, AmoC2 and Hao1, AmoC2 and Hao2, AmoC2 and Hao3, AmoC2 and c554 CycA1, AmoC2 and c554 CycA2, AmoC2 and c554 CycA3, AmoC2 and cM552 CycB1, AmoC2 and cM552 CycB2, AmoC3 and Hao1, AmoC3 and Hao2, AmoC3 and Hao3, AmoC3 and c554 CycA1, AmoC3 and c554 CycA2, AmoC3 and c554 CycA3, AmoC3 and cM552 CycB1, AmoC3 and cM552 CycB2, Hao1 and Hao2, Hao1 and Hao3, Hao1 and c554 CycA1, Hao1 and c554 CycA2, Hao1 and c554 CycA3, Hao1 and cM552 CycB1, Hao1 and cM552 CycB2, Hao2 and Hao3, Hao2 and c554 CycA1, Hao2 and c554 CycA2, Hao2 and c554 CycA3, Hao2 and cM552 CycB1, Hao2 and cM552 CycB2, Hao3 and c554 CycA1, Hao3 and c554 CycA2, Hao3 and c554 CycA3, Hao3 and cM552 CycB1, Hao3 and cM552 CycB2, c554 CycA1 and c554 CycA2, c554 CycA1 and c554 CycA3, c554 CycA1 and cM552 CycB1, c554 CycA1 and cM552 CycB2, c554 CycA2 and c554 CycA3, c554 CycA2 and cM552 CycB1, c554 CycA2 and cM552 CycB2, c554 CycA3 and cM552 CycB1, c554 CycA3 and cM552 CycB2, or cM552 CycB1 and cM552 CycB2.
In some embodiments, the bacterium or preparation comprises mutations relative to N. eutropha strain C91 in at least three genes, e.g., at least three (e.g., 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, or all) genes listed in Table 2. The three genes may be, for instance AmoA1 and AmoA2 and AmoA3; AmoC1 and AmoC2 and AmoC3; or Hao1 and Hao2 and Hao3.
In some embodiments, the bacterium or preparation comprises at least one structural difference, e.g., at least one mutation, relative to a wild-type bacterium such as N. eutropha strain C91. In some embodiments, the bacterium or preparation comprises a nucleic acid that can be amplified using a pair of primers described herein, e.g., a primer comprising a sequence of SEQ ID NO: 64 and a primer comprising a sequence of SEQ ID NO: 65. In some embodiments, the bacterium or preparation comprises a nucleic acid or protein at least 80%, 85%, 90%, 95%, 98%, 99%, 99.5%, or 100% identical to a gene of FIG. 6, 7, or 8, or a protein encoded by a gene of FIG. 6, 7, or 8. In some embodiments, the bacterium or preparation comprises a nucleic acid or protein at least 80%, 85%, 90%, 95%, 98%, 99%, 99.5%, or 100% identical to a sequence of any of SEQ ID NOS: 64-66 or a protein encoded by a sequence of any of SEQ ID NOS: 64-66.
In some aspects, the present disclosure provides, inter alia, an N. eutropha bacterium, or a purified preparation thereof, comprising a mutation in an ammonia monooxygenase gene, a hydroxylamine oxidoreductase gene, a cytochrome c554 gene, or a cytochrome cM552 gene. The mutation may be relative to a wild-type bacterium such as N. eutropha strain C91. The mutation may be in one or more of the amoA1 gene, the amoA2 gene, amoB1 gene, the amoB2 gene, and the amoC3 gene. The N. eutropha bacterium, or a purified preparation thereof may have a mutation at a position described herein, e.g., in Table 2. The N. eutropha bacterium, or a purified preparation thereof may have a mutation wherein said mutation is a mutation described herein, e.g., in Table 2.
In some embodiments, the mutation may be in one or more of the hao1 gene, the hao2 gene, or the hao3 gene. The N. eutropha bacterium, or a purified preparation thereof may have a mutation at a position described herein, e.g., in Table 2. The N. eutropha bacterium, or a purified preparation thereof may have a mutation wherein said mutation is a mutation described herein, e.g., in Table 2.
In some embodiments, the mutation may be in one or more of the c554 cycA1 gene, the c554 cycA2 gene, and the c554 cycA3 gene. The N. eutropha bacterium, or a purified preparation thereof may have a mutation at a position described herein, e.g., in Table 2. The N. eutropha bacterium, or a purified preparation thereof may have a mutation wherein said mutation is a mutation described herein, e.g., in Table 2.
In some embodiments, the mutation may be in one or more of the cM552 cycB1 gene and the cM552 cycB2 gene. The N. eutropha bacterium, or a purified preparation thereof may have a mutation at a position described herein, e.g., in Table 2. The N. eutropha bacterium, or a purified preparation thereof may have a mutation wherein said mutation is a mutation described herein, e.g., in Table 2.
In certain aspects the N. eutropha bacterium, or a purified preparation thereof, described in the preceding four paragraphs may be based on a N. eutropha bacterium, e.g., an optimized N. eutropha, e.g., a purified preparation of optimized N. eutropha, having at least one property selected from:
In certain aspects, the N. eutropha bacterium, or a purified preparation thereof, described in the preceding five paragraphs may have a mutation in at least 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, or 35 positions of one or more of amoA1 gene, amoA2 gene, amoB1 gene, amoB2 gene, amoC3 gene, hao1 gene, hao2 gene, hao3 gene, c554 cycA1 gene, c554 cycA2 gene, c554 cycA3 gene, cM552 cycB1 gene, and c554 cycB2 gene.
In some embodiments, the N. eutropha bacterium has an optimized growth rate, e.g., an optimized growth rate described herein, and a structural difference such as a mutation (e.g., relative to a wild-type strain such as N. eutropha strain C91), e.g., a mutation described herein, e.g., a mutation of Table 2. In some embodiments, the N. eutropha bacterium has an optimized NH4+ oxidation rate, e.g., an optimized NH4+ oxidation rate described herein, and a structural difference such as a mutation (e.g., relative to a wild-type strain such as N. eutropha strain C91), e.g., a mutation described herein, e.g., a mutation of Table 2. In some embodiments, the N. eutropha bacterium has an optimized resistance to NH4+, e.g., an optimized resistance to NH4+ described herein, and a structural difference such as a mutation (e.g., relative to a wild-type strain such as N. eutropha strain C91), e.g., a mutation described herein, e.g., a mutation of Table 2.
In some embodiments, the N. eutropha bacterium comprises a nucleic acid that can be amplified using a pair of primers described herein, e.g., a primer comprising a sequence of SEQ ID NO: 64 and a primer comprising a sequence of SEQ ID NO: 65.
In certain aspects, this disclosure provides an N. eutropha bacterium (which is optionally axenic) comprising a chromosome that hybridizes at high stringency to SEQ ID NO: 1.
In embodiments, the chromosome hybridizes at very high stringency to SEQ ID NO: 1. In embodiments, the N. eutropha bacterium (which is optionally axenic) comprises a gene that is at least about 80%, 85%, 90%, 95%, 97%, 98%, 99%, or 100% identical to one or more genes of FIGS. 6-8 (e.g., 10, 20, 30, 40, 50, 100, or all genes of any one or more of FIGS. 6, 7, and 8).
In embodiments, the N. eutropha bacterium (which is optionally axenic) lacks any plasmid that is at least about 80%, 85%, 90%, 95%, 97%, 98%, 99%, or 100% identical to SEQ ID NO: 2 (pNeut1) or SEQ ID NO: 3 (pNeut2), as described by Stein et al. Whole-genome analysis of the ammonia-oxidizing bacterium, Nitrosomonas eutropha C91: implications for niche adaptation. Environmental Microbiology (2007) 9(12), 2993-3007. In embodiments, the N. eutropha (which is optionally axenic) lacks one or more genes present on the plasmids of SEQ ID NO: 2 or SEQ ID NO: 3. For instance, the N. eutropha (which is optionally axenic) may lack at least 2, 3, 4, 5, 10, 15, or 20 genes present on one or both of pNeut1 and pNeut2. pNeut1 contains 55 protein-coding sequences while pNeutP2 contains 52 protein-coding sequences. In embodiments, the N. eutropha bacterium (which is optionally axenic) lacks any plasmid.
In certain aspects, this disclosure provides an N. eutropha bacterium (which is optionally axenic) comprising one or more of an amoA1 gene at least about 98.9% identical to SEQ ID NO: 7 and an amoA2 gene at least about 98.8% identical to SEQ ID NO: 13.
In certain aspects, this disclosure provides an N. eutropha bacterium (which is optionally axenic) comprising one or more of an AmoA1 protein at least about 99.0% identical to SEQ ID NO: 6 and an AmoA2 protein at least about 99.0% identical to SEQ ID NO: 12.
In certain aspects, this disclosure provides an N. eutropha bacterium (which is optionally axenic) comprising one or more of an amoB1 gene at least about 99.2% identical to SEQ ID NO: 9 and an amoB2 gene at least about 99.2% identical to SEQ ID NO: 15.
In embodiments, the N. eutropha bacterium (which is optionally axenic) further comprises one or more of an amoA1 or amoA2 gene at least about 98.9% identical to SEQ ID NO: 7 or 13.
In certain aspects, this disclosure provides an N. eutropha bacterium (which is optionally axenic) comprising one or more of an AmoB1 protein at least about 99.6% identical to SEQ ID NO: 8 and an AmoB1 protein at least about 99.6% identical to SEQ ID NO: 14.
In embodiments, the N. eutropha bacterium (which is optionally axenic) further comprises one or more of an AmoA1 protein at least about 99.0% identical to SEQ ID NO: 6 and an AmoA2 protein at least about 99.0% identical to SEQ ID NO: 12.
In certain aspects, this disclosure provides an N. eutropha bacterium (which is optionally axenic) comprising one or more of an amoC1 gene at least about 99.9% identical to SEQ ID NO: 5, an amoC2 gene at least about 99.9% identical to SEQ ID NO: 11, and an amoC3 gene at least about 99.0% identical to SEQ ID NO: 17.
In embodiments, the N. eutropha bacterium (which is optionally axenic) further comprises one or more of an amoA1 gene at least about 98.9% identical to SEQ ID NO: 7, an amo2 gene at least about 98.9% identical to SEQ ID NO: 13, an amoB1 gene at least about 99.2% identical to SEQ ID NO: 9, and an amoB2 gene at least about 99.2% identical to SEQ ID NO: 15.
In certain aspects, this disclosure provides an N. eutropha bacterium (which is optionally axenic) comprising an AmoC3 protein at least about 99.4% identical to SEQ ID NO: 16.
In embodiments, the N. eutropha bacterium (which is optionally axenic) further comprises one or more of an AmoA1 protein at least about 99.0% identical to SEQ ID NO: 6, an AmoA2 protein at least about 99.0% identical to SEQ ID NO: 12, an AmoB1 protein at least about 99.6% identical to SEQ ID NO: 8, and an AmoB1 protein at least about 99.6% identical to SEQ ID NO: 14.
In certain aspects, this disclosure provides an N. eutropha bacterium (which is optionally axenic) comprising one or more of a hao1 gene at least about 99.1% identical to SEQ ID NO: 19, a hao2 gene at least about 99.5% identical to SEQ ID NO: 21, and a hao3 gene at least about 99.3% identical to SEQ ID NO: 23.
In embodiments, the N. eutropha bacterium (which is optionally axenic) further comprises one or more of an amoA1 gene at least about 98.9% identical to SEQ ID NO: 7, an amo2 gene at least about 98.9% identical to SEQ ID NO: 13, an amoB1 gene at least about 99.2% identical to SEQ ID NO: 9, an amoB2 gene at least about 99.2% identical to SEQ ID NO: 15, an amoC1 gene at least about 99.9% identical to SEQ ID NO: 5, an amoC2 gene at least about 99.9% identical to SEQ ID NO: 11, and an amoC3 gene at least about 99.0% identical to SEQ ID NO: 17.
In certain aspects, this disclosure provides an N. eutropha bacterium (which is optionally axenic) comprising one or more of a Hao1 protein at least about 99.6% identical to SEQ ID NO: 18, a Hao2 protein at least about 99.7% identical to SEQ ID NO: 20, and a Hao3 protein at least about 99.7% identical to SEQ ID NO: 22.
In embodiments, the N. eutropha bacterium (which is optionally axenic) further comprises an AmoA1 protein at least about 99.0% identical to SEQ ID NO: 6, an AmoA2 protein at least about 99.0% identical to SEQ ID NO: 12, an AmoB1 protein at least about 99.6% identical to SEQ ID NO: 8, an AmoB1 protein at least about 99.6% identical to SEQ ID NO: 14, or an AmoC3 protein at least about 99.4% identical to SEQ ID NO: 16.
In certain aspects, this disclosure provides an N. eutropha bacterium (which is optionally axenic) comprising one or more of a cycA1 gene at least about 98.1% identical to SEQ ID NO: 25, a cycA2 gene at least about 98.8% identical to SEQ ID NO: 27, and a cycA3 gene at least about 99.4% identical to SEQ ID NO: 28.
In embodiments, the N. eutropha bacterium (which is optionally axenic) further comprises one or more of an amoA1 gene at least about 98.9% identical to SEQ ID NO: 7, an amo2 gene at least about 98.9% identical to SEQ ID NO: 13, an amoB1 gene at least about 99.2% identical to SEQ ID NO: 9, an amoB2 gene at least about 99.2% identical to SEQ ID NO: 15, an amoC1 gene at least about 99.9% identical to SEEQ ID NO: 5, an amoC2 gene at least about 99.9% identical to SEQ ID NO: 11, an amoC3 gene at least about 99.0% identical to SEQ ID NO: 17, a hao1 gene at least about 99.1% identical to SEQ ID NO: 19, a hao2 gene at least about 99.5% identical to SEQ ID NO: 21, and a hao3 gene at least about 99.3% identical to SEQ ID NO: 23.
In certain aspects, this disclosure provides an N. eutropha bacterium (which is optionally axenic) comprising one or more of a CycA1 protein at least about 99.2% identical to SEQ ID NO: 24, a CycA2 protein at least about 99.7% identical to SEQ ID NO: 26, and a CycA3 protein at least about 99.7% identical to SEQ ID NO: 28.
In embodiments, the N. eutropha bacterium (which is optionally axenic) further comprises one or more of an AmoA1 protein at least about 99.0% identical to SEQ ID NO: 6, an AmoA2 protein at least about 99.0% identical to SEQ ID NO: 12, an AmoB1 protein at least about 99.6% identical to SEQ ID NO: 8, an AmoB1 protein at least about 99.6% identical to SEQ ID NO: 14, an AmoC3 protein at least about 99.4% identical to SEQ ID NO: 16, a Hao1 protein at least about 99.6% identical to SEQ ID NO: 18, a Hao2 protein at least about 99.7% identical to SEQ ID NO: 20, and a Hao3 protein at least about 99.7% identical to SEQ ID NO: 22.
In certain aspects, this disclosure provides an N. eutropha bacterium (which is optionally axenic) comprising one or more of a cycB1 gene at least about 96.8% identical to SEQ ID NO: 31 and a cycB2 gene at least about 97.2% identical to SEQ ID NO: 33.
In embodiments, the N. eutropha bacterium (which is optionally axenic) further comprises one or more of an amoA1 gene at least about 98.9% identical to SEQ ID NO: 7, an amo2 gene at least about 98.9% identical to SEQ ID NO: 13, an amoB1 gene at least about 99.2% identical to SEQ ID NO: 9, an amoB2 gene at least about 99.2% identical to SEQ ID NO: 15, an amoC1 gene at least about 99.9% identical to SEQ ID NO: 5, an amoC2 gene at least about 99.9% identical to SEQ ID NO: 11, an amoC3 gene at least about 99.0% identical to SEQ ID NO: 17, a hao1 gene at least about 99.1% identical to SEQ ID NO: 19, a hao2 gene at least about 99.5% identical to SEQ ID NO: 21, a hao3 gene at least about 99.3% identical to SEQ ID NO: 23, a cycA1 gene at least about 98.1% identical to SEQ ID NO: 25, a cycA2 gene at least about 98.8% identical to SEQ ID NO: 27, and a cycA3 gene at least about 99.4% identical to SEQ ID NO: 28.
In certain aspects, this disclosure provides an N. eutropha bacterium (which is optionally axenic) comprising one or more of a CycB1 protein at least about 97.2% identical to SEQ ID NO: 30 or a CycB2 protein at least about 98.8% identical to SEQ ID NO: 32.
In embodiments, the N. eutropha bacterium (which is optionally axenic) further comprises one or more of an AmoA1 protein at least about 99.0% identical to SEQ ID NO: 6, an AmoA2 protein at least about 99.0% identical to SEQ ID NO: 12, an AmoB1 protein at least about 99.6% identical to SEQ ID NO: 8, an AmoB1 protein at least about 99.6% identical to SEQ ID NO: 14, an AmoC3 protein at least about 99.4% identical to SEQ ID NO: 16, a Hao1 protein at least about 99.6% identical to SEQ ID NO: 18, a Hao2 protein at least about 99.7% identical to SEQ ID NO: 20, a Hao3 protein at least about 99.7% identical to SEQ ID NO: 22, a CycA1 protein at least about 99.2% identical to SEQ ID NO: 24, a CycA2 protein at least about 99.7% identical to SEQ ID NO: 26, and a CycA3 protein at least about 99.7% identical to SEQ ID NO: 28.
In certain aspects, this disclosure provides an N. eutropha bacterium (which is optionally axenic) comprising one or more genes according to SEQ ID NOS: 5, 7, 9, 11, 13, 15, 17, 19, 21, 23, 25, 27, 29, 31, and 33.
In certain aspects, this disclosure provides an N. eutropha bacterium (which is optionally axenic) comprising one or more proteins according to SEQ ID NOS: 4, 6, 8, 10, 12, 14, 16, 18, 20, 22, 24, 26, 28, 30, and 32.
In certain aspects, this disclosure provides an N. eutropha bacterium (which is optionally axenic) comprising a protein that is mutant relative to N. eutropha strain C91 at at least 1, 2, 3, 4, 5, 10, 15, 20, 25, 30, or all of the amino acid positions listed in Table 2.
In certain aspects, this disclosure provides an N. eutropha bacterium (which is optionally axenic) comprising proteins that are mutant relative to N. eutropha strain C91 at all of the amino acid positions listed in Table 2.
In certain aspects, this disclosure provides an N. eutropha bacterium (which is optionally axenic) of strain D23, 25 vials of said bacterium, designated AOB D23-100, having been deposited with the ATCC patent depository on Apr. 8, 2014 under ATCC accession number PTA-121157.
In embodiments, the N. eutropha bacterium (which is optionally axenic) is transgenic.
In embodiments, the N. eutropha bacterium (which is optionally axenic) has at least one property selected from an optimized growth rate, an optimized NH4+ oxidation rate, and an optimized resistance to NH4+.
In embodiments, the N. eutropha bacterium (which is optionally axenic) has at least two properties selected from an optimized growth rate, an optimized NH4+ oxidation rate, and an optimized resistance to NH4+.
In embodiments, the N. eutropha bacterium (which is optionally axenic) has an optimized growth rate, an optimized NH4+ oxidation rate, and an optimized resistance to NH4+.
In embodiments, the N. eutropha bacterium as described herein (e.g., strain D23) is substantially free of bacteria, other ammonia oxidizing bacteria, fungi, viruses, or pathogens (e.g., animal pathogens, e.g., human pathogens), or any combination thereof.
In certain aspects, this disclosure provides a composition comprising the N. eutropha bacterium as described herein (e.g., strain D23), wherein the composition is substantially free of other organisms.
In certain aspects, this disclosure provides a composition comprising the N. eutropha bacterium as described herein (e.g., strain D23) and further comprising a second organism (e.g., a second strain or species), wherein the composition is substantially free of other organisms (e.g., strains or species). In embodiments, the second organism is an ammonia oxidizing bacterium. In embodiments, the second organism is selected from the group consisting of Nitrosomonas, Nitrosococcus, Nitrosospria, Nitrosocystis, Nitrosolobus, Nitrosovibrio, Lactobacillus, Streptococcus, and Bifidobacter, and combinations thereof.
This disclosure also provides a composition comprising the N. eutropha bacterium as described herein (e.g., strain D23) and further comprising a second and a third organism (e.g., of other strains or species), wherein the composition is substantially free of other organisms (e.g., strains or species). This disclosure also provides a composition comprising the N. eutropha bacterium as described herein (e.g., strain D23) and further comprising 2, 3, 4, 5, 6, 7, 8, 9, or 10 other organisms (e.g., of other strains or species), wherein the composition is substantially free of other organisms (e.g., strains or species).
In some aspects, this disclosure provides a composition comprising a cell suspension of an actively dividing culture of N. eutropha bacteria having an OD600 of at least about 0.1, 0.15, 0.2, 0.25, 0.3, 0.35, 0.4, 0.45, 0.5, 0.6, 0.7, or 0.8, wherein the composition is substantially free of other organisms.
In some aspects, this disclosure provides a composition for topical administration, comprising the N. eutropha bacterium as described herein (e.g., strain D23) and a pharmaceutically or cosmetically acceptable excipient suitable for topical administration. In embodiments, the composition is substantially free of other organisms. In embodiments, the composition further comprises a second organism (e.g., of another strain or specie). In embodiments, the composition further comprises 2, 3, 4, 5, 6, 7, 8, 9, or 10 other organisms (e.g., of other strains or species). The second organism may be, for example, an ammonia oxidizing bacterium. In embodiments, the second organism is selected from the group consisting of Nitrosomonas, Nitrosococcus, Nitrosospria, Nitrosocystis, Nitrosolobus, Nitrosovibrio, Lactobacillus, Streptococcus, and Bifidobacter, and combinations thereof.
In embodiments, the composition is a powder, cosmetic, cream, stick, aerosol, salve, wipe, or bandage. In embodiments, the composition further comprises a moisturizing agent, deodorizing agent, scent, colorant, insect repellant, cleansing agent, or UV-blocking agent. In embodiments, the excipient is an anti-adherent, binder, coat, disintegrant, filler, flavor, color, lubricant, glidant, sorbent, preservative, or sweetener. In embodiments, the concentration of N. eutropha in the composition is about 1011-1013 CFU/L. In embodiments, the concentration of N. eutropha in the composition is about 109 CFU/ml. In embodiments, the mass ratio of N. eutropha to pharmaceutical excipient may be about 0.1 gram per liter to about 100 grams per liter. In some embodiments, the mass ratio of N. eutropha to pharmaceutical excipient is 1 gram per liter.
In some aspects the composition and/or excipient may be in the form of one or more of a liquid, a solid, or a gel. For example, liquid suspensions may include, but are not limited to, water, saline, phosphate-buffered saline, or an ammonia oxidizing storage buffer. Gel formulations may include, but are not limited to agar, silica, polyacrylic acid (for example Carbopol®), carboxymethyl cellulose, starch, guar gum, alginate or chitosan. In some embodiments, the formulation may be supplemented with an ammonia source including, but not limited to ammonium chloride or ammonium sulfate.
In some aspects, this disclosure provides a composition comprising at least about 10, 20, 50, 100, 200, 500, 1,000, 2,000, or 10,000 L, e.g., at about 1011 CFU/L, 1012 CFU/L, 1013 CFU/L of the N. eutropha bacterium as described herein (e.g., strain D23). In some embodiments, the composition is at a concentration of at least about 109 CFU/L, 1010 CFU/L, 1011 CFU/L, or 1012 CFU/L. In some aspects, this disclosure provides a composition comprising at least about 1, 2, 5, 10, 20, 50, 100, 200, or 500 g of the N. eutropha bacterium described herein, e.g., as a dry formulation such as a powder.
In some aspects, this disclosure provides an article of clothing comprising the N. eutropha as described herein (e.g., strain D23). In embodiments, the article of clothing is packaged. In embodiments, the article of clothing is packaged in a material that is resistant to gaseous exchange or resistant to water. The article of clothing may be provided, e.g., at a concentration that provides one or more of a treatment or prevention of a skin disorder, a treatment or prevention of a disease or condition associated with low nitrite levels, a treatment or prevention of body odor, a treatment to supply nitric oxide to a subject, or a treatment to inhibit microbial growth.
In some aspects, this disclosure provides a cloth comprising the N. eutropha as described herein (e.g., strain D23).
In some aspects, this disclosure provides a yarn comprising the N. eutropha as described herein (e.g., strain D23).
In some aspects, this disclosure provides a thread comprising the N. eutropha as described herein (e.g., strain D23).
In some aspects, this disclosure provides a method of obtaining, e.g., manufacturing, an (optionally axenic) N. eutropha bacterium having an optimized growth rate, an optimized NH4+ oxidation rate, or an optimized resistance to NH4+, comprising:
(a) culturing the bacterium under conditions that select for one or more of an optimized growth rate, an optimized NH4+ oxidation rate, or an optimized resistance to NH4+, thereby producing a culture;
(b) testing a sample from the culture for an optimized growth rate, an optimized NH4+ oxidation rate, or an optimized resistance to NH4+; and
(c) repeating the culturing and testing steps until a bacterium having an optimized growth rate, an optimized NH4+ oxidation rate, or an optimized resistance to NH4+ is obtained.
In embodiments, the method comprises a step of obtaining an N. eutropha bacterium from a source, such as soil or the skin of an individual. In embodiments, culturing the bacterium under conditions that select for one or more (e.g., 2 or 3) of an optimized growth rate, an optimized NH4+ oxidation rate, or an optimized resistance to NH4+ comprises culturing the bacterium in N. europaea medium that comprises about 200 mM NH4+. In embodiments, the method comprises a step of creating an axenic culture. In embodiments, the method comprises a step of co-culturing the N. eutropha together with at least one other type of ammonia oxidizing bacteria. In embodiments, the N. eutropha of step (a) lack an optimized growth rate, an optimized NH4+ oxidation rate, and an optimized resistance to NH4+ In embodiments, step (c) comprises repeating the culturing and testing steps until a bacterium having at least two of an optimized growth rate, an optimized NH4+ oxidation rate, and an optimized resistance to NH4+ is obtained.
In some aspects, this disclosure provides an N. eutropha bacterium as described herein (e.g., strain D23), produced by the methods described above.
In some aspects, this disclosure provides a method of testing a preparation of (optionally axenic) N. eutropha, comprising:
assaying the N. eutropha for one or more of an optimized growth rate, an optimized NH4+ oxidation rate, or an optimized resistance to NH4+; and
if the N. eutropha has one or more of an optimized growth rate, an optimized NH4+ oxidation rate, or an optimized resistance to NH4+, classifying the N. eutropha as accepted.
In embodiments, the method further comprises a step of testing the preparation for contaminating organisms. In embodiments, the method further comprises a step of removing a sample from the preparation and conducting testing on the sample. In embodiments, the method further comprises testing medium in which the N. eutropha is cultured. In embodiments, the method further comprises packaging N. eutropha from the preparation into a package. In embodiments, the method further comprises placing N. eutropha from the preparation into commerce.
In some aspects, this disclosure provides a method of producing, e.g., manufacturing N. eutropha, comprising contacting N. eutropha with culture medium and culturing the N. eutropha until an OD600 of at least about 0.3, 0.4, 0.5, 0.6, 0.7, or 0.8 is reached. In some embodiments, the method comprises culturing the N. eutropha until an OD600 of at about 0.3-0.4, 0.4-0.5, 0.5-0.6, 0.6-0.7, or 0.7-0.8 is reached.
In embodiments, the method further comprises assaying the N. eutropha and culture medium for contaminating organisms. In embodiments, the method further comprises assaying the N. eutropha for one or more (e.g., 2 or 3) of an optimized growth rate, an optimized NH4+ oxidation rate, or an optimized resistance to NH4+ In embodiments, the method comprises producing at least at least about 10, 20, 50, 100, 200, 500, 1,000, 2,000, 5,000, or 10,000 L per day of N. eutropha, e.g., at about 1012 CFUs/L. In some embodiments, the N. eutropha is at a concentration of about 109, 1010, 1011, 1012, 1013, or 1014 CFUs/L. In some embodiments, the N. eutropha is at a concentration of least about 109, 1010, 1011, 1012, 1013, or 1014 CFUs/L.
In some aspects, this disclosure provides a method of producing, e.g., manufacturing, N. eutropha, comprising contacting N. eutropha with culture medium and culturing the N. eutropha until about at least about 1,000 L at about 1012 CFU/L N. eutropha are produced.
In embodiments, the method further comprises a step of assaying the N. eutropha for one or more (e.g., 2 or 3) of an optimized growth rate, an optimized NH4+ oxidation rate, or an optimized resistance to NH4+.
In embodiments, the method further comprises a step of testing the N. eutropha or culture medium for contaminating organisms. In embodiments, the N. eutropha brought into contact with the culture medium is an N. eutropha having one or more (e.g., 2 or 3) of an optimized growth rate, an optimized NH4+ oxidation rate, or an optimized resistance to NH4+.
In some aspects, this disclosure provides a method of producing, e.g., manufacturing N. eutropha, comprising:
(a) contacting N. eutropha with a culture medium; and
(b) culturing the N. eutropha for 1-2 days, thereby creating a culture, until the culture reaches an OD600 of about 0.5-0.6.
In embodiments, the method further comprises a step of assaying the N. eutropha for one or more of an optimized growth rate, an optimized NH4+ oxidation rate, or an optimized resistance to NH4+. In embodiments, the method further comprises a step of testing the culture for contaminating organisms, e.g., bacteria, viruses, fungi, or pathogens, or a combination thereof. In embodiments, the N. eutropha of step (a) is an N. eutropha having one or more (e.g., 2 or 3) of an optimized growth rate, an optimized NH4+ oxidation rate, or an optimized resistance to NH4+. In embodiments, the method comprises producing at least at least about 1,000 L per day at about 1012 CFUs/L of N. eutropha.
In some aspects, this disclosure provides a N. eutropha bacterium produced by the methods described above.
In embodiments, a preparation of N. eutropha made by the methods described above. In some aspects, the preparation may comprise about 0.1 milligrams to about 100 milligrams (mg) of N. eutropha.
In some aspects, a reaction mixture may be provided comprising N. eutropha at an optical density of about 0.5 to about 0.6. In some aspects, this disclosure provides a method of producing N. eutropha-bearing clothing, comprising contacting an article of clothing with of the N. eutropha as described herein (e.g., strain D23).
In embodiments, the method comprises producing at least 10, 100, or 1000 articles of clothing. In embodiments, the method comprises contacting the article of clothing with at least 1010 CFUs of N. eutropha. In embodiments, the method further comprises packaging the clothing.
In certain aspects, the present disclosure provides a method of obtaining a formulation of N. eutropha, combining contacting N. eutropha described herein (e.g., strain D23) with a pharmaceutically or cosmetically acceptable excipient.
In embodiments, the method further comprises mixing the N. eutropha and the excipient. In embodiments, the method is performed under conditions that are substantially free of contaminating organisms, e.g., bacteria, viruses, fungi, or pathogens.
In certain aspects, the present disclosure provides a method of packaging N. eutropha, comprising assembling N. eutropha described herein (e.g., strain D23) into a package.
In embodiments, the package is resistant to gaseous exchange or resistant to water. In embodiments, the package is permeable to gaseous exchange, NH3, NH4+, or NO2−.
In certain aspects, the present disclosure provides a method of inhibiting microbial growth on a subject's skin, comprising topically administering to a subject in need thereof an effective dose of the N. eutropha bacteria described herein (e.g., strain D23).
In embodiments, the effective dose is approximately 1×109 CFU, 2×109 CFU, 5×109 CFU, 1×1010 CFU, 1.5×1010 CFU, 2×1010 CFU, 5×1010 CFU, or 1×1011 CFU. In embodiments, the effective dose is at least about 1×109 CFU, 2×109 CFU, 5×109 CFU, 1×1010 CFU, 1.5×1010 CFU, 2×1010 CFU, 5×1010 CFU, or 1×1011 CFU. In embodiments, the effective dose is approximately 1×109 CFU-2×109 CFU, 2×109 CFU-5×109 CFU, 5×109 CFU-1×1010 CFU, 1×1010 CFU-1.5×1010 CFU, 1×1010 CFU-2×1010 CFU 1.5×1010 CFU-2×1010 CFU, 2×1010 CFU-5×1010 CFU, or 5×1010 CFU-1×1011 CFU. In embodiments, the bacterium is administered at a concentration of about 1×108, 2×108, 5×108, 1×109, 2×109, 5×109, or 1×1010 CFU/ml. In embodiments, the bacterium is administered at a concentration of at least about 1×108, 2×108, 5×108, 1×109, 2×109, 5×109, or 1×1010 CFU/ml. In embodiments, the bacterium is administered at a concentration of about 1×108-2×108, 2×108-5×108, 5×108-1×109, 1×109-2×109, 2×109-5×109, or 5×109-1×1010 CFU/ml. In embodiments, the administration is performed twice per day. In embodiments, the subject is a human. In embodiments, the microbial growth to be inhibited is growth of Pseudomonas aeruginosa or Staphylococcus aureus (S. aureus or SA), Streptococcus pyogenes (S. pyogenes or SP), or Acinetobacter baumannii (A. baumannii or AB).
In certain aspects, the present disclosure provides a method of supplying nitric oxide to a subject, comprising positioning an effective dose of the N. eutropha bacteria described herein (e.g., strain D23) in close proximity to the subject.
In certain aspects, the present disclosure provides a method of reducing body odor, comprising topically administering to a subject in need thereof an effective dose of the N. eutropha bacteria described herein (e.g., strain D23).
In certain aspects, the present disclosure provides a method of treating a disease associated with low nitrite levels, comprising topically administering to a subject in need thereof a therapeutically effective dose of the N. eutropha bacteria described herein (e.g., strain D23).
In embodiments, the disease is HIV dermatitis, infection in a diabetic foot ulcer, atopic dermatitis, acne, e.g., acne vulgaris, eczema, contact dermatitis, allergic reaction, psoriasis, skin infections, vascular disease, vaginal yeast infection, a sexually transmitted disease, heart disease, atherosclerosis, baldness, leg ulcers secondary to diabetes or confinement to bed, angina, particularly chronic, stable angina pectoris, ischemic diseases, congestive heart failure, myocardial infarction, ischemia reperfusion injury, laminitis, hypertension, hypertrophic organ degeneration, Raynaud's phenomenon, fibrosis, fibrotic organ degeneration, allergies, autoimmune sensitization, end stage renal disease, obesity, impotence, or cancer.
In certain aspects, the present disclosure provides a method of treating a skin disorder, comprising topically administering to a subject in need thereof a therapeutically effective dose of the N. eutropha bacteria as described herein (e.g., strain D23). In related aspects, the disclosure provides an N. eutropha bacteria as described herein (e.g., strain D23) for treating a disorder such as a skin disorder. In related aspects, the disclosure provides an N. eutropha bacteria as described herein (e.g., strain D23) for the manufacture of a medicament, e.g., a medicament for treating a skin disorder.
In embodiments, the skin disorder is acne, e.g., acne vulgaris, rosacea, eczema, or psoriasis. In some embodiments, the skin disorder is an ulcer, e.g., venous ulcer, e.g., leg ulcer, e.g., venous leg ulcer, e.g., infection in a diabetic foot ulcer. In some embodiments, topically administering comprises pre-treating the subject with N. eutropha, e.g., an N. eutropha described herein. In some embodiments, topically administering comprises topically administering prior to occurrence of the skin disorder. In some embodiments, topically administering comprises topically administering subsequent to occurrence of the skin disorder.
In certain aspects, the present disclosure provides a method of promoting wound healing or closure, comprising administering to a wound an effective dose of the N. eutropha bacteria as described herein (e.g., strain D23). In related aspects, the disclosure provides an N. eutropha bacteria as described herein (e.g., strain D23) for promoting wound healing. In related aspects, the disclosure provides an N. eutropha bacteria as described herein (e.g., strain D23) for the manufacture of a medicament, e.g., a medicament for promoting wound healing.
In embodiments, the wound comprises one or more undesirable bacteria, e.g., pathogenic bacteria. In embodiments, the wound comprises S. aureus, P. aeruginosa, P. aeroginosa, or A. baunannii.
In embodiments, the N. eutropha is administered to the subject prior to occurrence of the wound. In embodiments, administering to the wound comprises administering to the subject prior to occurrence of the wound. In embodiments, the method further comprises administering N. eutropha (e.g., an N. eutropha described herein, e.g., strain D23) to the wound subsequent to occurrence of the wound. In some aspects, the disclosure provides a method of killing or inhibiting growth of pathogenic bacteria comprising contacting, e.g., applying, N. eutropha bacteria (e.g., N. eutropha described herein, e.g., strain D23) to the skin.
In embodiments, the pathogenic bacteria contribute to one or more of the following conditions: HIV dermatitis, an ulcer, e.g., venous ulcer, e.g., leg ulcer, e.g., venous leg ulcer, e.g., infection in a diabetic foot ulcer, atopic dermatitis, acne, e.g., acne vulgaris, eczema, contact dermatitis, allergic reaction, psoriasis, uticaria, rosacea, skin infections, vascular disease, vaginal yeast infection, a sexually transmitted disease, heart disease, atherosclerosis, baldness, leg ulcers secondary to diabetes or confinement to bed, angina, particularly chronic, stable angina pectoris, ischemic diseases, congestive heart failure, myocardial infarction, ischemia reperfusion injury, laminitis, hypertension, hypertrophic organ degeneration, Raynaud's phenomenon, fibrosis, fibrotic organ degeneration, allergies, autoimmune sensitization, end stage renal disease, obesity, impotence, pneumonia, primary immunodeficiency, epidermal lysis bulosa, or cancer.
In embodiments, the condition is an ulcer, e.g., venous ulcer, e.g., leg ulcer, e.g., venous leg ulcer, e.g., infection in a diabetic foot ulcer. In embodiments, the condition is a venous leg ulcer. In embodiments, the condition is acne, e.g., acne vulgaris. In embodiments, the condition is acne vulgaris. In embodiments, the pathogenic bacteria is one or more of Propionibacterium acnes, Pseudomonas aeruginosa, Staphylococcus aureus, Streptococcus pyogenes, or Acinetobacter baumannii. In embodiments, the method further comprises determining whether the subject is in need of killing or inhibiting growth of pathogenic bacteria, e.g., determining that the subject is in need of killing or inhibiting growth of pathogenic bacteria. In embodiments, the method further comprises selecting the subject in need of killing or inhibiting growth of pathogenic bacteria.
In some embodiments, the N. eutropha catalyze the following reactions.
At a neutral pH, ammonia generated from ammonium around neutral pH conditions is the substrate of the initial reaction. The conversion of ammonia to nitrite takes place in two steps catalyzed respectively by ammonia monooxygenase (Amo) and hydroxylamine oxidoreductase (Hao), as follows:
NH3+2H++2e−+O2→NH2OH+H2O (A)
NH2OH+H2O→NO2−+4e−+5H+ (B)
In some instances, reaction B is reported as follows, to indicate nitrous acid (HNO2) formation at low pH:
NH2OH+H2O→HNO2+4e−+4H+
In certain embodiments, the N. eutropha has a doubling time of less than 4, 5, 6, 7, 8, 9, or 10 hours, for instance about 8 hours, e.g., 7-9 hours or 6-10 hours, when grown under batch culture conditions. In some embodiments, the doubling time is at least 3, 4, 5, or 6 hours under batch culture conditions. In some embodiments, the N. eutropha has a doubling time of less than 16, 18, 20, 22, 24, or 26 hours, for instance about 20 hours, e.g., 19-21 hours or 18-22 hours, when grown under chemostat (i.e., continuous culture) conditions. In some embodiments, the doubling time is at least 10, 12, 14, 16, or 18 hours under chemostat conditions.
In certain embodiments, a continuous culture of N. eutropha at an OD600 of about 0.15-0.18 is capable of reaching an OD600 of about 0.5-0.6 in about 1-2 days. For instance, in some embodiments, a continuous culture of N. eutropha may grow from an OD600 of about 0.15 to at least 0.3, 0.4, 0.5, 0.6, 0.7, or 0.8 over about 1 day; in embodiments the culture may reach an OD in range of 0.4-0.6 or 0.3-0.7 over about 1 day. In embodiments, the continuous culture of N. eutropha may grow from an OD600 of about 0.15 to at least 0.3, 0.4, 0.5, 0.6, 0.7, or 0.8 over about 2 days; in embodiments the culture may reach an OD in the range of 0.4-0.6 or 0.3-0.7 over about 2 days. In some embodiments, the continuous culture conditions comprise growth in a bioreactor in N. europaea medium, optionally comprising about 200 mM NH4+. In some embodiments, the continuous culture conditions are conditions set out in Example 2.
In certain embodiments, the N. eutropha are capable of converting NH4+ (e.g., at about 200 mM) to nitrite (e.g., reaching up to about 180 mM) at a rate of at least about 50, 75, 125, or 150 micromoles NO2− per minute, e.g., about 100-150, 75-175, 75-125, 100-125, 125-150, or 125-175 micromoles/minute, e.g., about 125 micromoles NO2− per minute. In some embodiments, the reaction rates are measured in an about 1 L chemostat culture of about 109 CFU/ml over the course of 24 hours.
In certain embodiments, the N. eutropha are capable of growing in medium comprising at least 50 mM, 75 mM, 100 mM, 125 mM, 150 mM, 175 mM, 200 mM, 225 mM, 250 mM, 275 mM, or 300 mM NH4+ (or NH3), e.g., about 150-200, 175-225, 200-250, 225-275, 250-300 mM, e.g., about 200 or about 250 mM. In certain embodiments, the N. eutropha is grown in a bioreactor under these concentrations of ammonium. In some embodiments, when the N. eutropha is grown under these concentrations of ammonium, the concentration of nitrate or nitrite is capable of reaching at least 60, 80, 100, 120, 140, 160, or 180 mM, e.g., about 140-180, 160-200, or 140-200 mM, e.g., about 160 or 180 mM.
In certain aspects, the present disclosure provides high density cultures of N. eutropha, e.g., N. eutropha strain D23. For instance, the high density culture composition may comprise a cell suspension of an actively dividing culture of N. eutropha bacteria having an OD600 of at least about 0.1, 0.2, 0.3, 0.4, 0.5, 0.6, or 0.7, e.g., about 0.2-0.6, 0.3-0.6, 0.4-0.6, 0.5-0.6, or 0.4-0.7, wherein the composition is substantially free of other organisms
In some embodiments, the N. eutropha are stable for at least 2 weeks, 1 month, 2 months, 3 months, 4 months, 5 months, or 6 months when stored at 4° C. In some embodiments, the method of storage comprises resuspending the cells in a buffer comprising one or more of Na2HPO4 and MgCl2, for instance 50 mM Na2HPO4 and 2 mM MgCl2, for instance the storage buffer described in Example 2. For example, the storage conditions may be those specified in Example 2. In some embodiments, the N. eutropha are continuously cultured at 200 mM NH4+ at a pH of 6-8, e.g., 7, before storage at 4°. Stability can include one or more of 1) retaining viability, 2) retaining a relevant property such as the ability to produce a given level of nitrite.
In certain embodiments, NH4+ and NH3 may be used interchangeably throughout the disclosure.
This disclosure provides, inter alia, a method of changing a composition of a skin microbiome of a subject. The method comprises administering, e.g., applying, a preparation comprising ammonia oxidizing bacteria to a surface of the skin, wherein the amount and frequency of administration, e.g., application, is sufficient to reduce the proportion of pathogenic bacteria on the surface of the skin.
Ammonia oxidizing bacteria are, in some embodiments, ubiquitous Gram-negative obligate chemolithoautotrophic bacteria with a unique capacity to generate energy exclusively from the conversion of ammonia to nitrite.
In some embodiments, the method may further comprise, selecting the subject on the basis of the subject being in need of a reduction in the proportion of pathogenic bacteria on the surface of the skin.
In some embodiments, the preparation comprising ammonia oxidizing bacteria comprises at least one of ammonia, ammonium salts, and urea.
In some embodiments, the preparation comprising ammonia oxidizing bacteria comprises a controlled release material, e.g., slow release material.
In some embodiments, the preparation of ammonia oxidizing bacteria, comprises an excipient, e.g., one of a pharmaceutically acceptable excipient or a cosmetically acceptable excipient. The excipient, e.g., one of the pharmaceutically acceptable excipient and the cosmetically acceptable excipient, may be suitable for one of topical, nasal, pulmonary, and gastrointestinal administration. The excipient, e.g., one of the pharmaceutically acceptable excipient and the cosmetically acceptable excipient may be a surfactant. The surfactant may be selected from the group consisting of cocamidopropyl betaine (ColaTeric COAB), polyethylene sorbitol ester (e.g., Tween 80), ethoxylated lauryl alcohol (RhodaSurf 6 NAT), sodium laureth sulfate/lauryl glucoside/cocamidopropyl betaine (Plantapon 611 L UP), sodium laureth sulfate (e.g., RhodaPex ESB 70 NAT), alkyl polyglucoside (e.g., Plantaren 2000 N UP), sodium laureth sulfate (Plantaren 200), Dr. Bronner's Castile soap, lauramine oxide (ColaLux Lo), sodium dodecyl sulfate (SDS), polysulfonate alkyl polyglucoside (PolySufanate 160 P), sodium lauryl sulfate (Stepanol-WA Extra K), and any combination thereof. Dr. Bronner's Castile soap comprises water, organic coconut oil, potassium hydroxide, organic olive oil, organic fair deal hemp oil, organic jojoba oil, citric acid, and tocopherol. In some embodiments, the excipient comprises one or more of, e.g., all of, water, organic coconut oil, potassium hydroxide, organic olive oil, organic fair deal hemp oil, organic jojoba oil, citric acid, and tocopherol.
In some embodiments, the preparation may be substantially free of other organisms.
In some embodiments, the preparation may be disposed in a powder, cosmetic, cream, stick, aerosol, salve, wipe, or bandage. The preparation may be provided as a powder, cosmetic, cream, stick, aerosol, salve, wipe, or bandage.
In some embodiments, the preparation may comprise a moisturizing agent, deodorizing agent, scent, colorant, insect repellant, cleansing agent, or UV-blocking agent.
In some embodiments, the excipient, e.g., the pharmaceutically acceptable excipient or the cosmetically acceptable excipient may comprise an anti-adherent, binder, coat, disintegrant, filler, flavor, color, lubricant, glidant, sorbent, preservative, or sweetener.
In some embodiments, the preparation comprising ammonia oxidizing bacteria may comprise between about 108 and about 1014 CFU/L. In certain aspects, the preparation may comprise between about 1×109 CFU/L and about 10×109 CFU/L.
In some embodiments, the preparation comprising ammonia oxidizing bacteria may comprise between about 50 milligrams (mg) and about 1000 mg of ammonia oxidizing bacteria.
In some embodiments, the mass ratio of ammonia oxidizing bacteria to the excipient, e.g., the pharmaceutically acceptable excipient or the cosmetically acceptable excipient is in a range of about 0.1 grams per liter to about 1 gram per liter.
In some embodiments, the preparation of ammonia oxidizing bacteria are useful in the treatment or prevention of a disease or condition associated with low nitrite levels, a treatment or prevention of body odor, a treatment to supply nitric oxide to a subject, or a treatment to inhibit microbial growth, e.g., pathogenic bacterial growth.
In some embodiments, the ammonia oxidizing bacteria is selected from the group consisting of Nitrosomonas, Nitrosococcus, Nitrosospria, Nitrosocystis, Nitrosolobus, Nitrosovibrio, and combinations thereof. The preparation may further comprise an organism selected from the group consisting of Lactobacillus, Streptococcus, Bifidobacter, and combinations thereof. In certain aspects, the preparation is substantially free of organisms other than ammonia oxidizing bacteria.
In some embodiments, the preparation comprising ammonia oxidizing bacteria may comprise ammonia oxidizing bacteria in a growth state. In some embodiments, the preparation comprising ammonia oxidizing bacteria may comprise ammonia oxidizing bacteria in a storage state.
In some embodiments, the methods of the present disclosure may be used to deliver a cosmetic product. In some embodiments, the methods of the present disclosure may be used to deliver a therapeutic product. The preparation may be useful for treatment of at least one of HIV dermatitis, infection in a diabetic foot ulcer, atopic dermatitis, acne, e.g., acne vulgaris, eczema, contact dermatitis, allergic reaction, psoriasis, uticaria, rosacea, skin infections, vascular disease, vaginal yeast infection, a sexually transmitted disease, heart disease, atherosclerosis, baldness, leg ulcers secondary to diabetes or confinement to bed, angina, particularly chronic, stable angina pectoris, ischemic diseases, congestive heart failure, myocardial infarction, ischemia reperfusion injury, laminitis, hypertension, hypertrophic organ degeneration, Raynaud's phenomenon, fibrosis, fibrotic organ degeneration, allergies, autoimmune sensitization, end stage renal disease, obesity, impotence, pneumonia, primary immunodeficiency, epidermal lysis bulosa, or cancer.
In certain aspects, the preparation may be useful for treatment of at least one of acne, e.g., acne vulgaris, eczema, psoriasis, uticaria, rosacea, and skin infections.
In some embodiments, the preparation may be provided in a container, the preparation and the container having a weight of less than about 50, 100, 200, 300, 400, 500, 600, 700, 800, 900, 1000, 1500, or 2000 grams.
In some embodiments, the preparation has less than about 0.1% to about 10% of surfactant. In certain aspects, the preparation may be substantially free of surfactant.
In some embodiments, the preparation may comprise a chelator. In some embodiments, the preparation may be substantially free of a chelator.
In some embodiments, the method may comprise applying the preparation about 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, or 24 times per day. In certain aspects, the preparation may be applied one time per day. In certain other aspects, the preparation may be applied two times per day.
In some embodiments, the preparation may be applied for about 1-3, 3-5, 5-7, 7-9, 5-10, 10-14, 12-18, 12-21, 21-28, 28-35, 35-42, 42-49, 49-56, 46-63, 63-70, 70-77, 77-84, or 84-91 days. In certain aspects, the preparation may be applied for about 16 days.
In some embodiments, the method may further comprise obtaining a sample from the surface of the skin. In certain aspects, the method may further comprise isolating DNA of bacteria in the sample. In certain aspects, the method may further comprise sequencing DNA of bacteria in the sample.
In some embodiments, administering the ammonia oxidizing bacteria provides for an increase in the proportion of non-pathogenic bacteria on the surface. In certain aspects, the non-pathogenic bacteria may be commensal non-pathogenic bacteria. In certain aspects, the non-pathogenic bacteria is commensal non-pathogenic bacteria of a genus of Staphylococcus. In certain aspects, the non-pathogenic bacteria may be commensal non-pathogenic bacteria Staphylococcus epidermidis.
In some embodiments, the proportion of non-pathogenic bacteria Staphylococcus is, or is identified as being, increased after about 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10 weeks. In certain aspects, the proportion of non-pathogenic bacteria Staphylococcus epidermidis Staphylococcus is, or is identified as being, increased after about 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10 weeks.
In some embodiments, potentially pathogenic or disease associated Propionibacteria is, or is identified as being, reduced after about 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10 weeks.
In some embodiments, potentially pathogenic or disease associated Stenotrophomonas is, or is identified as being, reduced after about 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10 weeks.
In some embodiments, the surface of the skin comprises a wound.
In some embodiments, a method of treating acne e.g., acne vulgaris, may be provided by one or more methods of the present disclosure. In some embodiments, a method of treating eczema may be provided by one or more methods of the present disclosure. In some embodiments, a method of treating psoriasis may be provided by one or more methods of the present disclosure. In some embodiments, a method of treating uticaria may be provided by one or more methods of the present disclosure. In some embodiments, a method of treating rosacea may be provided by one or more methods of the present disclosure. In some embodiments, a method of treating skin infection may be provided by one or more methods of the present disclosure. In some embodiments, a method of reducing an amount of undesirable bacteria on a surface of a subject is provided.
In some embodiments, the method herein (e.g., a method of administering a N. eutropha bacterium, e.g., a bacterium of strain D23 to a subject in need thereof), further comprise treating the subject with an antibiotic. In embodiments, the antibiotic is Tetracycline, a Lincosamide such as Clindamycin, a Macrolide such as Erythromycin, an Aminoglycoside such as Gentamicin, a β-lactam such as Piperacillin, β-lactamase inhibitor such as Tazobactam, or any combination thereof (such as a combination of a β-lactam such as Piperacillin and a β-lactamase inhibitor such as Tazobactam). In some embodiments, the antibiotic is an antibiotic to which the bacterium is sensitive. In embodiments, the antibiotic is administered after the bacterium has achieved the desired therapeutic effect. In embodiments, the antibiotic is an antibiotic to which the bacterium is resistant. In embodiments, the antibiotic is administered before or during the period in which the bacterium is producing its therapeutic effect.
It is understood that compositions and methods herein involving a bacterium can also involve a plurality of bacteria. For instance, a method of administering a N. eutropha bacterium can also involve administering a plurality of N. eutropha bacteria.
The present disclosure also provides, in certain aspects, a nucleic acid comprising a sequence of consecutive nucleotides (e.g., 15-100 nucleotides) from within the D23 genome, e.g., a sequence of a gene provided herein, e.g., a gene described in Table 1, FIG. 6-8 or Supplementary Table 1, or SEQ ID NO: 66, or a reverse complement of any of the foregoing. In a related aspect, the present disclosure provides a nucleic acid comprising a sequence of consecutive nucleotides (e.g., 15-100 nucleotides) from within SEQ ID NO: 1 or a reverse complement thereof. In a related aspect, the present disclosure provides a nucleic acid comprising a sequence of consecutive nucleotides (e.g., 15-100 nucleotides) from within a gene of Table 1 (e.g., a sequence of SEQ ID NO: 5, 7, 9, 11, 13, 15, 17, 19, 21, 23, 25, 27, 29, 31, or 33) or a reverse complement thereof.
In some embodiments, the nucleic acid has a non-naturally occurring sequence or another modification such as a label, or both. In some embodiments, the sequence of consecutive nucleotides is not a sequence found in N. Eutropha strain C91. In some embodiments, the nucleic acid comprises a heterologous sequence 5′ to the sequence of 15-100 consecutive nucleotides, or a heterologous sequence 3′ to the sequence of 15-100 consecutive nucleotides, or both. In some embodiments, the nucleic acid has a length of 10-15, 15-20, 20-25, 25-30, 30-24, 35-40 nucleotides. In some embodiments, the nucleic acid is bound, e.g., covalently bound, to a detectable label, e.g., a fluorescent label. In some embodiments, the nucleic acid comprises 10-15, 15-20, 20-25, 25-30, 30-24, 35-40, 40-50, 50-60, 60-70, 70-80, 80-90, or 90-100 consecutive nucleotides from within the D23 genome. In some embodiments, the nucleic acid comprises at least about 10, 15, 20, 25, 30, 35, 40, 50, 60, 70, 80, 90, 100, 150, 200, 250, 300, 350, 400, 450, 500, 600, 700, 800, 900, or 1000 consecutive nucleotides from within the D23 genome. In some embodiments, the nucleic acid is DNA.
In some aspects, the disclosure provides a composition or a kit comprising a first nucleic acid and a second nucleic acid. In some embodiments, the first nucleic acid comprises consecutive nucleotides (e.g., 15-100) from within SEQ ID NO: 1, SEQ ID NO: 66, a gene of FIGS. 6-8, or a gene of Table 1, or a reverse complement thereof. In some embodiments, the second nucleic acid comprises consecutive nucleotides (e.g., 15-100) from within SEQ ID NO: 1, SEQ ID NO: 66, a gene of FIGS. 6-8, or a gene of Table 1, or a reverse complement thereof. In some embodiments, the nucleic acid has a non-naturally occurring sequence, e.g., a sequence not found in N. eutropha strain C91. In some embodiments, the first nucleic acid and the second nucleic acid define an amplicon in a gene of Table 1, e.g., a sequence of SEQ ID NO: 5, 7, 9, 11, 13, 15, 17, 19, 21, 23, 25, 27, 29, 31, or 33) or a reverse complement thereof.
In some embodiments, the first nucleic acid has a sequence that corresponds to a first region of SEQ ID NO: 1, and the reverse complement of the second nucleic acid has a sequence that corresponds to a second region of SEQ ID NO: 1, and the first and second regions are separated by a distance suitable for PCR. In some embodiments, the reverse complement of the first nucleic acid has a sequence that corresponds to a first region of SEQ ID NO: 1, and the second nucleic acid has a sequence that corresponds to a second region of SEQ ID NO: 1, and the first and second regions are separated by a distance suitable for PCR. In an embodiment, the distance suitable for PCR is no more than 50, 100, 150, 200, 250, 300, 350, 400, 450, 500, 600, 700, 800, 900, or 1000 nucleotides of SEQ ID NO: 1. In some embodiments, the first nucleic acid and second nucleic acid delineate an amplicon in SEQ ID NO: 1. In some embodiments, the first nucleic acid and second nucleic acid each has a melting temperature (Tm) suitable for PCR, e.g., about 55-65° or about 60-65° C. In some embodiments, the Tm of the first nucleic acid is within 10, 9, 8, 7, 6, 5, 4, 3, 2, or 1° C. of the Tm of the second nucleic acid.
In some embodiments, the first nucleic acid, the second nucleic acid, or each of the first nucleic acid and second nucleic acid further comprises a heterologous sequence 5′ to the sequence of consecutive nucleotides. Alternatively or in combination, in some embodiments, the first nucleic acid, the second nucleic acid, or each of the first nucleic acid and second nucleic acid further comprises a heterologous sequence 3′ to the sequence of consecutive nucleotides from within SEQ ID NO: 1 or SEQ ID NO: 66. In some embodiments, the first nucleic acid, the second nucleic acid, or each of the first nucleic acid and second nucleic acid has a length of 15-20, 20-25, 25-30, 30-24, or 35-40 nucleotides. In some embodiments, the first nucleic acid, the second nucleic acid, or each of the first nucleic acid and second nucleic acid is bound, e.g., covalently bound, to a detectable label, e.g., a fluorescent label. In some embodiments, the first nucleic acid comprises, or consists of, a sequence of SEQ ID NO: 64. In some embodiments, the second nucleic acid comprises, or consists of, a sequence of SEQ ID NO: 65. In some embodiments, the first nucleic acid, the second nucleic acid, or both, are DNA.
In some embodiments, the composition or kit comprises at least two (e.g., 3, 4, 5, 6, 7, 8, 9, or 10) pairs of primers, each pair recognizing an amplicon in a gene of Table 1 (e.g., a sequence of SEQ ID NO: 5, 7, 9, 11, 13, 15, 17, 19, 21, 23, 25, 27, 29, 31, or 33) or a reverse complement thereof. In some embodiments, a first pair of primers recognizes an amplicon in an Amo gene (e.g., AmoA1, AmoA2, AmoB1, AmoB2, AmoC1, AmoC2, or AmoC3) and the second pair of primers recognizes an amplicon in an Amo gene (e.g., AmoA1, AmoA2, AmoB1, AmoB2, AmoC1, AmoC2, or AmoC3). In some embodiments, a first pair of primers recognizes an amplicon in an AmoA gene (e.g., AmoA1 or AmoA2). In some embodiments, a second pair of primers recognizes an amplicon in an AmoB gene (e.g., AmoB1 or AmoB2). In some embodiments, a third pair of primers recognizes an amplicon in an AmoC gene (e.g., AmoC1, AmoC2, or AmoC3).
In some embodiments, the kit comprises a first container in which the first nucleic acid is disposed and a second container in which the second nucleic acid is disposed. The kit may comprise additional containers, e.g., for a third, fourth, fifth, or sixth nucleic acid. In some embodiments, a pair of primers recognizing an amplicon is stored in a single container.
The present disclosure also provides, in some aspects, a nucleic acid comprising, or consisting of, the sequence of SEQ ID NO: 64. The present disclosure also provides, in some aspects, a nucleic acid comprising, or consisting of, the sequence of SEQ ID NO: 65. The present disclosure also provides, in some aspects, the present disclosure provides a molecule comprising a nucleic acid described herein and a detectable label, e.g., a fluorescent label. The nucleic acid may consist of a sequence of SEQ ID NO: 64 or SEQ ID NO: 65, for example.
The present disclosure provides, in some aspects, a composition comprising a first molecule and a second molecule. In some embodiments, the first molecule comprises a nucleic acid described herein, e.g., a nucleic acid consisting of the sequence of SEQ ID NO: 64, and optionally comprises a detectable label, e.g., a fluorescent label. In some embodiments, the second molecule comprises a nucleic acid described herein, e.g., a nucleic acid consisting of the sequence of SEQ ID NO: 65, and optionally comprises a detectable label, e.g., a fluorescent label.
In some embodiments, the kit comprises a first container in which the first molecule is disposed and a second container in which the second molecule is disposed.
In some embodiments, a kit described herein further comprises one or more of a buffer, an enzyme (e.g., a polymerase such as a thermostable polymerase such as Taq), nucleotides (e.g., dNTPs), and chain-terminating nucleotides (e.g., dideoxy nucleotides) which are optionally dye-labeled; these components may be provided separately or as part of a single composition.
In certain aspects, this disclosure provides a method of detecting whether a D23 N. eutropha nucleic acid is present in a sample, comprising: performing a polymerase chain reaction (PCR) on the sample using primers specific to D23 N. eutropha, and determining whether a PCR product is produced, wherein the presence of a PCR product indicates that the D23 N. eutropha nucleic acid was present in the sample. In embodiments, at least two PCR reactions are performed, e.g., 3, 4, 5, 6, 7, 8, 9 or 10 PCR reactions. In embodiments, the PCR reactions are performed in separate reaction volumes. In embodiments, two or more PCR reactions are performed in multiplex.
In some embodiments, the primers specific to D23 N. eutropha are a first nucleic acid and second nucleic acid described herein, e.g., a first and second nucleic acid from a composition or kit described herein. In some embodiments, the first primer comprises or consists of a sequence of SEQ ID NO: 65, and the second primer comprises or consists of a sequence of SEQ ID NO: 66.
In some embodiments, the PCR reaction is a quantitative or real-time PCR reaction. In some embodiments, the PCR reaction comprises a TaqMan reaction. In some embodiments, the PCR reaction comprises cycling the temperature of a reaction mixture between a denaturing temperature (e.g., about 95° C.), an annealing temperature (e.g., 45-68, 55-65, or 60-65° C.), and an elongation temperature (e.g., about 68° C.) for a number of cycles sufficient to produce a detectable PCR product, e.g., about 10, 15, 20, 25, or 30 cycles. In some embodiments, detecting the PCR product comprises detecting fluorescence from the PCR product. In some embodiments, a positive control is performed, e.g., using a known D23 N. eutropha nucleic acid as a template. In some embodiments, a negative control is used, e.g., using no template or using another bacterial nucleic acid as a template.
In certain aspects, the disclosure provides a method of detecting whether a D23 N. eutropha nucleic acid is present in a sample, comprising detecting binding of a nucleic acid described herein to a sample, wherein the presence of binding indicates that the D23 N. eutropha nucleic acid was present in the sample. In some embodiments, binding is detected by primer extension or RNase protection.
In some embodiments of the methods herein, the sample comprises at least 2, 3, 4, 5, 6, 7, 8, 9, or 10 strains of bacteria. In some embodiments, the sample is from the skin of a subject, e.g., a human subject. In some embodiments, the methods herein comprise detecting one or more additional types of bacterium in the sample, e.g., Pseudomonas aeruginosa, Staphylococcus aureus, Streptococcus pyogenes, or Acinetobacter baumannii.
The disclosure contemplates all combinations of any one or more of the foregoing aspects and/or embodiments, as well as combinations with any one or more of the embodiments set forth in the detailed description and examples.
FIG. 1 shows the growth of a mixed culture of bacteria comprising N. eutropha strain D23. The optical density at a 600 nm wavelength is plotted relative to time.
FIG. 2A shows the nitrite production of a mixed culture of bacteria comprising N. eutropha strain D23. The nitrite concentration is plotted relative to time.
FIG. 2B-I shows the nitrite production kinetics by N. eutropha D23 in batch culture. The nitrite concentration is plotted relative to time.
FIG. 2B-II shows the nitrite production kinetics by N. eutropha D23 in vitro. The nitrite concentration is plotted relative to time.
FIG. 2C shows N. eutropha D23 stability upon storage at 4° C. The nitrite concentration is plotted relative to time.
FIG. 3A shows the N. eutropha D23's ability to inhibit the growth of P. aeruginosa (left panel) and S. aureus (right panel) in co-culture experiments. The amount of each type of undesirable bacteria (in CFU/ml) is plotted relative to time. In this figure, “AOB” refers to strain D23.
FIG. 3B shows the N. eutropha D23's ability to inhibit the growth of Streptococcus pyogenes (left panel) and Acinetobacter baumannii (right panel) in co-culture experiments. The amount of each type of undesirable bacteria (in CFU/ml) is plotted relative to time. In this figure, “AOB” refers to strain D23.
FIG. 3C shows the N. eutropha D23's ability to inhibit the growth of Propionibacterium acnes in co-culture experiments. The amount of each type of undesirable bacteria (in CFU/ml) is plotted relative to time. In this figure, “AOB” refers to strain D23.
FIG. 4A (top panel) plots the NO2− concentration over time in a co-culture experiment. The bottom panel plots pH over time in a co-culture experiment.
FIG. 4B (top panels) plots the CFU/ml of the indicated bacteria over time in a co-culture experiment. The center panels plot the NO2− concentration over time in a co-culture experiment.
The bottom panels plot pH over time in a co-culture experiment.
FIG. 4C plots the microbicidal activity of D23 against skin pathogens.
FIG. 4D plots the microbicidal activity of D23 against skin pathogens.
FIG. 4E shows an alternative plot of microbicidal activity of D23 against skin pathogens.
FIG. 5A plots the percent wound closure over time in an experiment testing D23's ability to improve wound healing.
FIG. 5B plots CT50 for various D23 treatments.
FIG. 5C plots the percent wound closure over time in an experiment testing D23's ability to improve wound healing.
FIG. 5D plots the percent wound closure over time in an experiment testing D23's ability to improve wound healing.
FIG. 5E plots CT50 for various D23 treatments.
FIG. 5F shows images of D23 enhanced wound healing in diabetic mice at Day 1, Day 11, and Day 15.
FIG. 5G shows blood glucose measurements for various concentrations of D23.
FIG. 5H shows body weight of test subjects over the course of testing.
FIG. 5I shows body weight of test subjects over the course of testing.
FIG. 5J shows PCR scores for a scalp test of subjects. AOB refers to D23 in this Figure.
FIG. 5K shows a schematic of a human volunteer study for an evaluation of a Nitrosomonas-containing topical suspension (AOB-001).
FIG. 5L (left panel) shows PCR analyses of scalp swabs collected during the study. Percent-positive samples for AOB-specific three-gene signature (amoA, amoB, amoC). The right panel shows PCR analyses of scalp swabs collected during the study. Composite PCR scores for a total of six samples collected from each of 23 volunteers. The scoring scheme used for the positive samples collected at each of six sampling points is indicated.
FIG. 5M shows genus-level bacterial diversity as determined by 16S rDNA sequencing in skin swab samples collected before and after topical application of AOB-001. The percentage of the total sequence reads representing each of twelve bacterial genera in samples collected at baseline prior to application (Day 0) and immediately after the one week application (Day 8), or one week after stopping topical application (Day 14), are shown. The proportions of Acinetobacter, Burkholderia, Enterobacter, Escherichia Shigella, Klebsiella, Nitrosomonas, Pantoea, Propionibacterium, Pseudomonas, Serratia, Staphylococcus, and Stenotrophomonas are shown.
FIG. 5N-A shows changes in abundance of Nitrosomonas and other species in skin samples collected before and after AOB-001 application. The percentages of the total 16S rDNA sequence reads representing Nitrosomonas prior to application (Day 0), immediately after the one-week application (Day 8), or one week after terminating application (Day 14) are shown.
FIG. 5N-B shows changes in abundance of Nitrosomonas and other species in skin samples collected before and after AOB-001 application. Changed patterns in abundance of species were detected by 16S rDNA sequencing in Day 0 versus Day 8 samples collected from AOB users.
FIG. 5O shows user evaluation of AOB-001. Assessment of AOB-001 cosmetic effects as provided by 23 volunteers upon completion of the one week application to their scalp and face. Subjects were plotted in order of increasing composite PCT scores. (2=agree strongly; 0=no change; −2=disagree strongly).
FIG. 6 is a table displaying unique D23 genes that have either an assigned open reading frame (ORF) number and a function based on sequence analysis, or a hypothetical gene above 200 base pairs in length. The column headers signify as follows: Feature.ID=a unique identifier for the gene; Type=type of gene, where CDS indicates a protein-coding DNA sequence; Start=starting position of gene in the genome sequence of SEQ ID NO: 1; Stop=end of gene in the genome sequence of SEQ ID NO: 1; Frame=reading frame; Length=length of gene in base pairs; Function=gene or protein function based on sequence analysis; Subsystem=category of gene function; D23GbkId=a gene identifier.
FIG. 7 is a table displaying unique D23 genes below 200 base pairs that have an assigned ORF number. Column headers are as described in FIG. 6.
FIG. 8 is a table displaying unique D23 genes with no assigned ORF number. Column headers are as described in FIG. 6.
FIG. 9 lists unique C91 genes that do not have a homolog in D23.
FIG. 10 is a sequence alignment between the AmoA1 and AmoA2 proteins in N. eutropha strains D23 and C91. The SEQ ID of each protein is listed in Table 1. FIG. 10 discloses SEQ ID NOS 6, 12, 36 and 42, respectively, in order of appearance.
FIG. 11 is a sequence alignment between the AmoB1 and AmoB2 proteins in N. eutropha strains D23 and C91. The SEQ ID of each protein is listed in Table 1. FIG. 11 discloses SEQ ID NOS 8, 14, 38 and 44, respectively, in order of appearance.
FIG. 12 is a sequence alignment between the AmoC1 and AmoC2 proteins in N. eutropha strains D23 and C91. The SEQ ID of each protein is listed in Table 1. FIG. 12 discloses SEQ ID NOS 34, 40, 10 and 4, respectively, in order of appearance.
FIG. 13 is a sequence alignment between the AmoC3 proteins in N. eutropha strains D23 and C91. The SEQ ID of each protein is listed in Table 1. FIG. 13 discloses SEQ ID NOS 46 and 16, respectively, in order of appearance.
FIG. 14 A and FIG. 14 B show a sequence alignment between the Hao1, Hao2, and Hao3 proteins in N. eutropha strains D23 and C91. The SEQ ID of each protein is listed in Table 1. FIG. 14 discloses SEQ ID NOS 20, 22, 18, 50, 52 and 48, respectively, in order of appearance.
FIG. 15 is a sequence alignment between the cycA1, cycA2, and cycA3 genes in N. eutropha strains D23 and C91. The SEQ ID of each protein is listed in Table 1. FIG. 15 discloses SEQ ID NOS 26, 28, 24, 58, 56 and 54, respectively, in order of appearance.
FIG. 16 is a sequence alignment between the cycB1 and cycB2 genes in N. eutropha strains D23 and C91. The SEQ ID of each protein is listed in Table 1. FIG. 16 discloses SEQ ID NOS 30, 32, 60 and 62, respectively, in order of appearance.
FIG. 17 shows a bar graph of proportion of bacteria, by genus versus day.
FIG. 18 shows a bar graph of proportion of bacteria, by genus versus bacteria genus, for day 0, day 1, day 8, day 14, and day 16.
Supplementary Table 1 displays the genome annotation of 2,777 genes identified in strain D23 using sequence analysis. Column headers are as described in FIG. 6. “C91 Alias” refers to a homolog in strain C91. Supplementary Table 1 is appended to the end of the Detailed Description and Examples.
Supplementary Table 2 displays the sequences of selected proteins genes identified in strain D23. Supplementary Table 2 is appended to the end of the Detailed Description and Examples.
Ammonia-oxidizing bacteria (AOB) of the genus Nitrosomonas are Gram-negative obligate autotrophic bacteria with a unique capacity to generate nitrite and nitric oxide exclusively from ammonia as an energy source. They are widely present both in soil and water environments and are essential components of environmental nitrification processes. Due to the roles of nitrite and nitric oxide on human skin as important components of several physiological functions, such as vasodilation, skin inflammation and wound healing, these bacteria may have beneficial properties for both healthy and immunopathological skin conditions. These bacteria may be safe for use in humans because they are slow-growing, cannot grow on organic carbon sources, may be sensitive to soaps and antibiotics, and have never been associated with any disease or infection in animals or humans.
An ammonia oxidizing bacterium refers to a bacterium capable of oxidizing ammonia or ammonium to nitrite at a rate, e.g., a substantial rate, e.g., a pre-determined rate, e.g., at least the rate depicted in any one of FIG. 2A, 2B, 2C, 4A, 4B, or 5 or at least 90%, 80%, 70%, 60%, 50%, 40%, 30%, 20%, or 10% of that rate. In some embodiments, the substantial rate refers to the conversion of ammonium ions (NH4+)(e.g., at about 200 mM) to nitrite (NO2−) at a rate of at least 50, 75, 125, or 150 micromoles NO2− per minute, e.g., about 100-150, 75-175, 75-125, 100-125, 125-150, or 125-175 micromoles/minute, e.g., about 125 micromoles NO2− per minute. Examples of ammonia oxidizing bacteria include N. eutropha strains D23 and C91, and other bacteria in the genera Nitrosomonas, Nitrosococcus, Nitrosospira, Nitrosocystis, Nitrosolobus, and Nitrosovibrio. D23 Nitrosomonas eutropha strain refers to the strain, designated AOB D23-100, deposited with the American Tissue Culture Collection (ATCC) on Apr. 8, 2014 having accession number PTA-121157. The D23 Nitrosomonas eutropha of accession number PTA-121157 has a genome sequence as set out in SEQ ID NO: 1 herein. The nucleic acid sequence(s), e.g., genome sequence, of accession number PTA-121157 are hereby incorporated by reference in their entireties.
Optimized Nitrosomonas eutropha (N. eutropha), as that term is used herein, refers to an N. eutropha having an optimized growth rate; an optimized NH4+ oxidation rate; or optimized resistance to NH4+. In an embodiment it differs from naturally occurring N. eutropha by at least one nucleotide, e.g., a nucleotide in a gene selected from ammonia monooxygenase, hydroxylamine oxidoreductase, cytochrome c554, and cytochrome cM552. The difference can arise, e.g., through selection of spontaneously arising mutation, induced mutation, or directed genetic engineering, of the N. eutropha. In an embodiment it differs from a naturally occurring N. eutropha in that it has a constellation of alleles, not present together in nature. These differences may provide for one or more of a treatment or prevention of a skin disorder, a treatment or prevention of a disease or condition associated with low nitrite levels, a treatment or prevention of body odor, a treatment to supply nitric oxide to a subject, and a treatment to inhibit microbial growth.
As used herein, “axenic” refers to a composition comprising an organism that is substantially free of other organisms. For example, an axenic culture of ammonia oxidizing bacteria is a culture that is substantially free of organisms other than ammonia oxidizing bacteria. For example, an axenic culture of N. eutropha is a culture that is substantially free of organisms other than N. eutropha. In some embodiments, “substantially free” denotes undetectable by a method used to detect other organisms, e.g., plating the culture and examining colony morphology, or PCR for a conserved gene such as 16S RNA. An axenic composition may comprise elements that are not organisms, e.g., it may comprise nutrients or excipients. Any embodiment, preparation, composition, or formulation of ammonia oxidizing bacteria discussed herein may comprise, consist essentially of, or consist of optionally axenic ammonia oxidizing bacteria.
Throughout this disclosure, formulation may refer to a composition or preparation.
As used herein, an “autotroph”, e.g., an autotrophic bacterium, is any organism capable of self-nourishment by using inorganic materials as a source of nutrients and using photosynthesis or chemosynthesis as a source of energy. Autotrophic bacteria may synthesize organic compounds from carbon dioxide and ATP derived from other sources, oxidation of ammonia to nitrite, oxidation of hydrogen sulfide, and oxidation of Fe2+ to Fe3+ Autotrophic bacteria of the present disclosure are incapable of causing infection.
Administered “in combination,” as used herein, means that two (or more) different treatments are delivered to the subject during the course of the subject's affliction with the disorder, e.g., the two or more treatments are delivered after the subject has been diagnosed with the disorder and before the disorder has been cured or eliminated. In some embodiments, the delivery of one treatment is still occurring when the delivery of the second begins, so that there is overlap. This is sometimes referred to herein as “simultaneous” or “concomitant” or “concurrent delivery”. In other embodiments, the delivery of one treatment ends before the delivery of the other treatment begins. This is sometimes referred to herein as “successive” or “sequential delivery.” In embodiments of either case, the treatment is more effective because of combined administration. For example, the second treatment is a more effective, e.g., an equivalent effect is seen with less of the second treatment, or the second treatment reduces symptoms to a greater extent, than would be seen if the second treatment were administered in the absence of the first treatment, or the analogous situation is seen with the first treatment. In some embodiments, delivery is such that the reduction in a symptom, or other parameter related to the disorder is greater than what would be observed with one treatment delivered in the absence of the other. The effect of the two treatments can be partially additive, wholly additive, or greater than additive (i.e., synergistic). The delivery can be such that an effect of the first treatment delivered is still detectable when the second is delivered.
Complete N. europaea medium refers to the N. europaea growth medium described in Ensign et al., “In vitro activation of ammonia monooxygenase from Nitrosomonas europaea by copper.” J Bacteriol. 1993 April; 175(7):1971-80.
To “culture” refers to a process of placing an amount of a desired bacterium under conditions that promote its growth, i.e., promoting cell division. The conditions can involve a specified culture medium, a set temperature range, and/or an agitation rate. Bacteria can be cultured in a liquid culture or on plates, e.g., agar plates.
The term “isolated,” as used herein, refers to material that is removed from its original or native environment (e.g., the natural environment if it is naturally occurring). For example, a naturally-occurring polynucleotide or polypeptide present in a living animal is not isolated, but the same polynucleotide or polypeptide, separated by human intervention from some or all of the co-existing materials in the natural system, is isolated. Such polynucleotides could be part of a vector and/or such polynucleotides or polypeptides could be part of a composition, and still be isolated in that such vector or composition is not part of the environment in which it is found in nature.
The terms “nucleic acid,” “nucleic acid sequence,” “nucleotide sequence,” or “polynucleotide sequence,” and “polynucleotide” are used interchangeably. They refer to a polymeric form of nucleotides of any length, e.g., deoxyribonucleotides or ribonucleotides, or analogs thereof. The polynucleotide may be either single-stranded or double-stranded, and if single-stranded may be the coding strand or non-coding (antisense) strand. A polynucleotide may comprise modified nucleotides, such as methylated nucleotides and nucleotide analogs. The sequence of nucleotides may be interrupted by non-nucleotide components. A polynucleotide may be further modified after polymerization, such as by conjugation with a labeling component.
The nucleic acid may be a recombinant polynucleotide, or a polynucleotide of genomic, cDNA, semisynthetic, or synthetic origin which either does not occur in nature or is linked to another polynucleotide in a nonnatural arrangement.
As used herein, the term “optimized growth rate” refers to one or more of: a doubling time of less than about 4, 5, 6, 7, 8, 9, or 10 hours when cultured under batch conditions as described herein in Example 2; a doubling time of less than about 16, 18, 20, 22, 24, or 26 hours, when grown under chemostat conditions as described herein in Example 2; or growing from an OD600 of about 0.15 to at least about 0.3, 0.4, 0.5, 0.6, 0.7, or 0.8 over about 1 or 2 days. In an embodiment, optimized growth rate is one having a doubling time that it is at least 10, 20, 30, 40, or 50% shorter than that of a naturally occurring N. eutropha.
As used herein, “optimized NH4+ oxidation rate” refers to a rate of at least about 50, 75, 125, or 150 micromoles per minute of converting NH3 or NH4+ into NO2−. For instance, the rate may be at least about 50, 75, 125, or 150 micromoles per minute of converting NH4+ (e.g., at about 200 mM) to NO2−. In an embodiment, an optimized NH4+ oxidation rate is one in which NH3 or NH4+ is converted into NO2−′ at least 10, 20, 30, 40, or 50% more rapidly than is seen with a naturally occurring N. eutropha.
Percent (%) amino acid sequence identity, with respect to the amino acid sequences here (e.g., proteins expressed by N. eutropha D23) is defined as the percentage of amino acid residues in a candidate sequence that are identical with the amino acid residues in the reference sequence, which may be a naturally-occurring N. eutropha sequence or an N. eutropha D23 sequence, after aligning the sequences and introducing gaps, if necessary, to achieve the maximum percent sequence identity, and not considering any conservative substitutions as part of the sequence identity. Alignment for purposes of determining percent amino acid sequence identity can be achieved in various ways that are within the means of those skilled in the art, for instance, using publicly available computer software such as BLAST, ALIGN or Megalign (DNASTAR) software. Those skilled in the art can determine appropriate parameters for measuring alignment, including any algorithms needed to achieve maximal alignment over the full length of the sequences being compared. For instance, the WU-BLAST-2 software may be used to determine amino acid sequence identity (Altschul et al, Methods in Enzymology 266, 460-480 (1996); http://blast.wustl/edu/blast/README.html). WU-BLAST-2 uses several search parameters, most of which are set to the default values. The adjustable parameters are set with the following values: overlap span=1, overlap fraction=0.125, world threshold (T)=I 1. HSP score (S) and HSP S2 parameters are dynamic values and are established by the program itself, depending upon the composition of the particular sequence, however, the minimum values may be adjusted as appropriate.
Amino acid substitutions can be the result of replacing one amino acid with another amino acid having similar structural and/or chemical properties, such as the replacement of a leucine with a serine, i.e., conservative amino acid replacements. Typical but not limiting conservative substitutions are the replacements, for one another, among the aliphatic amino acids Ala, Val, Leu and Ile; interchange of Ser and Thr containing hydroxy residues, interchange of the acidic residues Asp and Glu, interchange between the amide-containing residues Asn and Gln, interchange of the basic residues Lys and Arg, interchange of the aromatic residues Phe and Tyr, and interchange of the small-sized amino acids Ala, Ser, Thr, Met and Gly. Additional conservative substitutions include the replacement of an amino acid by another of similar spatial or steric configuration, for example the interchange of Asn for Asp, or Gln for Glu. Amino acid substitutions can also be the result of replacing one amino acid with another amino acid having dis-similar structural and/or chemical properties, i.e., non-conservative amino acid replacements. Insertions or deletions may optionally be in the range of 1 to 5 amino acids. The variation allowed may be determined by systematically making insertions, deletions or substitutions of amino acids in the sequence and testing the resulting variants for activity in the in vivo or in vitro assays for, e.g., metabolizing urea or ammonia.
Percent (%) sequence identity with respect to the nucleic acid sequences here (e.g., the N. eutropha D23 genome and portions thereof) is defined as the percentage of nucleotides in a candidate sequence that are identical with the nucleotides in the reference sequence, which may be a naturally-occurring N. eutropha sequence or an N. eutropha D23 sequence, after aligning the sequences and introducing gaps, if necessary, to achieve the maximum percent sequence identity. Alignment for purposes of determining percent nucleotide sequence identity can be achieved in various ways that are within the means of those skilled in the art, for instance, using publicly available computer software such as BLAST. Those skilled in the art can determine appropriate parameters for measuring alignment, including any algorithms needed to achieve maximal alignment over the full length of the sequences being compared.
The terms “polypeptide”, “peptide” and “protein” (if single chain) are used interchangeably herein to refer to amino acid polymers. The polymer may be linear or branched, it may comprise modified amino acids, and it may be interrupted by non-amino acids. The terms also encompass an amino acid polymer that has been modified; for example, disulfide bond formation, glycosylation, lipidation, acetylation, phosphorylation, or any other manipulation, such as conjugation with a labeling component. The polypeptide can be isolated from natural sources, can be a produced by recombinant techniques from a eukaryotic or prokaryotic host, or can be a product of synthetic procedures.
As used herein, “optimized resistance to NH4+” refers to an ability to grow in conditions of greater than 50, 75, 100, 125, 150, 175, 200, 225, 250, 275, or 300 mM NH3 or NH4+ for at least about 24 or 48 hours. In an embodiment, an optimized resistance to NH4+ refers to the ability to grow at least 10, 20, 30, 40, or 50% more rapidly, or at least 10, 20, 30, 40, or 50% longer, in the presence of a selected concentration of NH3 or NH4+ than can a naturally occurring N. eutropha.
As used herein with respect to a comparison between nucleic acid or protein sequences, “similar” means having homology. A similar gene or protein may comprise, e.g., substitutions (such as conservative or non-conservative substitutions), insertions (e.g., of at least 1, 2, 3, 4, 5, 10, 15, 20, 25, 30 amino acids, and for example up to 2, 3, 4, 5, 10, 15, 20, 25, 30, or 50 amino acids, or any positive combination thereof, or the number of nucleotides necessary to encode said amino acids), or deletions (e.g., of at least 1, 2, 3, 4, 5, 10, 15, 20, 25, 30 amino acids, and for example up to 2, 3, 4, 5, 10, 15, 20, 25, 30, or 50 amino acids, or any positive combination thereof, or the number of nucleotides necessary to encode said amino acids), or any combination thereof. Each of substitutions, insertions, and deletions may be positioned at the N-terminus, C-terminus, or a central region of the protein or gene. In embodiments, a conservative substitution is one that does not alter the charge and/or polarity and/or approximate size and/or geometry at the substituted position.
As used herein, “transgenic” means comprising one or more exogenous portions of DNA. The exogenous DNA is derived from another organism, e.g., another bacterium, a bacteriophage, an animal, or a plant.
As used herein, treatment of a disease or condition refers to reducing the severity or frequency of at least one symptom of that disease or condition, compared to a similar but untreated patient. Treatment can also refer to halting, slowing, or reversing the progression of a disease or condition, compared to a similar but untreated patient. Treatment may comprise addressing the root cause of the disease and/or one or more symptoms.
As used herein a therapeutically effective amount refers to a dose sufficient to prevent advancement, or to cause regression of a disease or condition, or which is capable of relieving a symptom of a disease or condition, or which is capable of achieving a desired result. A therapeutically effective dose can be measured, for example, as a number of bacteria or number of viable bacteria (e.g., in CFUs) or a mass of bacteria (e.g., in milligrams, grams, or kilograms), or a volume of bacteria (e.g., in mm3).
As used herein, the term “viability” refers to the autotrophic bacteria's, e.g., ammonia oxidizing bacteria's, ability to oxidize ammonia, ammonium, or urea to nitrite at a pre-determined rate. In some embodiments, the rate refers to the conversion of ammonium ions (NH4+) (e.g., at about 200 mM) to nitrite (NO2−) at a rate of at least 50, 75, 125, or 150 micromoles NO2− per minute, e.g., about 100-150, 75-175, 75-125, 100-125, 125-150, or 125-175 micromoles/minute, e.g., about 125 micromoles NO2− per minute.
“Growth media” or “AOB media,” as referred to herein comprises the following components of Table 3 or Table 4 herein.
In some embodiments, the states most relevant to the present disclosure are the state of growth, e.g., maximal growth, characterized by a pH of at least about 7.6, ammonia, trace minerals, oxygen and carbon dioxide. Another state may be characterized by a pH of about 7.4 or less and characterized by an absence of carbon dioxide. Under low carbon dioxide conditions, ammonia oxidizing bacteria, e.g., Nitrosomonas, continues to oxidize ammonia into nitrite and generates ATP, but lacking carbon dioxide, e.g., lacking sufficient carbon dioxide, to fix and generate protein, it instead generates polyphosphate, which it uses as an energy storage medium. This may allow the ammonia oxidizing bacteria to remain in a “storage state” for a period of time, e.g., a pre-determined period of time, for example, at least 1, 2, 3, 4, 5, 6, 7, days, 1, 2, 3, 4 weeks, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12 months, 1, 2, 3, 4, or 5 years. In some embodiments, the ammonia oxidizing bacteria may remain in a storage state for at least about 6 months to about 1 year.
As used herein, “growth state” refers to autotrophic bacteria, e.g., ammonia oxidizing bacteria, in a state or in an environment, e.g., a media, e.g., a culture media, e.g., a growth media, that may have a pH of at least about 7.6. Levels of at least one of ammonia, ammonium ions, and urea may be between about 1 micromolar and 1000 millimolar. Levels of trace materials are between about 0.01 micromolar iron and 200 micromolar iron. Levels of oxygen are between about 5% and 100% oxygen saturation (e.g., of media). Levels of carbon dioxide are between about 20 ppm and 10% saturation (e.g., of media). In certain aspects, levels of at least one of ammonia, ammonium ions, and urea may be between about 10 micromolar and 100 millimolar. Levels of trace materials are between about 0.1 micromolar iron and 20 micromolar iron. Levels of oxygen are between about 5% and 100% oxygen saturation. Levels of carbon dioxide are between about 200 ppm and 5% saturation (e.g., of media).
As used herein, “polyphosphate loading state” refers to autotrophic bacteria, e.g., ammonia oxidizing bacteria, in a state or in an environment, e.g., a media, e.g., a culture media, e.g., a growth media, that may have a pH of about 7.4, or less. Levels of at least one of ammonia, ammonium ions, and urea are between about 1 micromolar and 2000 millimolar. Levels of trace materials are between 0.01 micromolar iron and 200 micromolar iron. Levels of oxygen are between about 0% and 100% 02 saturation (e.g., of media). Levels of carbon dioxide are between/less than about zero and 400 ppm, and phosphate levels greater than about 1 micromolar. In certain aspects, levels of at least one of ammonia, ammonium ions, and urea are between about 10 micromolar and 200 millimolar. Levels of trace materials are between 0.1 micromolar iron and 20 micromolar iron. Levels of oxygen are between about 5% and 100% 02 saturation. Levels of carbon dioxide are between/less than about zero and 200 ppm, and phosphate levels greater than about 10 micromolar.
The polyphosphate loading state may be induced for a period of time, e.g., a pre-determined period of time. The pre-determined period of time may the time period that allows sufficient polyphosphate accumulation in the ammonia oxidizing bacteria. This pre-determined period of time is the period of time suitable to provide for sufficient polyphosphate loading to allow for the ammonia oxidizing bacteria to be stored for an extended period of time. The pre-determined period of time may be at least partially based on a period of time of about 0.2-10 times, 0.3-5 times, 0.5-3 times, 0.5-1.5 times, or 0.5 to 1 times the doubling time for the ammonia oxidizing bacteria. The pre-determined period of time may be at least partially based on a period of time of about one doubling time for the ammonia oxidizing bacteria. In some embodiments, the pre-determined period of time is between about 8 hours and 12 hours. In some embodiments, the pre-determined period of time is about 10 hours. In some embodiments, the pre-determined period of time is about 24 hours.
A purpose of the polyphosphate loading state may be to provide AOB with sufficient ammonia, ammonium ions, and/or urea, and O2 such that ATP can be produced, but to deny them CO2 and carbonate such that they are unable to use that ATP to fix CO2 and instead use that ATP to generate polyphosphate which may be stored by the bacteria.
As used herein, the term “storage state” refers to autotrophic bacteria, e.g., ammonia oxidizing bacteria, in a state or in an environment, e.g., a media, e.g., a culture media, e.g., a growth media, having a pH of about 7.4 or less (in some embodiments, the pH may be 7.6 or less). Levels of at least one of ammonia, ammonium ions, and urea are between about _1 and 1000 micromolar. Levels of trace materials are between about 0.1 and 100 micromolar. Levels of oxygen are between about 0 and 100% saturation (e.g., of media). Levels of carbon dioxide are between about 0 and 800 ppm. In certain aspects, levels of at least one of ammonia, ammonium ions, and urea are between about _10 and 100 micromolar. Levels of trace materials are between about 1 and 10 micromolar. Levels of oxygen are between about 0 and 100% saturation (e.g., of media). Levels of carbon dioxide are between about 0 and 400 ppm.
AOB are produced according to some embodiments of the present disclosure by generating AOB biomass during a growth state, then exposing the AOB to a polyphosphate loading state and then removing the media and resuspending the AOB in a buffer, e.g., a storage buffer (i.e., the storage state).
The ammonia oxidizing bacteria may remain in a “storage state” for a period of time, e.g., a pre-determined period of time, for example, at least 1, 2, 3, 4, 5, 6, 7, days, 1, 2, 3, 4 weeks, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12 months, 1, 2, 3, 4, or 5 years. In some embodiments, the ammonia oxidizing bacteria may remain in a storage state for at least about 6 months to about 1 year. Upon revival, the viability of the ammonia oxidizing bacteria is at least about 50%, 60%, 70%, 80%, 90%, or 100% of the viability as of the ammonia oxidizing bacteria prior to storage e.g., in a growth state). In some embodiments, the preparation of ammonia oxidizing bacteria may be prepared, such that no more than 10%, 20%, 30%, 40%, 50%, 60%, or 70% of the ability to oxidize NH4+ is lost upon storage at selected conditions.
The time that it takes to revive the ammonia oxidizing bacteria from a storage state (or a polyphosphate loading state) may be a pre-determined period of time. For example, the pre-determined period of time may be less than about 75 hours, or less than about 72 hours. The pre-determined period of time may at least partially based on a period time of about 0.2-10 times, 0.3-5 times, 0.5-3 times, 0.5-1.5 times, or 0.5 to 1 times the doubling time for the ammonia oxidizing bacteria. The pre-determined period of time may be at least partially based on a period of time of about one doubling time for the ammonia oxidizing bacteria. The pre-determined period of time may be between about 8 hours and 12 hours. The pre-determined period of time may be about 10 hours. The pre-determined time may be less than about 75 hours, 72 hours, 70 hours, 68 hours, 65 hours, 60 hours, 55 hours, 50 hours, 45 hours, 40 hours, 35 hours, 30 hours, 25 hours, 20 hours, 15 hours, 10 hours, 5 hours, 4 hours, 3, hours, 2 hours, or 1 hour. The pre-determined period of time may be between about 5 minutes and 5 hours. The pre-determined period of time may be about 5-10 minutes, 10-15 minutes, 15-20 minutes, 20-25 minutes, 25-30 minutes, 30-45 minutes, 45-60 minutes, 60 minutes-1.5 hours, 1.5 hours-2 hours, 2 hours-2.5 hours, 2.5 hours-3 hours, 3 hours-3.5 hours, 3.5 hours-4 hours, 4 hours-4.5 hours, 4.5 hours-5 hours. In some embodiments, the pre-determined period of time may be about 2 hours. The pre-determined period of time, e.g., may be the time it may take to achieve revival of the ammonia oxidizing bacteria, e.g., achieve viability of the ammonia oxidizing bacteria as compared to the viability of the bacteria prior to storage (e.g., in a growth state), e.g., at least about 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, 90%, 95%, 97%, 98%, 99%, or 100% viability.
Autotrophic ammonia oxidizing bacteria, which may be referred to herein as AOBs or AOB, are obligate autotrophic bacteria as noted by Alan B. Hooper and A. Krummel at al. Alan B. Hooper, Biochemical Basis of Obligate Autotrophy in Nitrosomonas europaea, Journal of Bacteriology, February 1969, p. 776-779. Antje Krummel et al., Effect of Organic Matter on Growth and Cell Yield of Ammonia-Oxidizing Bacteria, Arch Microbiol (1982) 133: 50-54. These bacteria derive all metabolic energy only from the oxidation of ammonia to nitrite with nitric oxide (NO) as an intermediate product in their respiration chain and derive virtually all carbon by fixing carbon dioxide. They are incapable of utilizing carbon sources other than a few simple molecules.
Ammonia oxidizing bacteria (AOB) are widely found in the environment, and in the presence of ammonia, oxygen and trace metals will fix carbon dioxide and proliferate. AOB may be slow growing and toxic levels of ammonia may kill fish and other organisms before AOB can proliferate and reduce ammonia to non-toxic levels. Slow growth of AOB also may delay the health benefits of the NO and nitrite the AOB produce when applied to the skin.
Supplementing the aquarium, skin, or process with sufficient viable AOB grown and stored for that purpose is desired. AOB do not form spores, so storage in the dry state with high viability is difficult, and storage in the wet state leaves them metabolically active. Decay of nitrifying capacity during storage of AOB for wastewater treatment has been studied, as for example (Munz G, Lubello C, Oleszkiewicz J A. Modeling the decay of ammonium oxidizing bacteria. Water Res. 2011 January; 45(2): 557-64. Oi: 10.1016/j.watres.2010.09.022.)
Growth, prolonged storage, and restoration of activity of Nitrosomonas is discussed by Cassidy et al. (U.S. Pat. No. 5,314,542) where they disclose growing Nitrosomonas, removing toxic waste products, storing in sterile water of appropriate salinity for periods of time up to one year, and then reviving by adding buffer (CaCO3) and 200 ppm, of ammonium, which reviving takes 72 hours.
As obligate autotrophs, AOB synthesize protein via the fixing of CO2 using the energy and reducing equivalents generated by the oxidation of ammonia to nitrite. Growth requires ammonia, oxygen, minerals and carbon dioxide.
Nitrosomonas may exist in several metabolic states, according to “Polyphosphate and Orthophosphate Content of Nitrosomonas europaea as a Function of Growth” by K. R. Terry and A. B. Hooper, Journal of Bacteriology, July 1970, p. 199-206, Vol. 103, No. I.
In certain embodiments of the disclosure, the ammonia oxidizing bacteria may be axenic. The preparation (formulation or composition) of ammonia oxidizing bacteria may comprise, consist essentially of, or consist of axenic ammonia oxidizing bacteria. The ammonia oxidizing bacteria may be from a genus selected from the group consisting of Nitrosomonas, Nitrosococcus, Nitrosospria, Nitrosocystis, Nitrosolobus, Nitrosovibrio, and combinations thereof.
This disclosure provides, inter alia, N. eutropha strain D23, a unique, e.g., optimized strain of ammonia oxidizing bacteria that can increase production of nitric oxide and nitric oxide precursors on the surface of a subject, e.g., a human subject. This disclosure also provides methods of using the bacteria and articles comprising the bacteria.
In embodiments, the N. eutropha is non-naturally occurring. For instance, it may have accumulated desirable mutations during a period of selection. In other embodiments, desirable mutations may be introduced by an experimenter. In some embodiments, the N. eutropha may be a purified preparation, and may be an optimized N. eutropha.
In preferred embodiments, the N. eutropha strain is autotrophic and so incapable of causing infection. A preferred strain utilizes urea as well as ammonia, so that hydrolysis of the urea in sweat would not be necessary prior to absorption and utilization by the bacteria. Also, in order to grow at low pH, the bacteria may either absorb NH4+ ions or urea. The selected strain should also be capable of living on the external skin of a subject, e.g., a human, and be tolerant of conditions there.
Although this disclosure refers to N. eutropha strain D23 in detail, the preparations, methods, compositions, treatments, wearable articles, and articles of clothing may be used with one or more of: one or more other strains of N. eutropha, one or more other species of Nitrosomonas, and one or more other ammonia oxidizing bacteria. Autotrophic AOBs are obligate autotrophic bacteria as noted by Alan B. Hooper and A. Krummel at al. Alan B. Hooper, Biochemical Basis of Obligate Autotrophy in Nitrosomonas europaea, Journal of Bacteriology, February 1969, p. 776-779. Antje Krummel et al., Effect of Organic Matter on Growth and Cell Yield of Ammonia-Oxidizing Bacteria, Arch Microbiol (1982) 133: 50-54. These bacteria derive all metabolic energy only from the oxidation of ammonia to nitrite with nitric oxide (NO) as an intermediate product in their respiration chain and derive virtually all carbon by fixing carbon dioxide. They are incapable of utilizing carbon sources other than a few simple molecules.
In certain embodiments, the N. eutropha is the strain deposited with the American Tissue Culture Collection (ATCC) on Apr. 8, 2014, designated AOB D23-100 (25 vials) under accession number PTA-121157.
In certain embodiments, the N. eutropha comprises a chromosome having a sequence at least 70%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 99.5% identical to SEQ ID NO: 1 (the strain D23 whole-genome sequence).
In certain embodiments, a bacterium with the above-mentioned sequence characteristics has one or more of (1) an optimized growth rate as measured by doubling time, (2) an optimized growth rate as measured by OD600, (3) an optimized NH4+ oxidation rate, (4) an optimized resistance to NH4+, and (4) an optimized resistance to NO2−. Particular sub-combinations of these properties are specified in the following paragraph.
In some embodiments, the N. eutropha described herein has one or more of: (1) an optimized growth rate as measured by doubling time, (2) an optimized growth rate as measured by OD600, (3) an optimized NH4+ oxidation rate, (4) an optimized resistance to, NH4+, and (4) an optimized resistance to, NO2−. For instance, the bacterium may have properties (1) and (2); (2) and (3); (3) and (4); or (4) and (5) from the list at the beginning of this paragraph. As another example, the bacterium may have properties (1), (2), and (3); (1), (2), and (4); (1), (2), and (5); (1), (3), and (4); (1), (3), and (5); (1), (4), and (5); (2), (3), and (4); (2), (3), and (5), or (3), (4), and (5) from the list at the beginning of this paragraph. As a further example, the bacterium may have properties (1), (2), (3), and (4); (1), (2), (3), and (5); (1), (2), (4), and (5); (1), (3), (4), and (5); or (2), (3), (4), and (5) from the list at the beginning of this paragraph. In some embodiments, the bacterium has properties (1), (2), (3), (4), and (5) from the list at the beginning of this paragraph.
This disclosure also provides an axenic composition of N. eutropha having one or more of: (1) an optimized growth rate as measured by doubling time, (2) an optimized growth rate as measured by OD600, (3) an optimized NH4+ oxidation rate, (4) an optimized resistance to, NH4+, and (4) an optimized resistance to, NO2−. For instance, the axenic N. eutropha composition may have properties (1) and (2); (2) and (3); (3) and (4); or (4) and (5) from the list at the beginning of this paragraph. As another example, the axenic N. eutropha composition may have properties (1), (2), and (3); (1), (2), and (4); (1), (2), and (5); (1), (3), and (4); (1), (3), and (5); (1), (4), and (5); (2), (3), and (4); (2), (3), and (5), or (3), (4), and (5) from the list at the beginning of this paragraph. As a further example, the axenic N. eutropha composition may have properties (1), (2), (3), and (4); (1), (2), (3), and (5); (1), (2), (4), and (5); (1), (3), (4), and (5); or (2), (3), (4), and (5) from the list at the beginning of this paragraph. In some embodiments, the axenic N. eutropha composition has properties (1), (2), (3), (4), and (5) from the list at the beginning of this paragraph.
N. eutropha strain D23, as deposited in the form of 25 vials on Apr. 8, 2014, in the ATCC patent depository, designated AOB D23-100, under accession number PTA-121157, comprises a circular genome having SEQ ID NO: 1 or its complement. Accordingly, in some embodiments, an N. eutropha strain described herein comprises a nucleic acid sequence, e.g., a genome, that is similar to SEQ ID NO: 1 or its complement.
For instance, the N. eutropha may comprise a nucleic acid sequence having a 1,000 base pair portion having at least about 80%, 85%, 90%, 95%, 97%, 98%, 99%, or 99.5% identity to a 1,000 base pair portion of SEQ ID NO: 1 or its complement. The 1,000 base pair portion may span, e.g., nucleotides (n*1,000)+1 to (n+1)*1,000, where n=0, 1, 2, 3 . . . 2538, e.g., nucleotides 1-1,000, 1,001-2,000, and so on through the end of SEQ ID NO: 1.
In embodiments, the N. eutropha comprises a nucleic acid sequence having a 2,000 base pair portion having at least about 80%, 85%, 90%, 95%, 97%, 98%, 99%, or 99.5% identity to a 2,000 base pair portion of SEQ ID NO: 1 or its complement. The 2,000 base pair portion may span, e.g., nucleotides (n*2,000)+1 to (n+1)*2,000, where n=0, 1, 2, 3 . . . 1269, e.g., nucleotides 1-2,000, 2,001-4,000, and so on through the end of SEQ ID NO: 1.
In embodiments, the N. eutropha comprises a nucleic acid sequence having a 5,000 base pair portion having at least about 80%, 85%, 90%, 95%, 97%, 98%, 99%, or 99.5% identity to a 5,000 base pair portion of SEQ ID NO: 1 or its complement. The 5,000 base pair portion may span, e.g., nucleotides (n*5,000)+1 to (n+1)*5,000, where n=0, 1, 2, 3 . . . 508, e.g., nucleotides 1-5,000, 5,001-10,000, and so on through the end of SEQ ID NO: 1.
In embodiments, the N. eutropha comprises a nucleic acid sequence having a 10,000 base pair portion having at least about 80%, 85%, 90%, 95%, 97%, 98%, 99%, or 99.5% identity to a 10,000 base pair portion of SEQ ID NO: 1 or its complement. The 10,000 base pair portion may span, e.g., nucleotides (n*10,000)+1 to (n+1)*10,000, where n=0, 1, 2, 3 . . . 254, e.g., nucleotides 1-10,000, 10,001-20,000, and so on through the end of SEQ ID NO: 1.
In embodiments, the N. eutropha comprises a nucleic acid sequence having a 20,000 base pair portion having at least about 80%, 85%, 90%, 95%, 97%, 98%, 99%, or 99.5% identity to a 20,000 base pair portion of SEQ ID NO: 1 or its complement. The 20,000 base pair portion may span, e.g., nucleotides (n*20,000)+1 to (n+1)*20,000, where n=0, 1, 2, 3 . . . 127, e.g., nucleotides 1-20,000, 20,001-40,000, and so on through the end of SEQ ID NO: 1.
In embodiments, the N. eutropha comprises a nucleic acid sequence having a 50,000 base pair portion having at least about 80%, 85%, 90%, 95%, 97%, 98%, 99%, or 99.5% identity to a 50,000 base pair portion of SEQ ID NO: 1 or its complement. The 50,000 base pair portion may span, e.g., nucleotides (n*50,000)+1 to (n+1)*50,000, where n=0, 1, 2, 3 . . . 51, e.g., nucleotides 1-50,000, 50,001-100,000, and so on through the end of SEQ ID NO: 1.
In embodiments, the N. eutropha comprises a nucleic acid sequence having a 100,000 base pair portion having at least about 80%, 85%, 90%, 95%, 97%, 98%, 99%, or 99.5% identity to a 100,000 base pair portion of SEQ ID NO: 1 or its complement. The 100,000 base pair portion may span, e.g., nucleotides (n*100,000)+1 to (n+1)*100,000, where n=0, 1, 2, 3 . . . 26, e.g., nucleotides 1-100,000, 100,001-20,000, and so on through the end of SEQ ID NO: 1.
In some aspects, the present disclosure provides a composition of N. eutropha comprising a chromosome at least about 70%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 99.5% identical to SEQ ID NO: 1. In some aspects, the present disclosure provides an axenic composition of N. eutropha comprising a chromosome at least about 70%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 99.5% identical to SEQ ID NO: 1.
In certain embodiments, the N. eutropha strain comprises a nucleic acid sequence, e.g., a genome, that hybridizes to SEQ ID NO: 1, or to the genome of the D23 strain deposited in the form of 25 vials with the ATCC patent depository on Apr. 8, 2014, designated AOB D23-100, under accession number PTA-121157, or their complements, under low stringency, medium stringency, high stringency, or very high stringency, or other hybridization condition described herein. As used herein, the term “hybridizes under low stringency, medium stringency, high stringency, or very high stringency conditions” describes conditions for hybridization and washing. Guidance for performing hybridization reactions can be found in Current Protocols in Molecular Biology, John Wiley & Sons, N.Y. (1989), 6.3.1-6.3.6, which is incorporated by reference. Aqueous and nonaqueous methods are described in that reference and either can be used. Specific hybridization conditions referred to herein are as follows: 1) low stringency hybridization conditions in 6× sodium chloride/sodium citrate (SSC) at about 45° C., followed by two washes in 0.2×SSC, 0.1% SDS at least at 50° C. (the temperature of the washes can be increased to 55° C. for low stringency conditions); 2) medium stringency hybridization conditions in 6×SSC at about 45° C., followed by one or more washes in 0.2×SSC, 0.1% SDS at 60° C.; 3) high stringency hybridization conditions in 6×SSC at about 45° C., followed by one or more washes in 0.2×SSC, 0.1% SDS at 65° C.; 4) very high stringency hybridization conditions are 0.5M sodium phosphate, 7% SDS at 65° C., followed by one or more washes at 0.2×SSC, 1% SDS at 65° C. Very high stringency conditions (4) are suitable conditions and the ones that should be used unless otherwise specified.
The genome of strain D23 (SEQ ID NO: 1) was compared with the genome of N. eutropha C91. An annotation of the D23 genome is shown in Supplementary Table 1, which lists the positions of 2,777 genes in SEQ ID NO: 1 as identified by sequence analysis. In certain embodiments, the N. eutropha described herein comprises one or more genes or proteins listed in Supplementary Table 1, or a gene or protein similar to one of said genes or proteins.
Accordingly, in some embodiments, the N. eutropha comprises a gene of Supplementary Table 1, or a protein encoded by said gene. In certain embodiments, the N. eutropha comprises a gene that is similar (e.g., at least 70%, 80%, 85%, 90%, 95%, 97%, 98%, 99%, or 99.5% identical) to a gene of Supplementary Table 1, or a protein encoded by said gene. In embodiments, the N. eutropha comprises genes or proteins that are identical or similar to at least 2, 3, 4, 5, 10, 20, 30, 40, 50, 100, 150, 200, 250, 300, 350, 400, 450, 500, 1000, 1500, 2000, 2500, or all the genes of Supplementary Table 1, or a protein encoded by said genes.
In some embodiments, the N. eutropha described herein (e.g., strain D23) comprises one or more genes or proteins that are absent from strain C91, or a gene or protein similar to one of said genes or proteins. Examples of these genes are set out in FIG. 6-8 and are described in more detail in Example 4 herein.
Accordingly, with respect to FIG. 6, in some embodiments, the N. eutropha comprises genes that are identical or similar (e.g., at least 70%, 80%, 85%, 90%, 95%, 97%, 98%, 99%, or 99.5% identical) to 1, 2, 3, 4, 5, 10, 15, 20, 30, 40, 50, 60, 70, 80, 90, 100, 110, 120, 130, 140, 150, 160, or all of the genes in FIG. 6. In some embodiments, the N. eutropha comprises proteins that are identical or similar (e.g., at least 70%, 80%, 85%, 90%, 95%, 97%, 98%, 99%, or 99.5% identical) to 1, 2, 3, 4, 5, 10, 15, 20, 30, 40, 50, 60, 70, 80, 90, 100, 110, 120, 130, 140, 150, 160, or all of the proteins encoded by the genes listed in FIG. 6.
With respect to FIG. 7, in some embodiments, the N. eutropha comprises genes that are identical or similar (e.g., at least 70%, 80%, 85%, 90%, 95%, 97%, 98%, 99%, or 99.5% identical) to 1, 2, 3, 4, 5, 10, 15, 20, 30, 40, 50, 60, 70, 80, 90, 100, 110, 120, 130, 140, 150, 160, or all of the genes in FIG. 7. In some embodiments, the N. eutropha comprises proteins that are identical or similar (e.g., at least 70%, 80%, 85%, 90%, 95%, 97%, 98%, 99%, or 99.5% identical) to 1, 2, 3, 4, 5, 10, 15, 20, 30, 40, 50, 60, 70, 80, 90, 100, 110, 120, 130, 140, 150, 160, or all of the proteins encoded by the genes listed in FIG. 7.
With respect to FIG. 8, in some embodiments, the N. eutropha comprises genes that are identical or similar (e.g., at least 70%, 80%, 85%, 90%, 95%, 97%, 98%, 99%, or 99.5% identical) to 1, 2, 3, 4, 5, 10, 15, 20, 30, 40, 50, 60, 70, 80, 90, 100, 110, 120, 130, 140, 150, 200, or all of the genes in FIG. 8. In some embodiments, the N. eutropha comprises proteins that are identical or similar (e.g., at least 70%, 80%, 85%, 90%, 95%, 97%, 98%, 99%, or 99.5% identical) to 1, 2, 3, 4, 5, 10, 15, 20, 30, 40, 50, 60, 70, 80, 90, 100, 110, 120, 130, 140, 150, 200, or all of the proteins encoded by the genes listed in FIG. 8.
With respect to FIGS. 6-8 collectively, in some embodiments, the N. eutropha comprises genes that are identical or similar (e.g., at least 70%, 80%, 85%, 90%, 95%, 97%, 98%, 99%, or 99.5% identical) to 1, 2, 3, 4, 5, 10, 20, 40, 60, 80, 100, 150, 200, 250, 300, 350, 400, 450, 500, or all of the genes in FIGS. 6-8. In some embodiments, the N. eutropha comprises proteins that are identical or similar (e.g., at least 70%, 80%, 85%, 90%, 95%, 97%, 98%, 99%, or 99.5% identical) to 1, 2, 3, 4, 5, 10, 20, 40, 60, 80, 100, 150, 200, 250, 300, 350, 400, 450, 500, or all of the proteins encoded by genes listed in FIGS. 6-8.
In some embodiments, the N. eutropha described herein (e.g., strain D23) lacks one or more genes or proteins that are unique to strain C91, or a gene or protein similar to one of said genes or proteins. Examples of these genes are set out in FIG. 9 and are described in more detail in Example 4 herein. Accordingly, in some embodiments, the N. eutropha described herein lacks at least 1, 2, 3, 4, 5, 10, 20, 50, 100, 150, 200, 250, or all of the genes of FIG. 9. In some embodiments, the N. eutropha described herein lacks up to 2, 3, 4, 5, 10, 20, 50, 100, 150, 200, 250, or all of the genes of FIG. 9. In embodiments, the N. eutropha described herein lacks about 1-5, 5-10, 10-20, 20-50, 50-100, 100-150, 150-200, 200-250, or 250-all of the genes of FIG. 9.
Sequencing of the D23 genome revealed several genes of potential interest, including genes involved in ammonia metabolism (e.g., ammonia monooxygenase, hydroxylamine oxidoreductase, cytochrome c554, and cytochrome cM552). All of these genes are present in multiple copies, and in general the copies are not identical to each other. One set of genes of interest is the ammonia monooxygenase synthesis operon amoCAB, which is present in two copies, along with a third copy of amoC. The operons have homologs in C91, i.e., Neut_2078/7/6 and Neut_2319/8/7. Another set of genes of interest is hydroxylamine oxidoreductase (hao), which is present in three copies. The hao homologs in C91 are designated Neut_1672, 1793, and 2335. A third set of genes of interest is the cytochrome c554 gene encoded by cycA, which is present in three copies. The corresponding C91 genes are designated Neut_1670, 1791, and 2333. A fourth set of genes of interest is the cytochrome cM552 genes encoded by cycB, which are present in two copies. The homologous C91 genes are designated Neut_1790 and 2332. Each group of genes is summarized in Table 1 and is discussed in more detail below.
| TABLE 1 |
| Sequences of ammonia metabolism genes in N. eutropha |
| strain D23. |
| SEQ ID in | SEQ ID in | |||
| strain D23 | strain C91 | Type | Gene name | |
| 1. ammonia monooxygenase |
| 4 | 34 | Protein | amoC1 | |
| 5 | 35 | DNA | amoC1 | |
| 6 | 36 | Protein | amoA1 | |
| 7 | 37 | DNA | amoA1 | |
| 8 | 38 | Protein | amoB1 | |
| 9 | 39 | DNA | amoB1 | |
| 10 | 40 | Protein | amoC2 | |
| 11 | 41 | DNA | amoC2 | |
| 12 | 42 | Protein | amoA2 | |
| 13 | 43 | DNA | amoA2 | |
| 14 | 44 | Protein | amoB2 | |
| 15 | 45 | DNA | amoB2 | |
| 16 | 46 | Protein | amoC3 | |
| 17 | 47 | DNA | amoC3 |
| 2. hydroxylamine oxidoreductase |
| 18 | 48 | Protein | hao1 | |
| 19 | 49 | DNA | hao1 | |
| 20 | 50 | Protein | hao2 | |
| 21 | 51 | DNA | hao2 | |
| 22 | 52 | Protein | hao3 | |
| 23 | 53 | DNA | hao3 |
| 3. cytochrome c554 |
| 24 | 54 | Protein | c554 cycA1 | |
| 25 | 55 | DNA | c554 cycA1 | |
| 26 | 56 | Protein | c554 cycA2 | |
| 27 | 57 | DNA | c554 cycA2 | |
| 28 | 58 | Protein | c554 cycA3 | |
| 29 | 59 | DNA | c554 cycA3 |
| 4. cytochrome cM552 |
| 30 | 60 | Protein | cM552 cycB1 | |
| 31 | 61 | DNA | cM552 cycB1 | |
| 32 | 62 | Protein | cM552 cycB2 | |
| 33 | 63 | DNA | cM552 cycB2 | |
In some aspects, the N. eutropha described herein comprises genes identical to or similar to the genes and proteins of Table 1.
More particularly, in certain aspects, this disclosure provides a composition of N. eutropha, e.g., a purified preparation of N. eutropha comprising a nucleic acid sequence at least about 70%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 99.5% identical to an ammonia monooxygenase sequence of Table 1. In certain aspects, this disclosure provides a composition of N. eutropha comprising a nucleic acid sequence at least about 70%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 99.5% identical to a hydroxylamine oxidoreductase sequence of Table 1. In certain aspects, this disclosure provides a composition of N. eutropha comprising a nucleic acid sequence at least about 70%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 99.5% identical to a cytochrome c554 sequence of Table 1. In certain aspects, this disclosure provides a composition of N. eutropha comprising nucleic acid sequences at least about 70%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 99.5% identical to a cytochrome cM552 sequence of Table 1.
In certain aspects, this disclosure provides a composition of N. eutropha comprising an amino acid sequence at least about 70%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, 99.2%, 99.3%, 99.4%, 99.5%, or 99.6% identical to an ammonia monooxygenase sequence of Table 1. In certain aspects, this disclosure provides a composition of N. eutropha comprising an amino acid sequence at least about 70%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, 99.4%, 99.5%, 99.6%, or 99.7% identical to hydroxylamine oxidoreductase sequence of Table 1. In certain aspects, this disclosure provides a composition of N. eutropha comprising an amino acid sequence at least about 70%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, 99.1%, 99.2%, 99.3%, 99.5%, 99.6%, or 99.7% identical to a cytochrome c554 sequence of Table 1. In certain aspects, this disclosure provides a composition of N. eutropha comprising amino acid sequences at least about 70%, 80%, 85%, 90%, 95%, 96%, 97%, 97.1%, 97.2%, 97.5%, 98%, 98.5%, 98.6%, 98.7%, 98.8%, 99%, or 99.5% identical to a cytochrome cM552 sequence of Table 1.
In some embodiments, the N. eutropha are present in an axenic composition, and e.g., in the form of a purified preparation of optimized N. eutropha.
More particularly, in certain aspects, this disclosure provides an axenic composition of N. eutropha comprising a nucleic acid sequence at least about 70%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 98.5%, 98.8%, 98.9%, 99%, 99.2%, 99.3%, 99.4%, 99.5%, or 99.6% identical to an ammonia monooxygenase sequence of Table 1. In certain aspects, this disclosure provides an axenic composition of N. eutropha comprising a nucleic acid sequence at least about 70%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 99.5% identical to a hydroxylamine oxidoreductase sequence of Table 1. In certain aspects, this disclosure provides an axenic composition of N. eutropha comprising a nucleic acid sequence at least about 70%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 99.5% identical to a cytochrome c554 sequence of Table 1. In certain aspects, this disclosure provides an axenic composition of N. eutropha comprising nucleic acid sequences at least about 70%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 99.5% identical to a cytochrome cM552 sequence of Table 1.
In certain aspects, this disclosure provides an axenic composition of N. eutropha comprising an amino acid sequence at least about 70%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 98.5%, 98.8%, 98.9%, 99%, 99.2%, 99.3%, 99.4%, 99.5%, or 99.6% identical to an ammonia monooxygenase sequence of Table 1. In certain aspects, this disclosure provides an axenic composition of N. eutropha comprising an amino acid sequence at least about 70%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, 99.4%, 99.5%, 99.6%, or 99.7% identical to hydroxylamine oxidoreductase sequence of Table 1. In certain aspects, this disclosure provides an axenic composition of N. eutropha comprising an amino acid sequence at least about 70%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, 99.1%, 99.2%, 99.3%, 99.5%, 99.6%, or 99.7% identical to a cytochrome c554 sequence of Table 1. In certain aspects, this disclosure provides an axenic composition of N. eutropha comprising amino acid sequences at least about 70%, 80%, 85%, 90%, 95%, 96%, 97%, 97.1%, 97.2%, 97.5%, 98%, 98.5%, 98.6%, 98.7%, 98.8%, 99%, or 99.5% identical to a cytochrome cM552 sequence of Table 1.
In some embodiments, the N. eutropha comprises a gene or protein comprising a sequence at least about 70%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 99.5% identical to a strain D23 sequence of Table 1, e.g., any of SEQ IDs 4-33. Substitutions may be conservative or non-conservative; also, insertions and deletions are contemplated. In some embodiments, the N. eutropha comprises a gene or protein comprising a sequence of Table 1, e.g., any of SEQ IDs 4-33. In some embodiments, the protein has an N-terminal and/or C-terminal extension or deletion of up to about 1, 2, 3, 4, 5, 6, 8, 10, 15, 20, 25, 50, or 100 amino acids.
Alignment of the nucleic acid sequences of Table 1 shows the percent identity between homologs in C91 and D23. The following paragraphs discuss this percent identity and describe various genes having homology to the D23 genes of Table 1.
More specifically, the amoA1 genes are about 98.8% identical (i.e., at 821/831 positions). Accordingly, in some embodiments, the N. eutropha described herein comprise D23 nucleotides at at least 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, or all of the positions that differ in this gene between strains C91 and D23. In embodiments, the N. eutropha described herein comprise D23 nucleotides at at most 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, or all of the positions that differ in this gene between strains C91 and D23. In embodiments, the N. eutropha described herein comprise a gene at least about 98.8%, 98.9%, 99.0%, 99.2%, 99.4%, 99.6%, 99.8%, or 100% identical to the D23 amoA1 gene.
The amoA2 genes are about 98.8% identical (i.e., at 821/831 positions). Accordingly, in some embodiments, the N. eutropha described herein comprise D23 nucleotides at at least 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, or all of the positions that differ in this gene between strains C91 and D23. In embodiments, the N. eutropha described herein comprise D23 nucleotides at at most 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, or all of the positions that differ in this gene between strains C91 and D23. In embodiments, the N. eutropha described herein comprise a gene at least about 98.8%, 98.9%, 99.0%, 99.2%, 99.4%, 99.6%, 99.8%, or 100% identical to the D23 amoA2 gene.
The amoB1 genes are about 99.1% identical (i.e., at 1255/1266 positions). Accordingly, in some embodiments, the N. eutropha described herein comprise D23 nucleotides at at least 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, or all of the positions that differ in this gene between strains C91 and D23. In embodiments, the N. eutropha described herein comprise D23 nucleotides at at most 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, or all of the positions that differ in this gene between strains C91 and D23. In embodiments, the N. eutropha described herein comprise a gene at least about 99.1%, 99.2%, 99.4%, 99.6%, 99.8%, or 100% identical to the D23 amoB1 gene.
The amoB2 genes are about 99.1% identical (i.e., at 1254/1266 positions). Accordingly, in some embodiments, the N. eutropha described herein comprise D23 nucleotides at at least 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12 or all of the positions that differ in this gene between strains C91 and D23. In embodiments, the N. eutropha described herein comprise D23 nucleotides at at most 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12 or all of the positions that differ in this gene between strains C91 and D23. In embodiments, the N. eutropha described herein comprise a gene at least about 99.1%, 99.2%, 99.4%, 99.6%, 99.8%, or 100% identical to the D23 amoB2 gene.
The amoC1 genes are about 99.8% identical (i.e., at 814/816 positions). Accordingly, in some embodiments, the N. eutropha described herein comprise D23 nucleotides at at least 1, 2, or all of the positions that differ in this gene between strains C91 and D23. In embodiments, the N. eutropha described herein comprise D23 nucleotides at at most 1, 2, or all of the positions that differ in this gene between strains C91 and D23. In embodiments, the N. eutropha described herein comprise a gene at least about 99.8%, 99.9%, or 100% identical to the D23 amoC1 gene.
The amoC2 genes are about 99.8% identical (i.e., at 814/816 positions). Accordingly, in some embodiments, the N. eutropha described herein comprise D23 nucleotides at at least 1, 2, or all of the positions that differ in this gene between strains C91 and D23. In embodiments, the N. eutropha described herein comprise D23 nucleotides at at most 1, 2, or all of the positions that differ in this gene between strains C91 and D23. In embodiments, the N. eutropha described herein comprise a gene at least about 99.8%, 99.9%, or 100% identical to the D23 amoC2 gene.
The amoC3 genes are about 98.9% identical (i.e., at 816/825 positions). Accordingly, in some embodiments, the N. eutropha described herein comprise D23 nucleotides at at least 1, 2, 3, 4, 5, 6, 7, 8, 9, or all of the positions that differ in this gene between strains C91 and D23. In embodiments, the N. eutropha described herein comprise D23 nucleotides at at most 1, 2, 3, 4, 5, 6, 7, 8, 9, or all of the positions that differ in this gene between strains C91 and D23. In embodiments, the N. eutropha described herein comprise a gene at least about 98.9%, 99.0%, 99.2%, 99.4%, 99.6%, 99.8%, or 100% identical to the D23 amoC3 gene.
The hao1 genes are about 99.0% identical (i.e., at 1696/1713 positions). Accordingly, in some embodiments, the N. eutropha described herein comprise D23 nucleotides at at least 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, or all of the positions that differ in this gene between strains C91 and D23. In embodiments, the N. eutropha described herein comprise D23 nucleotides at at most 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, or all of the positions that differ in this gene between strains C91 and D23. In embodiments, the N. eutropha described herein comprise a gene at least about 99.0%, 99.2%, 99.4%, 99.6%, 99.8%, or 100% identical to the D23 hao1 gene.
The hao2 genes are about 99.4% identical (i.e., at 1702/1713 positions). Accordingly, in some embodiments, the N. eutropha described herein comprise D23 nucleotides at at least 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, or all of the positions that differ in this gene between strains C91 and D23. In embodiments, the N. eutropha described herein comprise D23 nucleotides at at most 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, or all of the positions that differ in this gene between strains C91 and D23. In embodiments, the N. eutropha described herein comprise a gene at least about 99.4%, 99.6%, 99.8%, or 100% identical to the D23 hao2 gene.
The hao3 genes are about 99.2% identical (i.e., at 1700/1713 positions). Accordingly, in some embodiments, the N. eutropha described herein comprise D23 nucleotides at at least 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, or all of the positions that differ in this gene between strains C91 and D23. In embodiments, the N. eutropha described herein comprise D23 nucleotides at at most 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, or all of the positions that differ in this gene between strains C91 and D23. In embodiments, the N. eutropha described herein comprise a gene at least about 99.2%, 99.4%, 99.6%, 99.8%, or 100% identical to the D23 hao3 gene.
The cycA1 genes are about 98.0% identical (i.e., at 694/708 positions). Accordingly, in some embodiments, the N. eutropha described herein comprise D23 nucleotides at at least 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, or all of the positions that differ in this gene between strains C91 and D23. In embodiments, the N. eutropha described herein comprise D23 nucleotides at at most 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, or all of the positions that differ in this gene between strains C91 and D23. In embodiments, the N. eutropha described herein comprise a gene at least about 98.0%, 98.2%, 98.4%, 98.6%, 98.8%, 99.0%, 99.2%, 99.4%, 99.6%, 99.8%, or 100% identical to the D23 cycA1 gene.
The cycA2 genes are about 98.7% identical (i.e., at 699/708 positions). Accordingly, in some embodiments, the N. eutropha described herein comprise D23 nucleotides at at least 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, or all of the positions that differ in this gene between strains C91 and D23. In embodiments, the N. eutropha described herein comprise D23 nucleotides at at most 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, or all of the positions that differ in this gene between strains C91 and D23. In embodiments, the N. eutropha described herein comprise a gene at least about 98.7%, 98.8%, 99.0%, 99.2%, 99.4%, 99.6%, 99.8%, or 100% identical to the D23 cycA2 gene.
The cycA3 genes are about 99.3% identical (i.e., at 703/708 positions). Accordingly, in some embodiments, the N. eutropha described herein comprise D23 nucleotides at at least 1, 2, 3, 4, 5, or all of the positions that differ in this gene between strains C91 and D23. In embodiments, the N. eutropha described herein comprise D23 nucleotides at at most 1, 2, 3, 4, 5, or all of the positions that differ in this gene between strains C91 and D23. In embodiments, the N. eutropha described herein comprise a gene at least about 99.3%, 99.4%, 99.6%, 99.8%, or 100% identical to the D23 cycA3 gene.
The cycB1 genes are about 96.7% identical (i.e., at 696/720 positions). Accordingly, in some embodiments, the N. eutropha described herein comprise D23 nucleotides at at least 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, or all of the positions that differ in this gene between strains C91 and D23. In embodiments, the N. eutropha described herein comprise D23 nucleotides at at most 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, or all of the positions that differ in this gene between strains C91 and D23. In embodiments, the N. eutropha described herein comprise a gene at least about 96.7%, 96.8%, 97.0%, 97.2%, 97.4%, 97.6%, 97.8%, 98.0%, 98.2%, 98.4%, 98.4%, 98.6%, 98.8%, 99.0%, 99.2%, 99.4%, 99.6%, 99.8%, or 100% identical to the D23 cycB1 gene.
The cycB2 genes are about 97.1% identical (i.e., at 702/723 positions). Accordingly, in some embodiments, the N. eutropha described herein comprise D23 nucleotides at at least 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, or all of the positions that differ in this gene between strains C91 and D23. In embodiments, the N. eutropha described herein comprise D23 nucleotides at at most 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, or all of the positions that differ in this gene between strains C91 and D23. In embodiments, the N. eutropha described herein comprise a gene at least about 97.1%, 97.2%, 97.4%, 97.6%, 97.8%, 98.0%, 98.2%, 98.4%, 98.4%, 98.6%, 98.8%, 99.0%, 99.2%, 99.4%, 99.6%, 99.8%, or 100% identical to the D23 cycB2 gene.
The following four paragraphs describe genes and proteins of Table 1 in more detail.
Ammonia monooxygenase is an enzyme involved in ammonia oxidation, that catalyzes the reaction NH3+O2+2e−+2H+ NH2OH+H2O (Ensign et al., 1993). In N. eutropha strain D23, the ammonia monooxygenase operon comprises three genes designated amoA, amoB, and amoC. Strain D23 comprises two copies of the entire operon, and a third copy of amoC. These genes and the corresponding proteins are listed in Table 1 above. In certain embodiments, the N. eutropha described herein comprise 1 or 2 ammonia monooxygenase subunit A genes and/or protein of Table 1 (e.g., the D23 sequences of Table 1), or genes and/or proteins similar thereto. In some embodiments, the N. eutropha described herein comprise 1 or 2 ammonia monooxygenase subunit B genes and/or proteins of Table 1 (e.g., the D23 sequences of Table 1), or genes and/or proteins similar thereto. In certain embodiments, the N. eutropha described herein comprise 1, 2, or 3 ammonia monooxygenase subunit C genes and/or proteins of Table 1 (e.g., the D23 sequences of Table 1), or genes and/or proteins similar thereto. In some embodiments, the N. eutropha described herein comprise at least one or two each of (a) an ammonia monooxygenase subunit A gene and/or protein of Table 1 (e.g., the D23 sequences of Table 1), (b) an ammonia monooxygenase subunit B gene and/or protein of Table 1 (e.g., the D23 sequences of Table 1), and (c) an ammonia monooxygenase subunit C gene and/or protein of Table 1 (e.g., the D23 sequences of Table 1). For instance, the N. eutropha may comprise all of the ammonia monooxygenase genes and/or proteins of Table 1 (e.g., the D23 sequences of Table 1), or genes and/or proteins similar thereto. Even more specifically, in some embodiments, the N. eutropha comprises all of the D23 ammonia monooxygenase genes of Table 1. In some embodiments, the N. eutropha comprises all of the D23 ammonia monooxygenase proteins of Table 1. Hydroxylamine oxidoreductases catalyze the general reaction NH2OH+O2 NO2−+H2O. They typically use heme as a cofactor. N. eutropha strain D23 comprises three hydroxylamine oxidoreductases, designated hao1, hao2, and hao3. These genes and the corresponding proteins are listed in Table 1 above. In some embodiments, the N. eutropha described herein comprise 1, 2, or 3 hydroxylamine oxidoreductase genes and/or proteins of Table 1 (e.g., the D23 sequences of Table 1), or genes and/or proteins similar thereto. For instance, the N. eutropha may comprise all of the hydroxylamine oxidoreductase genes and/or proteins of Table 1 (e.g., the D23 sequences of Table 1), or genes and/or proteins similar thereto. Even more specifically, in some embodiments, the N. eutropha comprises all of the D23 hydroxylamine oxidoreductase genes of Table 1. In some embodiments, the N. eutropha comprises all of the D23 hydroxylamine oxidoreductase proteins of Table 1.
The capacity of D23 to aerobically catabolize ammonia as the sole source of energy and reductant requires two specialized protein complexes, Amo and Hao as well as the cytochromes c554 and cm552, which relay the electrons to the quinone pool. The NO reductase activity of c554 is important during ammonia oxidation at low oxygen concentrations. N. eutropha strain D23 comprises three cytochrome c554 genes, designated cycA1, cycA2, and cycA3. These genes and the corresponding proteins are listed in Table 1 above. In some embodiments, the N. eutropha described herein comprise 1, 2, or 3 cytochrome c554 genes and/or proteins of Table 1 (e.g., the D23 sequences of Table 1), or genes and/or proteins similar thereto. For instance, the N. eutropha may comprise all of the cytochrome c554 genes and/or proteins of Table 1 (e.g., the D23 sequences of Table 1), or genes and/or proteins similar thereto. Even more specifically, in some embodiments, the N. eutropha comprises all of the D23 cytochrome c554 genes of Table 1. In some embodiments, the N. eutropha comprises all of the D23 cytochrome c554 proteins of Table 1.
The capacity of D23 to aerobically catabolize ammonia as the sole source of energy and reductant requires two specialized protein complexes, Amo and Hao as well as the Cytochromes c554 and cM552, which relay the electrons to the quinone pool. Cytochrome cM552 reduces quinones, with electrons originating from Hao. N. eutropha strain D23 comprises two cytochrome cM552 genes, designated cycB1 and cycB2. These genes and the corresponding proteins are listed in Table 1 above. In some embodiments, the N. eutropha described herein comprise 1 or 2 cytochrome cM552 genes and/or proteins of Table 1 (e.g., the D23 sequences of Table 1), or genes and/or proteins similar thereto. For instance, the N. eutropha may comprise both of the cytochrome cM552 genes and/or proteins of Table 1 (e.g., the D23 sequences of Table 1), or genes and/or proteins similar thereto. Even more specifically, in some embodiments, the N. eutropha comprises both of the D23 cytochrome cM552 genes of Table 1. In some embodiments, the N. eutropha comprises both of the D23 Cytochrome cM552 proteins of Table 1.
In some embodiments, the N. eutropha described herein comprises a combination of genes and/or proteins selected from Table 1. This combination may comprise, for instance, genes and/or proteins listed in the preceding four paragraphs. For instance, the combination may comprise genes and/or proteins from two classes within Table 1. Accordingly, in some embodiments, the N. eutropha comprises one or more ammonia monooxygenase genes and/or proteins and one or more hydroxylamine oxidoreductase genes and/or proteins as described in Table 1, or as described in the preceding four paragraphs. In embodiments, the N. eutropha comprises one or more ammonia monooxygenase genes and/or proteins and one or more cytochrome c554 genes and/or proteins as described in Table 1, or as described in the preceding four paragraphs. In embodiments, the N. eutropha comprises one or more ammonia monooxygenase genes and/or proteins and one or more cytochrome cM552 genes and/or proteins as described in Table 1, or as described in the preceding four paragraphs. In embodiments, the N. eutropha comprises one or more hydroxylamine oxidoreductase genes and/or proteins and one or more cytochrome c554 genes and/or proteins as described in Table 1, or as described in the preceding four paragraphs. In embodiments, the N. eutropha comprises one or more hydroxylamine oxidoreductase genes and/or proteins and one or more cytochrome cM552 genes and/or proteins as described in Table 1, or as described in the preceding four paragraphs.
The combination may also comprise genes and/or proteins from three classes within Table 1. Accordingly, in some embodiments, the N. eutropha comprises one or more ammonia monooxygenase genes and/or proteins and one or more hydroxylamine oxidoreductase genes and/or proteins and one or more cytochrome c554 genes and/or proteins as described in Table 1, or as described in the aforementioned four paragraphs. In embodiments, the N. eutropha comprises one or more ammonia monooxygenase genes and/or proteins and one or more hydroxylamine oxidoreductase genes and/or proteins and one or more cytochrome cM552 genes and/or proteins as described in Table 1, or as described in the aforementioned four paragraphs. In embodiments, the N. eutropha comprises one or more one or more ammonia monooxygenase genes and/or proteins and one or more cytochrome c554 genes and/or proteins and/or one or more cytochrome cM552 genes and/or proteins as described in Table 1, or as described in the aforementioned four paragraphs. In embodiments, the N. eutropha comprises one or more one or more hydroxylamine oxidoreductase genes and/or proteins and one or more cytochrome c554 genes and/or proteins and/or one or more cytochrome cM552 genes and/or proteins as described in Table 1, or as described in the aforementioned four paragraphs.
The combination may comprise genes and/or proteins from all four classes within Table 1. Accordingly, in some embodiments, the N. eutropha comprises one or more ammonia monooxygenase genes and/or proteins and one or more hydroxylamine oxidoreductase genes and/or proteins and one or more cytochrome c554 genes and/or proteins and/or one or more cytochrome cM552 genes as described in Table 1, or as described in the aforementioned four paragraphs.
Table 2 (below) lists sequence differences between the D23 and C91 proteins of Table 1. For example, AmoA1 has M at position 1 in C91 but V at position 1 in D23, and this difference is abbreviated as M1V in Table 2. As another example, the D23 CycB1 has an insertion of DDD between residues 194 and 195 of the C91 protein, so that the added residues are residues number 195, 196, and 197 of the D23 protein and this difference is abbreviated as 195insD, 196insD, and 197insD respectively in Table 2. The sequence alignments that form the basis for Table 2 are shown in FIGS. 10-16.
| TABLE 2 |
| Amino acid sequence differences between N. eutropha |
| strains D23 and C91 |
| Protein | Sequence characteristics of D23 compared to C91 |
| 1. ammonia monooxygenase |
| AmoA1 | M1V, M160L, P167A |
| AmoA2 | M1V, M160L, P167A |
| AmoB1 | I33V, V165I |
| AmoB2 | I33V, V165I |
| AmoC1 | N/A |
| AmoC2 | N/A |
| AmoC3 | V79A, I271V |
| 2. hydroxylamine oxidoreductase |
| Hao1 | N85S, V163A, G312E |
| Hao2 | N85S, G312E |
| Hao3 | N85S, G312E |
| 3. cytochrome c554 |
| c554 CycA1 | A65T, A186T |
| c554 CycA2 | A65T |
| c554 CycA3 | A65T |
| 4. cytochrome cM552 |
| cM552 CycB1 | I63V, S189P, D194G, 195insD, 196insD, |
| 197insD, 206insE, 207insE | |
| cM552 CycB2 | I63V, S189P, 206insE, 207insE |
Accordingly, the N. eutropha described herein may comprise one or more of the sequence characteristics listed in Table 2. For instance, the N. eutropha may comprise at least 1, 2, 3, 4, 5, 10, 15, 20, 25, 30, or all of the sequence characteristics of Table 2. In some embodiments, the N. eutropha comprises no more than 2, 3, 4, 5, 10, 15, 20, 25, 30, or all of the sequence characteristics of Table 2. In embodiments, the N. eutropha comprises 1-5, 5-10, 10-15, 15-20, 20-25, 25-30, or all of the sequence characteristics of Table 2. The N. eutropha may also comprise fragments of said proteins.
As to individual categories of genes or proteins, in some embodiments, the N. eutropha comprises at least 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, or all of the sequence characteristics of Table 2, Section 1 (which describes ammonia monooxygenases). In embodiments, the N. eutropha comprises 1-5, 3-7, 4-8, or 5-10 of the sequence characteristics of Table 2, Section 1. For instance, in some embodiments, the N. eutropha comprises at least 1, 2, or 3 sequence characteristics of an amoA gene or protein as listed in Table 2, and/or no more than 2 or 3 of these characteristics. The N. eutropha may also comprise at least 1 or 2 sequence characteristics of an amoB gene or protein as listed in Table 2. In addition, the N. eutropha may comprise at least 1 or 2 sequence characteristics of the amoC3 gene as listed in Table 2. The N. eutropha may also comprise fragments of said proteins.
With respect to hao genes and proteins, the N. eutropha may comprise at least 1, 2, 3, 4, 5, 6, 7, 8, or all of the sequence characteristics of Table 2, Section 2 (which describes hydroxylamine oxidoreductases). In embodiments, the N. eutropha comprises 1-4, 2-5, 3-6, or 4-8 of the sequence characteristics of Table 2, Section 2. The N. eutropha may also comprise at least 1, 2 or 3 sequence characteristics of Hao1 as listed in Table 1, and/or no more than 2 or 3 of these characteristics. The N. eutropha may also comprise at least 1 or 2 sequence characteristics of Hao2 or Hao3 as listed in Table 2. The N. eutropha may also comprise fragments of said proteins.
Turning now to cytochrome c554, the N. eutropha may comprise at least 1, 2, 3, 4, or all of the sequence characteristics of Table 2, Section 3 (which describes cytochrome c554). In embodiments, the N. eutropha comprises at most 2, 3, 4, or all of the sequence characteristics of Table 2 Section 3. In embodiments, the N. eutropha comprises at least 1 or 2 sequence characteristics of cytochrome c554 CycA1 as listed in Table 2. The N. eutropha may also comprise at least 1 sequence characteristic of c554 CycA2 or c554 CycA3 as listed in Table 2. The N. eutropha may also comprise fragments of said proteins.
With respect to the cM552 genes and proteins, the N. eutropha may comprise at least 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, or all of the sequence characteristics of Table 2, Section 4 (which describes cytochrome cM552). In embodiments, the N. eutropha comprises at most 2, 3, 4, 5, 6, 7, 8, 9, 10, or all the sequence characteristics of Table 2, Section 4. For instance, in embodiments the N. eutropha comprises 1-5, 2-7, 3-8, or 5-10 sequence characteristics of Table 2, Section 4. In embodiments, at least 1, 2, 3, 4, 5, 6, or 7 sequence characteristics of cM552 CycB1 as listed in Table 2, and/or no more than 2, 3, 4, 5, 6, or 7 of these characteristics. The N. eutropha may also comprise at least 1, 2, or 3 sequence characteristics of cM552 CycB2 as listed in Table 2, and/or no more than 2 or 3 of these characteristics. The N. eutropha may also comprise fragments of said proteins.
It is understood that the paragraphs above, which refer to sequence characteristics of various N. eutropha proteins, also describe the sequences of nucleic acids that encode these proteins.
The sequencing analysis described herein revealed that strain D23 lacks plasmids. Consequently, in some embodiments, the N. eutropha bacterium lacks plasmids, i.e., all of its DNA is contained in the chromosome. In some embodiments, the N. eutropha bacterium lacks endogenous plasmids, but carries one or more transgenic plasmids.
This D23 strain is not believed to be a product of nature, but rather has acquired certain mutations and characteristics during an extended period of culture and selection in the laboratory. For instance, D23 has an ability to grow in conditions of greater than about 200 or 250 mM NH4+ for more than 24 hours.
In some embodiments, the N. eutropha disclosed herein differ from naturally occurring bacteria in the abundance of siderophores. For instance, the N. eutropha may have elevated or reduced levels of siderophores compared to N. eutropha C91. Generally, siderophores are secreted iron-chelating compounds that help bacteria scavenge iron from their environment. Some siderophores are peptides, and others are small organic molecules.
The AOBs, for example, N. eutropha contemplated in this disclosure may comprise mutations relative to wild-type N. eutropha and/or the N. eutropha sequences disclosed herein. These mutations may, e.g., occur spontaneously, be introduced by random mutagenesis, or be introduced by targeted mutagenesis. For instance, the N. eutropha may lack one or more genes or regulatory DNA sequences that wild-type N. eutropha typically comprises. The N. eutropha may also comprise point mutations, substitutions, insertions, deletions, and/or rearrangements relative to the sequenced strain or a wild-type strain. The N. eutropha may be a purified preparation of optimized N. eutropha.
In certain embodiments, the N. eutropha is transgenic. For instance, it may comprise one or more genes or regulatory DNA sequences that wild-type N. eutropha D23 lacks. More particularly, the N. eutropha may comprise, for instance, a reporter gene, a selective marker, a gene encoding an enzyme, or a promoter (including an inducible or repressible promoter). In some embodiments the additional gene or regulatory DNA sequence is integrated into the bacterial chromosome; in some embodiments the additional gene or regulatory DNA sequence is situated on a plasmid, for instance a plasmid related to a plasmid found in N. eutropha N91.
In some preferred embodiments, the N. eutropha differs by at least one nucleotide from naturally occurring bacteria. For instance, the N. eutropha may differ from naturally occurring bacteria in a gene or protein that is part of a relevant pathway, e.g., an ammonia metabolism pathway, a urea metabolism pathway, or a pathway for producing nitric oxide or nitric oxide precursors. More particularly, the N. eutropha may comprise a mutation that elevates activity of the pathway, e.g., by increasing levels or activity of an element of that pathway.
The above-mentioned mutations can be introduced using any suitable technique. Numerous methods are known for introducing mutations into a given position. For instance, one could use site-directed mutagenesis, oligonucleotide-directed mutagenesis, or site-specific mutagenesis. Non-limiting examples of specific mutagenesis protocols are described in, e.g., Mutagenesis, pp. 13.1-13.105 (Sambrook and Russell, eds., Molecular Cloning A Laboratory Manual, Vol. 3, 3.sup.rd ed. 2001). In addition, non-limiting examples of well-characterized mutagenesis protocols available from commercial vendors include, without limitation, Altered Sites® II in vitro Mutagenesis Systems (Promega Corp., Madison, Wis.); Erase-a-Base® System (Promega, Madison, Wis.); GeneTailor™ Site-Directed Mutagenesis System (Invitrogen, Inc., Carlsbad, Calif.); QuikChange® II Site-Directed Mutagenesis Kits (Stratagene, La Jolla, Calif.); and Transformer™ Site-Directed Mutagenesis Kit (BD-Clontech, Mountain View, Calif.).
In some embodiments, the preparation of ammonia oxidizing bacteria may comprise a concentration or amount of ammonia oxidizing bacteria in order to at least partially treat a condition or disease. The preparation of ammonia oxidizing bacteria may comprise a concentration or amount of ammonia oxidizing bacteria in order to alter, e.g., reduce or increase, an amount, concentration or proportion of a bacterium, or genus of bacteria, on a surface, e.g., a skin surface. The bacteria may be non-pathogenic or pathogenic, or potentially pathogenic.
In some embodiments, the preparation of ammonia oxidizing bacteria may comprise between about 108 to about 1014 CFU/L. The preparation may comprise at least 108, 109, 1010, 1011, 2×1011, 5×1011, 1012, 2×1012, 5×1012, 1013, 2×1013, 5×1013, or 1014; or about 108-109, 109-1010, 1011-1011, 1011-1012, 1012-1013, or 1013-1014 CFU/L. In certain aspects, the preparation may comprise between about 1×109 CFU/L to about 10×109 CFU/L. In certain aspects, the preparation may comprise between about 1×109 CFU to about 10×109 CFU.
In some embodiments, the preparation of ammonia oxidizing bacteria may comprise between about 0.1 milligrams (mg) and about 1000 mg of ammonia oxidizing bacteria. In certain aspects, the preparation may comprise between about 50 mg and about 1000 mg of ammonia oxidizing bacteria. The preparation may comprise between about 0.1-0.5 mg, 0.2-0.7 mg, 0.5-1.0 mg, 0.5-2 mg, 0.5-5 mg, 2.5-5 mg, 2.5-7.0 mg, 5.0-10 mg, 7.5-15 mg, 10-15 mg, 15-20 mg, 15-25 mg, 20-30 mg, 25-50 mg, 25-75 mg, 50-75 mg, 50-100 mg, 75-100 mg, 100-200 mg, 200-300 mg, 300-400 mg, 400-500 mg, 500-600 mg, 600-700 mg, 700-800 mg, 800-900 mg, 900-1000 mg, 100-250 mg, 250-500 mg, 100-500 mg, 500-750 mg, 750-1000 mg, or 500-1000 mg.
In some embodiments, the preparation of ammonia oxidizing bacteria may comprise a mass ratio of ammonia oxidizing bacteria to an excipient, e.g., a pharmaceutically acceptable excipient or a cosmetically acceptable excipient in a range of about 0.1 grams per liter to about 1 gram per liter. The preparation may comprise a mass ratio of ammonia oxidizing bacteria to an excipient in a range of about 0.1-0.2, 0.2-0.3, 0.1-0.5, 0.2-0.7, 0.5-1.0, or 0.7-1.0 grams per liter.
In some embodiments, the preparation of ammonia oxidizing bacteria may be in a growth state. A growth state may be provided by exposing ammonia oxidizing bacteria to an environment that may promote growth. The growth state may be a state, e.g., ammonia oxidizing bacteria in an environment that allows immediate availability of ammonia oxidizing bacteria to convert ammonium ions (NH4+) to nitrite (NO2−). The growth state may comprise providing ammonia oxidizing bacteria in an environment having a pH of greater than about 7.6. The growth state may also comprise providing ammonia oxidizing bacteria in an environment having ammonia, ammonium salts, and/or urea, trace minerals and sufficient oxygen and carbon dioxide, as described above in Section 1.
In some embodiments, the preparation of ammonia oxidizing bacteria may be in a polyphosphate loading state, wherein the state or the environment, e.g., a media, e.g., a culture media, e.g., a growth media, may have a pH of less than about 7.4. Levels of at least one of ammonia, ammonium ions, and urea may be between about 10 micromolar and 200 millimolar. Levels of trace materials may be between 0.1 micromolar iron and 20 micromolar iron. Levels of oxygen may be between about 5% and 100% oxygen saturation. Levels of carbon dioxide may be between/less than about zero and 200 ppm, and phosphate levels greater than about 10 micromolar. The purpose of the polyphosphate loading state is to provide AOB with ammonia and oxygen such that ATP can be produced, but to deny them carbon dioxide and carbonate such that they are unable to use that ATP to fix carbon dioxide and instead use that ATP to generate polyphosphate which may be stored.
In some embodiments, the preparation of ammonia oxidizing bacteria may be in a storage state. A storage state may be defined as ammonia oxidizing bacteria in an environment in which they may be stored to be later revived. The storage state may be a state, e.g., ammonia oxidizing bacteria in an environment that allows availability of ammonia oxidizing bacteria after being revived, e.g., after being place in an environment promoting a growth state for a pre-determined period of time.
The storage state may comprise providing ammonia oxidizing bacteria in an environment having a pH of less than about 7.4. The storage state may also comprise providing ammonia oxidizing bacteria in an environment having ammonia, ammonia salts, and/or urea, trace minerals, oxygen, and low concentrations of carbon dioxide, as described above in Section 1.
Storage may also be accomplished by storing at 4° C. for up to several months. The storage buffer in some embodiments may comprise 50 mM Na2HPO4-2 mM MgCl2 (pH 7.6).
In some embodiments, ammonia oxidizing bacteria may be cyropreserved. A 1.25 ml of ammonia oxidizing bacteria mid-log culture may be added to a 2 ml cryotube and 0.75 ml of sterile 80% glycerol. Tubes may be shaken gently, and incubate at room temperature for 15 min to enable uptake of the cryoprotective agents by the cells. The tubes may be directly stored in a −80° C. freezer for freezing and storage.
For resuscitation of cultures, frozen stocks may be thawed on ice for 10-20 minutes, and then centrifuged at 8,000×g for 3 minutes at 4° C. The pellet may be washed by suspending it in 2 ml AOB medium followed by another centrifugation at 8,000×g for 3 minutes at 4° C. to reduce potential toxicity of the cryoprotective agents. The pellet may be resuspended in 2 ml of AOB medium, inoculated into 50 ml of AOB medium containing 50 mM NH4+, and incubated in dark at 30° C. by shaking at 200 rpm.
In some embodiments, the preparation of ammonia oxidizing bacteria may comprise ammonia oxidizing bacteria in a storage state and/or ammonia oxidizing bacteria in a polyphosphate loading state and/or ammonia oxidizing bacteria in a growth state.
Without wishing to be bound by theory, by maintaining ammonia oxidizing bacteria under conditions or in an environment of low carbon dioxide, with sufficient oxygen and ammonia, they may accumulate polyphosphate for a pre-determined period, e.g., for a period of about one doubling time, e.g., for about 8-12 hours, e.g., for about 10 hours. The ammonia oxidizing bacteria may accumulate sufficient polyphosphate to extend their storage viability, storage time, and accelerate their revival. This may occur with or without the addition of buffer and ammonia.
The presence of sufficient stored polyphosphate may allow the ammonia oxidizing bacteria the ATP resources to maintain metabolic activity even in the absence of ammonia and oxygen, and to survive insults that would otherwise be fatal.
The process of oxidation of ammonia to generate ATP has two steps. The first step is the oxidation of ammonia to hydroxylamine by ammonia monoxoygenase (Amo), followed by the conversion of hydroxylamine to nitrite by hydroxylamine oxidoreductase (Hao). Electrons from the second step (conversion of hydroxylamine to nitrite) are used to power the first step (oxidation of ammonia to hydroxylamine).
If an ammonia oxidizing bacteria does not have hydroxylamine to generate electrons for Amo, then hydroxylamine is not available for Hao. For example, acetylene irreversibly inhibits the enzyme crucial for the first step in the oxidation of ammonia to nitrite, the oxidation of ammonia to hydroxylamine. Once AOB are exposed to acetylene, Amo is irreversibly inhibited and new enzyme must be synthesized before hydroxylamine can be generated. In a normal consortium biofilm habitat, AOB may share and receive hydroxylamine form other AOB (even different strains with different susceptibilities to inhibitors) and so the biofilm tends to be more resistant to inhibitors such as acetylene than an individual organism. AOB can use stored polyphosphate to synthesize new Amo, even in the absence of hydroxylamine.
Any embodiment, preparation, composition, or formulation of ammonia oxidizing bacteria discussed herein may comprise, consist essentially of, or consist of optionally axenic ammonia oxidizing bacteria.
Methods of culturing various Nitrosomonas species are known in the art. N. eutropha may be cultured, for example, using N. europaea medium as described in Example 2 below. Ammonia oxidizing bacteria may be cultured, for example, using the media described in Table 3 or Table 4, above.
N. eutropha may be grown, for example, in a liquid culture or on plates. Suitable plates include 1.2% R2A agar, 1.2% agar, 1.2% agarose, and 1.2% agarose with 0.3 g/L pyruvate.
In some embodiments, ammonia oxidizing bacteria, such as N. eutropha is cultured in organic free media. One advantage of using organic free media is that it lacks substrate for heterotrophic bacteria to metabolize except for that produced by the autotrophic bacteria. Another advantage of using the as-grown culture is that substantial nitrite accumulates in the culture media, and this nitrite is also inhibitory of heterotrophic bacteria and so acts as a preservative during storage.
In some embodiments, ammonia oxidizing bacteria such as an N. eutropha strain with improved, e.g. optimized, properties is produced by an iterative process of propagation and selecting for desired properties. In some embodiments, the selection and propagation are carried out simultaneously. In some embodiments, the selection is carried out in a reaction medium (e.g., complete N. europaea medium) comprising 50 mM, 75 mM, 100 mM, 125 mM, 150 mM, 175 mM, 200 mM, 225 mM, 250 mM, 275 mM, or 300 mM NH4+, e.g., at least 200 mM NH4+. In some embodiments, the period of propagation and/or selection is at least 1, 2, 3, or 6 months. In embodiments, the period of propagation and/or selection is at least 1, 2, 4, 6, 8, or 10 years.
In some aspects, the ammonia oxidizing bacteria, such as the N. eutropha are manufactured on a commercial scale. In some embodiments, commercial scale refers to a liquid culturing method with a culture medium volume of at least 10,000, 20,000, 30,000, 50,000, or 100,000 liters (L). In some embodiments, the bacteria are produced in a bioreactor. The bioreactor may maintain the bacteria at a constant temperature, e.g., about 26-30 degrees Celsius using, for example a thermal jacket for insulation, a temperature sensor, and a heating or cooling element. The bioreactor may have an apparatus for stirring the culture to improve distribution of nutrients like ammonia, urea, oxygen, carbon dioxide, and various minerals. The bioreactor may also have an inlet tube for addition of new medium, and an outlet tube for collection of cells. The bioreactor may also have an aerator for distributing oxygen and/or carbon dioxide to the culture. The bioreactor may be, e.g., a batch reactor, a fed batch reactor, or a continuous reactor. In some embodiments, commercial scale production of N. eutropha yields a batch of 1,000 to 100,000 L per day at about 1012 CFU/liter and 1,000 to 100,000. The commercial scale production may yield e.g., a batch of 1,000-5,000, 5,000-10,000, 10,000-50,000, or 50,000-100,000 L/day. The commercial scale production may yield e.g., a batch of 1,000-5,000, 5,000-10,000, 10,000-50,000, or 50,000-100,000 L per batch. In some embodiments, the yield is at a concentration of at least 1010, 1011, 2×1011, 5×1011, or 1012, or about 1010-1011, 1011-1012, 1012-1013, or 1013-1014 CFU/L
In some embodiments, typically including commercial scale production, quality control (QC) testing steps are carried out. The general steps of QC typically comprise, 1) culturing N. eutropha, 2) performing a testing step on the culture or an aliquot thereof, and 3) obtaining a value from the testing step, and optionally: 4) comparing the obtained value to a reference value or range of acceptable values, and 5) if the obtained value meets the acceptable reference value or range, then classifying the culture as acceptable, and if the obtained value does not meet the acceptable reference value or range, then classifying the culture as unacceptable. If the culture is classified as acceptable, the culture may, e.g., be allowed to continue growing and/or may be harvested and added to a commercial product. If the culture is classified as unacceptable, the culture may, e.g., be safely disposed of or the defect may be remedied.
The testing step may comprise measuring the optical density (OD) of the culture. OD is measured in a spectrophotometer, and provides information on the amount of light transmitted through the sample as distinguished from light absorbed or scattered. In some embodiments, the OD600 (e.g., optical density of light with a wavelength of 600 nm) may be determined. This measurement typically indicates the concentration of cells in the medium, where a higher optical density corresponds to a higher cell density.
The testing step may comprise measuring the pH of the culture. The pH of an N. eutropha culture indicates the rate of nitrogen oxidation, and can also indicate whether the culture comprises a contaminating organism. pH may be measured using, e.g., a pH-sensing device comprising a electrode (such as a hydrogen electrode, quinhydron-Electrode, antimony electrode, glass electrode), a pH-sensing device comprising a semiconductor, or a color indicator reagent such as pH paper.
In certain embodiments, producing the ammonia oxidizing bacteria such as N. eutropha comprises carrying out various quality control steps. For instance, one may test the medium in which the N. eutropha is grown, e.g., to determine whether it has an appropriate pH, whether it has a sufficiently low level of waste products, and/or whether it has a sufficiently high level or nutrients. One may also test for the presence of contaminating organisms. A contaminating organism is typically an organism other than an ammonia oxidizing bacteria such as N. eutropha, for instance an organism selected Microbacterium sp., Alcaligenaceae bacterium, Caulobacter sp., Burkodelia multivorans, Escherichia coli, Klebsiella pneumoniae, and Staphylococcus aureus. One may test for contaminants by, e.g., extracting DNA, amplifying it, and sequencing a conserved gene such as 16S rRNA. One may also test for contaminants by plating culture on agar plates and observing colony morphology. N. eutropha typically forms red colonies, so non-red colonies are often indicative of contaminating organisms.
The present disclosure provides, inter alia, compositions comprising ammonia oxidizing bacteria, e.g., a preparation of ammonia oxidizing bacteria, or a purified preparation of ammonia oxidizing bacteria e.g., a natural product, or a fortified natural product. The compositions comprising ammonia oxidizing bacteria, e.g., a preparation of ammonia oxidizing bacteria, or a purified preparation of ammonia oxidizing bacteria may be provided in a cosmetic product or a therapeutic product. The preparation may comprise, inter alia, at least one of ammonia, ammonium salts, and urea.
The present disclosure provides, inter alia, compositions comprising N. eutropha, e.g., a purified preparation of an optimized N. eutropha. In some embodiments, the N. eutropha in the compositions has at least one property selected from an optimized growth rate, an optimized NH4+ oxidation rate, and an optimized resistance to NH4+.
In some aspects, the present disclosure provides compositions with a defined number of species. For instance, this disclosure provides a composition having N. eutropha and one other type of organism, and no other types of organism. In other examples, the composition has N. eutropha and 2, 3, 4, 5, 6, 7, 8, 9, or 10 other types of organism, and no other types of organism. The other type of organism in this composition may be, for instance, a bacterium, such as an ammonia-oxidizing bacterium. Suitable ammonia-oxidizing bacteria for this purpose include those in the genera Nitrosomonas, Nitrosococcus, Nitrosospira, Nitrosocystis, Nitrosolobus, or Nitrosovibrio.
In some embodiments, the composition comprising N. eutropha provides conditions that support N. eutropha viability. For instance, the composition may promote N. eutropha growth and metabolism or may promote a dormant state (e.g., freezing) from which viable N. eutropha can be recovered. When the composition promotes growth or metabolism, it may contain water and/or nutrients that N. eutropha consumes, e.g., as ammonium, ammonia, urea, oxygen, carbon dioxide, or trace minerals. In some embodiments, the composition comprising ammonia oxidizing bacteria provides conditions that support ammonia oxidizing bacteria viability. For instance, the composition may promote ammonia oxidizing bacteria growth and metabolism or may promote a dormant state (e.g., freezing) or storage state as described herein, from which viable ammonia oxidizing bacteria can be recovered. When the composition promotes growth or metabolism, it may contain water and/or nutrients that ammonia oxidizing bacteria consumes, e.g., as ammonium ions, ammonia, urea, oxygen, carbon dioxide, or trace minerals.
In some embodiments, one or more other organisms besides ammonia oxidizing bacteria may be included in the preparation of ammonia oxidizing bacteria. For example, an organism of the genus selected from the group consisting of Lactobacillus, Streptococcus, Bifidobacter, and combinations thereof, may be provided in the preparation of ammonia oxidizing bacteria. In some embodiments, the preparation may be substantially free of other organisms.
Preparations of ammonia oxidizing bacteria may comprise between about between about 108 to about 1014 CFU/L. The preparation may comprise at least about 108, 109, 1010, 1011, 2×1011, 5×1011, 1012, 2×1012, 5×1012, 1013, 2×1013, 5×1013, or 1014; or about 108-109, 109-1010, 1010-1011, 1011-1012, 1012-1013, or 1013-1014 CFU/L.
In some embodiments, the preparation may comprise at least 108, 109, 1010, 1011, 2×1011, 5×1011, 1012, 2×1012, 5×1012, 1013, 2×1013, 5×1013, or 1014; or about 108-109, 109-1010, 1010-1011, 1011-1012, 1012-1013, or 1013-1014 CFU/ml.
In some embodiments, the preparation may comprise between about 1×109 to about 10×109 CFU/L. In some embodiments, the preparation may comprise about 3×1010 CFU, e.g., 3×1010 CFU per day. In some embodiments, the preparation may comprise about 1×109 to about 10×109 CFU, e.g., about 1×109 to about 10×109 CFU per day.
In some embodiments, the preparation of ammonia oxidizing bacteria may comprise between about 0.1 milligrams (mg) and about 1000 mg of ammonia oxidizing bacteria. In certain aspects, the preparation may comprise between about 50 mg and about 1000 mg of ammonia oxidizing bacteria. The preparation may comprise between about 0.1-0.5 mg, 0.2-0.7 mg, 0.5-1.0 mg, 0.5-2 mg, 0.5-5 mg, 2.5-5 mg, 2.5-7.0 mg, 5.0-10 mg, 7.5-15 mg, 10-15 mg, 15-20 mg, 15-25 mg, 20-30 mg, 25-50 mg, 25-75 mg, 50-75 mg, 50-100 mg, 75-100 mg, 100-200 mg, 200-300 mg, 300-400 mg, 400-500 mg, 500-600 mg, 600-700 mg, 700-800 mg, 800-900 mg, 900-1000 mg, 100-250 mg, 250-500 mg, 100-500 mg, 500-750 mg, 750-1000 mg, or 500-1000 mg.
In some embodiments, the preparation of ammonia oxidizing bacteria my comprise a mass ratio of ammonia oxidizing bacteria to an excipient, e.g., a pharmaceutically acceptable excipient or a cosmetically acceptable excipient in a range of about 0.1 grams per liter to about 1 gram per liter. The preparation may comprise a mass ratio of ammonia oxidizing bacteria to an excipient in a range of about 0.1-0.2, 0.2-0.3, 0.1-0.5, 0.2-0.7, 0.5-1.0, or 0.7-1.0 grams per liter.
Advantageously, a formulation may have a pH that promotes AOB, e.g., N. eutropha viability, e.g., metabolic activity. Urea would hydrolyze to ammonia and would raise the pH to 7 to 8. AOB are very active at this pH range and would lower the pH to about 6 where the NH3 converts to ammonium and is unavailable. Lower pH levels, e.g. about pH 4, are also acceptable. The ammonia oxidizing bacteria, e.g., N. eutropha may be combined with one or more pharmaceutically or cosmetically acceptable excipients. In some embodiments, “pharmaceutically acceptable excipient” refers to a pharmaceutically-acceptable material, composition, or vehicle, such as a liquid or solid filler, diluent, solvent, or encapsulating material. In some embodiments, each excipient is “pharmaceutically acceptable” in the sense of being compatible with the other ingredients of a pharmaceutical formulation, and suitable for use in contact with the tissue or organ of humans and animals without excessive toxicity, irritation, allergic response, immunogenicity, or other problems or complications, commensurate with a reasonable benefit/risk ratio. See, Remington: The Science and Practice of Pharmacy, 21st ed.; Lippincott Williams & Wilkins: Philadelphia, Pa., 2005; Handbook of Pharmaceutical Excipients, 6th ed.; Rowe et al., Eds.; The Pharmaceutical Press and the American Pharmaceutical Association: 2009; Handbook of Pharmaceutical Additives, 3rd ed.; Ash and Ash Eds.; Gower Publishing Company: 2007; Pharmaceutical Preformulation and Formulation, 2nd ed.; Gibson Ed.; CRC Press LLC: Boca Raton, Fla., 2009.
In some embodiments, a cosmetically acceptable excipient refers to a cosmetically acceptable material, composition, or vehicle, such as a liquid or solid filler, diluent, solvent, or encapsulating material. In some embodiments, each excipient is cosmetically acceptable in the sense of being compatible with the other ingredients of a cosmetic formulation, and suitable for use in contact with the tissue or organ of humans and animals without excessive toxicity, irritation, allergic response, immunogenicity, or other problems or complications, commensurate with a reasonable benefit/risk ratio.
While it is possible for the active ingredient, e.g., ammonia oxidizing bacteria, e.g., N. eutropha, to be administered alone, in many embodiments it present in a pharmaceutical formulation or composition. Accordingly, this disclosure provides a pharmaceutical formulation comprising ammonia oxidizing bacteria, for example, N. eutropha and a pharmaceutically acceptable excipient. Pharmaceutical compositions may take the form of a pharmaceutical formulation as described below.
The pharmaceutical formulations described herein include those suitable for oral, parenteral (including subcutaneous, intradermal, intramuscular, intravenous, and intraarticular), inhalation (including fine particle dusts or mists which may be generated by means of various types of metered doses, pressurized aerosols, nebulizers or insufflators, and including intranasally or via the lungs), rectal and topical (including dermal, transdermal, transmucosal, buccal, sublingual, and intraocular) administration, although the most suitable route may depend upon, for example, the condition and disorder of the recipient.
The formulations may conveniently be presented in unit dosage form and may be prepared by any of the methods known in the art of pharmacy. Typically, methods include the step of bringing the active ingredient (e.g., ammonia oxidizing bacteria, e.g., N. eutropha) into association with a pharmaceutical carrier which constitutes one or more accessory ingredients. In general the formulations are prepared by uniformly and intimately bringing into association the active ingredient with liquid carriers or finely divided solid carriers or both and then, if necessary, shaping the product into the desired formulation.
Formulations may be presented as discrete units such as capsules, cachets or tablets, each containing a predetermined amount of, e.g., N. eutropha; as a powder or granules; as a solution or a suspension in an aqueous liquid or a non-aqueous liquid; or as an oil-in-water liquid emulsion or a water-in-oil liquid emulsion. The active ingredient may also be presented as a bolus, electuary or paste. Various pharmaceutically acceptable carriers and their formulation are described in standard formulation treatises, e.g., Remington's Pharmaceutical Sciences by E. W. Martin. See also Wang, Y. J. and Hanson, M. A., Journal of Parenteral Science and Technology, Technical Report No. 10, Supp. 42:2 S, 1988.
The ammonia oxidizing bacteria, e.g., N. eutropha compositions can, for example, be administered in a form suitable for immediate release or extended release. Suitable examples of sustained-release systems include suitable polymeric materials, for example semi-permeable polymer matrices in the form of shaped articles, e.g., films, or microcapsules; suitable hydrophobic materials, for example as an emulsion in an acceptable oil; or ion exchange resins. Sustained-release systems may be administered orally; rectally; parenterally; intracisternally; intravaginally; intraperitoneally; topically, for example as a powder, ointment, gel, drop or transdermal patch; bucally; or as a spray.
Preparations for administration can be suitably formulated to give controlled release of ammonia oxidizing bacteria, e.g., N. eutropha. For example, the pharmaceutical compositions may be in the form of particles comprising one or more of biodegradable polymers, polysaccharide jellifying and/or bioadhesive polymers, or amphiphilic polymers. These compositions exhibit certain biocompatibility features which allow a controlled release of an active substance. See U.S. Pat. No. 5,700,486.
Exemplary compositions include suspensions which can contain, for example, microcrystalline cellulose for imparting bulk, alginic acid or sodium alginate as a suspending agent, methylcellulose as a viscosity enhancer, dicalcium phosphate, starch, magnesium stearate and/or lactose and/or other excipients, binders, extenders, disintegrants, diluents and lubricants, mannitol, lactose, sucrose and/or cyclodextrins. Also included in such formulations may be high molecular weight excipients such as celluloses (avicel) or polyethylene glycols (PEG). Such formulations can also include an excipient to aid mucosal adhesion such as hydroxy propyl cellulose (HPC), hydroxy propyl methyl cellulose (HPMC), sodium carboxy methyl cellulose (SCMC), maleic anhydride copolymer (e.g., Gantrez), and agents to control release such as polyacrylic copolymer (e.g. Carbopol 934). Lubricants, glidants, flavors, coloring agents and stabilizers may also be added for ease of fabrication and use. The surfactant may be a zwitterionic surfactant, a non-ionic surfactant, or an anionic surfactant.
Excipients, such as surfactants that may be used with embodiments of the present disclosure may include one or more of cocamidopropyl betaine (ColaTeric COAB), polyethylene sorbitol ester (e.g., Tween 80), ethoxylated lauryl alcohol (RhodaSurf 6 NAT), sodium laureth sulfate/lauryl glucoside/cocamidopropyl betaine (Plantapon 611 L UP), sodium laureth sulfate (e.g., RhodaPex ESB 70 NAT), alkyl polyglucoside (e.g., Plantaren 2000 N UP), sodium laureth sulfate (Plantaren 200), Dr. Bronner's Castile soap, Dr. Bronner's Castile baby soap, Lauramine oxide (ColaLux Lo), sodium dodecyl sulfate (SDS), polysulfonate alkyl polyglucoside (PolySufanate 160 P), sodium lauryl sulfate (Stepanol-WA Extra K). and combinations thereof. Dr. Bronner's Castile soap and Dr. Bronner's baby soap comprises water, organic coconut oil, potassium hydroxide, organic olive oil, organic fair deal hemp oil, organic jojoba oil, citric acid, and tocopherol.
In some embodiments, surfactants may be used with ammonia oxidizing bacteria in amounts that allow nitrite production to occur. In some embodiments, the preparation may have less than about 0.0001% to about 10% of surfactant. In some embodiments, the preparation may have between about 0.1% and about 10% surfactant. In some embodiments, the concentration of surfactant used may be between about 0.0001% and about 10%. In some embodiments, the preparation may be substantially free of surfactant.
In some embodiments, the formulation, e.g., preparation, may include other components that may enhance effectiveness of ammonia oxidizing bacteria, or enhance a treatment or indication.
In some embodiments, a chelator may be included in the preparation. A chelator may be a compound that may bind with another compound, e.g., a metal. The chelator may provide assistance in removing an unwanted compound from an environment, or may act in a protective manner to reduce or eliminate contact of a particular compound with an environment, e.g., ammonia oxidizing bacteria, e.g. a preparation of ammonia oxidizing bacteria, e.g., an excipient. In some embodiments, the preparation may be substantially free of chelator.
Formulations may also contain anti-oxidants, buffers, bacteriostats that prevent the growth of undesired bacteria, solutes, and aqueous and non-aqueous sterile suspensions which may include suspending agents and thickening agents. The formulations may be presented in unit-dose or multi-dose containers, for example sealed ampoules and vials, and may be stored in a freeze-dried (lyophilised) condition requiring only the addition of a sterile liquid carrier, for example saline or water-for-injection, immediately prior to use. Extemporaneous solutions and suspensions may be prepared from powders, granules and tablets of the kind previously described. Exemplary compositions include solutions or suspensions which can contain, for example, suitable non-toxic, pharmaceutically acceptable diluents or solvents, such as mannitol, 1,3-butanediol, water, Ringer's solution, an isotonic sodium chloride solution, or other suitable dispersing or wetting and suspending agents, including synthetic mono- or diglycerides, and fatty acids, including oleic acid, or Cremaphor. An aqueous carrier may be, for example, an isotonic buffer solution at a pH of from about 3.0 to about 8.0, a pH of from about 3.5 to about 7.4, for example from 3.5 to 6.0, for example from 3.5 to about 5.0. Useful buffers include sodium citrate-citric acid and sodium phosphate-phosphoric acid, and sodium acetate/acetic acid buffers. The composition in some embodiments does not include oxidizing agents.
Excipients that can be included are, for instance, proteins, such as human serum albumin or plasma preparations. If desired, the pharmaceutical composition may also contain minor amounts of non-toxic auxiliary substances, such as wetting or emulsifying agents, preservatives, and pH buffering agents and the like, for example sodium acetate or sorbitan monolaurate. In some embodiments, excipients, e.g., a pharmaceutically acceptable excipient or a cosmetically acceptable excipient, may comprise an anti-adherent, binder, coat, disintegrant, filler, flavor, color, lubricant, glidant, sorbent, preservative, or sweetener. In some embodiments, the preparation may be substantially free of excipients.
In some embodiments, the preparation may be substantially free of one or more of the compounds or substances listed in the disclosure.
Exemplary compositions for aerosol administration include solutions in saline, which can contain, for example, benzyl alcohol or other suitable preservatives, absorption promoters to enhance bioavailability, and/or other solubilizing or dispersing agents. Conveniently in compositions for aerosol administration the ammonia oxidizing bacteria, e.g., N. eutropha is delivered in the form of an aerosol spray presentation from a pressurized pack or a nebulizer, with the use of a suitable propellant, e.g., dichlorodifluoro-methane, trichlorofluoromethane, dichlorotetrafluoroethane, carbon dioxide or other suitable gas. In the case of a pressurized aerosol the dosage unit can be determined by providing a valve to deliver a metered amount. Capsules and cartridges of e.g., gelatin can be formulated to contain a powder mix of the N. eutropha and a suitable powder base, for example lactose or starch. In certain embodiments, N. eutropha is administered as an aerosol from a metered dose valve, through an aerosol adapter also known as an actuator. Optionally, a stabilizer is also included, and/or porous particles for deep lung delivery are included (e.g., see U.S. Pat. No. 6,447,743).
Formulations may be presented with carriers such as cocoa butter, synthetic glyceride esters or polyethylene glycol. Such carriers are typically solid at ordinary temperatures, but liquefy and/or dissolve at body temperature to release the ammonia oxidizing bacteria, e.g., N. eutropha.
Exemplary compositions for topical administration include a topical carrier such as Plastibase (mineral oil gelled with polyethylene). In some aspects, the composition and/or excipient may be in the form of one or more of a liquid, a solid, or a gel. For example, liquid suspensions may include, but are not limited to, water, saline, phosphate-buffered saline, or an ammonia oxidizing storage buffer. Gel formulations may include, but are not limited to agar, silica, polyacrylic acid (for example Carbopol®), carboxymethyl cellulose, starch, guar gum, alginate or chitosan. In some embodiments, the formulation may be supplemented with an ammonia source including, but not limited to ammonium chloride or ammonium sulfate.
In some embodiments, an ammonia oxidizing bacteria, e.g., N. eutropha composition is formulated to improve NO penetration into the skin. A gel-forming material such as KY jelly or various hair gels would present a diffusion barrier to NO loss to ambient air, and so improve the skin's absorption of NO. The NO level in the skin will generally not greatly exceed 20 nM/L because that level activates GC and would cause local vasodilatation and oxidative destruction of excess NO.
It should be understood that in addition to the ingredients particularly mentioned above, the formulations as described herein may include other agents conventional in the art having regard to the type of formulation in question.
The formulation, e.g., preparation, e.g., composition may be provided in a container, delivery system, or delivery device, having a weight, including or not including the contents of the container, that may be less than about 50, 100, 200, 300, 400, 500, 600, 700, 800, 900, 1000, 1500, or 2000 grams.
Suitable unit dosage formulations are those containing an effective dose, as hereinbefore recited, or an appropriate fraction thereof, of ammonia oxidizing bacteria, e.g., N. eutropha.
A therapeutically effective amount of ammonia oxidizing bacteria, e.g., N. eutropha may be administered as a single pulse dose, as a bolus dose, or as pulse doses administered over time. Thus, in pulse doses, a bolus administration of ammonia oxidizing bacteria, e.g., N. eutropha is provided, followed by a time period wherein ammonia oxidizing bacteria, e.g., N. eutropha is administered to the subject, followed by a second bolus administration. In specific, non-limiting examples, pulse doses are administered during the course of a day, during the course of a week, or during the course of a month.
In some embodiments, a preparation of ammonia oxidizing bacteria, e.g., a formulation, e.g., a composition, may be applied for a pre-determined number of days. This may be based, for example, at least in part, on the severity of the condition or disease, the response to the treatment, the dosage applied and the frequency of the dose. For example, the preparation may be applied for about 1-3, 3-5, 5-7, 7-9, 5-10, 10-14, 12-18, 12-21, 21-28, 28-35, 35-42, 42-49, 49-56, 46-63, 63-70, 70-77, 77-84, 84-91 days, for about 1 month, for about 2 months, for about 3 months. In some embodiments, the ammonia oxidizing bacteria is administered for an indefinite period of time, e.g., greater than one year, greater than 5 years, greater than 10 years, greater than 15 years, greater than 30 years, greater than 50 years, greater than 75 years. In certain aspects, the preparation may be applied for about 16 days.
In some embodiments, a preparation of ammonia oxidizing bacteria, e.g., a formulation, e.g., a composition, may be applied a pre-determined number of times per day. This may be based, for example, at least in part, on the severity of the condition or disease, the response to the treatment, the dosage applied and the frequency of the dose. For example, the preparation may be applied 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24 times per day.
In some embodiments, the preparation may be applied one time per day. In other embodiments, the preparation may be applied two times per day. In some embodiments, the preparation may be applied a first pre-determined amount for a certain number of days, and a second pre-determined amount for a certain subsequent number of days. In some embodiments, the preparation may be applied for about 16 days.
Consumer Products
Ammonia oxidizing bacteria, e.g., N. eutropha may be associated with a variety of consumer products, and examples of such products are set out below. In some embodiments, the ammonia oxidizing bacteria, e.g., N. eutropha associated with a product is admixed with the product, for example, spread evenly throughout the product, and in some embodiments, ammonia oxidizing bacteria, e.g., the N. eutropha associated with a product is layered on the product.
In some embodiments, ammonia oxidizing bacteria, e.g., N. eutropha is associated with a powder. Powders are typically small particulate solids that are not attached to each other and that can flow freely when tilted. Exemplary powders for consumer use include talcum powder and some cosmetics (e.g., powder foundation).
In some embodiments, the ammonia oxidizing bacteria is associated with a cosmetic. The cosmetic may be a substance for topical application intended to alter a person's appearance, e.g., a liquid foundation, a powder foundation, blush, or lipstick. The cosmetic may be any substance recited in the Food and Drug Administration regulations, e.g., under 21 C.F.R. §720.4.
The cosmetic may be at least one of a baby product, e.g., a baby shampoo, a baby lotion, a baby oil, a baby powder, a baby cream; a bath preparation, e.g., a bath oil, a tablet, a salt, a bubble bath, a bath capsule; an eye makeup preparation, e.g., an eyebrow pencil, an eyeliner, an eye shadow, an eye lotion, an eye makeup remover, a mascara; a fragrance preparation, e.g., a colognes, a toilet water, a perfume, a powder (dusting and talcum), a sachet; hair preparations, e.g., hair conditioners, hair sprays, hair straighteners, permanent waves, rinses, shampoos, tonics, dressings, hair grooming aids, wave sets; hair coloring preparations, e.g., hair dyes and colors, hair tints, coloring hair rinses, coloring hair shampoos, hair lighteners with color, hair bleaches; makeup preparations, e.g., face powders, foundations, leg and body paints, lipstick, makeup bases, rouges, makeup fixatives; manicuring preparations, e.g., basecoats and undercoats, cuticle softeners, nail creams and lotions, nail extenders, nail polish and enamel, nail polish and enamel removers; oral hygiene products, e.g., dentrifices, mouthwashes and breath fresheners; bath soaps and detergents, deodorants, douches, feminine hygiene deodorants; shaving preparations, e.g., aftershave lotions, beard softeners, talcum, preshave lotions, shaving cream, shaving soap; skin care preparations, e.g., cleansing, depilatories, face and neck, body and hand, foot powders and sprays, moisturizing, night preparations, paste masks, skin fresheners; and suntan preparations, e.g., gels, creams, and liquids, and indoor tanning preparations.
In some embodiments, the formulations, compositions, or preparations described herein, may comprise, be provided as, or disposed in at least one of a baby product, e.g., a baby shampoo, a baby lotion, a baby oil, a baby powder, a baby cream; a bath preparation, e.g., a bath oil, a tablet, a salt, a bubble bath, a bath capsule; a powder (dusting and talcum), a sachet; hair preparations, e.g., hair conditioners, rinses, shampoos, tonics, face powders, cuticle softeners, nail creams and lotions, oral hygiene products, mouthwashes, bath soaps, douches, feminine hygiene deodorants; shaving preparations, e.g., aftershave lotions, skin care preparations, e.g., cleansing, face and neck, body and hand, foot powders and sprays, moisturizing, night preparations, paste masks, skin fresheners; and suntan preparations, e.g., gels, creams, and liquids.
In some embodiments, ammonia oxidizing bacteria, e.g., N. eutropha is associated with a cosmetic. The cosmetic may be a substance for topical application intended to alter a person's appearance, e.g., a liquid foundation, a powder foundation, blush, or lipstick. Other components may be added to these cosmetic preparations as selected by one skilled in the art of cosmetic formulation such as, for example, water, mineral oil, coloring agent, perfume, aloe, glycerin, sodium chloride, sodium bicarbonate, pH buffers, UV blocking agents, silicone oil, natural oils, vitamin E, herbal concentrates, lactic acid, citric acid, talc, clay, calcium carbonate, magnesium carbonate, zinc oxide, starch, urea, and erythorbic acid, or any other excipient known by one of skill in the art, including those disclosed herein.
In some embodiments, the preparation may be disposed in, or provided as, a powder, cosmetic, cream, stick, aerosol, salve, wipe, or bandage.
In some embodiments, ammonia oxidizing bacteria, e.g., N. eutropha is associated with a cream. The cream may be a fluid comprising a thickening agent, and generally has a consistency that allows it to be spread evenly on the skin. Exemplary creams include moisturizing lotion, face cream, and body lotion.
In some embodiments, ammonia oxidizing bacteria, e.g., the N. eutropha is associated with a stick. A stick is typically a solid that, when placed in contact with a surface, transfers some of the stick contents to the surface. Exemplary sticks include deodorant stick, lipstick, lip balm in stick form, and sunscreen applicator sticks.
In some embodiments, ammonia oxidizing bacteria, e.g., the N. eutropha is associated with an aerosol. An aerosol is typically a colloid of fine solid particles or fine liquid droplets, in a gas such as air. Aerosols may be created by placing the N. eutropha (and optionally carriers) in a vessel under pressure, and then opening a valve to release the contents. The container may be designed to only exert levels of pressure that are compatible with N. eutropha viability. For instance, the high pressure may be exerted for only a short time, and/or the pressure may be low enough not to impair viability. Examples of consumer uses of aerosols include for sunscreen, deodorant, perfume, hairspray, and insect repellant.
In some embodiments, ammonia oxidizing bacteria, e.g., the N. eutropha is associated with a salve. A salve may be a topically applied agent with a liquid or cream-like consistency, intended to protect the skin or promote healing. Examples of salves include burn ointments and skin moisturizers.
In some embodiments, ammonia oxidizing bacteria, e.g., the N. eutropha is associated with a wipe. A wipe may be a flexible material suitable for topically applying a liquid or cream onto skin. The wipe may be, e.g., paper-based or cloth based. Exemplary wipes include tissues and wet wipes.
The compositions comprising ammonia oxidizing bacteria, e.g., N. eutropha may also comprise one or more of a moisturizing agent, deodorizing agent, scent, colorant, insect repellant, cleansing agent, or UV-blocking agent.
For instance, the moisturizing agent may be an agent that reduces or prevents skin dryness. Exemplary moisturizing agents include humectants (e.g., urea, glycerin, alpha hydroxy acids and dimethicone) and emollients (e.g., lanolin, mineral oil and petrolatum). Moisturizing agents may be included, e.g., in ammonia oxidizing bacteria, e.g., N. eutropha-containing creams, balms, lotions, or sunscreen.
A deodorizing agent may be an agent that reduces unwanted odors. A deodorizing agent may work by directly neutralizing odors, preventing perspiration, or preventing the growth of odor-producing bacteria. Exemplary deodorizing agents include aluminum salts (e.g., aluminum chloride or aluminum chlorohydrate), cyclomethicone, talc, baking soda, essential oils, mineral salts, hops, and witch hazel. Deodorizing agents are typically present in spray or stick deodorants, and can also be found in some soaps and clothing.
An insect repellant may be an agent that can be applied to surfaces (e.g., skin) that discourage insects and other arthropods from lighting on the surface. Insect repellants include DEET (N,N-diethyl-m-toluamide), p-menthane-3,8-diol (PMD), icaridin, nepetalactone, citronella oil, neem oil, bog myrtle, dimethyl carbate, Tricyclodecenyl allyl ether, and IR3535 (3-[N-Butyl-N-acetyl]-aminopropionic acid, ethyl ester).
A cleansing agent may be an agent that removes dirt or unwanted bacteria from a surface like skin. Exemplary cleansing agents include bar soaps, liquid soaps, and shampoos.
A UV-blocking agent may be an agent that can be applied to a surface to reduce the amount of ultraviolet light the surface receives. A UV-blocking agent may block UV-A and/or UV-B rays. A UV blocking agent can function by absorbing, reflecting, or scattering UV. Exemplary UV-blocking agents include absorbers, e.g., homosalate, octisalate (also called octyl salicylate), octinoxate (also called octyl methoxycinnamate or OMC), octocrylene, oxybenzone, and avobenzone, and reflectors (e.g., titanium dioxide and zinc oxide). UV-blocking agents are typically presents in sunscreens, and can also be found in skin creams and some cosmetics.
In some embodiments, ammonia oxidizing bacteria, e.g., N. eutropha is associated with a conditioner. Conditioner generally refers to a substance with cream-like consistency that can be applied to hair to improve its appearance, strength, or manageability.
In some embodiments, ammonia oxidizing bacteria, e.g., N. eutropha is associated with cloth. Cloth generally refers to a flexible material suitable to be made into clothing, e.g., having enough material strength to withstand everyday motion by a wearer. Cloth can be fibrous, woven, or knit; it can be made of a naturally occurring material or a synthetic material. Exemplary cloth materials include cotton, flax, wool, ramie, silk, denim, leather, nylon, polyester, and spandex, and blends thereof.
In some embodiments, ammonia oxidizing bacteria, e.g., N. eutropha is associated with yarn. Yarn generally refers to a long, thin spun flexible material that is suitable for knitting or weaving. Yarn can be made of, e.g., wool, cotton, polyester, and blends thereof.
In some embodiments, ammonia oxidizing bacteria, e.g., N. eutropha is associated with thread. Thread generally refers to a long, thin spun flexible material that is suitable for sewing. Thread generally has a thinner diameter than yarn. Thread can be made of, e.g., cotton, polyester, nylon, silk, and blends thereof.
Articles of clothing such as, for example, shoes, shoe inserts, pajamas, sneakers, belts, hats, shirts, underwear, athletic garments, helmets, towels, gloves, socks, bandages, and the like, may also be treated with ammonia oxidizing bacteria, e.g., N. eutropha. Bedding, including sheets, pillows, pillow cases, and blankets may also be treated with ammonia oxidizing bacteria, e.g., N. eutropha. In some embodiments, areas of skin that cannot be washed for a period of time may also be contacted with ammonia oxidizing bacteria, e.g., N. eutropha. For example, skin enclosed in orthopedic casts which immobilize injured limbs during the healing process, and areas in proximity to injuries that must be kept dry for proper healing such as stitched wounds may benefit from contact with the ammonia oxidizing bacteria, e.g., N. eutropha.
In some aspects, the present disclosure provides a wearable article comprising an N. eutropha strain as described herein. A wearable article may be a light article that can be closely associated with a user's body, in a way that does not impede ambulation. Examples of wearable articles include a wristwatch, wristband, headband, hair elastic, hair nets, shower caps, hats, hairpieces, and jewelry. The wearable article comprising an ammonia oxidizing bacteria, e.g., N. eutropha strain described herein may provide, e.g., at a concentration that provides one or more of a treatment or prevention of a skin disorder, a treatment or prevention of a disease or condition associated with low nitrite levels, a treatment or prevention of body odor, a treatment to supply nitric oxide to a subject, or a treatment to inhibit microbial growth.
In some embodiments, the ammonia oxidizing bacteria, e.g., N. eutropha is associated with a product intended to contact the hair, for example, a brush, comb, shampoo, conditioner, headband, hair elastic, hair nets, shower caps, hats, and hairpieces. Nitric oxide formed on the hair, away from the skin surface, may be captured in a hat, scarf or face mask and directed into inhaled air.
Articles contacting the surface of a human subject, such as a diaper, may be associated with ammonia oxidizing bacteria, e.g., N. eutropha. Because diapers are designed to hold and contain urine and feces produced by incontinent individuals, the urea in urine and feces can be hydrolyzed by skin and fecal bacteria to form free ammonia which is irritating and may cause diaper rash. Incorporation of bacteria that metabolize urea into nitrite or nitrate, such as ammonia oxidizing bacteria, e.g., N. eutropha, may avoid the release of free ammonia and may release nitrite and ultimately NO which may aid in the maintenance of healthy skin for both children and incontinent adults. The release of nitric oxide in diapers may also have anti-microbial effects on disease causing organisms present in human feces. This effect may continue even after disposable diapers are disposed of as waste and may reduce the incidence of transmission of disease through contact with soiled disposable diapers
In some embodiments, the product comprising ammonia oxidizing bacteria, e.g., N. eutropha is packaged. The packaging may serve to compact the product or protect it from damage, dirt, or degradation. The packaging may comprise, e.g., plastic, paper, cardboard, or wood. In some embodiments the packaging is impermeable to bacteria. In some embodiments the packaging is permeable to oxygen and/or carbon dioxide.
The present disclosure provides various methods of treating diseases and conditions using ammonia oxidizing bacteria, e.g., N. eutropha. The ammonia oxidizing bacteria, e.g., N. eutropha that may be used to treat diseases and conditions include all the ammonia oxidizing bacteria, e.g., N. eutropha compositions described in this application, e.g. a purified preparation of optimized ammonia oxidizing bacteria, e.g., N. eutropha, e.g. those in Section 2 above, for instance strain D23.
For instance, the disclosure provides uses, for treating a condition or disease (e.g., inhibiting microbial growth on a subject's skin), an optionally axenic composition of N. eutropha comprising a nucleic acid sequence at least about 70%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 99.5% identical to SEQ ID NO: 1; an optionally axenic composition of N. eutropha comprising a nucleic acid sequence at least about 70%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 99.5% identical to any one of the strain D23 nucleic acids of Table 1. In embodiments, the N. eutropha comprises at least 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, or all of the strain D23 nucleic acids of Table 1. In embodiments, the N. eutropha comprises one or more nucleic acids of FIGS. 6-8. As a further example, this disclosure provides uses, for treating a condition or disease, an optionally axenic composition of N. eutropha comprising an amino acid sequence at least about 70%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 99.5% identical to any one of the strain D23 protein sequences of Table 1. In embodiments, the N. eutropha comprises at least 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, or all of the strain D23 protein sequences of Table 1. In embodiments, the N. eutropha comprises one or more proteins encoded by the nucleic acids of FIGS. 6-8. The N. eutropha of this paragraph may be used to treat, e.g., diabetic ulcers, e.g., diabetic foot ulcers, chronic wounds, acne, rosacea, eczema, or psoriasis.
In certain embodiments, the disclosure provides uses, for treating a condition or disease (e.g., inhibiting microbial growth on a subject's skin), an optionally axenic composition of N. eutropha having one or more of: (1) an optimized growth rate, (2) an optimized NH4+ oxidation rate, (3) an optimized resistance to NH3, (4) an optimized resistance to, NH4+, and (5) an optimized resistance to, NO2−. For instance, the axenic N. eutropha composition may have properties (1) and (2); (2) and (3); (3) and (4); or (4) and (5) from the list at the beginning of this paragraph. As another example, the axenic N. eutropha composition may have properties (1), (2), and (3); (1), (2), and (4); (1), (2), and (5); (1), (3), and (4); (1), (3), and (5); (1), (4), and (5); (2), (3), and (4); (2), (3), and (5), or (3), (4), and (5) from the list at the beginning of this paragraph. As a further example, the optionally axenic N. eutropha composition may have properties (1), (2), (3), and (4); (1), (2), (3), and (5); (1), (2), (4), and (5); (1), (3), (4), and (5); or (2), (3), (4), and (5) from the list at the beginning of this paragraph. In some embodiments, the axenic N. eutropha composition has properties (1), (2), (3), (4), and (5) from the list at the beginning of this paragraph. The N. eutropha of this paragraph may be used to treat, e.g., diabetic ulcers, e.g., diabetic foot ulcers, chronic wounds, acne, rosacea, eczema, or psoriasis.
In some embodiments, optionally axenic N. eutropha (e.g., strain D23) are used to treat a subject. Subjects may include an animal, a mammal, a human, a non-human animal, a livestock animal, or a companion animal.
In some embodiments, optionally axenic N. eutropha described herein (e.g., the N. eutropha described in this Section and in Section 2 above, e.g., strain D23) are used to inhibit the growth of other organisms. For instance, N. eutropha D23 is well-adapted for long-term colonization of human skin, and in some embodiments it out-competes other bacteria that are undesirable on the skin. Undesirable skin bacteria include, e.g., those that can infect wounds, raise the risk or severity of a disease, or produce odors. Certain undesirable skin bacteria include S. aureus, P. aeruginosa, S. pyogenes, and A. baumannii. The N. eutropha described herein may out-compete other organisms by, e.g., consuming scarce nutrients, or generating byproducts that are harmful to other organisms, e.g., changing the pH of the skin to a level that is not conducive to the undesirable organism's growth.
Accordingly, the present disclosure provides, inter alia, a method of inhibiting microbial growth on a subject's skin, comprising topically administering to a human in need thereof an effective dose of optionally axenic N. eutropha bacteria as described herein (e.g., strain D23). Similarly, the present disclosure provides optionally axenic N. eutropha as described herein (e.g., strain D23) for use in inhibiting microbial growth on a subject's skin. Likewise, the present disclosure provides a use of optionally axenic N. eutropha (e.g., strain D23) in the manufacture of a medicament for inhibiting microbial growth on a subject's skin.
The present disclosure also provides a method of supplying nitric oxide to a subject, comprising positioning an effective dose of optionally axenic N. eutropha bacteria described herein (e.g., strain D23) in close proximity to the subject. Similarly, the present disclosure provides optionally axenic N. eutropha (e.g., strain D23) as described herein for use in supplying nitric oxide to a subject. Likewise, the present disclosure provides a use of optionally axenic N. eutropha (e.g., strain D23) in the manufacture of a medicament or composition suitable for position in close proximity to a subject.
The present disclosure also provides a method of reducing body odor, comprising topically administering to a subject in need thereof an effective dose of optionally axenic N. eutropha bacteria described herein (e.g., strain D23). Similarly, the present disclosure provides optionally axenic N. eutropha as described herein (e.g., strain D23) for use in reducing body odor in a subject. Likewise, the present disclosure provides a use of optionally axenic N. eutropha as described herein (e.g., strain D23) in the manufacture of a medicament or composition for reducing body odor.
The present disclosure also provides a method of treating or preventing a disease associated with low nitrite levels, comprising topically administering to a subject in need thereof a therapeutically effective dose of optionally axenic N. eutropha bacteria described herein (e.g., strain D23). Similarly, the present disclosure provides a topical formulation of optionally axenic N. eutropha as described herein (e.g., strain D23) for use in treating a disease associated with low nitrite levels. Likewise, the present disclosure provides a use of optionally axenic N. eutropha as described herein (e.g., strain D23) in the manufacture of a topical medicament for treating a disease associated with low nitrite levels.
The present disclosure also provides a method of treating or preventing a skin disorder or skin infection, comprising topically administering to a subject in need thereof a therapeutically effective dose of optionally axenic N. eutropha bacteria as described herein (e.g., strain D23). Similarly, the present disclosure provides optionally axenic N. eutropha as described herein (e.g., strain D23) for use in treating a skin disorder in a subject. Likewise, the present disclosure provides a use of optionally axenic N. eutropha as described herein (e.g., strain D23) in the manufacture of a medicament for treating skin disorder. In embodiments, the skin disorder is acne, rosacea, eczema, psoriasis, or urticaria; the skin infection is impetigo.
While not wishing to be bound by theory, it is proposed that treatment of acne with a therapeutically effective dose of optionally axenic N. eutropha bacteria as described herein (e.g., strain D23) may involve the downregulation of inflammation due to NO generation; and/or limiting and/or inhibiting the spread and proliferation of Propionibacterium acnes associated with acne vulgaris through acidified nitrite and NO production.
For instance, the disclosure provides uses, for treating a condition or disease (e.g., inhibiting microbial growth on a subject's skin), a composition of ammonia oxidizing bacteria. In embodiments, the ammonia oxidizing bacteria may be used to treat, e.g., chronic wounds, acne, rosacea, eczema, psoriasis, uticaria, skin infections, or diabetic ulcers, e.g., diabetic foot ulcers.
The systems and methods of the present disclosure may provide for, or contain contents, to be useful for treating or preventing a skin disorder, treating or preventing a disease or condition associated with low nitrite levels, a treating or preventing body odor, treating to supply nitric oxide to a subject, or treating to inhibit microbial growth.
The systems and methods of the present disclosure may provide for reducing an amount of undesirable bacteria from an environment, e.g., a surface of a subject.
The systems and methods of the present disclosure may provide for, or contain contents, to be useful in a treatment of at least one of HIV dermatitis, infection in a diabetic foot ulcer, atopic dermatitis, acne, eczema, contact dermatitis, allergic reaction, psoriasis, uticaria, rosacea, skin infections, vascular disease, vaginal yeast infection, a sexually transmitted disease, heart disease, atherosclerosis, baldness, leg ulcers secondary to diabetes or confinement to bed, angina, particularly chronic, stable angina pectoris, ischemic diseases, congestive heart failure, myocardial infarction, ischemia reperfusion injury, laminitis, hypertension, hypertrophic organ degeneration, Raynaud's phenomenon, fibrosis, fibrotic organ degeneration, allergies, autoimmune sensitization, end stage renal disease, obesity, impotence, pneumonia, primary immunodeficiency, epidermal lysis bulosa, or cancer.
The systems and methods of the present disclosure may provide for, or contain contents, to be useful in a treatment of at least one of acne, eczema, psoriasis, uticaria, rosacea, skin infections and wounds, e.g., an infected wound.
In some embodiments, ammonia oxidizing bacteria may be used to treat a subject. Subjects may include an animal, a mammal, a human, a non-human animal, a livestock animal, or a companion animal.
In some embodiments, ammonia oxidizing bacteria described herein are used to inhibit the growth of other organisms. For instance, ammonia oxidizing bacteria may be well-adapted for long-term colonization of human skin, and in some embodiments it out-competes other bacteria that are undesirable on the skin. Undesirable skin bacteria include, e.g., those that can infect wounds, raise the risk or severity of a disease, or produce odors. Undesirable bacteria may be referred to as pathogenic bacteria. Certain undesirable skin bacteria include Staphylococcus aureus (S. aureus), e.g., methicillin resistant Staphylococcus aureus Pseudomonas aeruginosa (P. aeruginosa), Streptococcus pyogenes (S. pyogenes), Acinetobacter baumannii (A. baumannii), Propionibacteria, and Stenotrophomonas. The ammonia oxidizing bacteria described herein may out-compete other organisms by, e.g., consuming scarce nutrients, or generating byproducts that are harmful to other organisms, e.g., changing the pH of the skin to a level that is not conducive to the undesirable organism's growth.
Accordingly, the present disclosure provides, inter alia, a method of inhibiting microbial growth on a subject's skin, comprising topically administering to a human in need thereof an effective dose of ammonia oxidizing bacteria as described herein. Similarly, the present disclosure provides ammonia oxidizing bacteria as described herein for use in inhibiting microbial growth on a subject's skin. Likewise, the present disclosure provides a use of ammonia oxidizing bacteria in the manufacture of a medicament for inhibiting microbial growth on a subject's skin.
The present disclosure provides, inter alia, a method of changing a composition of a skin microbiome, e.g., modulating a composition of a skin microbiome, e.g., modulating or changing the proportions of the skin microbiome, in an environment, e.g., a surface, e.g., a surface of a subject. The method may comprise administering, e.g., applying, a preparation comprising ammonia oxidizing bacteria to an environment, e.g., a surface, e.g., a surface of a subject. In some embodiments, the amount and frequency of administration, e.g., application, may be sufficient to reduce the proportion of pathogenic bacteria on the surface of the skin. In some embodiments, the subject may be selected on the basis of the subject being in need of a reduction in the proportion of pathogenic bacteria on the surface of the skin.
The present disclosure may further provide obtaining a sample from the surface of the skin, and isolating DNA of bacteria in the sample. Sequencing of the DNA of bacteria in the sample may also be performed to determine or monitor the amount or proportion of bacteria in a sample of a subject.
The present disclosure may also provide for increasing the proportion of non-pathogenic bacteria on the surface. In some embodiments, the non-pathogenic bacteria may be commensal non-pathogenic bacteria. In some embodiments, the non-pathogenic bacteria may be of the Staphylococcus genus. In some embodiments, the non-pathogenic bacteria may be Staphylococcus epidermidis. In some embodiments, the non-pathogenic bacteria that is increased in proportion may be of the Staphylococcus genus, comprising at least about 10%, 15%, 20%, 25%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% Staphylococcus epidermidis.
The increase in the proportion of non-pathogenic bacteria may occur with a pre-determined period of time, e.g., in less than 1 day, 2 days, 3 days, 4 days, 5 days, 1 week, 2 weeks, 3 weeks, or 4 weeks, or in less than 1-3, 3-5, 5-7, 7-9, 5-10, 10-14, 12-18, 12-21, 21-28, 28-35, 35-42, 42-49, 49-56, 46-63, 63-70, 70-77, 77-84, 84-91 days.
The increase in the proportion of Staphylococcus bacteria, e.g., Staphylococcus epidermidis, may be observed in less than about 3 weeks, e.g., about 16 days, e.g., about 2 weeks.
The present disclosure may provide for decreasing the proportion of pathogenic bacteria, e.g., potentially pathogenic bacteria, e.g., disease-associated bacteria on the surface. In some embodiments, the pathogenic bacteria may be Propionibacteria. In some embodiments, the pathogenic bacteria may be Stenotrophomonas.
The decrease in the proportion of pathogenic bacteria may occur with a pre-determined period of time, e.g., in less than 1 day, 2 days, 3 days, 4 days, 5 days, 1 week, 2 weeks, 3 weeks, or 4 weeks, or in less than 1-3, 3-5, 5-7, 7-9, 5-10, 10-14, 12-18, 12-21, 21-28, 28-35, 35-42, 42-49, 49-56, 46-63, 63-70, 70-77, 77-84, 84-91 days.
The decrease in the proportion of Propionibacteria bacteria and/or Stenotrophomonas may be observed in less than about 3 weeks, e.g., about 16 days, e.g., about 2 weeks.
The present disclosure also provides a method of supplying nitric oxide to a subject, comprising positioning an effective dose of ammonia oxidizing bacteria described herein in close proximity to the subject. Similarly, the present disclosure provides ammonia oxidizing bacteria as described herein for use in supplying nitric oxide to a subject. Likewise, the present disclosure provides a use of in the manufacture of a medicament or composition suitable for position in close proximity to a subject.
The present disclosure also provides a method of reducing body odor, comprising topically administering to a subject in need thereof an effective dose of ammonia oxidizing bacteria described herein. Similarly, the present disclosure provides ammonia oxidizing bacteria as described herein for use in reducing body odor in a subject. Likewise, the present disclosure provides a use of ammonia oxidizing bacteria as described herein in the manufacture of a medicament or composition for reducing body odor.
The present disclosure also provides a method of treating or preventing a disease associated with low nitrite levels, comprising topically administering to a subject in need thereof a therapeutically effective dose of ammonia oxidizing bacteria described herein. Similarly, the present disclosure provides a topical formulation of ammonia oxidizing bacteria as described herein for use in treating a disease associated with low nitrite levels. Likewise, the present disclosure provides a use of ammonia oxidizing bacteria as described herein in the manufacture of a topical medicament for treating a disease associated with low nitrite levels.
The present disclosure also provides a method of treating or preventing a skin disorder or skin infection, comprising topically administering to a subject in need thereof a therapeutically effective dose of ammonia oxidizing bacteria as described herein. Similarly, the present disclosure provides ammonia oxidizing bacteria as described herein for use in treating a skin disorder in a subject. Likewise, the present disclosure provides a use of ammonia oxidizing bacteria as described herein in the manufacture of a medicament for treating skin disorder. In embodiments, the skin disorder is acne, rosacea, eczema, psoriasis, or urticaria; the skin infection is impetigo.
While not wishing to be bound by theory, it is proposed that treatment of rosacea with a therapeutically effective dose of optionally axenic N. eutropha bacteria as described herein (e.g., strain D23) may involve downregulation due to NO generation. This may be due to expression of Kazal-type KLK5/KLK7 inhibitor(s) that may reduce formation of the human cathelicidin peptide LL-37 from its precursor propeptide hCAP18.
While not wishing to be bound by theory, it is proposed that treatment of eczema and/or atopic dermatitis with a therapeutically effective dose of optionally axenic N. eutropha bacteria as described herein (e.g., strain D23) may involve downregulation of inflammation due to NO generation; and/or limiting and/or inhibiting the spread and proliferation of S. aureus and other skin pathogens often associated with very high colonization rates and skin loads in atopic dermatitis through acidified nitrite and NO production.
While not wishing to be bound by theory, it is proposed that treatment of psoriasis with a therapeutically effective dose of optionally axenic N. eutropha bacteria as described herein (e.g., strain D23) may involve downregulation of inflammation due to NO generation and reduction in formation of human cathelicidin peptide LL-37.
While not wishing to be bound by theory, it is proposed that treatment of psoriasis with a therapeutically effective dose of optionally axenic N. eutropha bacteria as described herein (e.g., strain D23) may involve downregulation of inflammation due to NO generation.
While not wishing to be bound by theory, it is proposed that treatment of impetigo or other skin and soft tissue infections with a therapeutically effective dose of optionally axenic N. eutropha bacteria as described herein (e.g., strain D23) may involve limiting and/or inhibiting the spread and proliferation of S. aureus and S. pyogenes.
The present disclosure also provides a method of promoting wound healing, comprising administering to a wound an effective dose of optionally axenic N. eutropha bacteria as described herein (e.g., strain D23). Similarly, the present disclosure provides optionally axenic N. eutropha as described herein (e.g., strain D23) for use in treating a wound. Likewise, the present disclosure provides a use of optionally axenic N. eutropha as described herein (e.g., strain D23) in the manufacture of a medicament or a composition for treating a wound.
Optionally axenic N. eutropha as described herein (e.g., strain D23) may be used to promote wound healing in a patient that has an impaired healing ability, e.g., a diabetic patient.
In some embodiments, this disclosure provides methods of using optionally axenic N. eutropha as described herein (e.g., strain D23) to prevent a disease or disorder, e.g., a skin disorder. Prevention, in certain embodiments, means reducing the risk of a subject developing a disease, compared to a similar untreated subject. The risk need not be reduced to zero.
Individuals having a reduced bathing frequency, such as astronauts, submarine crew members, military personnel during a campaign, civilian workers in remote locations, refugees, bedridden individuals and many others may maintain healthier skin by maintaining N. eutropha on the skin. With regard to bedridden individuals, the N. eutropha in some embodiments reduces the frequency or severity of bed sores by augmenting inadequate circulation.
It is appreciated that many modern degenerative diseases may be caused by a lack of NO species, and that AOB on the external skin can supply those species by diffusion, and that application of AOB to the skin resolves long standing medical conditions. In certain embodiments, AOB are applied to a subject to offset modern bathing practices, especially with anionic detergents remove AOB from the external skin.
One suitable method of topical application to apply sufficient N. eutropha and then wear sufficient clothing so as to induce sweating. However, many people will want to derive the benefits of AOB while maintaining their current bathing habits, in which case, a culture of the bacteria can be applied along with sufficient substrate for them to produce NO. A nutrient solution approximating the inorganic composition of human sweat can be used for this purpose. Using bacteria adapted to media approximating human sweat minimizes the time for them to adapt when applied. Since sweat evaporates once excreted onto the skin surface, using a culture media that has a higher ionic strength is desirable. A concentration approximately twice that of human sweat is suitable, but other conditions are also contemplated. AOB's nutritional needs are typically met with NH3 or urea, O2, CO2, and minerals. In some embodiments, the substrate comprises trace minerals including iron, copper, zinc, cobalt, molybdenum, manganese, sodium, potassium, calcium, magnesium, chloride, phosphate, sulfate, or any combination thereof.
In some embodiments, the present disclosure provides a method of treating a wound by applying a bandage comprising N. eutropha to the wound. Also provided are methods of producing such a bandage. The bandage may comprise, for example, an adhesive portion to affix the bandage to undamaged skin near the wound and a soft, flexible portion to cover or overlay the wound. In some embodiments, the bandage contains no other organisms but N. eutropha. The bandage may be made of a permeable material that allows gasses like oxygen and carbon dioxide to reach the N. eutropha when the bandage is applied to the wound. In certain embodiments, the bandage comprises nutrients for N. eutropha such as ammonium, ammonia, urea, or trace minerals. In certain embodiments, the bandage comprises an antibiotic to which the N. eutropha is resistant. The antibiotic resistance may arise from one or more endogenous resistance gene or from one or more transgenic.
In some embodiments, the N. eutropha is administered at a dose of about 108-109 CFU, 109-1010 CFU, 1010-1011 CFU, or 1011-1012 CFU per application. In some embodiments, the N. eutropha is administered topically at a dose of about 1010-1011 CFU, e.g., about 1×1010-5×1010, 1×1010-3×1010, or 1×1010-2×1010 CFU.
In some embodiments, the N. eutropha is administered in a volume of about 1-2, 2-5, 5-10, 10-15, 12-18, 15-20, 20-25, or 25-50 ml per dose. In some embodiments, the solution is at a concentration of about 108-109, 109-1010, or 1010-1011 CFUs/ml. In some embodiments, the N. eutropha is administered as two 15 ml doses per day, where each dose is at a concentration of 109 CFU/ml.
In some embodiments, ammonia oxidizing bacteria, e.g., the N. eutropha is administered once, twice, three, or four times per day. In some embodiments, ammonia oxidizing bacteria, e.g., the N. eutropha is administered once, twice, three, four, five, or six times per week. In some embodiments, ammonia oxidizing bacteria, e.g., the N. eutropha is administered shortly after bathing. In some embodiments, ammonia oxidizing bacteria, e.g., the N. eutropha is administered shortly before sleep.
In certain aspects, the present disclosure provides combination therapies comprising ammonia oxidizing bacteria, e.g., a N. eutropha and a second therapeutic. For instance, the disclosure provides physical admixtures of the two (or more) therapies are physically admixed. In other embodiments, the two (or more) therapies are administered in combination as separate formulation. The second therapy may be, e.g., a pharmaceutical agent, surgery, or any other medical approach that treats the relevant disease or disorder. The following paragraphs describe combination therapies capable of treating diabetic ulcers, chronic wounds, acne, rosacea, eczema, and psoriasis.
For instance, in a combination therapy capable of treating diabetic ulcers, the second therapy may comprise, e.g., a wound dressing (e.g., absorptive fillers, hydrogel dressings, or hydrocolloids), angiotensin, angiotensin analogues, platelet-rich fibrin therapy, hyperbaric oxygen therapy, negative pressure wound therapy, debridement, drainage, arterial revascularization, hyperbaric oxygen therapy, low level laser therapy, and gastrocnemius recession. The combination therapy may comprise one or more of the above-mentioned treatments.
In a combination therapy capable of treating chronic wounds, the second therapy may comprise, e.g., an antibiotic (e.g., topical or systemic, and bacteriocidal or bacteriostatic) such as Penicillins, cephalosporins, polymyxins, rifamycins, lipiarmycins, quinolones, sulfonamides, macrolides, lincosamides, tetracyclines, cyclic lipopeptides, glycylcyclines, oxazolidinones, and lipiarmycins; angiotensin, angiotensin analogues; debridement; drainage; wound irrigation; negative pressure wound therapy; application of heat; arterial revascularization; hyperbaric oxygen therapy; antioxidants such as ascorbic acid, glutathione, lipoic acid, carotenes, α-tocopherol, or ubiquinol; low level laser therapy; gastrocnemius recession; growth factors such as vascular endothelial growth factor, insulin-like growth factor 1-2, platelet derived growth factor, transforming growth factor-β, or epidermal growth factor; application of autologous platelets such as those that secrete one or more growth factors such as vascular endothelial growth factor, insulin-like growth factor 1-2, platelet derived growth factor, transforming growth factor-β, or epidermal growth factor; implantation of cultured keratinocytes; allograft; collagen, for instance a dressing comprising collagen; or protease inhibitors such as SLPI. The combination therapy may comprise one or more of the above-mentioned treatments.
In a combination therapy capable of treating acne, the second therapy may comprise, e.g., a medication (e.g., systemic or topical) such as Benzoyl peroxide, antibiotics (such as erythromycin, clindamycin, or a tetracycline), Salicylic acid, hormones (e.g., comprising a progestin such as desogestrel, norgestimate or drospirenone), retinoids such as tretinoin, adapalene, tazarotene, or isotretinoin. The second therapy may also be a procedure such as comedo extraction, corticosteroid injection, or surgical lancing. The combination therapy may comprise one or more of the above-mentioned treatments.
In a combination therapy capable of treating rosacea, the second therapy may comprise, e.g., an antibiotic, e.g., an oral tetracycline antibiotic such as tetracycline, doxycycline, or minocycline, or a topical antibiotic such as metronidazole; azelaic acid; alpha-hydroxy acid; isotretinoin can be prescribed; sandalwood oil; clonidine; beta-blockers such as nadolol and propranolol; antihistamines (such as loratadine); mirtazapine; methylsulfonylmethane or silymarin, optionally in combination with each other; lasers such as dermatological vascular laser or CO2 laser; or light therapies such as intense pulsed light, low-level light therapy or photorejuvenation. The combination therapy may comprise one or more of the above-mentioned treatments.
In a combination therapy capable of treating eczema, the second therapy may comprise, e.g., a corticosteroid such as hydrocortisone or clobetasol propionate, immunosuppressants (topical or systemic) such as pimecrolimus, tacrolimus, ciclosporin, azathioprine or methotrexate, or light therapy such as with ultraviolet light. The combination therapy may comprise one or more of the above-mentioned treatments.
In a combination therapy capable of treating psoriasis, the second therapy may comprise, e.g., a corticosteroid such as desoximetasone; a retinoid; coal tar; Vitamin D or an analogue thereof such as paricalcitol or calcipotriol; moisturizers and emollients such as mineral oil, vaseline, calcipotriol, decubal, or coconut oil; dithranol; or fluocinonide. The combination therapy may comprise one or more of the above-mentioned treatments.
While not wishing to be bound by theory, it is proposed that treatment of psoriasis with a therapeutically effective dose of ammonia oxidizing bacteria described herein may involve downregulation of inflammation due to NO generation and reduction in formation of human cathelicidin peptide LL-37.
While not wishing to be bound by theory, it is proposed that treatment of psoriasis with a therapeutically effective dose of ammonia oxidizing bacteria as described herein may involve downregulation of inflammation due to NO generation.
While not wishing to be bound by theory, it is proposed that treatment of impetigo or other skin and soft tissue infections with a therapeutically effective dose of ammonia oxidizing bacteria as described herein may involve limiting and/or inhibiting the spread and proliferation of Staphylococcus aureus (S. aureus), e.g., methicillin resistant Staphylococcus aureus, Pseudomonas aeruginosa (P. aeruginosa), Streptococcus pyogenes (S. pyogenes), Acinetobacter baumannii (A. baumannii), Propionibacteria, and Stenotrophomonas.
The present disclosure also provides a method of promoting wound healing, comprising administering to a wound an effective dose of ammonia oxidizing bacteria as described herein. Similarly, the present disclosure provides ammonia oxidizing bacteria as described herein for use in treating a wound. Likewise, the present disclosure provides a use of ammonia oxidizing bacteria as described herein in the manufacture of a medicament or a composition for treating a wound.
Ammonia oxidizing bacteria as described herein may be used to promote wound healing in a patient that has an impaired healing ability, e.g., a diabetic patient.
In some embodiments, this disclosure provides methods of using ammonia oxidizing bacteria as described herein to prevent a disease or disorder, e.g., a skin disorder. Prevention, in certain embodiments, means reducing the risk of a subject developing a disease, compared to a similar untreated subject. The risk need not be reduced to zero.
Individuals having a reduced bathing frequency, such as astronauts, submarine crew members, military personnel during a campaign, civilian workers in remote locations, refugees, bedridden individuals and many others may maintain healthier skin by maintaining ammonia oxidizing bacteria on the skin. With regard to bedridden individuals, the ammonia oxidizing bacteria in some embodiments reduces the frequency or severity of bed sores by augmenting inadequate circulation.
It is appreciated that many modern degenerative diseases may be caused by a lack of NO species, and that ammonia oxidizing bacteria on the external skin can supply those species by diffusion, and that application of ammonia oxidizing bacteria to the skin resolves long standing medical conditions. In certain embodiments, ammonia oxidizing bacteria are applied to a subject to offset modern bathing practices, especially with anionic detergents remove ammonia oxidizing bacteria from the external skin.
One suitable method of topical application to apply sufficient ammonia oxidizing bacteria and then wear sufficient clothing so as to induce sweating. However, many people will want to derive the benefits of ammonia oxidizing bacteria while maintaining their current bathing habits, in which case, a culture of the bacteria can be applied along with sufficient substrate for them to produce NO. A nutrient solution approximating the inorganic composition of human sweat can be used for this purpose. Using bacteria adapted to media approximating human sweat minimizes the time for them to adapt when applied. Since sweat evaporates once excreted onto the skin surface, using a culture media that has a higher ionic strength is desirable. A concentration approximately twice that of human sweat is suitable, but other conditions are also contemplated. Ammonia oxidizing bacteria's nutritional needs are typically met with NH3 or urea, O2, CO2, and minerals. In some embodiments, the substrate comprises trace minerals including iron, copper, zinc, cobalt, molybdenum, manganese, sodium, potassium, calcium, magnesium, chloride, phosphate, sulfate, or any combination thereof.
In some embodiments, the present disclosure provides a method of treating a wound by applying a bandage comprising ammonia oxidizing bacteria to the wound. Also provided are methods of producing such a bandage. The bandage may comprise, for example, an adhesive portion to affix the bandage to undamaged skin near the wound and a soft, flexible portion to cover or overlay the wound. In some embodiments, the bandage contains no other organisms but ammonia oxidizing bacteria. The bandage may made of a permeable material that allows gasses like oxygen and carbon dioxide to reach the ammonia oxidizing bacteria when the bandage is applied to the wound. In certain embodiments, the bandage comprises nutrients for ammonia oxidizing bacteria such as ammonium, ammonia, urea, or trace minerals. In certain embodiments, the bandage comprises an antibiotic to which the ammonia oxidizing bacteria is resistant. The antibiotic resistance may arise from one or more endogenous resistance gene or from one or more transgenes.
In some embodiments, the ammonia oxidizing bacteria, e.g., a preparation of ammonia oxidizing bacteria, is administered at a dose of about 108-109 CFU, 109-1010 CFU, 1010-1011 CFU, or 1011-1012 CFU per application or per day. In some embodiments, the ammonia oxidizing bacteria is administered topically at a dose of about 109-1010 CFU, e.g., about 1×109-5×109, 1×109-3×109, or 1×109-10×109 CFU.
In some embodiments, the ammonia oxidizing bacteria is administered in a volume of about 1-2, 2-5, 5-10, 10-15, 12-18, 15-20, 20-25, or 25-50 ml per dose. In some embodiments, the solution is at a concentration of about 108-109, 109-1010, or 1010-1011 CFU/ml. In some embodiments, the ammonia oxidizing bacteria is administered as two 15 ml doses per day, where each dose is at a concentration of 109 CFU/ml.
In some embodiments, the ammonia oxidizing bacteria is administered once, twice, three, or four times per day. In some embodiments, the ammonia oxidizing bacteria is administered once, twice, three, four, five, or six times per week. In some embodiments, the ammonia oxidizing bacteria is administered shortly after bathing. In some embodiments, the ammonia oxidizing bacteria is administered shortly before sleep.
In some embodiments, the ammonia oxidizing bacteria is administered for about 1-3, 3-5, 5-7, 7-9, 5-10, 10-14, 12-18, 12-21, 21-28, 28-35, 35-42, 42-49, 49-56, 46-63, 63-70, 70-77, 77-84, 84-91 days, e.g., for about 1 month, for about 2 months, for about 3 months. In some embodiments, the ammonia oxidizing bacteria is administered for an indefinite period of time, e.g., greater than one year, greater than 5 years, greater than 10 years, greater than 15 years, greater than 30 years, greater than 50 years, greater than 75 years.
Treatments comprising ammonia oxidizing bacteria as described herein (optionally in combination with another therapy) can be refined using a number of model systems. These model systems can be used to determine suitable doses and timing of administration.
For instance, with respect to chronic wounds and diabetic ulcers, one may use the mouse skin puncture model. Other models for these disorders include controlled cutaneous ischemia in a guinea pig model, rabbit ear ulcer model, application of calcium to a wound, or topical application of doxorubicin.
With respect to acne, one may use (for example) the Mexican hairless dog model, the Rhino mouse model, or the rabbit ear assay. With respect to rosacea, one may use (for example) intradermal injection of LL-37 into mouse skin or the Syrian hamster model. With respect to eczema, one may use (for example) application of a crude extract of Dermatophagoides farina, application of dinitrochlorobenzene to the ears of sensitized guinea pigs, or NC/Nga mice. With respect to psoriasis, one may use (for example) xenograft models in which involved and uninvolved psoriatic skin are transplanted onto immunodeficient mice, application of an antibody directed against interleukin 15 to the skin of SCID mice, and the Sharpincpdm/Sharpincpdm mouse model.
Treatments comprising ammonia oxidizing bacteria, e.g., N. eutropha as described herein (e.g., strain D23) (optionally in combination with another therapy) can be refined using a number of model systems. These model systems can be used to determine suitable doses and timing of administration.
For instance, with respect to chronic wounds and diabetic ulcers, one may use the mouse skin puncture model described herein in Example 6. Other models for these disorders include controlled cutaneous ischemia in a guinea pig model, rabbit ear ulcer model, application of calcium to a wound, or topical application of doxorubicin.
With respect to acne, one may use (for example) the Mexican Hairless Dog model, the Rhino mouse model, or the rabbit ear assay. With respect to rosacea, one may use (for example) intradermal injection of LL-37 into mouse skin or the Syrian hamster model. With respect to eczema, one may use (for example) application of a crude extract of Dermatophagoides farina, application of dinitrochlorobenzene to the ears of sensitized guinea pigs, or NC/Nga mice. With respect to psoriasis, one may use (for example) xenograft models in which involved and uninvolved psoriatic skin are transplanted onto immunodeficient mice, application of an antibody directed against interleukin 15 to the skin of SCID mice, and the Sharpincpdm/Sharpincpdm mouse model.
While not wishing to be bound by theory, it is believed that one or more of the following mechanisms contributes to the beneficial effect of ammonia oxidizing bacteria, e.g., N. eutropha in treating the diseases and conditions discussed herein. Additional mechanistic details are found in International Application WO/2005/030147, which is herein incorporated by reference in its entirety.
In order to understand the beneficial aspects of these bacteria, it is helpful to understand angiogenesis. All body cells, except those within a few hundred microns of the external air, receive all metabolic oxygen from the blood supply. The oxygen is absorbed by the blood in the lung, is carried by red blood cells as oxygenated hemoglobin to the peripheral tissues, where it is exchanged for carbon dioxide, which is carried back and exhaled from the lung. Oxygen must diffuse from the erythrocyte, through the plasma, through the endothelium and through the various tissues until it reached the mitochondria in the cell which consumes it. The human body contains about 5 liters of blood, so the volume of the circulatory system is small compared to that of the body. Oxygen is not actively transported. It passively diffuses down a concentration gradient from the air to the erythrocyte, from the erythrocyte to the cell, and from the cell to cytochrome oxidase where it is consumed. The concentration of oxygen at the site of consumption is the lowest in the body, and the O2 flux is determined by the diffusion resistance and the concentration gradient. Achieving sufficient oxygen supply to all the peripheral tissues requires exquisite control of capillary size and location. If the spacing between capillaries were increased, achieving the same flux of oxygen would require a larger concentration difference and hence a lower O2 concentration at cytochrome oxidase. With more cells between capillaries, the O2 demand would be greater. If the spacing between capillaries were decreased, there would be less space available for the cells that perform the metabolic function of the organ.
In certain aspects, it is appreciated that NO from ammonia oxidizing bacteria is readily absorbed by the outer skin and converted into S-nitrosothiols since the outer skin is free from hemoglobin. M. Stucker et al. have shown that the external skin receives all of its oxygen from the external air in “The cutaneous uptake of atmospheric oxygen contributes significantly to the oxygen supply of human dermis and epidermis. (Journal of Physiology (2002), 538.3, pp. 985-994.) This is readily apparent, because the external skin can be seen to be essentially erythrocyte free. There is circulation of plasma through these layers because they are living and do require the other nutrients in blood, just not the oxygen. S-nitrosothiols formed are stable, can diffuse throughout the body, and constitute a volume source of authentic NO and a source of NO to transnitrosate protein thiols.
In some aspects, it is appreciated that capillary rarefaction may be one of the first indications of insufficient levels of NO. F. T. Tarek et al. have shown that sparse capillaries, or capillary rarefaction, is commonly seen in people with essential hypertension. (Structural Skin Capillary Rarefaction in Essential Hypertension. Hypertension. 1999; 33:998-1001
A great many conditions are associated with the capillary density becoming sparser. Hypertension is one, and researchers reported that sparse capillaries are also seen in the children of people with essential hypertension, and also in people with diabetes. Significant complications of diabetes are hypertension, diabetic nephropathy, diabetic retinopathy, and diabetic neuropathy. R. Candido et al. have found that the last two conditions are characterized by a reduction in blood flow to the affected areas prior to observed symptoms. (Haemodynamics in microvascular complications in type 1 diabetes. Diabetes Metab Res Rev 2002; 18: 286-304.) Reduced capillary density is associated with obesity, and simple weight loss increases capillary density as shown by A Philip et al. in “Effect of Weight Loss on Muscle Fiber Type, Fiber Size, Capilarity, and Succinate Dehydrogenase Activity in Humans. The Journal of Clinical Endocrinology & Metabolism Vol. 84, No. 11 4185-4190, 1999.
Researchers have shown that in primary Raynaud's phenomena (PRP), the nailfold capillaries are sparser (slightly) than in normal controls, and more abundant than in patients that have progressed to systemic sclerosis (SSc). M. Bukhari, Increased Nailfold Capillary Dimensions In Primary Raynaud's Phenomenon And Systemic Sclerosis. British Journal of Rheumatology, Vol. 24 No 35: 1127-1131, 1996. They found that the capillary density decreased from 35 loops/mm2 (normal controls) to 33 (PRP), to 17 (SSc). The average distance between capillary limbs was 18μ, 18μ, and 30μ for controls, PRP and SSc, respectively.
In certain aspects, it is appreciated that the mechanism that the body normally uses to sense “hypoxia” may affect the body's system that regulates capillary density. According to this aspect of the invention, a significant component of “hypoxia” is sensed, not by a decrease in O2 levels, but rather by an increase in NO levels. Lowering of basal NO levels interferes with this “hypoxia” sensing, and so affects many bodily functions regulated through “hypoxia.” For Example, anemia is commonly defined as “not enough hemoglobin,” and one consequence of not enough hemoglobin is “hypoxia”, which is defined as “not enough oxygen.” According to some aspects, these common definitions do not account for the nitric oxide mediated aspects of both conditions.
At rest, acute isovolemic anemia is well tolerated. A ⅔ reduction in hematocrit has minimal effect on venous return PvO2, indicating no reduction in either O2 tension or delivery throughout the entire body. Weiskopf et al. Human cardiovascular and metabolic response to acute, severe isovolemic anemia. JAMA 1998, vol 279, No. 3, 217-221. At 50% reduction (from 140 to 70 g Hb/L), the average PvO2 (over 32 subjects) declined from about 77% to about 74% (of saturation). The reduction in O2 capacity of the blood is compensated for by vasodilatation and tachycardia with the heart rate increasing from 63 to 85 bpm. That the compensation is effective is readily apparent, however, the mechanism is not. A typical explanation is that “hypoxia” sensors detected “hypoxia” and compensated with vasodilatation and tachycardia. However, there was no “hypoxia” to detect. There was a slight decrease in blood lactate (a marker for anaerobic respiration) from 0.77 to 0.62 mM/L indicating less anaerobic respiration and less “hypoxia.” The 3% reduction in venous return PvO2 is the same level of “hypoxia” one would get by ascending 300 meters in altitude (which typically does not produce tachycardia). With the O2 concentration in the venous return staying the same, and the O2 consumption staying the same, there is no place in the body where there is a reduction in O2 concentration. Compensation during isovolemic anemia may not occur because of O2 sensing.
Thus the vasodilatation that is observed in acute isovolemic anemia may be due to the increased NO concentration at the vessel wall. NO mediates dilatation of vessels in response to shear stress and other factors. No change in levels of NO metabolites would be observed, because the production rate of NO is unchanged and continues to equal the destruction rate. The observation of no “hypoxic” compensation with metHb substitution can be understood because metHb binds NO just as Hb does, so there is no NO concentration increase with metHb substitution as there is with Hb withdrawal.
Nitric oxide plays a role in many metabolic pathways. It has been suggested that a basal level of NO exerts a tonal inhibitory response, and that reduction of this basal level leads to a dis-inhibition of those pathways. Zanzinger et al. have reported that NO has been shown to inhibit basal sympathetic tone and attenuate excitatory reflexes. (Inhibition of basal and reflex-mediated sympathetic activity in the RVLM by nitric oxide. Am. J. Physiol. 268 (Regulatory Integrative Comp. Physiol. 37): R958-R962, 1995.)
In some aspects, it is appreciated that one component of a volume source of NO is low molecular weight S-nitrosothiols produced in the erythrocyte free skin from NO produced on the external skin by ammonia oxidizing bacteria. These low molecular weight S-nitrosothiols are stable for long periods, and can diffuse and circulate freely in the plasma. Various enzymes can cleave the NO from various S-nitrosothiols liberating NO at the enzyme site. It is the loss of this volume source of NO from AOB on the skin that leads to disruptions in normal physiology. The advantage to the body of using S-nitrosothiols to generate NO far from a capillary is that O2 is not required for NO production from S-nitrosothiols. Production of NO from nitric oxide synthase (NOS) does require O2. With a sufficient background of S-nitrosothiols, NO can be generated even in anoxic regions. Free NO is not needed either since NO only exerts effects when attached to another molecule, such as the thiol of a cysteine residue or the iron in a heme, so the effects of NO can be mediated by transnitrosation reactions even in the absence of free NO provided that S-nitrosothiols and transnitrosation enzymes are present.
Frank et al. have shown that the angiogenesis that accompanies normal wound healing is produced in part by elevated VEGF which is induced by increased nitric oxide. (Nitric oxide triggers enhanced induction of vascular endothelial growth factor expression in cultured keratinocytes (HaCaT) and during cutaneous wound repair. FASEB J. 13, 2002-2014 (1999).)
NO has a role in the development of cancer, indicating that the bacteria described herein may be used in methods of cancer treatment and prevention. According to certain aspects, it is appreciated that the presence of NO during hypoxia may prevent cells from dividing while under hypoxic stress, when cells are at greater risk for errors in copying DNA. One relevant cell function is the regulation of the cell cycle. This is the regulatory program which controls how and when the cell replicates DNA, assembles it into duplicate chromosomes, and divides. The regulation of the cell cycle is extremely complex, and is not fully understood. However, it is known that there are many points along the path of the cell cycle where the cycle can be arrested and division halted until conditions for doing so have improved. The p53 tumor suppressor protein is a key protein in the regulation of the cell cycle, and it serves to initiate both cell arrest and apoptosis from diverse cell stress signals including DNA damage and p53 is mutated in over half of human cancers as reported by Ashcroft et al. in “Stress Signals Utilize Multiple Pathways To Stabilize p53.” (Molecular And Cellular Biology, May 2000, p. 3224-3233.) Hypoxia does initiate accumulation of p53, and while hypoxia is important in regulating the cell cycle, hypoxia alone fails to induce the downstream expression of p53 mRNA effector proteins and so fails to cause arrest of the cell cycle. Goda et al. have reported that hypoxic induction of cell arrest requires hypoxia-inducing factor-1 (HIF-1α). (Hypoxia-Inducible Factor 1α Is Essential for Cell Cycle Arrest during Hypoxia. Molecular And Cellular Biology, January 2003, p. 359-369.) Britta et al. have reported that NO is one of the main stimuli for HIF-1α. (Accumulation of HIF-1α under the influence of nitric oxide. Blood, 15 Feb. 2001, Volume 97, Number 4.) In contrast, NO does cause the accumulation of transcriptionally active p53 and does cause arrest of the cell cycle and does cause apoptosis. Wang et al., P53 Activation By Nitric Oxide Involves Down-Regulation Of Mdm2. THE JOURNAL OF BIOLOGICAL CHEMISTRY Vol. 277, No. 18, Issue Of May 3, Pp. 15697-15702, 2002.
In certain aspect of the invention, it is appreciated that preventing the necrotic death of cells by preventing the capillary rarefaction that leads to their hypoxic death may prevent autoimmune disorders. When cells are exposed to chronic hypoxia, the production of reactive oxygen species (ROS) is increased, and there is increased damage to the cells metabolic machinery and ultimately to the cells' DNA. Decreased metabolic capacity will decrease capacity for repair of damage due to ROS and due to exogenous carcinogen exposure. Over time, the damage accumulates and increases the chance of three events: the cell will undergo deletion of cancer-preventing genes and the cell will become cancerous, the cell will die through necrosis, or the cell will die through apoptosis. When cells die, either through necrosis or apoptosis, the cell debris must be cleared from the site. Dead cells are phagocytosed by immune cells, including dendritic cells and macrophages. When these cells phagocytose a body, it is digested by various proteolytic enzymes into antigenic fragments, and then these antigens are attached to the major histocompatibility complex (MHC1, MHC2) and the antigen-MHC complex is moved to the surface of the cell where it can interact with T cells and activate the T cells in various ways. Any cell injury releases adjuvants which stimulate the immune system in various ways. In general, cells that undergo necrosis stimulate a greater immune response than cells that undergo apoptosis. Chronic exposure of immune cells to dead and dying cells is therefore likely to lead to autoimmune disorders.
In certain aspects, it is appreciated that low basal NO leads to fibrotic hypertrophy. Once a dead cell has been cleared, a new cell cannot easily take its place, because there is insufficient O2 to support it. Any such new cell would suffer the same fate. The space can remain empty, in which case the organ shrinks, the capillaries draw closer together, new cells are now deprived of the VEGF formerly produced by the now-missing cell, so capillaries ablate and the hypoxic zone reforms. This could result in a general shrinkage of the affected tissues. In tissues that support fibrosis, relatively inert collagen fibers can fill the space. Since the metabolic requirements of the body for the particular organ in question are not reduced, the organ may attempt to grow larger, but now with a significant fibrous content. This may result in fibrotic hypertrophy, such as of the heart and liver. Some organs, such as the brain, cannot grow larger or smaller because the three-dimensional connectivity of nerves and blood vessels are important, and cannot be continuously and simultaneously mapped onto an asymmetrically shrinking brain. The space must be filled with something, and β-amyloid might be the (not so inert) space filler. The kidney cannot grow larger because of the renal capsule, so the number of living cells becomes smaller and they are replaced with fibrotic tissue. If the dead cells are cleared, the tissue shrinks, and the ratio of NO/O2 goes down again, and the capillaries again become sparser. This may set up the vicious circle of end stage renal disease, congestive heart failure/cardiac hypertrophy, primary biliary cirrhosis, Alzheimer's disease, atherosclerosis, inflammatory bowel disease, hypertrophic scar formation, and the multiple connective tissue diseases starting with Raynaud's phenomena and ending with Systemic Sclerosis and primary Sjogren's syndrome where capillary rarefaction is also observed. Ferrini et al, have shown that a reduction in basal NO levels through chronic inhibition of NOS with L-NAME leads to generalized fibrosis of the heart and kidneys. (Antifibrotic Role of Inducible Nitric Oxide Synthase. Nitric Oxide: Biology and Chemistry Vol. 6, No. 3, pp. 283-294 (2002).) It may be that low basal NO leads to fibrotic hypertrophy.
In certain aspects, it is appreciated that capillary rarefaction affects a subject's ability to control their appetite. Capillary rarefaction is observed in the brains of aged humans and animals. Capillary rarefaction is associated with declines in circulating growth factors including insulin like growth factor-1. Neurogenesis in the adult brain is coordinated with angiogenesis. Since the brain regulates many homeostatic functions, increased diffusion lengths between capillaries to control elements of the brain might be “interpreted” as inadequate blood concentrations of those species. The flux of glucose in the brain is quite close to normal metabolic needs, where glucose flux is only 50 to 75% greater than glucose consumption and the glucose transporters across the blood brain barrier are saturable, stereospecific and independent of energy or ion gradients. A large part of the regulation of appetite is mediated through the brain, and capillary rarefaction may cause an adequate blood concentration of “nutrients” (or marker compounds proportional to “nutrients”) to be interpreted as insufficient. This may be one cause of obesity.
According to certain aspects, it is appreciated that capillary rarefaction may be a cause of non-insulin dependent diabetes. Non-insulin dependent diabetes (NIDDM) is also known as the Metabolic Syndrome or Diabetes type 2, and is characterized by insulin resistance. The sensitivity of the body to insulin is reduced, and insulin levels increase People with NIDDM have high blood glucose, high blood triglycerides, are typically obese, hypertensive, and typically have significant visceral fat.
Other symptoms accompany NIDDM, which may point to capillary rarefaction as the cause. In a study of 40 men, with and without NIDDM, obese (BMI 29) and lean (BMI 24) (10 of each), Konrad et al. report that blood lactate levels at rest were 1.78, 2.26, 2.42, and 2.76 (mM/L) for lean men without, obese men without, lean men with NIDDM, obese men with NIDDM respectively. (A-Lipoic acid treatment decreases serum lactate and pyruvate concentrations and improves glucose effectiveness in lean and obese patients with type 2 diabetes. Diabetes Care 22:280-287, 1999.) Lactate is a measure of anaerobic glycolysis. When O2 is insufficient to generate ATP through oxidative phosphorylation, cells can produce ATP through anaerobic glycolysis. One of the products of anaerobic glycolysis is lactate, which must be exported from the cells, otherwise the pH drops and function is compromised. Blood lactate is commonly measured in exercise studies, where an increase indicates the work load at which maximum oxidative work can be done. Higher levels of lactate at rest would indicate increased anaerobic glycolysis at rest, which is consistent with capillary rarefaction.
Primary biliary cirrhosis is associated with Raynaud's phenomena, pruritus, sicca syndrome, osteoporosis, portal hypertension, neuropathy, and pancreatic insufficiency, and liver abnormalities are associated with rheumatic diseases. Elevated liver enzymes are a symptom of liver inflammation, and elevated liver enzymes are observed as an early symptom of “asymptomatic” primary biliary cirrhosis. Accordingly, the bacteria described herein may be used to treat liver inflammation.
Torre et al have reported that Alzheimer's disease (AD) is a microvascular disorder with neurological degeneration secondary to hypoperfusion, resulting in part from insufficient nitric oxide. (Review: Evidence that Alzheimer's disease is a microvascular disorder: the role of constitutive nitric oxide, Brain Research Reviews 34 (2000) 119-136.) Accordingly, the bacteria described herein may be used to treat AD.
Adverse health effects that are associated with hypertension may also be consequences of low basal NO. The decreased response to vasodilatation is also consistent with low basal NO. NO is a diffusible molecule that diffuses from a source to a sensor site where it has the signaling effect. With low NO levels, every NO source must produce more NO to generate an equivalent NO signal of a certain intensity a certain distance away. NO diffuses in three dimensions and the whole volume within that diffusion range must be raised to the level that will give the proper signal at the sensor location. This may result in higher NO levels at the source and between the source and the sensor. Adverse local effects of elevated NO near a source may then arise from too low a NO background. There is some evidence that this scenario actual occurs. In rat pancreatic islets, Henningsson et al have reported that inhibition of NOS with L-NAME increases total NO production through the induction of iNOS. (Chronic blockade of NO synthase paradoxically increases islet NO production and modulates islet hormone release. Am J Physiol Endocrinol Metab 279: E95-E107, 2000.) Increasing NO by increasing NOS activity will only work up to some limit. When NOS is activated but is not supplied with sufficient tetrahydrobiopterin (BH4) or L-arginine, it becomes “uncoupled” and generates superoxide (O2−) instead of NO. This O2− may then destroy NO. Attempting to produce NO at a rate that exceeds the supply of BH4 or L-arginine may instead decrease NO levels. This may result in positive feedback where low NO levels are made worse by stimulation of NOS, and uncoupled NOS generates significant O2− which causes local reactive oxygen species (ROS) damage such as is observed in atherosclerosis, end stage renal disease, Alzheimer's, and diabetes.
The bacteria described herein may also be used to delay the signs of aging. Caloric restriction extends lifespan, and Holloszy reported that restricting food intake to 70% of ad lib controls, prolongs life in sedentary rats from 858 to 1,051 days, almost 25%. (Mortality rate and longevity of food restricted exercising male rats: a reevaluation. J. Appl. Physiol. 82(2): 399-403, 1997.) The link between calorie restriction and prolonged life is well established, however, the causal mechanism is not. Lopez-Torres et al. reported that the examination of liver mitochondrial enzymes in rats indicates a reduction in H2O2 production due to reduced complex I activity associated with calorie restriction. (Influence Of Aging And Long-Term Caloric Restriction On Oxygen Radical Generation And Oxidative DNA Damage In Rat Liver Mitochondria. Free Radical Biology & Medicine Vol. 32 No 9 pp 882-8899, 2002.) H2O2 is produced by dismutation of O2−, which is a major ROS produced by the mitochondria during respiration. The main source of O2− has been suggested by Kushareva et al. and others to be complex I which catalyzes the NAD/NADH redox couple by reverse flow of electrons from complex III, the site of succinate reduction. The free radical theory, proposed by Beckman, of aging postulates, that free radical damage to cellular DNA, antioxidant systems and DNA repair systems accumulates with age and when critical systems are damaged beyond repair, death ensues. (The Free Radical Theory of Aging Matures. Physiol. Rev. 78: 547-581, 1998.)
As an additional mechanism, NO has been demonstrated by Vasa et al. to activate telomerase and to delay senescence of endothelial cells. (Nitric Oxide Activates Telomerase and Delays Endothelial Cell Senescence. Circ Res. 2000; 87:540-542.) Low basal NO will increase basal metabolic rate by disinhibition of cytochrome oxidase. Increased basal metabolism will also increase cell turn-over and growth rate. Capillary rarefaction, by inducing chronic hypoxia may increase free radical damage and may also increase cell turn-over, and so accelerate aging by both mechanisms.
In some aspects, it is appreciated that autotrophic ammonia-oxidizing bacteria may produce protective aspects for allergies and autoimmune disorders. The best known autoimmune disease is perhaps Diabetes Type 1, which results from the destruction of the insulin producing cells in the pancreas by the immune system. Recurrent pregnancy loss is also associated with autoimmune disorders where the number of positive autoimmune antibodies correlated positively with numbers recurrent pregnancy losses. Systemic Sclerosis, Primary Biliary Cirrhosis, autoimmune hepatitis, and the various rheumatic disorders are other examples of autoimmune disorders. Application of AOB was observed to reduce an allergy, hay fever, as described in WO/2005/030147.
One mechanism by which AOB may exert their protective effect on allergies and autoimmune disorders is through the production of nitric oxide, primarily through the regulatory inhibition of NF-κB and the prevention of activation of immune cells and the induction of inflammatory reactions. NF-κB is a transcription factor that up-regulates gene expression and many of these genes are associated with inflammation and the immune response including genes which cause the release of cytokines, chemokines, and various adhesion factors. These various immune factors cause the migration of immune cells to the site of their release resulting in the inflammation response. Constitutive NO production has been shown to inhibit NF-κB by stabilizing IκBα (an inhibitor of NF-κB) by preventing IκBα degradation.
Administration of an NO donor has been shown by Xu et al. to prevent the development of experimental allergic encephalomyelitis in rats. (SIN-1, a Nitric Oxide Donor, Ameliorates Experimental Allergic Encephalomyelitis in Lewis Rats in the Incipient Phase: The Importance of the Time Window. The Journal of Immunology, 2001, 166: 5810-5816.) In this study, it was demonstrated that administering an NO donor, reduced the infiltration of macrophages into the central nervous system, reduced the proliferation of blood mononuclear cells, and increased apoptosis of blood mononuclear cells. All of these results are expected to reduce the extent and severity of the induced autoimmune response.
Low basal NO may lead to autism via the mechanism that new connections in the brain are insufficiently formed as a result of insufficient basal nitric oxide. While not wishing to be bound in theory, in some embodiments, formation of neural connections is modulated by NO. In these cases, any condition that lowers the range of NO diffusion may decrease the volume size of brain elements that can undergo connections. A brain which developed under conditions of low basal NO levels may be arranged in smaller volume elements because the reduced effective range of NO.
Additional symptoms exhibited in autistic individuals may also point to low NO as a cause, including increased pitch discrimination, gut disturbances, immune system dysfunction, reduced cerebral blood flow, increased glucose consumption of the brain, increased plasma lactate, attachment disorders, and humming. Each of these symptoms may be attributed to a low basal NO level.
Takashi Ohnishi et al. have reported that autistic individuals show decreased blood flow. Takashi Ohnishi et al., Abnormal regional cerebral blood flow in childhood autism. Brain (2000), 123, 1838-1844. J. M. Rumsey et al. have reported that autistic individuals have increased glucose consumption. Rumsey J M, Duara R, Grady C, Rapoport J L, Margolin R A, Rapoport S I, Cutler N R. Brain metabolism in autism. Resting cerebral glucose utilization rates as measured with positron emission tomography. Arch Gen Psychiatry, 1985 May; 42(5):448-55 (abstract). D. C. Chugani has reported that autistic individuals have an increased plasma lactate levels. Chugani D C, et al., Evidence of altered energy metabolism in autistic children. Prog Neuropsychopharmacol Biol Psychiatry. 1999 May; 23(4):635-41. The occurrence of these effects may be a result of capillary rarefaction in the brain, which may reduce blood flow and O2 supply, such that some of the metabolic load of the brain may be produced through glycolysis instead of oxidative phosphorylation.
Nitric oxide has been demonstrated by B. A. Klyachko et al. to increase the excitability of neurons by increasing the after hyperpolarization through cGMP modification of ion channels. Vitaly A. Klyachko et al., cGMP-mediated facilitation in nerve terminals by enhancement of the spike after hyperpolarization. Neuron, Vol. 31, 1015-1025, Sep. 27, 2001. C. Sandie et al. have shown that inhibition of NOS reduces startle. Carmen Sandi et al., Decreased spontaneous motor activity and startle response in nitric oxide synthase inhibitor-treated rats. European journal of pharmacology 277 (1995) 89-97. Attention-Deficit Hyperactivity Disorder (ADHD) has been modeled using the spontaneously hypertensive rat (SHR) and the Naples high-excitability (NHE) rat. Both of these models have been shown by Raffaele Aspide et al, to show increased attention deficits during periods of acute NOS inhibition. Raffaele Aspide et al., Non-selective attention and nitric oxide in putative animal models of attention-deficit hyperactivity disorder. Behavioral Brain Research 95 (1998) 123-133. Accordingly, the bacteria herein may be used in the treatment of ADHD.
Inhibition of NOS has also been shown by M. R. Dzoljic to inhibit sleep. M. R. Dzoljic, R. de Vries, R. van Leeuwen. Sleep and nitric oxide: effects of 7-nitro indazole, inhibitor of brain nitric oxide synthase. Brain Research 718 (1996) 145-150. G. Zoccoli has reported that a number of the physiological effects seen during sleep are altered when NOS is inhibited, including rapid eye movement and sleep-wake differences in cerebral circulation. G. Zoccoli, et al., Nitric oxide inhibition abolishes sleep-wake differences in cerebral circulation. Am. J. Physiol. Heart Circ Physiol 280: H2598-2606, 2001. NO donors have been shown by L. Kapas et al. to promote non-REM sleep, however, these increases persisted much longer than the persistence of the NO donor, suggesting perhaps a rebound effect. Levente Kapas et al. Nitric oxide donors SIN-1 and SNAP promote nonrapid-eye-movement sleep in rats. Brain Research Bullitin, vol 41, No 5, pp. 293-298, 1996. M. Rosaria et al., Central NO facilitates both penile erection and yawning. Maria Rosaria Melis and Antonio Argiolas. Role of central nitric oxide in the control of penile erection and yawning. Prog Neuro-Psychopharmacol & Biol. Phychiat. 1997, vol 21, pp 899-922. P. Tani et al, have reported that insomnia is a frequent finding in adults with Asperger's. Pekka Tani et al., Insomnia is a frequent finding in adults with Asperger's syndrome. BMC Psychiatry 2003, 3:12. Y. Hoshino has also observed sleep disturbances in autistic children. Hoshino Y, Watanabe H, Yashima Y, Kaneko M, Kumashiro H. An investigation on sleep disturbance of autistic children. Folia Psychiatr Neurol Jpn. 1984; 38(1):45-51. (abstract) K. A. Schreck et al. has observed that the severity of sleep disturbances correlates with severity of autistic symptoms. Schreck K A, et al., Sleep problems as possible predictors of intensified symptoms of autism. Res Dev Disabil. 2004 Jan.-Feb.; 25(1):57-66. (abstract). Accordingly, the bacteria herein may be used in the treatment of insomnia.
W. D. Ratnasooriya et al reported that inhibition of NOS in male rats reduces pre-coital activity, reduces libido, and reduces fertility. W. D. Ratnasooriya et al., Reduction in libido and fertility of male rats by administration of the nitric oxide (NO) synthase inhibitor N-nitro-L-arginine methyl ester. International journal of andrology, 23: 187-191 (2000).
It may be that a number of seemingly disparate disorders, characterized by ATP depletion and eventual organ failure are actually “caused” by nitropenia, caused by a global deficiency in basal nitric oxide. When this occurs in the heart, the result is dilative cardiomyopathy. When this occurs in the brain, the result is white matter hyperintensity, Alzheimer's, vascular depression, vascular dementia, Parkinson's, and the Lewy body dementias. When this occurs in the kidney, the result is end stage renal disease, when this occurs in the liver, the result is primary biliary cirrhosis. When this occurs in muscle, the consequence is fibromyaligia, Gulf War Syndrome, or chronic fatigue syndrome. When this occurs in the bowel, the consequence is ischemic bowel disease. When this occurs in the pancreas, the consequence is first type 2 diabetes, followed by chronic inflammation of the pancreas, followed by autoimmune attack of the pancreas (or pancreatic cancer), followed by type 1 diabetes. When this occurs in the connective tissue, the consequence is systemic sclerosis.
In the remnant kidney model of end stage renal disease, part of the kidney is removed, (either surgically or with a toxin) which increases the metabolic load on the remainder. Superoxide is generated to decrease NO and increase O2 diffusion to the kidney mitochondria. Chronic overload results in progressive kidney capillary rarefaction and progressive kidney failure. In acute kidney failure, putting people in dialysis can give the kidney a “rest”, and allows it to recover. In acute renal failure induced by rhabdomyolysis (muscle damage which releases myoglobin into the blood stream) kidney damage is characterized by ischemic damage. Myoglobin scavenges NO, just as hemoglobin does, and would cause vasoconstriction in the kidney leading to ischemia. Myoglobin would also induce local nitropenia and the cascade of events leading to further ATP depletion.
In some aspects, low NO levels lead to reduced mitochondrial biogenesis. Producing the same ATP at a reduced mitochondria density will result in an increase in O2 consumption, or an accelerated basal metabolic rate. An accelerated basal metabolic rate is observed in a number of conditions, including: Sickle cell anemia, Congestive heart failure, Diabetes, Liver Cirrhosis, Crohn's disease, Amyotrophic lateral sclerosis, Obesity, End stage renal disease, Alzheimer's, and chronic obstructive pulmonary disease.
While some increased O2 consumption might be productively used, in many of these conditions uncoupling protein is also up-regulated, indicating that at least part of the increased metabolic rate is due to inefficiency. Conditions where uncoupling protein is known to be up-regulated include obesity and diabetes.
With fewer mitochondria consuming O2 to a lower O2 concentration, the O2 gradient driving O2 diffusion is greater, so the O2 diffusion path length can increase resulting in capillary rarefaction, which is observed in dilative cardiomyopathy, hypertension, diabetes type 2, and renal hypertension.
Copper, either as Cu2+ or as ceruloplasmin (CP) (the main Cu containing serum protein which is present at 0.38 g/L in adult sera and which is 0.32% Cu and contains 94% of the serum copper) catalyzes the formation of S—NO-thiols from NO and thiol containing groups (RSH). The Cu content of plasma is variable and is increased under conditions of infection. Berger et al. reported that the Cu and Zn content of burn-wound exudates is considerable with patients with ⅓ of their skin burned, losing 20 to 40% of normal body Cu and 5 to 10% of Zn content in 7 days. (Cutaneous copper and zinc losses in burns. Burns. 1992 October; 18(5):373-80.) If the patients skin were colonized by AOB, wound exudates which contains urea and Fe, Cu, and Zn that AOB need, would be converted into NO and nitrite, greatly supplementing the local production of NO by iNOS, without consuming resources (such as O2 and L-arginine) in the metabolically challenged wound. A high production of NO and nitrite by AOB on the surface of a wound would be expected to inhibit infection, especially by anaerobic bacteria such as the Clostridia which cause tetanus, gas gangrene, and botulism.
The practice of the present invention may employ, unless otherwise indicated, conventional methods of immunology, molecular biology, and recombinant DNA techniques within the skill of the art. Such techniques are explained fully in the literature. See, e.g., Sambrook, et al. Molecular Cloning: A Laboratory Manual (Current Edition); and Current Protocols in Molecular Biology (F. M. Ausubel, et al. eds., current edition).
This disclosure provides, among other things, proteins and nucleic acids (optionally, isolated proteins and nucleic acids) that are identical to or similar to those found in strain D23. While not wishing to be bound by theory, it is believed that the sequenced strain of D23 has non-naturally occurring protein and nucleic acid sequences due to an extended period of culture and selection in the laboratory.
These nucleic acids and proteins have numerous uses. For instance, the proteins may be used to generate antibodies or other binding molecules that detect strain D23 or related strains. The proteins may also be used to carry out reactions under high-NH4+ conditions, because D23 is adapted for growth and metabolism under these conditions. As another example, the nucleic acids may be used to produce proteins for generating antibodies or carrying out reactions as described above. The nucleic acids may also be used to detect strain D23 or related strains, e.g., using a microarray or another hybridization-based assay.
The genome of strain D23 is provided as SEQ ID NO: 1. The genome annotation (including the position and orientation of genes within SEQ ID NO: 1) is provided as Supplementary Table 1. Accordingly, this disclosure provides genes and proteins identical or similar to the genes listed in Supplementary Table 1.
Accordingly, this disclosure provides a nucleic acid (e.g., an isolated nucleic acid) comprising a sequence of a gene of Supplementary Table 1, as well as a protein encoded by said gene. In certain embodiments, the nucleic acid comprises a sequence that is similar (e.g., at least 70%, 80%, 85%, 90%, 95%, 97%, 98%, 99%, or 99.5% identical) to a gene of Supplementary Table 1, or a protein encoded by said gene. The disclosure also provides a composition comprising a nucleic acid that is at least 1, 2, 3, 4, 5, 10, 15, 20, 50, 100, 200, 500, 1,000, 1,500, 2,000, 2,500, or all of the sequences of Supplementary Table 1, or a sequence that is similar thereto (e.g., at least 70%, 80%, 85%, 90%, 95%, 97%, 98%, 99%, or 99.5% identical), or one or more proteins encoded by said nucleic acids. Also provided are fragments of said nucleic acids and proteins.
The present disclosure also provides, inter alia, one or more genes or proteins that are present in strain D23 and absent from strain C91, or a gene or protein similar to one of said genes or proteins. Examples of these genes are set out in FIGS. 6-8 and are described in more detail in Example 4 herein. Examples of these genes and proteins, as well as genes and proteins similar thereto, are described below.
Accordingly, with respect to FIG. 6, this application discloses nucleic acids that are identical or similar (e.g., at least 70%, 80%, 85%, 90%, 95%, 97%, 98%, 99%, or 99.5% identical) to 1, 2, 3, 4, 5, 10, 15, 20, 30, 40, 50, 60, 70, 80, 90, 100, 110, 120, 130, 140, 150, 160, or all of the sequences in FIG. 6. This application also discloses proteins that are identical or similar (e.g., at least 70%, 80%, 85%, 90%, 95%, 97%, 98%, 99%, or 99.5% identical) to 1, 2, 3, 4, 5, 10, 15, 20, 30, 40, 50, 60, 70, 80, 90, 100, 110, 120, 130, 140, 150, 160, or all of the proteins encoded by the genes listed in FIG. 6. Furthermore, the application discloses fragments of these genes and proteins, e.g., fragments of 0-20, 20-50, 50-100, 100-200, 200-500, 500-1000, or greater than 1000 nucleotides or amino acids. In some embodiments, a plurality of the above-mentioned genes or proteins are affixed to a solid support, e.g., to form a microarray.
With respect to FIG. 7, this application discloses nucleic acids that are identical or similar (e.g., at least 70%, 80%, 85%, 90%, 95%, 97%, 98%, 99%, or 99.5% identical) to 1, 2, 3, 4, 5, 10, 15, 20, 30, 40, 50, 60, 70, 80, 90, 100, 110, 120, 130, 140, 150, 160, or all of the sequences in FIG. 7. This application also discloses proteins that are identical or similar (e.g., at least 70%, 80%, 85%, 90%, 95%, 97%, 98%, 99%, or 99.5% identical) to 1, 2, 3, 4, 5, 10, 15, 20, 30, 40, 50, 60, 70, 80, 90, 100, 110, 120, 130, 140, 150, 160, or all of the proteins encoded by the genes listed in FIG. 7. Furthermore, the application discloses fragments of these genes and proteins, e.g., fragments of 0-20, 20-50, 50-100, 100-200, 200-500, 500-1000, or greater than 1000 nucleotides or amino acids. In some embodiments, a plurality of the above-mentioned genes or proteins are affixed to a solid support, e.g., to form a microarray.
With respect to FIG. 8, this application discloses nucleic acids that are identical or similar (e.g., at least 70%, 80%, 85%, 90%, 95%, 97%, 98%, 99%, or 99.5% identical) to 1, 2, 3, 4, 5, 10, 15, 20, 30, 40, 50, 60, 70, 80, 90, 100, 110, 120, 130, 140, 150, 200, or all of the sequences in FIG. 8. This application also discloses proteins that are identical or similar (e.g., at least 70%, 80%, 85%, 90%, 95%, 97%, 98%, 99%, or 99.5% identical) to 1, 2, 3, 4, 5, 10, 15, 20, 30, 40, 50, 60, 70, 80, 90, 100, 110, 120, 130, 140, 150, 200, or all of the proteins encoded by the genes listed in FIG. 8. Furthermore, the application discloses fragments of these genes and proteins, e.g., fragments of 0-20, 20-50, 50-100, 100-200, 200-500, 500-1000, or greater than 1000 nucleotides or amino acids. In some embodiments, a plurality of the above-mentioned genes or proteins are affixed to a solid support, e.g., to form a microarray.
With respect to FIGS. 6-8 collectively, this application discloses nucleic acids that are identical or similar (e.g., at least 70%, 80%, 85%, 90%, 95%, 97%, 98%, 99%, or 99.5% identical) to 1, 2, 3, 4, 5, 10, 20, 40, 60, 80, 100, 150, 200, 250, 300, 350, 400, 450, 500, or all of the sequences in FIGS. 6-8. This application discloses proteins that are identical or similar (e.g., at least 70%, 80%, 85%, 90%, 95%, 97%, 98%, 99%, or 99.5% identical) to 1, 2, 3, 4, 5, 10, 20, 40, 60, 80, 100, 150, 200, 250, 300, 350, 400, 450, 500, or all of the proteins encoded by genes listed in FIGS. 6-8. Furthermore, the application discloses fragments of these genes and proteins, e.g., fragments of 1-20, 20-50, 50-100, 100-200, 200-500, 500-1000, or greater than 1000 nucleotides or amino acids. In some embodiments, a plurality of the above-mentioned genes or proteins are affixed to a solid support, e.g., to form a microarray.
This disclosure also provides nucleic acid sequences that are fragments of SEQ ID NO: 1. The fragments may be, e.g., 1-20, 20-50, 50-100, 100-200, 200-500, 500-1000, 1,000-2,000, 2,000-5,000, or 10,000 or more nucleotides in length. The fragments may also be at least about 80%, 85%, 90%, 95%, 97%, 98%, 99%, or 99.5% identity to the corresponding portion of SEQ ID NO: 1 or its complement. The fragment may also be a fragment that hybridizes to SEQ ID NO: 1, or to the genome of the D23 strain deposited with the ATCC patent depository on Apr. 8, 2014, designated AOB D23-100 with the ATCC under accession number PTA-121157, or their complements, under low stringency, medium stringency, high stringency, or very high stringency, or other hybridization condition described herein.
The disclosure also provides nucleic acid sequences set out in Table 1 (which describes genes involved in ammonia metabolism). Accordingly, in some aspects, this application discloses genes that are identical or similar (e.g., at least 70%, 80%, 85%, 90%, 95%, 96%, 97%, 97.5%, 98%, 98.2%, 98.4%, 98.6%, 98.8%, 99%, 99.1%, 99.2%, 99.3%, 99.4%, 99.5%, 99.6%, 99.7%, 99.8%, 99.9%, or 100% identical) to 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, or all of the genes in Table 1. In embodiments, this application discloses proteins that are identical or similar (e.g., at least 70%, 80%, 85%, 90%, 95%, 96%, 97%, 97.5%, 98%, 98.2%, 98.4%, 98.6%, 98.8%, 99%, 99.1%, 99.2%, 99.3%, 99.4%, 99.5%, 99.6%, 99.7%, 99.8%, 99.9%, or 100% identical) to 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, or all of the proteins in Table 1.
Alignment of the nucleic acid sequences of Table 1 shows the percent identity between homologs in C91 and D23. The following paragraphs discuss this percent identity and describe various nucleic acids having homology to the D23 genes of Table 1.
More specifically, the amoA1 genes are about 98.8% identical (i.e., at 821/831 positions). Accordingly, in some embodiments, the amoA1 nucleic acid comprises D23 nucleotides at at least 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, or all of the positions that differ in this gene between strains C91 and D23. In embodiments, the amoA1 nucleic acid comprise D23 nucleotides at at most 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, or all of the positions that differ in this gene between strains C91 and D23. In embodiments, the amoA1 nucleic acid comprises a sequence at least about 98.8%, 98.9%, 99.0%, 99.2%, 99.4%, 99.6%, 99.8%, or 100% identical to the D23 amoA1 gene.
The amoA2 genes are about 98.8% identical (i.e., at 821/831 positions). Accordingly, in some embodiments, the amoA2 nucleic acid comprises D23 nucleotides at at least 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, or all of the positions that differ in this gene between strains C91 and D23. In embodiments, the amoA2 nucleic acid comprises D23 nucleotides at at most 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, or all of the positions that differ in this gene between strains C91 and D23. In embodiments, the amoA2 nucleic acid comprises a sequence at least about 98.8%, 98.9%, 99.0%, 99.2%, 99.4%, 99.6%, 99.8%, or 100% identical to the D23 amoA2 gene.
The amoB1 genes are about 99.1% identical (i.e., at 1255/1266 positions). Accordingly, in some embodiments, the amoB1 nucleic acid comprises D23 nucleotides at at least 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, or all of the positions that differ in this gene between strains C91 and D23. In embodiments, the amoB1 nucleic acid comprises D23 nucleotides at at most 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, or all of the positions that differ in this gene between strains C91 and D23. In embodiments, the amoB1 nucleic acid comprises a sequence at least about 99.1%, 99.2%, 99.4%, 99.6%, 99.8%, or 100% identical to the D23 amoB1 gene.
The amoB2 genes are about 99.1% identical (i.e., at 1254/1266 positions). Accordingly, in some embodiments, the amoB2 nucleic acid comprises D23 nucleotides at at least 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12 or all of the positions that differ in this gene between strains C91 and D23. In embodiments, the amoB2 nucleic acid comprises D23 nucleotides at at most 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12 or all of the positions that differ in this gene between strains C91 and D23. In embodiments, the amoB2 nucleic acid comprises a sequence at least about 99.1%, 99.2%, 99.4%, 99.6%, 99.8%, or 100% identical to the D23 amoB2 gene.
The amoC1 genes are about 99.8% identical (i.e., at 814/816 positions). Accordingly, in some embodiments, the amoC1 nucleic acid comprises D23 nucleotides at at least 1, 2, or all of the positions that differ in this gene between strains C91 and D23. In embodiments, the amoC1 nucleic acid comprises D23 nucleotides at at most 1, 2, or all of the positions that differ in this gene between strains C91 and D23. In embodiments, the amoC1 nucleic acid comprises a sequence at least about 99.8%, 99.9%, or 100% identical to the D23 amoC1 gene.
The amoC2 genes are about 99.8% identical (i.e., at 814/816 positions). Accordingly, in some embodiments, the amoC2 nucleic acid comprises D23 nucleotides at at least 1, 2, or all of the positions that differ in this gene between strains C91 and D23. In embodiments, the amoC2 nucleic acid comprises D23 nucleotides at at most 1, 2, or all of the positions that differ in this gene between strains C91 and D23. In embodiments, the amoC2 nucleic acid comprises a sequence at least about 99.8%, 99.9%, or 100% identical to the D23 amoC2 gene.
The amoC3 genes are about 98.9% identical (i.e., at 816/825 positions). Accordingly, in some embodiments, the amoC3 nucleic acid comprises D23 nucleotides at at least 1, 2, 3, 4, 5, 6, 7, 8, 9, or all of the positions that differ in this gene between strains C91 and D23. In embodiments, the amoC3 nucleic acid comprises D23 nucleotides at at most 1, 2, 3, 4, 5, 6, 7, 8, 9, or all of the positions that differ in this gene between strains C91 and D23. In embodiments, the amoC3 nucleic acid comprises a sequence at least about 98.9%, 99.0%, 99.2%, 99.4%, 99.6%, 99.8%, or 100% identical to the D23 amoC3 gene.
The hao1 genes are about 99.0% identical (i.e., at 1696/1713 positions). Accordingly, in some embodiments, the hao1 nucleic acid comprises D23 nucleotides at at least 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, or all of the positions that differ in this gene between strains C91 and D23. In embodiments, the hao1 nucleic acid comprises D23 nucleotides at at most 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, or all of the positions that differ in this gene between strains C91 and D23. In embodiments, the hao1 nucleic acid comprises a sequence at least about 99.0%, 99.2%, 99.4%, 99.6%, 99.8%, or 100% identical to the D23 hao1 gene.
The hao2 genes are about 99.4% identical (i.e., at 1702/1713 positions). Accordingly, in some embodiments, the hao2 nucleic acid comprises D23 nucleotides at at least 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, or all of the positions that differ in this gene between strains C91 and D23. In embodiments, the hao2 nucleic acid comprises D23 nucleotides at at most 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, or all of the positions that differ in this gene between strains C91 and D23. In embodiments, the hao2 nucleic acid comprises a sequence at least about 99.4%, 99.6%, 99.8%, or 100% identical to the D23 hao2 gene.
The hao3 genes are about 99.2% identical (i.e., at 1700/1713 positions). Accordingly, in some embodiments, the hao3 nucleic acid comprises D23 nucleotides at at least 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, or all of the positions that differ in this gene between strains C91 and D23. In embodiments, the hao3 nucleic acid comprises D23 nucleotides at at most 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, or all of the positions that differ in this gene between strains C91 and D23. In embodiments, the hao3 nucleic acid comprises a sequence at least about 99.2%, 99.4%, 99.6%, 99.8%, or 100% identical to the D23 hao3 gene.
The cycA1 genes are about 98.0% identical (i.e., at 694/708 positions). Accordingly, in some embodiments, the cycA1 nucleic acid comprises D23 nucleotides at at least 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, or all of the positions that differ in this gene between strains C91 and D23. In embodiments, the cycA1 nucleic acid comprises D23 nucleotides at at most 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, or all of the positions that differ in this gene between strains C91 and D23. In embodiments, the cycA1 nucleic acid comprises a sequence at least about 98.0%, 98.2%, 98.4%, 98.6%, 98.8%, 99.0%, 99.2%, 99.4%, 99.6%, 99.8%, or 100% identical to the D23 cycA1 gene.
The cycA2 genes are about 98.7% identical (i.e., at 699/708 positions). Accordingly, in some embodiments, the cycA2 nucleic acid comprises D23 nucleotides at at least 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, or all of the positions that differ in this gene between strains C91 and D23. In embodiments, the cycA2 nucleic acid comprises D23 nucleotides at at most 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, or all of the positions that differ in this gene between strains C91 and D23. In embodiments, the cycA2 nucleic acid comprises a sequence at least about 98.7%, 98.8%, 99.0%, 99.2%, 99.4%, 99.6%, 99.8%, or 100% identical to the D23 cycA2 gene.
The cycA3 genes are about 99.3% identical (i.e., at 703/708 positions). Accordingly, in some embodiments, the cycA3 nucleic acid comprises D23 nucleotides at at least 1, 2, 3, 4, 5, or all of the positions that differ in this gene between strains C91 and D23. In embodiments, the cycA3 nucleic acid comprises D23 nucleotides at at most 1, 2, 3, 4, 5, or all of the positions that differ in this gene between strains C91 and D23. In embodiments, the cycA3 nucleic acid comprises a sequence at least about 99.3%, 99.4%, 99.6%, 99.8%, or 100% identical to the D23 cycA3 gene.
The cycB1 genes are about 96.7% identical (i.e., at 696/720 positions). Accordingly, in some embodiments, the cycB1 nucleic acid comprises D23 nucleotides at at least 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, or all of the positions that differ in this gene between strains C91 and D23. In embodiments, the cycB1 nucleic acid comprises D23 nucleotides at at most 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, or all of the positions that differ in this gene between strains C91 and D23. In embodiments, the cycB1 nucleic acid comprises a sequence at least about 96.7%, 96.8%, 97.0%, 97.2%, 97.4%, 97.6%, 97.8%, 98.0%, 98.2%, 98.4%, 98.4%, 98.6%, 98.8%, 99.0%, 99.2%, 99.4%, 99.6%, 99.8%, or 100% identical to the D23 cycB1 gene.
The cycB2 genes are about 97.1% identical (i.e., at 702/723 positions). Accordingly, in some embodiments, the cycB2 nucleic acid comprises D23 nucleotides at at least 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, or all of the positions that differ in this gene between strains C91 and D23. In embodiments, the cycB2 nucleic acid comprises D23 nucleotides at at most 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, or all of the positions that differ in this gene between strains C91 and D23. In embodiments, the cycB2 nucleic acid comprises a sequence at least about 97.1%, 97.2%, 97.4%, 97.6%, 97.8%, 98.0%, 98.2%, 98.4%, 98.4%, 98.6%, 98.8%, 99.0%, 99.2%, 99.4%, 99.6%, 99.8%, or 100% identical to the D23 cycB2 gene.
Further provided herein are vectors comprising nucleotide sequences described herein. In some embodiments, the vectors comprise nucleotides encoding a protein described herein. The vectors include, but are not limited to, a virus, plasmid, cosmid, lambda phage or a yeast artificial chromosome (YAC). Such vectors may include a promoter, an open reading frame with or without introns, and a termination signal.
The present disclosure also provides host cells comprising a nucleic acid as described herein, or a nucleic acid encoding a protein as described herein.
In certain embodiments, the host cells are genetically engineered by using an expression cassette. The phrase “expression cassette,” refers to nucleotide sequences, which are capable of affecting expression of a gene in hosts compatible with such sequences. Such cassettes may include a promoter, an open reading frame with or without introns, and a termination signal. Additional factors necessary or helpful in effecting expression may also be used, such as, for example, an inducible promoter.
The disclosure also provides host cells comprising the vectors described herein.
The cell can be, but is not limited to, a eukaryotic cell, a bacterial cell, an insect cell, or a human cell. If the cell is a bacterial cell, it may be, e.g., E. coli or an ammonia-oxidizing bacterium such as Nitrosomonas (e.g., N. eutropha or N. europaea), Nitrosococcus, Nitrosospira, Nitrosocystis, Nitrosolobus, and Nitrosovibrio.
The present disclosure provides for systems and methods for changing the skin microbiome, e.g., the human skin microbiome. The systems and methods may provide treatment of infections or conditions, e.g., related to the skin, e.g., skin infections and/or skin conditions.
Ammonia-oxidizing bacteria (AOB) of the genus Nitrosomonas are Gram-negative obligate autotrophic bacteria with a unique capacity to generate nitrite and nitric oxide exclusively from ammonia as an energy source. They are widely present both in soil and water environments and are essential components of environmental nitrification processes. Due to the roles of nitrite and nitric oxide on human skin as important components of several physiological functions, such as vasodilation, skin inflammation and wound healing, these bacteria may have beneficial properties for both healthy and immunopathological skin conditions. These bacteria may be safe for use in humans because they are slow-growing, cannot grow on organic carbon sources, may be sensitive to soaps and antibiotics, and have never been associated with any disease or infection in animals or humans.
Topical application of ammonia oxidizing bacteria to a subject, e.g., a human subject may lead to unexpected changes in the skin microbiome, and more specifically it may lead to increases in the proportion of normal commensal non-pathogenic species and reductions in the proportion of potentially pathogenic, pathogenic, or disease causing organisms.
A soil-derived culture enriched in various ammonia oxidizing bacteria was applied to the skin of an adult male subject as described in WO/2003/057380. The period of growth on the human body selected for a strain with the capacity to colonize human skin for an extended period of time. After several months, the strain was re-isolated from the skin of the individual and cultured in laboratory conditions for a sustained period as described in the subsequent examples. While not wishing to be bound by theory, it is believed that the sustained laboratory culture selected for new mutations improving the strain properties, e.g., improved tolerance for high-ammonia conditions.
D23 can be grown in batches or by continuous cultivation in a bioreactor. Batch preparation uses the medium of Table 3.
| TABLE 3 |
| Growth Medium for Batch culturing: |
| Weight/Volume | Final Concentration | |
| (in~1.5 L) | (in~1.5 L) | |
| (NH4)2SO4 | 4.95 | g | 50 | mM NH4+ |
| (MW 132.14) | ||||
| KH2PO4 (MW 136.1) | 0.616 | g | 3.0 | mM |
| 1M MgSO4 | 1.137 | ml | 0.76 | mM |
| 1M CaCl2 | 0.3 | ml | 0.2 | mM |
| 30 mM FeCl3/50 mM | 0.5 | ml | 10 | μM/16.7 μM |
| EDTA | ||||
| 50 mM CuSO4 | 30 | μl | 1.0 | μM |
| Add 1400 ml ddH2O to flask. Autoclave. Store at room temperature. |
| After autoclaving add: |
| Phosphate Buffer | 100 | ml | 32 | mM KH2PO4/ |
| 2.7 | mM NaH2PO4•H2O |
| 5% Na2CO3 | 12 | ml | 0.04% |
The medium of Table 3 is inoculated with ˜15 ml of a 3 day old culture of D23 (i.e. 1% volume). The cultures are incubated in the dark at 30° C. by shaking at 200 rpm.
Often, a N. eutropha D23 mixed culture is grown on complete N. europaea media. The culture medium is described below, and additional details on culturing ammonia-oxidizing bacteria are available on the World Wide Web at nitrificationnetwork.org/Nerecipe.php, Ensign et al., 1993, and Stein & Arp, 1998.
Add 900 ml of deionized water to a 2-liter Erlenmeyer flask.
Add in sequence:
3.3 g (NH4+)2SO4 (50 mM);
0.41 g KH2PO4
0.75 ml 1 M MgSO4 stock solution
0.2 ml 1 M CaCl2 stock solution
0.33 ml 30 mM FeSO4/50 mM EDTA stock solution
0.01 ml 50 mM CuSO4 stock solution
Sterilize the solution by autoclaving.
Add 400 ml of deionized water to a beaker. Add:
27.22 g KH2PO4
2.4 g NaH2PO4
Adjust the pH to 8.0 with 10 N NaOH, and bring the final volume to 500 ml with deionized water.
Sterilize 100 ml fractions of the solution by autoclaving in 250-500 ml Erlenmeyer flasks.
Prepare 500 ml of 5% (w/v) Na2CO3 (anhydrous)
Sterilize the solution by autoclaving.
Add 1×100 ml aliquot of solution prepared in Step 2 to the flask prepared in Step 1.
Add 8 ml of the solution prepared in Step 3 to the flask prepared in Step 1.
The D23 can also be cultured continuously in a bioreactor. Table 4 describes the appropriate media.
| TABLE 4 |
| Growth Medium for continuous culture: |
| Batch medium | Feeding solution | |
| Weight/Volume (1 L) | Weight/Volume (1 L) | |
| (Final concentration) | (Final concentration) | |
| (NH4)2SO4 (MW 132.14) | 3.3 | g | 13.2 | g |
| (50 mM NH4+) | (200 mM NH4+) |
| KH2PO4 (MW 136.1) | 1.23 | g | 0.41 | g |
| (9.0 mM) | (3.0 mM) |
| 1M MgSO4 | 0.758 | ml | 0.758 | ml |
| (0.76 mM) | (0.76 mM) |
| 1M CaCl2 | 0.2 | ml | 0.2 | ml |
| (0.2 mM) | (0.2 mM) |
| 30 mM FeCl3/50 mM EDTA | 0.333 | ml | 0.333 | ml |
| (10 μM/16.7 μM) | (10 μM/16.7 μM) |
| 50 mM CuSO4 | 20 | μl | 20 | μl |
| (1.0 μM) | (1.0 μM) | |
| ddH2O | 1000 ml | 1000 ml |
| Autoclave each solution and store at room temperature. |
The batch media, in a bioreactor vessel, is inoculated with ˜10 ml of a 3 day old N. eutropha D23 culture (i.e. 1% volume). The pH is adjusted to 7.6 using 7.5% Na2CO3 The bioreactor is run in batch mode with below parameters: pH: 7.6 (lower limit: 7.45 & upper limit: 7.8), Temperature: 28° C. (lower limit: 25° C. & upper limit: 32° C.), DO (dissolved oxygen): 45% (lower limit: 10%, upper limit: 100%), Stirrer: 550 rpm.
The OD600 nm of the culture in the bioreactor reaches 0.15 to 0.18 in 3-4 days. At this point, the culture will consume most of the 50 mM NH4+ present in the AOB growth media, and a user should start feeding the bioreactor with feeding solution at 0.59 ml/min (˜10%). The outflow pump should also be turned on at 0.59 ml/min (˜10%). The OD600 nm of the bioreactor reaches 0.5-0.6 in 1-2 days of continuous culture. The culture in the bioreactor is tested for heterotrophic contaminants by plating 1 ml of the bioreactor outflow on an LB plate.
Monitoring Growth of N. eutropha D23
Growth of N. eutropha D23 cells is monitored by measuring the OD600 nm of the culture. Typical growth in a batch culture as measured by OD600 nm is between 0.06 to 0.08.
The AOB growth medium contains NH4+ that is stoichiometrically converted to NO2− by N. eutropha D23. Another way to monitor the growth of N. eutropha is to follow the release of nitrite (NO2−) in the growth medium. NO2− concentration is determined with Griess reagents, sulfanilamide and N-naphthylethylenediamine (also called NNEQ). Briefly, sulfanilamide and NNEQ are added to a sample and to known concentrations of sodium nitrite that make up a standard curve. Samples are incubated in the dark for 30 minutes. The absorbance is read at 540 nm.
Another way to follow nitrite production is by using a spectrophotometer by monitoring the optical density (OD) difference between 352 nm and 400 nm. The nitrite concentration is determined using a millimolar extinction coefficient of 0.0225 mM−1. This assay can be performed directly by sampling the medium with the cells.
NO2− concentration (mM)=(OD352−OD400)/0.0225
The growth of a mixed culture comprising D23 was monitored by measuring optical density at 600 nm (OD600 nm) and by measuring Nitrite (NO2−), and the growth rate is shown in FIGS. 1 and 2. FIG. 1 shows that the optical density at a 600 nm wavelength plateaus slightly below 0.1, after 3 to 4 days. FIG. 2A shows that the amount of nitrite produced plateaus slightly below 25 mM after 3 to 4 days. NO2− concentrations in the cultures were determined colorimetrically by the Griess reagent (Hageman & Hucklesby, 1971), and is used as a second indicator for the growth rates and growth phases since the accumulation of NO2− is consistently proportional to the increase in cell mass during growth.
In FIG. 2B-I, increasing densities of D23 harvested from continuous culture were suspended in medium supplemented with 50 mM NH4+ and grown shaking at 30° C. for 48 hours. Nitrite production was measured in supernatant samples using the Griess assay at the time points indicated. Results shown are mean values±SD from three independent experiments.
In FIG. 2B-II. Nitrite production by N. eutropha D23 in vitro is shown. Increasing densities of D23 were suspended in mineral salt medium supplemented with 50 mM NH4+ and grown shaking at 30° C. for 24 hr. Nitrite production was measured in supernatant samples using the Griess assay at the time points indicated.
Storage Conditions
N. eutropha suspensions obtained from the continuous culture system showed remarkable stability upon storage at 4° C. for several months, as indicated by the highly consistent nitrite concentrations generated upon subculture under batch growth conditions. Protocols for storing and recovering N. eutropha are set out below.
Obtain 500 ml of a N. eutropha D23 culture grown to late-exponential phase (OD600=0.5-0.6 in continuous culture). Centrifuge at 10,000×g for 15 min at 20° C. Remove supernatant and resuspend the pellet in 50 ml of AOB storage buffer. Spin as above. Remove supernatant and resuspend thoroughly in a total of 50 ml storage buffer. This would be the 10× AOB stock. Store upright at 4° C. in 50 ml polypropylene tubes.
AOB Storage Buffer (for AOB storage at 4° C.): 50 mM Na2HPO4-2 mM MgCl2 (pH 7.6) can be made as follows.
In 1 Liter ddH2O: Na2HPO4-7.098 g
MgCl2-0.1904 g
Adjust pH to 7.6. Filter-sterilize.
N. eutropha may be cryopreserved as follows. Transfer 1.25 ml of N. eutropha D23 mid-log culture to a 2 ml cryotube and 0.75 ml of sterile 80% glycerol. Shake tubes gently, incubate at room temperature for 15 min to enable uptake of the cryoprotective agents by the cells. Then, put tubes directly in a −80oC freezer for freezing and storage. For resuscitation of cultures, thaw frozen stocks on ice for 10-20 minutes. Centrifuge, at 8,000×g for 3 minutes at 4° C. Discard supernatant and wash the pellet by suspending it in 2 ml AOB medium followed by another centrifugation at 8,000×g for 3 minutes at 4° C. to reduce potential toxicity of the cryoprotective agents in subsequent growth experiments. Discard the supernatant and resuspend the pellet in 2 ml of AOB medium, inoculate into 50 ml of AOB medium containing 50 mM NH4+, and incubate in dark at 30° C. by shaking at 200 rpm.
In FIG. 2C, stability upon storage at 4° C. was studied. N. eutropha D23 previously harvested from continuous culture and stored at 4° C. was inoculated at 109 CFU/ml in mineral salt medium supplemented with 50 mM NH4+ and grown shaking at 30° C. Nitrite production was determined at 24 and 48 hours post-incubation (left and right panel, respectively). Data shown are representative of a D23 suspension sampled repeatedly over a 6-month period.
To isolate N. eutropha D23 in pure culture, four types of media (described below) were made, autoclaved and poured in plates. Sterile nylon membranes were placed on the plates.
N. europaea media+1.2% R2A agar
N. europaea media+1.2% agar
N. europaea media+1.2% agarose
N. europaea media+1.2% agarose+0.3 g/L pyruvate
3 day old N. eutropha D23 culture was streaked onto the nylon membranes and the plates were incubated at 30° C. The plates were monitored daily for growth of red colored N. eutropha cells. Nylon membranes were transferred to fresh plates once a week.
Reddish colored colonies appeared on plates with R2A agar or agar by end of 1 week. Single colonies were picked from plates with R2A agar and grown in N. europaea media. The cultures grew well in 6 days to 0.08 OD600 nm. Heterotrophic colonies appeared when the culture was plated on LB-Agar plates.
Reddish colored colonies on plates with R2A agar, agar, agarose, or agarose+pyruvate appeared by end of 2 weeks. Single colonies were picked from plates with agar or agarose and grown in N. europaea media. The cultures grew well in 6-8 days to 0.08 OD600 nm. Heterotrophic colonies appeared when the culture was plated on LB-Agar plates.
Bright reddish colonies on plates with R2A agar, agar, agarose, or agarose+pyruvate appeared by end of 4 weeks. Single colonies were picked from plates with agarose and grown in N. europaea media. The cultures grew well in 6-8 days to 0.08 OD600 nm. White colonies appeared when the culture was plated on LB-Agar plates.
Contaminating bacteria (e.g., non-N. eutropha bacteria present in the mixed culture) were identified by culturing, amplifying 16S rRNA by PCR, and sequencing of the PCR products. Contaminants were identified as Microbacterium sp. and Alcaligenaceae bacterium.
To create an axenic culture of D23 (i.e., free of contaminating bacteria) serial dilution was used. Eight single colonies (designated A-H) were picked, and each was placed into a 10 ml culture of N. europae medium. For each culture, five sequential 1:10 dilutions were created. For each culture A-H, growth was observed in the two or three most concentrated of the dilutions.
A second serial dilution was carried out. 50 ml of media was inoculated with approximately 2×108 N. eutropha cells, and sequential dilutions of 1:50 were made, such that after the fifth dilution, a flask was expected to have approximately one cell. Flasks that exhibited bacterial growth were plated on LB-agar to assay for contaminating bacteria, and no contaminating bacteria were observed. In addition, no contaminating gram positive cells were observed under the microscope.
Accordingly, the serial dilution process yielded an axenic or substantially axenic culture of N. eutropha.
Strain D23 was obtained as described in Example 1, and was made axenic as described in Example 3.
A 10 ml aliquot the bacterial sample was inoculated into approximately 1 L of N. europaea growth medium described in Example 2. The culture grew well to optical density of 0.08 at 600 nm in a batch culture in 3 days.
Total DNA of the culture was prepared and sequenced using Illumina® technology and/or SMRT® DNA Sequencing System technology, Pacific Biosciences. The strain was identified as Nitrosomonas eutropha and was designated D23.
The genome sequence of D23 was compared to that of N. eutropha C91, which is believed to be the only other sequenced strain of N. eutropha.
The length of the D23 chromosome is 2,537,572 base pairs, which is shorter than the 2,661,057 base pair chromosome of N. eutropha strain C91 chromosome. Based on the 16S-23S operon, strain D23 has 99.46% identity to C91 and 95.38% identity to N. europaea. DNA sequencing of N. eutropha D23 indicated that this strain lacks plasmids. This contrasts with the sequence of strain C91, which has two plasmids.
Protein-encoding regions and RNA-encoding sequences were identified by sequence analysis. Supplementary Table 1 is a table of annotations that lists the positions of 2,777 genes in the D23 genome (SEQ ID NO: 1).
On the level of individual genes, several genes are present in D23 that are absent in C91. These genes are summarized in FIGS. 6-8. FIG. 6 is a table displaying unique D23 genes with an assigned ORF number and a function based on sequence analysis, or a hypothetical gene above 200 base pairs in length. There are 162 genes in this category. FIG. 7 is a table displaying unique D23 genes below 200 base pairs that have an assigned ORF number. There are 164 of these genes. FIG. 8 is a table displaying unique D23 genes with no assigned ORF number. There are 219 of these genes (of which 180 are below 200 bp in length).
Strain D23 also lacks a number of genes that are present (or lack close homologs) in strain C91. These genes are sometimes referred to as unique C91 genes. These genes include the about 300 genes listed in FIG. 9.
D23 contains several ammonia metabolism genes that differ from their homologs in C91. Certain of these genes are enumerated in Table 1 of the Detailed Description. Sequence alignments were performed between the D23 proteins and their homologs in strain C91. The sequence alignments are shown in FIGS. 10-16 and sequence differences between the two strains are shown in Table 2 of the Detailed Description.
The sequence comparisons revealed the percent sequence identities between the C91 and D23 homologs of each protein. More specifically, FIG. 10 is an alignment between AmoA1 and AmoA2 of strains C91 and D23. Each protein is identical at 273/276 residues, and so each is about 98.9% identical between strains. FIG. 11 is an alignment between AmoB1 and AmoB2 of strains C91 and D23. Both proteins are identical at 419/421 positions, and so are about 99.5% identical between strains. FIG. 12 is an alignment between AmoC1 and AmoC2 of strains C91 and D23. Both proteins are identical throughout. FIG. 13 is an alignment between AmoC3 of strains C91 and D23. This protein is identical at 272/274 positions, and so are about 99.3% identical between strains.
As to the Hao proteins, FIG. 14 (A and B) is an alignment between Hao1, Hao2, and Hao3 of strains C91 and D23. Hao1 is identical at 567/570 positions, and so each is about 99.5% identical between strains. Hao2 and Hao3 are each identical at 568/570 positions, and so are about 99.6% identical between strains.
Turning now to cytochrome c554 proteins, FIG. 15 is an alignment between CycA1, CycA2, and CycA3 of strains C91 and D23. CycA1 is identical at 233/235 positions, and so is about 99.1% identical between strains. CycA2 and CycA3 are each identical at 234/235 positions, and so each is about 99.6% identical between strains.
As to the cytochrome cM552 proteins, FIG. 16 is an alignment between CycB1 and CycB2 of strains C91 and D23. CycB1 is identical at 232/239 positions, and so is about 97.1% identical between strains. CycB2 is identical at 236/239 positions, and so is about 98.7% identical between strains. Here, the length of the protein is considered 239 amino acids because that is its length in strain D23.
Alignment of the nucleic acid sequences of Table 1 shows the percent identity between homologs in C91 and D23. The amoA1 genes are about 98.8% identical (i.e., at 821/831 positions), the amoA2 genes are about 98.8% identical (i.e., at 821/831 positions), the amoB1 genes are about 99.1% identical (i.e., at 1255/1266 positions), the amoB2 genes are about 99.1% identical (i.e., at 1254/1266 positions), the amoC1 genes are about 99.8% identical (i.e., at 814/816 positions), the amoC2 genes are about 99.8% identical (i.e., at 814/816 positions), and the amoC3 genes are about 98.9% identical (i.e., at 816/825 positions). The hao1 genes are about 99.0% identical (i.e., at 1696/1713 positions), the hao2 genes are about 99.4% identical (i.e., at 1702/1713 positions), and the hao3 genes are about 99.2% identical (i.e., at 1700/1713 positions). Of the cytochrome c554 genes, the cycA1 genes are about 98.0% identical (i.e., at 694/708 positions), the cycA2 genes are about 98.7% identical (i.e., at 699/708 positions), and the cycA3 genes are about 99.3% identical (i.e., at 703/708 positions). Of the cytochrome cM552 genes, the cycB1 genes are about 96.7% identical (i.e., at 696/720 positions) and the cycB2 genes are about 97.1% identical (i.e., at 702/723 positions).
A study was designed to determine whether N. eutropha strain D23 could inhibit the growth of undesirable bacteria such as Pseudomonas aeruginosa (P. aeruginosa or PA), Staphylococcus aureus (S. aureus or SA), Streptococcus pyogenes (S. pyogenes or SP), Acinetobacter baumannii (A. baumannii or AB), and Propionibacterium acnes, all of which are important pathogenic agents frequently isolated from either one or both of infected skin and wound sites. This protocol may also be used to test other N. eutropha strains for the ability to inhibit the growth of undesirable bacteria.
Briefly, a suitable protocol can comprise the following steps. At t=0, a culture is inoculated with N. eutropha, and then the N. eutropha is incubated for 24 hours. Culture characteristics (e.g., pH and nitrite levels) are assayed. At t=24 hours, the undesirable bacterium is added to the culture. Immediately upon addition, samples are obtained for determining CFU/ml of the undesirable bacteria and optionally CFU/ml of N. eutropha, pH, and nitrite levels. Incubation is allowed to proceed for an additional 24 hours. At subsequent timepoints, e.g., t=30 and t=48, one can take the same measurements as at t=24. To determine CFU/ml, one can plate neat/−1/−2/−3/−4/−5 (or higher) to obtain accurate counts.
A more detailed protocol is set out below.
| TABLE 5 | |
| T0 |
| 10x | T24 | ||||||
| 10x | Killed | 1M | 1M | SA/PA | |||
| AOB | AOB | (NH4)2SO4 | H2O | NaNO2 | in saline | ||
| SAMPLE | Tube | (ml) | (ml) | (μl) | (μl) | (μl) | (ml) |
| Complete AOB medium |
| 10x AOB + NH4+ | 1 | 5 | — | 141 | — | — | 0.5 |
| 10x AOB | 2 | 5 | — | — | 141 | — | 0.5 |
| 10x Killed AOB + | 3 | — | 5 | 141 | — | — | 0.5 |
| NH4+ |
| Complete AOB medium/0.5x Phosphate Buffer |
| 10x AOB + NH4+ | 4 | 5 | — | 141 | — | — | 0.5 |
| 10x AOB + NH4+ | 5 | 5 | — | 141 | — | — | 0.5 |
| 10x AOB | 6 | 5 | — | — | 141 | — | 0.5 |
| 10x AOB | 7 | 5 | — | — | 141 | — | 0.5 |
| 10x AOB + NaNO2 | 8 | 5 | — | — | — | 141 | 0.5 |
| 10x Killed AOB + | 9 | — | 5 | 141 | — | — | 0.5 |
| NH4+ | |||||||
1. Use the 0.5 ml supernatant samples obtained for pH determination at 0, 2, 6, and 24 hr.
2. Serially dilute 56 μl of the supernatant in 0.5 ml dH2O to obtain 10-100- and 1000-fold dilutions, as needed. For TO samples, use 1/10 for Tube 1-6, 8, 9, and 1/1000 for Tube 7. For T24/T30/T48 samples, use 1/10, 1/100, 1/1000 for all tubes,
3. To prepare sodium nitrite standards, dilute 10 μl of a fresh 1 M stock in 990 μl complete AOB medium-10% saline to obtain a 10 mM solution.
4. Dilute 10 μl of the 10 mM stock in 990 μl dH2O to obtain a 100 μM working solution.
5. Prepare standards in dH2O as shown below. Run standards only with TO samples.
| TABLE 6 | ||||
| 100 μM | Nitrite | |||
| sodium nitrite | dH2O | conc | A540nm | |
| (μl) | (μl) | (μM) | (indicative values) | |
| 0 (blank) | 500 | 0 | 0 | |
| 62.5 | 437.5 | 12.5 | 0.307 | |
| 125 | 375 | 25 | 0.607 | |
| 250 | 250 | 50 | 1.164 | |
| 500 | 0 | 100 | 2.35 | |
This protocol was used to test N. eutropha D23's ability to inhibit the growth of P. aeruginosa (PA), S. aureus (SA), S. pyogenes (SP), A. baumannii (AB), or P. acnes. The results of this experiment are shown in FIGS. 3A, 3B, and 3C.
The left panel of FIG. 3A plots CFU/ml of PA versus time, when PA is co-cultured with live N. eutropha and ammonium (squares), live N. eutropha without ammonium (circles), killed N. eutropha and ammonium (triangles), or live N. eutropha with NaNO2 (inverted triangles). The right panel of FIG. 3A plots CFU/ml of SA versus time, under the same conditions. The left panel of FIG. 3B plots CFU/ml of SP versus time, under the same conditions. The right panel of FIG. 3B plots CFU/ml AB versus time, under the same conditions. FIG. 3C plots CFU/ml of P. acnes versus time, when P. acnes is co-cultured with live N. eutropha and ammonium (squares), live N. eutropha without ammonium (circles), killed N. eutropha and ammonium (triangles), or live N. eutropha with NaNO2 (inverted triangles). In all cases, live N. eutropha with ammonium results in declining numbers of PA, SA, SP, AB, or P. acnes whereas the other culture conditions allow the undesirable bacteria to grow. Without being bound by theory, these experiments suggest that nitrite generation from ammonia concurrently with medium acidification by D23 led to strong antibacterial effects, e.g., an approximately 100-fold reduction in viable counts of methicillin-resistant Staphylococcus aureus, Pseudomonas aeruginosa, Streptococcus pyogenes, Acinetobacter baumannii, or P. acnes. By contrast, control co-cultures of pathogenic bacteria either with heat-killed D23 supplemented with ammonia, or with live D23 without ammonia, did not produce comparable antibacterial effects. The control comprising live N. eutropha culture without ammonium is consistent with the model that N. eutropha's ammonia oxidation activity contributes to its antibacterial effects. The control comprising killed N. eutropha and ammonium indicates that some biological activity of the N. eutropha (e.g., its ammonia oxidation activity) contributes to antibacterial activity. The control comprising live N. eutropha with NaNO2 indicates that comparable nitrite levels at neutral pH (versus low pH when the bacteria use ammonia) do not have a strong antimicrobial effect, and is consistent with the model that N. eutropha's oxidation of ammonia, rather than nitrite alone, contributes to the antibacterial activity.
The top panel of FIG. 4A plots the NO2− concentration over time in the co-cultures described in the paragraph above. NO2− concentration is an indication of the rate of NH3 metabolism in the cultures. As above, PA is co-cultured with N. eutropha and ammonium (squares), N. eutropha without ammonium (circles), or killed N. eutropha and ammonium (triangles). Live N. eutropha with ammonium produces dramatically higher NO2− levels than the two control cultures, indicating that the live N. eutropha converts ammonium into NO2− under the culture conditions.
The bottom panel of FIG. 4A plots pH over time in the same co-culturing conditions. pH indicates the metabolic activity of the N. eutropha because the conversion of ammonia to nitrite produces hydrogen ions. PA is co-cultured with N. eutropha and ammonium (squares), N. eutropha without ammonium (circles), killed N. eutropha and ammonium (triangles), or live N. eutropha with NaNO2 (inverted triangles). Live N. eutropha with ammonium acidifies the medium, in contrast to the three control cultures, indicating that the live N. eutropha metabolizes ammonium under the culture conditions.
The top panels of FIG. 4B plot the NO2− concentration over time in the co-cultures described above. NO2− concentration is an indication of the rate of NH3 metabolism in the cultures. As above, S. pyogenes (SP) and A. baumannii (AB) are co-cultured with N. eutropha and ammonium (squares), N. eutropha without ammonium (circles), or killed N. eutropha and ammonium (triangles). Live N. eutropha with ammonium produces dramatically higher NO2 levels than the two control cultures, indicating that the live N. eutropha converts ammonium into NO2− under the culture conditions.
The bottom panels of FIG. 4B plot pH over time in the same co-culturing conditions. pH indicates the metabolic activity of the N. eutropha because the conversion of ammonia to nitrite produces hydrogen ions. SP and AB are co-cultured with N. eutropha and ammonium (squares), N. eutropha without ammonium (circles), killed N. eutropha and ammonium (triangles), or live N. eutropha with NaNO2 (inverted triangles). Live N. eutropha with ammonium acidifies the medium, in contrast to the three control cultures, indicating that the live N. eutropha metabolizes ammonium under the culture conditions.
FIG. 4E shows an alternative visualization the data of FIGS. 4A and 4B.
The capacity of Nitrosomonas eutropha D23 to inhibit proliferation of pathogenic bacteria due to nitrite production concurrent with acidification (acidified nitrite) was assessed by testing the survival of 5 strains of pathogenic bacteria in co-culture studies with D23 in vitro. The five strains of pathogenic bacteria included Propionibacterium acnes, Streptococcus pyogenes, methicillin-resistant Staphylococcus aureus (MRSA), Pseudomonas aeruginosa, and multidrug-resistant Acinetobacter baumannii. Incubation of N. eutropha D23 (1010 cells/ml) in the presence of ammonium led to nitrite concentrations of 10 mM or higher and acidification to pH 6 or lower (FIG. 4B). The combination of increased nitrite concentration and lowering of pH led to bactericidal or bacteriostatic effects and a marked reduction (up to 965-fold) in viable counts of the pathogenic bacterial species tested. The results of these studies are summarized in FIG. 4D and Table 7, below. In contrast to the D23 co-cultures incubated in the presence of ammonium, control co-cultures of the five pathogenic agents with D23 without ammonium, or with heat-killed D23 (B244) supplemented with ammonium, did not lead to any inhibitory or antimicrobial effects.
| TABLE 7 |
| Effect of N. eutropha D23 (D23) on relative survival of pathogenic |
| bacteria in vitro |
| Relative Survival (Fold Change) |
| Heat-Killed | |||
| Pathogen Tested | AOB + NH3 | AOB − NH3 | AOB + NH3 |
| Priopionibacterium acnes | −114 | −19,067 | −1.05 |
| ATCC 6919 | |||
| Staphylococcus aureus (MRSA) | −117.6 | 8.2 | 2.03 |
| ATCC BAA-1717 | |||
| Pseudomonas aeruginosa | −84.3 | 2.65 | 379 |
| ATCC 15442 | |||
| Streptococcus pyogenes | −965 | −2.88 | −3.81 |
| ATCC 19615 | |||
| Acinetobacter baumannii (MDR) | −5.43 | 92.4 | 89.8 |
| ATCC BAA-1605 | |||
The effect of Nitrosomonas eutropha D23 (sometimes also called B244) on wound closure in diabetic mice was evaluated in two separate studies. In Study 1, db/db mice (8 mice/group) were pre-treated by body immersion daily for one week with 3 concentrations of D23 (107, 108 or 109 cells/ml) supplemented with ammonium chloride, or with vehicle control suspension only. Subsequently, full-thickness wounds generated on the back of each animal were treated topically once daily for 14 days with vehicle alone or equal volumes of 3 concentrations of D23 (107, 108 or 109 cells/ml) in PBS supplemented ammonium chloride. Of the three D23-treated groups, the group receiving the highest dose showed significant improvement in wound closure from day 5 to day 15, with the most pronounced improvement of 83% observed on day 9 post-wounding. The median time to 50% wound closure was significantly reduced (P<0.05) for the animals treated with 109 cells/ml of D23, as compared to the animal group receiving vehicle treatment alone.
Initial histopathology analyses of wound tissue samples collected on Day 15 upon study completion did not reveal any gross differences between vehicle- and D23-treated animals. Subsequently, a more in-depth examination of the tissue sections was performed according to the scoring system and parameters adapted and modified form Altavilla, et al (2001). This analysis suggested a trend of increased levels of angiogenesis and maturity of granulation tissue with decreased levels of dermal inflammation in animals treated with 109 cells/ml of D23 versus the vehicle control group, which was consistent with the observed improvement in wound healing rates of the D23-treated animals
N. eutropha strain D23 was tested for its ability to accelerate wound healing in a diabetic mouse model, using C57BLKS/J Iar−+Leprdb/+Leprdb male mice (non-GLP). A detailed protocol is set out below.
Day −6 to Day 1: Whole-Body Immersion Pre-Treatment of Mice with Test Organism
| TABLE 8 | |||||
| 10× D23 | 1M | ||||
| (room | PBS | NH4/ | |||
| BATH/ | temp.) | pH 7.4 | Cl | CFU/ | |
| GROUP | (ml) | (ml) | (ml) | ml | |
| Vehicle | — | 500 | 1.0 | 0 | |
| (control) | |||||
| 1× D23 | 50 | 450 | 1.0 | 109 | |
| 0.1× D23 | 5 | 495 | 1.0 | 108 | |
| 0.01× D23 | 0.5 | 499 | 1.0 | 107 | |
| TABLE 9 | |||||
| PBS | 1M | ||||
| 1× D23 | pH 7.4 | NH4Cl | CFU/ | CFU/ | |
| GROUP | (ml) | (ml) | (μl) | ml | wound |
| Vehicle | 5.0 | 10 | 0 | 0 | |
| (control) | |||||
| 1× D23 | 5.0 | 0 | 10 | 109 | 2 × 108 |
| 0.1× D23 | 0.5 | 4.5 | 10 | 108 | 2 × 107 |
| 0.01× D23 | 0.05 | 4.95 | 10 | 107 | 2 × 106 |
As shown in FIG. 5A, topical application of 109 CFU/ml of strain D23 significantly (*p<0.05) accelerated wound healing. The sample size was N=8 animals/gp. The group receiving the highest doses showed significant improvement in would closure from day 5 to day 15, with the most pronounced improvement of 83% observed on day 9, post-wounding. This study demonstrates the potential therapeutic benefit of ammonia oxidizing bacteria, e.g., D23, to diabetic foot ulcers, chronic wounds, and other related indications.
FIG. 5B is a plot showing CT50 versus control (vehicle) and 109 CFU/ml D23. CT50 is the time required to achieve a 50% wound closure. As shown in the plot, those wounds having application of D23 provided for lower CT50 values.
FIG. 5C is a plot of another experiment in which the protocol above was carried out to obtain wound closure measurements versus time. Control (vehicle) wounds were tested and compared to D23 at 109 CFU/ml wounds. This plot shows the effects of D23 when immersion pre-treatment and topical application was carried out.
FIG. 5D is a plot of another experiment in which the protocol above was carried out, without immersion pre-treatment, to obtain wound closure measurements versus time. Control (vehicle) wounds were tested and compared to applications of D23 at 109 CFU/ml and 1010 CFU/ml to wounds. This plot shows the effects of D23 when topical application was carried out.
FIG. 5E is a plot showing CT50 versus control (vehicle) and 109 CFU/ml D23, with and without immersion pre-treatment, and 109 CFU/ml D23 without pre-treatment. As shown in the plot, those wounds having application of D23 provided for lower CT50 values.
FIG. 5F are images of the wound healing experiments, at Day 1, Day 11, and Day 15. AOB represents D23.
Possible modulation of inflammatory responses coupled with ant-infective action of D23 could prove an effective topical treatment against diabetic and other chronic wounds.
FIG. 5G are plots of blood glucose levels in the mice tested for the control (vehicle) and various concentrations of D23. “IM” shown in the x-axis of the right-hand panel plot represents those tests down with an immersion pre-treatment of D23. FIG. 5H is a plot of body weight of the animals used in testing for the study including immersion pre-treatment, over the time of the study. FIG. 5I are plots of body weight of the animals used in testing for the study, including the immersion pre-treatment study, and the study done without immersion pre-treatment, over the time of the studies.
In Study 2, the effect of pretreatment of db/db mice with 109 cells/ml of B244 on wound closure was examined. Groups of seven mice were treated topically with 109 cells/ml of B244 with and without prior body immersion. One additional group of seven mice was treated topically with 1010 cells/ml of D23 (B244). Corresponding vehicle groups (seven mice) were run in parallel with and without body immersion as negative controls. Wound surface area and photo images of each wound were obtained as before. These studies reproduced the findings of Study 1 suggesting improvement of wound closure with a B244 dose of approximately 109 cells/ml. Moreover, topical treatment alone with 109 cells/ml improved wound closure rates similar to the animals receiving topical treatments with immersion. Additional histopathology analyses by of H & E—stained wound tissue sections recovered on Day 5 did not reveal any differences between vehicle and D23 (B244)-treated wounds.
Cytokine and growth factor expression in D23-treated diabetic animals was investigated using Luminex technology. Specifically, expression of growth-regulated oncogene/keratinocyte chemoattractant (Gro/KC), interleukin-1 (IL-1), interleukin-6 (IL-6), macrophage inflammatory protein-2 (MIP-2), tumor necrosis factor (TNF), and vascular endothelial growth factor (VEGF) was compared between D23-treated and control diabetic animals in serum samples obtained on Day 5 and Day 15 from four mice per group treated with or without prior body immersion. In similar Luminex analyses, lysates of tissues from D23-treated or Vehicle control animals obtained upon completion of the study (Day 15) were also analyzed. Abnormally high and sustained expression of inflammation markers, including MIP-2, TNFα and IL-1β, has been previously associated with a dysregulated inflammatory response and impaired wound healing processes in db/db mice (Wetzler, 2000). Analyses of Day 5 and Day 15 serum samples yielded very low signal for all six cytokines in both D23-treated and vehicle control animals, a result indicating the lack of systemic effects following wound treatment with high D23 doses. In wound tissue lysates obtained on Day 15, MIP-2 levels (1155-1516 pg/100 g total protein) were significantly higher than the remaining five cytokines, with IL-6 and Gro/KC measured at much lower levels (44-48 pg/100 g total protein) and both IL-1 and VEGF being close to undetectable (≦3.8 pg/100 g total protein). Overall, no difference was observed between D23-treated animals and vehicle control animals with or without full-body immersion in D23 suspensions. The levels of all six cytokines or growth factors measured in tissue lysates of all four groups of mice examined are summarized in Table 10 below.
| TABLE 10 |
| Cytokine levels measured in wound tissue lysates of D23-treated and vehicle |
| control-treated db/db mice |
| MIP-2 | |||||||
| Gro/KC | IL-1β | IL-6 | (pg/ | TNFα | VEGF | ||
| (pg/100 g | (pg/100 g | (pg/100 g | 100 g | (pg/100 g | (pg/100 g | ||
| Treatment | Animal | protein) | protein) | protein) | protein) | protein) | protein) |
| Vehicle | 1-1 | 49 | 2.4 | 78 | 1089 | 28.7 | 5.8 |
| (with prior | 1-3 | 66 | 2.4 | 134 | 1335 | 31.2 | 4.5 |
| immersion) | 1-5 | 59 | 2.7 | 128 | 1112 | 25.7 | 4.2 |
| 1-7 | 76 | 1.2 | 148 | 1013 | 9.4 | 4.1 | |
| MEAN | 62 | 2.2 | 122 | 1137 | 23.7 | 4.7 | |
| D23 | 3-1 | 49 | 2.1 | 66 | 1830 | 24.7 | 4.1 |
| 109 cells/ml | 3-3 | 75 | 1.8 | 162 | 1615 | 32.3 | 3.6 |
| (with prior | 3-5 | 50 | 2.4 | 132 | 1896 | 23.9 | 4.3 |
| immersion) | 3-7 | 17 | 1.5 | 28 | 720 | 9.0 | 3.4 |
| MEAN | 48 | 1.9 | 97 | 1516 | 22.5 | 3.8 | |
| Vehicle | 5-1 | 43 | 1.5 | 90 | 833 | 13.2 | 3.6 |
| (topical | 5-3 | 55 | 2.2 | 104 | 1312 | 18.6 | 3.6 |
| only) | 5-5 | 44 | 1.4 | 59 | 644 | 17.6 | 3.2 |
| 5-7 | 100 | 3.8 | 168 | 1308 | 48.6 | 4.0 | |
| MEAN | 60 | 2.2 | 105 | 1024 | 24.5 | 3.6 | |
| D23 | 6-1 | 82 | 2.2 | 105 | 1573 | 28.5 | 2.9 |
| 109 cells/ml | 6-3 | 18 | 0.8 | 36 | 943 | 8.0 | 2.5 |
| (topical | 6-5 | 25 | 1.2 | 45 | 1027 | 9.5 | 2.2 |
| only) | 6-7 | 49 | 1.5 | 92 | 1077 | 18.5 | 2.9 |
| MEAN | 44 | 1.4 | 69 | 1155 | 16.1 | 2.6 | |
Pharmacokinetic evaluation of D23 (B244) in rodents was conducted during a 28-day repeat dose toxicology study as described in the section below. No separate single dose pharmacokinetic studies were run for D23 (B244).
28-Day Safety Study of Nitrosomonas eutropha D23 (B244) Application on Full-Thickness Wounds of Streptozotocin-Induced Diabetic Sprague-Dawley Rats
The objectives of this study were to determine the potential toxicity of Nitrosomonas eutropha D23 (B244) in rats when given dermally on wounded skin for a minimum of 28 days, and to evaluate the potential reversibility of any findings. In addition, the toxicokinetic characteristics of D23 (B244) were determined.
The design was based on the study objectives, the overall product development strategy for the test article, and the following study design guidelines: OECD Guidelines 407 and 417, Committee for Human Medicinal Products (CHMP), and ICH Harmonised Tripartite Guidelines M3 (R2), S3a, and S6 (R1). The study design is outlined herein and results are shown in Table 11.
| TABLE 11 |
| 28-Day Safety Study design |
| Dose | |||
| Volume | Dose | No. of Animals |
| Group | Test | Dose Level | (mL/kg) | Conc. | Main Study | Recovery |
| No. | Material | (CFU/kg/day) | Split | (CFU/mL) | M | F | M | F |
| 1 | Control | 0 | 0.8 | 0 | 10 | 10 | 5 | 5 |
| Article | ||||||||
| 2 | AOB-D23- | 6 × 107 | 0.8 | 8 × 107 | 10 | 10 | 0 | 0 |
| 100 | ||||||||
| 3 | AOB-D23- | 6 × 108 | 0.8 | 8 × 108 | 10 | 10 | 0 | 0 |
| 100 | ||||||||
| 4 | AOB-D23- | 6 × 109 | 0.8 | 8 × 109 | 10 | 10 | 5 | 5 |
| 100 | ||||||||
| M = Male, | ||||||||
| F = Female, | ||||||||
| Conc. = Concentration, | ||||||||
| CFU = Colony Forming Unit. | ||||||||
| Control Article = 99.998% Phosphate Buffered Saline, pH 7.4 (PBS), 0.002% 1M NH4Cl |
For induction of diabetes, Streptozotocin was administered to Sprague Dawley rats via intraperitoneal injection on Day −4. Animals with blood glucose levels of >200 mg/dL were considered as responders to the Streptozotocin treatment and were used for the dosing phase of the study. Two full-thickness skin wounds were created per animal (1 on each side of the back of each anesthetized animal) using an 8-mm skin biopsy punch. The wounds were left uncovered during administration of the control and test article and also for the duration of the study. The test and control articles were administered to the appropriate animals dermally once daily (for 24 hours±1 hour) from Days 1 to 28. The end points evaluated in this study were the following: clinical signs, dermal findings, body weights, body weight changes, food consumption, ophthalmology, glucose analysis, clinical pathology parameters (hematology, coagulation, clinical chemistry, urinalysis, hemoglobin A1c, and methemoglobulin), C-reactive protein and serum ferritin analysis, toxicokinetic parameters, gross necropsy findings, organ weights, and wound histopathology.
The results for the endpoints evaluated in the 28-day GLP toxicology study are outlined below in Table 12.
| TABLE 12 |
| 28-Day Safety Study-Results |
| End points | Observations | Comments |
| Mortality | No unscheduled deaths during the course of | |
| the study were attributed to D23 (B244). | ||
| One control male was found dead on Day | ||
| 41; the cause of death due to necrosis in the | ||
| kidney, liver, pancreas, and spleen | ||
| Clinical | No test article D23 (B244)-related clinical | Similar clinical signs |
| Observations | signs were observed during the study. | have been previously |
| Clinical signs including abdominal | associated with an | |
| distension, prominent backbone, fur | uncontrolled diabetic | |
| staining, soft stools and ungroomed | state in rats and other | |
| appearance were related to the diabetic state | animal models | |
| of the animals | ||
| Skin discoloration (red/black) was present | ||
| in both control and treated animals | ||
| Dermal Scores | No dermal irritation occurred during the | |
| study | ||
| No erythema or edema was observed | ||
| following dermal administration of the test | ||
| article | ||
| Body Weights and | No D23 (B244)-related effects on body | |
| Body Weight | weight or body weight change were noted | |
| Changes | during the study. | |
| Mean weight gain was observed throughout | ||
| the study interval, with isolated instances of | ||
| slight loss in individual animals across the | ||
| dose groups which did not follow specific | ||
| dose-related trends | ||
| Food Consumption | There were no test article-related effects on | |
| food consumption. | ||
| Ophthalmic | There were no D23 (B244)-related | The appearance of |
| Examinations | ophthalmologic changes during the study. The | cataracts is a known |
| majority of the animals on study developed | complication of | |
| cataracts and there were no differences among | diabetes | |
| dose groups. | ||
| Hematology, | No test article-related changes were noted in | |
| Coagulation, | hematology, coagulation, hemoglobin A1c, | |
| Hemoglobin A1c, | and methemoglobin parameters on | |
| and Methemoglobin | Day 29 or 43. | |
| Isolated statistically significant differences | ||
| were noted during the study; however, the | ||
| values were within the historical control | ||
| ranges and were not considered meaningful | ||
| Clinical Chemistry | No test article-related changes were noted on | |
| Days 29 or 43. | ||
| Isolated statistically significant differences | ||
| were noted during the study; however, the | ||
| values were within the historical control | ||
| ranges and not considered meaningful | ||
| Urinalysis | No test article-related effects | |
| C-reactive Protein | No test article-related effects | |
| and Serum Ferritin | ||
| Analysis | ||
| Gross Pathology | No test article-related gross findings were | Any gross findings |
| noted on Day 29 or Day 43 | observed were | |
| considered to be related | ||
| to the diabetic | ||
| condition of the rats | ||
| and incidental in nature | ||
| Organ Weights | There was an increase in adrenal weight in | |
| females at ≧6 × 108 CFU/kg/day on Day 29, | ||
| whereas adrenal weight was decreased in | ||
| males and there were no associated gross | ||
| pathology findings making the association | ||
| of this finding to D23 (B244) administration | ||
| equivocal | ||
| Potential D23 (B244)-related organ weight | ||
| changes noted at the terminal euthanasia | ||
| (Day 29) were not observed at the end of the | ||
| recovery period (Day 43) | ||
| Histopathology | No D23 (B244)-related microscopic findings | |
| Terminal | on Day 29. | |
| Euthanasia (Day 29) | Changes observed in the kidneys, large and | |
| small intestine, and urinary bladder were | ||
| related to the diabetic state of the animals. | ||
| The incidence and severity of these | ||
| findings were similar in all study groups | ||
| including controls. | ||
| Changes at the administration/wound sites | ||
| included epidermal regeneration, fibrosis, | ||
| and granulomatous inflammation. The | ||
| incidence and severity of these findings | ||
| were similar in all groups including | ||
| controls | ||
| Histopathology | Changes observed on Day 43 were similar | |
| Recovery | to those reported on Day 29 | |
| Euthanasia (Day 43) | ||
No D23 related mortality occurred during the study. There were no D23-related clinical signs or dermal irritation, and there were no effects on body weight, body weight changes, food consumption, clinical pathology parameters, C-reactive protein, or serum ferritin during the study. There were no test article-related gross necropsy findings or histopathologic findings. Increases in adrenal weights were noted in the >6×108 CFU/kg/day females on Day 29; however, association with D23 was considered equivocal based on the lack of a similar effect in the males, the lack of corresponding gross findings, and the lack of microscopic evaluation of this tissue.
All wound sites were completely covered by epidermis and appeared to be in the remodeling/resolution phase, which was characterized by stratification of the epidermis with keratinization and refinement of the dermal collagen (synthesis, bundling, and degradation) and capillaries to restore the normal architecture of the epidermis and dermis. The incidence and severity were similar in all groups, including controls.
The activities of five antibiotics, each representing a different antibiotic class, were tested against Nitrosomonas eutropha D23. The antibiotics tested included clindamycin, erythromycin, gentamicin, piperacillin with or without the β-lactamase inhibitor Tazobactam, and tetracycline. These were chosen based on the Clinical and Laboratory Standards Institute (CLSI) recommendations for routine testing and reporting of phylogenetically-related proteobacteria (Pseudomonas aeruginosa) listed under Non-fastidious organisms and Non-Enterobacteriaceae in the CLSI 24th Informational Supplement (M100-524), and also included topical or systemic antimicrobial agents commonly used against acne, such as clindamycin or tetracycline. Studies with clindamycin were included even though this antibiotic was not expected to be very effective at inhibiting Nitrosomonas, as is the case for other aerobic Gram-negative bacteria.
Minimal Inhibitory Concentrations (MICs) were determined by culturing N. eutropha D23 in decreasing concentrations of each of the five antibiotics. Bacterial growth at 30° C. was monitored for 48-72 hr by determining optical density (OD600) values in samples collected at 24 hr intervals. MIC values were identified as the lowest antibiotic concentration from a two-fold dilution series leading to no increase in OD600 measurements for the 2 or 3-day incubation period. The N. eutropha D23 phenotype in each antibiotic test was determined as Susceptible, Intermediate, or Resistant according to the MIC Interpretive Criteria provided by the CLSI. As summarized in Table 13, these studies demonstrated susceptibility of N. eutropha D23 to erythromycin and gentamicin and intermediate resistance to tetracycline and piperacillin suggesting the lack of strong antibiotic-resistance potential by the Drug Substance. Clindamycin resistance observed for N. eutropha D23 is in agreement with previous reports for natural resistance of aerobic Gram-negative bacteria to this antibiotic. In addition to testing the β-lactam antibiotic piperacillin alone, the broad range β-lactamase inhibitor Tazobactam was also tested in combination with piperacillin to assess the possible expression of β-lactamase(s) by N. eutropha D23. The results from this comparison showed no increase in N. eutropha D23 susceptibility, indicating the absence of β-lactamase expression by N. eutropha D23, at least under the conditions tested.
| TABLE 13 |
| MIC values for five antibiotics tested against N. eutropha |
| D23 cultures in vitro |
| MIC | MIC Interpretive | ||
| Antibiotic | Antibiotic Class | (μg/ml) | Criteria* |
| Clindamycin | Lincosamide | >16 | Resistant (≧4 μg/ml) |
| Erythromycin | Macrolide | 0.16 | Susceptible (≦0.5 μg/ml) |
| Gentamicin | Aminoglycoside | 0.25 | Susceptible (≦4 μg/ml) |
| Piperacillin | β-lactam | 64 | Intermediate |
| (32-64 μg/ml) | |||
| Piperacillin/ | β-lactam/ | 64/4 | Intermediate |
| Tazobactam | β-lactamase | (32/4-64/4 μg/ml) | |
| inhibitor | |||
| Tetracycline | Tetracycline | 8 | Intermediate (8 μg/ml) |
| *as recommended by the Clinical and Laboratory Standards Institute (values in parentheses represent MIC levels for corresponding Susceptible, Intermediate or Resistant outcomes) |
These studies demonstrate susceptibility of D23 (B244) to macrolide and aminoglycoside antibiotics and resistance to lincosamides, results that indicate the lack of strong antibiotic-resistance potential by the Drug Substance.
N. eutropha was defined at the species and the strain level using PCR and gene sequencing methodologies. The species level was defined as N. eutropha by sequencing of the V1-V5 variable regions of the 16S rRNA gene. N. eutropha was defined as a novel N. eutropha strain D23 by identification of a unique gene from whole genome sequence analysis. N. eutropha was defined at the species level as N. eutropha by 16S rRNA gene sequencing using the MicroSeq 500 rDNA Bacterial Identification PCL and sequencing kit.
Strain identity may be determined using custom primers, which correspond to the underlined portions of the following sequence and the D23 1c1355 sequence & primers Table 14 below. While not wishing to be bound by theory, it is believed that gene D23 1c1355 is unique to N. eutropha D23, and thus performing a PCR amplification reaction within gene D23 1c1355 will indicate whether N. eutropha D23 is present in a given sample.
| TABLE 14 |
| D23_1c1355 sequence & primers |
| Product | ||||
| Tm | Posi- | size | ||
| Primer | Sequence (5′-3′) | (° C.) | tion | (bp) |
| D23_ | AATCTGTCTCCACAGGCAGC | 54 | 287-305 | 595 |
| 1c1355-F | (SEQ ID NO: 64) | |||
| D23_ | TATACCCACCACCCACGCTA | 54 | 881-862 | |
| 1c1355-R | (SEQ ID NO: 65) | |||
| D23_1c1355 outer membrane autotransporter |
| barrel domain-containing protein |
| (SEQ ID NO: 66) |
| TTGGTTGGTTTGAAACAGGTAAGGGAGAAGGAGGAAAATCGCCAGAATAT |
| 10 20 30 40 50 |
| CGTCGCCAAAGGTTATCGGATCACCATAGCTTATCCACTCAAAGGGGAGA |
| 60 70 80 90 100 |
| TTATCATGAGCAAGGTTCGTCGATTAAAAAAGAGTTTATATACGGTTACT |
| 110 120 130 140 150 |
| GCACTAACTCTCGGTTTCGGACCATTTGTGACAGCGAGTGGACAATCATT |
| 160 170 180 190 200 |
| CGAAGAAACACCCGTACAAACACCCGGACGAGCTTTTGCAGTGGACAATT |
| 210 220 230 240 250 |
| TAAAGGGTATCTGTGTACAAAACACAAGTGAAGACCCCTCATTAGCAATA |
| 260 270 280 290 300 |
| GCTTGCACCTTCGCACTGGGCGGGATAAATGATATTACCGCGCAGAATCT |
| 310 320 330 340 350 |
| GTCTCCACAGGCAGCGATTCAGGCCGAGTCGATCGCGATTACTTCTCCCT |
| 360 370 380 390 400 |
| ATCAGTTTATTCGCAGCACGAATGAAAGCATACAGCGGCTAACAGGTCGC |
| 410 420 430 440 450 |
| TCTGCTGAGAAACGTCAGCAACAATCCTCTTTTTTACTACAAAGCTCAGC |
| 460 470 480 490 500 |
| GTCGGTAGCAGGCACGCCATCATTTGGCACTTCTGGTTTTATAGGGCCTG |
| 510 520 530 540 550 |
| TAGGGGTTTCGCTGAGCGGTGGCGGGAGCTTTGGTGAACGCAATACCGCT |
| 560 570 580 590 600 |
| GAAGGGCAGACCGGTTTTCAATTGAATACCCGGCAAACCAGCCTGATGAT |
| 610 620 630 640 650 |
| CGATTATTCATTTAATCAAAAATTGATTGGCGGCTTTTCCTTTAATTATC |
| 660 670 680 690 700 |
| TGGGGACAGATCGTAATTTGAGATTGGCGAGTGGGGACTTGAATTCCGAT |
| 710 720 730 740 750 |
| AGCTATCGGTTTGCACCCTTTGTGCTTTTCAGACCAACTACCAATAGCTA |
| 760 770 780 790 800 |
| CTTAACTCTGATGGGAGGGTATGCTTTGGTTAATTATCGTTCCACGCGCA |
| 810 820 830 840 850 |
| GCGTTTCGAGTCAAAATGACATCACGTTTGATAACGCCACAGCCAACTAT |
| 860 870 880 890 900 |
| GATGCTAATCAGTTTTTTGCTAGCGTGGGTGGTGGGTATACCTTTACTTT |
| 910 920 930 940 950 |
| AATGGATGGATGGAATCTGCGAGGATATGGTCGCGGGGACTTTAGTGATA |
| 960 970 980 990 1000 |
| TTAGTATCCAGAGCTTTCAGGAAAAAGGTGGCGTTGCTCATAGTGGGAAC |
| 1010 1020 1030 1040 1050 |
| GATAGTTTATCTCTTGCTATGTCTGTGAATAAACAAACCATACGCTCGGT |
| 1060 1070 1080 1090 1100 |
| TACCAGTACATTAGGCGTTGAACTTAGTCATGCAATTAGCACCAGAACTT |
| 1110 1120 1130 1140 1150 |
| TTATTCCCGTCATTATCCCGAGACTGCGTGCAGAATGGGTGCATGAATTT |
| 1160 1170 1180 1190 1200 |
| GAAAACAATGCCAGAACTATCACGGCCGGTTTCACTGGCCAGAACTATAG |
| 1210 1220 1230 1240 1250 |
| TCCCACTTCTGCATCAATGGCAGTTGCAAGCTCAGTGCGTAATTGGGCAA |
| 1260 1270 1280 1290 1300 |
| ACCTGGGGGTTGGAGTGCAAATGCTGTTTGCCCGCTCGATTATCGGGTAC |
| 1310 1320 1330 1340 1350 |
| ATTAATTACGACAGATTAATTATCAAGCACGCGGAGAACAATATCATTTC |
| 1360 1370 1380 |
| TGGTGGGATTCGTATGAATTTCTAA |
Ammonia oxidizing bacteria (N. eutropha D23) was applied topically to the back of the head of a subject for over 2 weeks. The dose was 3×1010 CFU applied per day. The product concentration was 1×109 CFU/ml (15 ml, two times a day) in a phosphate buffer with magnesium chloride. On each day a skin swab was taken to isolate and sequence all the bacterial DNA that was present, using isolation and sequencing protocols known in the art.
Ammonia oxidizing bacteria of the genus Nitrosomonas was not present in the Day 0 sample, and was detected and present in the Day 7, 14, and 16 skin swabs.
As shown in FIGS. 17 and 18, which plots the proportion versus bacterial genus for Day 0, 1, 8, 14, and 16, the application of ammonia oxidizing bacteria led to proportional increases in commensal non-pathogenic Staphylococcus (which was at least 98% Staphylococcus epidermidis) from close to 0% on day 0 to approximately 50% on day 16. Additionally, application of ammonia oxidizing bacteria led to a proportional reduction in potentially pathogenic or disease associated Propionibacteria over the time period tested (from over 75% on day 0 to less than 50% on day 16). Application of ammonia oxidizing bacteria also led to reductions in potentially pathogenic or disease associated Stenotrophomonas over the time period tested (from 0.1% on day 0 to less than 0.01% on day 16.)
Some of the data shown in FIGS. 1 and 2 is also presented below in Table 15.
| TABLE 15 |
| Genera by Day |
| Proportion | Proportion | Proportion | ||
| by genus: | by genus: | by genus: | ||
| Day | Propionibacteria | Staphylococci | Stenotrophomonas | |
| 0 | 0.78 | 0.01 | 0.13 | |
| 1 | 0.79 | 0.1 | 0 | |
| 8 | 0.8 | 0.15 | 0 | |
| 14 | 0.55 | 0.45 | 0.001 | |
| 16 | 0.48 | 0.49 | 0 | |
As shown in Table 15, the proportion of Propionibacteria was reduced after about 14 days (compare data for Day 0, 1, and 8 with Day 14 and 16 in Table 15). The proportion of Staphylococci increased after about two weeks (compare data for Day 0, 1, and 8 with Day 14 and 16 in Table 15). The proportion of Stenotrophomonas decreased after about 1 day (compare data for Day 0 with Day 1, 8, 14, and 16 in Table 15).
These changes in the skin microbiome composition to a less pathogenic state indicate that application of ammonia oxidizing bacteria would be useful in treatment of dermatologic diseases including but not limited to acne, eczema, skin infections, and rosacea.
A blinded, placebo-controlled 24 human volunteer study randomized 4:1 AOB to placebo control was performed. Subjects applied a Nitrosomonas suspension (109 CFU/ml, 2 times per day, for a total of 3×1010 CFU per day) to their face and scalp twice daily for one week and were followed for two additional weeks post-application. Volunteers were instructed to refrain from using hair products during the one-week AOB application as well as the week following application, then returned to regular shampoo use for the third week. Scalp swabs were obtained on Day 0 as baseline controls and on Day 1, 3, 8, 14 and 21 to assess presence/absence of AOB by PCR and 16S rRNA sequencing analyses.
No serious adverse events were associated with AOB application for one week and the product was deemed safe. AOB users reported a clear improvement in skin condition and quality, as indicated by self-assessment reports completed after the seven-day application period. Using AOB-specific PCR analyses of the skin samples, we could demonstrate presence of the bacteria in 83-100% of AOB users during the application period, whereas no AOB were detected in the placebo control samples. All subjects lacked AOB from baseline swabs obtained prior to study initiation, consistent with the predicted sensitivity of these bacteria to soaps and other commercial products. Amplification of the 16S rRNA gene and sequencing of a subset of samples confirmed presence of AOB in corresponding samples and suggested potential trends in modulating the skin microbiome by topical AOB application. In summary, live AOB-based products are safe and could hold great promise as novel self-regulating topical delivery agents of nitrite and nitric oxide to the human skin.
As shown in Table 16, below, the proportion of Nitrosomonas (AOB) went up when comparing Day 0 versus Day 8. The proportion of other bacteria, Propionibacterium, Enterobacter, and Citrobacter went down, when comparing Day 0 versus Day 8. The p-values indicated in Table 16 demonstrate that the most significant change between Day 0 and Day 8 was observed with Nitrosomonas (AOB) followed by Propionibacterium. Enterobacter and Citrobacter also showed changes between Day 0 and Day 8 to a lesser degree.
| TABLE 16 |
| Trends in microbiome composition following AOB application |
| (Day 0 versus Day 8) |
| Genus | P-value (unadjusted) | Trend | |
| Nitrosomonas (AOB) | 0.0039 | Up | |
| Propionibacterium | 0.0078 | Down | |
| Enterobacter | 0.0346 | Down | |
| Citrobacter | 0.036 | Down | |
Because nitrite and nitric oxide have been implicated in critical physiological functions, such as vasodilation, skin inflammation and wound healing, we have hypothesized that AOB may have beneficial effects on both healthy and immunopathological skin conditions by metabolizing ammonia from sweat while concurrently driving skin acidification. We reasoned that Nitrosomonas would be safe for human use because they are slow-growing and incapable of utilizing organic carbon sources, they are sensitive to antibiotics, and they have never been linked to animal or human disease. Here we describe a blinded, placebo-controlled 24 human volunteer study where subjects applied a live Nitrosomonas suspension to their face and scalp twice daily for one week and were subsequently followed for two additional weeks. Volunteers did not use hair products during the first and second week, then they returned to their regular routine for the third week. Scalp swabs were obtained on Day 0 as baseline controls and on Day 1, 3, 8, 14 and 21 to assess presence/absence of Nitrosomonas and to examine microbial diversity. Importantly, no adverse events were associated with topical application. PCR analyses demonstrated presence of the bacteria in 83%-100% of skin swabs obtained from AOB users during or immediately after completion of the one-week application period (Day 1, 3 or 8) and in 60% of the users on Day 14, but not in any of the placebo control samples. All subjects lacked AOB from baseline swabs obtained prior to study initiation. Increased levels of AOB during the one-week application period correlated with a qualitative improvement in skin condition, in contrast to no improvement reported by placebo control subjects. Sequencing of the 16S rRNA gene amplification product obtained from a subset of subjects verified the presence of AOB in corresponding samples and suggested potential modulation of the skin microbiome composition. In summary, live Nitrosomonas are well tolerated and may hold promise as novel self-regulating topical delivery agents of nitrite and nitric oxide to the human skin.
Here, we present the results from preliminary studies in humans where we have begun evaluating topical application of a Nitrosomonas suspension to the human skin and the potential of using AOB as natural delivery systems of NO/NO2− in vivo. We have explored methodologies for AOB detection in skin specimens and the possible effects of AOB in skin microbial communities, as well as collected important user feedback from the early adopters of our topical cosmetic.
Methods
Culture Conditions.
N. eutropha D23 was propagated in batch culture at 28-30° C. in mineral salt medium supplemented with 20-50 mM NH4+ and sodium carbonate as the carbon source [Ensign et al, 1993]. For continuous culture, D23 was grown at ˜109 cells/ml in a 1 liter mini-Bioreactor (Applikon Biotechnology) at 28° C. using sodium carbonate for both pH neutralization and the carbon source.
Nitrite Quantification.
Nitrite concentrations in culture supernatants were determined using the Griess colorimetric assay [Hageman and Kucklesby, 1971] and sodium nitrite as standards.
DNA Extraction from Skin Swabs.
Samples were maintained in 1 ml of 10% AssayAssure Bioservative (Thermo Scientific) diluted in PBS. Biomass was centrifuged and cells were lysed using a method developed for skin specimens [Grice, 2009] with modifications to the buffer designed to maintain long DNA integrity. DNA was then purified using the PowerLyzer UltraClean microbial DNA isolation kit (Mo Bio Laboratories). N. eutropha D23 was identified using a 3-gene PCR signature amplifying the ammonia monooxygenase encoding locus amoCAB.
PCR and Library Preparation.
Full-length 16S rRNA genes were amplified in duplicate reactions using a cocktail of primers and AccuPrime DNA polymerase SuperMix kit (Life Technologies). All PCR products were directly treated with the SMRTbell Template Prep Kit followed by the DNA/Polymerase Binding Kit P4 (Pacific Biosciences).
16S rDNA Sequencing and Analysis.
PCR products were sequenced using the Pacific Biosciences RS instrument [Eid, 2009]. Raw base calls were transformed to consensus DNA sequences using the Pacific Biosciences Consensus Tools package and then processed with the Whole Biome Microbiome Profiling Platform to obtain phylum-genus and strain-level frequency measures for each sample.
Human Volunteer Study.
A total of 24 male volunteers were included in a blinded, placebo-controlled, study each for a total of three weeks according to a protocol for topical AOB-001 use approved by the Allendale Institutional Review Board (Old Lyme, Conn.). Written informed consent was obtained from each study participant. Subjects applied 15 ml of an aqueous suspension of N. eutropha (AOB-001), or placebo (vehicle), twice daily containing ˜109 cells/ml.
The human volunteer study design for the preliminary evaluation of a Nitrosomonas-containing topical suspension (AOB-001) is shown in FIG. 5K. Detection of AOB was performed by PCR in scalp swab samples. FIG. 5L shows PCR analyses of scalp swabs collected during the study. The left panel indicates the percent-positive samples for AOB-specific three-gene signature (amoA, amoB, amoC). The right panel indicates the Composite PCR scores for a total of six samples collected from each of 23 volunteers. The scoring scheme used for the positive samples collected at each of six sampling points is indicated.
Skin microbiome composition prior and during AOB-001 application were obtained by 16S rDNA sequencing. FIG. 5M indicates that genus-level bacterial diversity as determined by 16S rDNA sequencing in skin swab samples collected before and after topical application of AOB-001.
The percentage of the total sequence reads representing each of twelve bacterial genera in samples collected at baseline prior to application (Day 0) and immediately after the one week application (Day 8), or one week after stopping topical application (Day 14), are shown.
FIG. 5N indicates changes in abundance of Nitrosomonas and other species in skin samples collected before and after AOB-001 application. Panel A shows percentages of the total 16S rDNA sequence reads representing Nitrosomonas prior to application (Day 0), immediately after the one-week application (Day 8), or one week after terminating application (Day 14) are shown. Panel B shows a change in patterns in abundance of species detected by 16S rDNA sequencing in Day 0 versus Day 8 samples collected from AOB users.
AOB-001 users report an improvement in skin condition. FIG. 5O shows a user evaluation of AOB-001. Assessment of AOB-001 cosmetic effects was provided by 23 volunteers upon completion of the one week application to their scalp and face. Subjects were plotted in order of increasing composite PCR scores. (The responses were categorized as 2=agree strongly; 0=no change; −2=disagree strongly). In summary, AOB-001 is well-tolerated. The user responses in a blind study indicate improved skin/scalp condition. AOB (Nitrosomonas) are readily detectable in skin microbiome samples by PCR and 16S rRNA gene sequencing. Preliminary microbiome analyses indicate modulation of skin microbiota by AOB.
| SUPPLEMENTARY TABLE 1 |
| Annotation of genes in SEQ ID NO: 1. |
| Feature | Length | D23 | C91 | |||||||
| ID | Type | Start | Stop | Frame | Strand | (bp) | Function | Subsystem | Gbkld | Alias |
| fig|6666666.60966.peg.1 | CDS | 35 | 1414 | 2 | + | 1380 | Chromosomal | Cell Division Subsystem | D23_1c0001 | Neut_0001 |
| replication initiator | including YidCD; | |||||||||
| protein DnaA | <br>DNA replication | |||||||||
| cluster 1 | ||||||||||
| fig|6666666.60966.peg.2 | CDS | 1619 | 2740 | 2 | + | 1122 | DNA polymerase III beta | Cell Division Subsystem | D23_1c0002 | Neut_0002 |
| subunit (EC 2.7.7.7) | including YidCD; | |||||||||
| <br>DNA replication | ||||||||||
| cluster 1 | ||||||||||
| fig|6666666.60966.peg.3 | CDS | 2798 | 5227 | 2 | + | 2430 | DNA gyrase subunit B | Cell Division Subsystem | D23_1c0003 | Neut_0003 |
| (EC 5.99.1.3) | including YidCD; | |||||||||
| <br>DNA gyrase | ||||||||||
| subunits; <br>DNA | ||||||||||
| replication cluster 1; | ||||||||||
| <br>DNA | ||||||||||
| topoisomerases, Type II, | ||||||||||
| ATP-dependent; | ||||||||||
| <br>Resistance to | ||||||||||
| fluoroquinolones | ||||||||||
| fig|6666666.60966.peg.4 | CDS | 5248 | 5691 | 1 | + | 444 | FIG039061: | -none- | D23_1c0004 | Neut_0004 |
| hypothetical protein | ||||||||||
| related to heme | ||||||||||
| utilization | ||||||||||
| fig|6666666.60966.peg.5 | CDS | 5748 | 6479 | 3 | + | 732 | tRNA pseudouridine | Colicin V and Bacteriocin | D23_1c0005 | Neut_0005 |
| synthase A (EC 4.2.1.70) | Production Cluster; | |||||||||
| <br>RNA pseudouridine | ||||||||||
| syntheses; <br>tRNA | ||||||||||
| modification Bacteria; | ||||||||||
| <br>tRNA processing | ||||||||||
| fig|6666666.60966.peg.6 | CDS | 7261 | 7518 | 1 | + | 258 | 4Fe—4S ferredoxin, iron- | Inorganic Sulfur | D23_1c0009 | Neut_0127 |
| sulfur binding | Assimilation | |||||||||
| fig|6666666.60966.peg.7 | CDS | 7584 | 7946 | 3 | + | 363 | FIG00858425: | -none- | D23_1c0010 | Neut_0128 |
| hypothetical protein | ||||||||||
| fig|6666666.60966.peg.8 | CDS | 11430 | 7966 | −3 | − | 3465 | Transcription-repair | Transcription factors | D23_1c0011 | Neut_0129 |
| coupling factor | bacterial; | |||||||||
| <br>Transcription repair | ||||||||||
| cluster | ||||||||||
| fig|6666666.60966.peg.9 | CDS | 12737 | 11457 | −2 | − | 1281 | InterPro IPR003416 | -none- | D23_1c0012 | Neut_0130 |
| COGs COG3174 | ||||||||||
| fig|6666666.60966.peg.10 | CDS | 14499 | 12730 | −3 | − | 1770 | Single-stranded-DNA- | DNA Repair Base | D23_1c0013 | Neut_0131 |
| specific exonuclease | Excision | |||||||||
| RecJ (EC 3.1.—.—) | ||||||||||
| fig|6666666.60966.peg.11 | CDS | 15277 | 14681 | −1 | − | 597 | InterPro IPR000345 | -none- | D23_1c0014 | Neut_0132 |
| fig|6666666.60966.peg.12 | CDS | 16285 | 15365 | −1 | − | 921 | Indole-3-glycerol | Chorismate: | D23_1c0015 | Neut_0133 |
| phosphate synthase (EC | Intermediate for | |||||||||
| 4.1.1.48) | synthesis of Tryptophan, | |||||||||
| PAPA antibiotics, PABA, | ||||||||||
| 3-hydroxyanthranilate | ||||||||||
| and more.; | ||||||||||
| <br>Tryptophan | ||||||||||
| synthesis | ||||||||||
| fig|6666666.60966.peg.13 | CDS | 17321 | 16296 | −2 | − | 1026 | Anthranilate | Auxin biosynthesis; | D23_1c0016 | Neut_0134 |
| phosphoribosyltransferase | <br>Chorismate: | |||||||||
| (EC 2.4.2.18) | Intermediate for | |||||||||
| synthesis of Tryptophan, | ||||||||||
| PAPA antibiotics, PABA, | ||||||||||
| 3-hydroxyanthranilate | ||||||||||
| and more.; | ||||||||||
| <br>Tryptophan | ||||||||||
| synthesis | ||||||||||
| fig|6666666.60966.peg.14 | CDS | 17920 | 17318 | −1 | − | 603 | Anthranilate synthase, | Chorismate: | D23_1c0017 | Neut_0135 |
| amidotransferase | Intermediate for | |||||||||
| component (EC | synthesis of Tryptophan, | |||||||||
| 4.1.3.27) | PAPA antibiotics, PABA, | |||||||||
| 3-hydroxyanthranilate | ||||||||||
| and more.; | ||||||||||
| <br>Tryptophan | ||||||||||
| synthesis | ||||||||||
| fig|6666666.60966.peg.15 | CDS | 18046 | 19545 | 1 | + | 1500 | Putative sensor-like | -none- | D23_1c0018 | Neut_0136 |
| histidine kinase YfhK | ||||||||||
| fig|6666666.60966.peg.16 | CDS | 19644 | 20081 | 3 | + | 438 | FIG00858754: | -none- | D23_1c0019 | Neut_0137 |
| hypothetical protein | ||||||||||
| fig|6666666.60966.peg.17 | CDS | 20101 | 21465 | 1 | + | 1365 | Putative sensory | -none- | D23_1c0020 | Neut_0138 |
| histidine kinase YfhA | ||||||||||
| fig|6666666.60966.peg.18 | CDS | 22742 | 21474 | −2 | − | 1269 | PDZ/DHR/GLGF domain | -none- | D23_1c0021 | Neut_0139 |
| protein | ||||||||||
| fig|6666666.60966.peg.19 | CDS | 26700 | 22798 | −3 | − | 3903 | Phosphoribosylformylglycinamidine | De Novo Purine | D23_1c0022 | Neut_0140 |
| synthase, | Biosynthesis; <br>De | |||||||||
| synthetase subunit (EC | Novo Purine | |||||||||
| 6.3.5.3)/ | Biosynthesis | |||||||||
| Phosphoribosylformylglycinamidine | ||||||||||
| synthase, | ||||||||||
| glutamine | ||||||||||
| amidotransferase | ||||||||||
| subunit (EC 6.3.5.3) | ||||||||||
| fig|6666666.60966.peg.20 | CDS | 26942 | 28510 | 2 | + | 1569 | hypothetical protein | -none- | D23_1c0023 | Neut_0141 |
| fig|6666666.60966.peg.22 | CDS | 28682 | 28867 | 2 | + | 186 | hypothetical protein | -none- | D23_1c0024 | NA |
| fig|6666666.60966.peg.23 | CDS | 29060 | 28851 | −2 | − | 210 | Death on curing | Phd-Doc, YdcE-YdcD | D23_1c0025 | NA |
| protein, Doc toxin | toxin-antitoxin | |||||||||
| (programmed cell death) | ||||||||||
| systems | ||||||||||
| fig|6666666.60966.peg.24 | CDS | 29367 | 29227 | −3 | − | 141 | Prevent host death | Phd-Doc, YdcE-YdcD | D23_1c0026 | Neut_0143 |
| protein, Phd antitoxin | toxin-antitoxin | |||||||||
| (programmed cell death) | ||||||||||
| systems | ||||||||||
| fig|6666666.60966.peg.25 | CDS | 29726 | 30082 | 2 | + | 357 | blr1219; hypothetical | -none- | D23_1c0028 | Neut_0144 |
| protein | ||||||||||
| fig|6666666.60966.peg.26 | CDS | 30113 | 31672 | 2 | + | 1560 | NAD(P)HX epimerase/ | YjeE; <br>YjeE | D23_1c0029 | Neut_0145 |
| NAD(P)HX dehydratase | ||||||||||
| fig|6666666.60966.peg.29 | CDS | 31959 | 32078 | 3 | + | 120 | hypothetical protein | -none- | D23_1c0030 | NA |
| fig|6666666.60966.peg.30 | CDS | 32096 | 32914 | 2 | + | 819 | O-antigen export | -none- | D23_1c0031 | Neut_0146 |
| system permease | ||||||||||
| protein RfbD | ||||||||||
| fig|6666666.60966.peg.31 | CDS | 33063 | 33266 | 3 | + | 204 | hypothetical protein | -none- | D23_1c0032 | Neut_0147 |
| fig|6666666.60966.peg.32 | CDS | 33441 | 33995 | 3 | + | 555 | hypothetical protein | -none- | D23_1c0033 | Neut_0148 |
| fig|6666666.60966.peg.33 | CDS | 34044 | 34424 | 3 | + | 381 | hypothetical protein | -none- | D23_1c0034 | NA |
| fig|6666666.60966.peg.34 | CDS | 34530 | 35588 | 3 | + | 1059 | putative transposase | -none- | D23_1c0035 | Neut_0149 |
| fig|6666666.60966.peg.36 | CDS | 36348 | 36064 | −3 | − | 285 | HigA protein (antitoxin | Toxin-antitoxin replicon | D23_1c0037 | Neut_0150 |
| to HigB) | stabilization systems | |||||||||
| fig|6666666.60966.peg.37 | CDS | 36621 | 36379 | −3 | − | 243 | HigB toxin protein | Toxin-antitoxin replicon | D23_1c0038 | Neut_0151 |
| stabilization systems | ||||||||||
| fig|6666666.60966.peg.38 | CDS | 36580 | 36750 | 1 | + | 171 | hypothetical protein | -none- | D23_1c0039 | NA |
| fig|6666666.60966.peg.39 | CDS | 36747 | 38108 | 3 | + | 1362 | Teichoic acid export | Rhamnose containing | D23_1c0040 | Neut_0152 |
| ATP-binding protein | glycans | |||||||||
| TagH (EC 3.6.3.40) | ||||||||||
| fig|6666666.60966.peg.40 | CDS | 38105 | 42433 | 2 | + | 4329 | Glycosyl transferase, | -none- | D23_1c0041 | Neut_0153 |
| group 2 family protein | ||||||||||
| fig|6666666.60966.peg.41 | CDS | 42537 | 43733 | 3 | + | 1197 | glycosyl transferase, | -none- | D23_1c0042 | NA |
| group 1/2 family | ||||||||||
| protein | ||||||||||
| fig|6666666.60966.peg.42 | CDS | 43945 | 44838 | 1 | + | 894 | Alpha-L-Rha alpha-1,3- | Rhamnose containing | D23_1c0043 | Neut_0166 |
| L-rhamnosyltransferase | glycans | |||||||||
| (EC 2.4.1.—) | ||||||||||
| fig|6666666.60966.peg.43 | CDS | 45457 | 45140 | −1 | − | 318 | HigA protein (antitoxin | Toxin-antitoxin replicon | D23_1c0044 | Neut_0167 |
| to HigB) | stabilization systems | |||||||||
| fig|6666666.60966.peg.44 | CDS | 45610 | 45470 | −1 | − | 141 | HigB toxin protein | Toxin-antitoxin replicon | D23_1c0045 | Neut_0168 |
| stabilization systems | ||||||||||
| fig|6666666.60966.peg.45 | CDS | 45950 | 46279 | 2 | + | 330 | Glycosyl transferase, | -none- | D23_1c0046 | Neut_0169 |
| group 2 family protein | ||||||||||
| fig|6666666.60966.peg.47 | CDS | 47082 | 46804 | −3 | − | 279 | hypothetical protein | -none- | D23_1c0047 | NA |
| fig|6666666.60966.peg.49 | CDS | 48719 | 47757 | −2 | − | 963 | Mobile element protein | -none- | D23_1c0049 | Neut_0978 |
| fig|6666666.60966.peg.50 | CDS | 48899 | 48777 | −2 | − | 123 | Mobile element protein | -none- | D23_1c0050 | Neut_0357 |
| fig|6666666.60966.peg.51 | CDS | 49218 | 48970 | −3 | − | 249 | Mobile element protein | -none- | D23_1c0051 | Neut_2405 |
| fig|6666666.60966.peg.52 | CDS | 49615 | 49502 | −1 | − | 114 | hypothetical protein | -none- | D23_1c0052 | NA |
| fig|6666666.60966.peg.53 | CDS | 49842 | 50255 | 3 | + | 414 | Nucleotidyltransferase | -none- | D23_1c0053 | Neut_0172 |
| (EC 2.7.7.—) | ||||||||||
| fig|6666666.60966.peg.54 | CDS | 50257 | 50622 | 1 | + | 366 | Nucleotidyltransferase | -none- | D23_1c0054 | Neut_0173 |
| (EC 2.7.7.—) | ||||||||||
| fig|6666666.60966.peg.55 | CDS | 51293 | 50880 | −2 | − | 414 | Mobile element protein | -none- | D23_1c0056 | NA |
| fig|6666666.60966.peg.56 | CDS | 51432 | 51253 | −3 | − | 180 | hypothetical protein | -none- | D23_1c0057 | Neut_0176 |
| fig|6666666.60966.peg.57 | CDS | 51530 | 52492 | 2 | + | 963 | Mobile element protein | -none- | D23_1c0058 | Neut_1746 |
| fig|6666666.60966.peg.58 | CDS | 52657 | 52908 | 1 | + | 252 | Mobile element protein | -none- | D23_1c0059 | Neut_0884 |
| fig|6666666.60966.peg.59 | CDS | 52964 | 53326 | 2 | + | 363 | Mobile element protein | -none- | D23_1c0060 | Neut_2499 |
| fig|6666666.60966.peg.60 | CDS | 54452 | 53361 | −2 | − | 1092 | putative transposase | -none- | D23_1c0061 | Neut_0177 |
| fig|6666666.60966.peg.61 | CDS | 54765 | 54430 | −3 | − | 336 | FIG00859125: | -none- | D23_1c0062 | Neut_0178 |
| hypothetical protein | ||||||||||
| fig|6666666.60966.peg.62 | CDS | 55016 | 55774 | 2 | + | 759 | dTDP-Rha:A-D-GlcNAc- | dTDP-rhamnose | D23_1c0063 | Neut_0179 |
| diphosphoryl | synthesis | |||||||||
| polyprenol, A-3-L- | ||||||||||
| rhamnosyl transferase | ||||||||||
| WbbL | ||||||||||
| fig|6666666.60966.peg.63 | CDS | 56735 | 55788 | −2 | − | 948 | UDP-glucose 4- | CBSS- | D23_1c0064 | Neut_0180 |
| epimerase (EC 5.1.3.2) | 296591.1.peg.2330; | |||||||||
| <br>N-linked | ||||||||||
| Glycosylation in | ||||||||||
| Bacteria; <br>Rhamnose | ||||||||||
| containing glycans | ||||||||||
| fig|6666666.60966.peg.64 | CDS | 56874 | 56746 | −3 | − | 129 | hypothetical protein | -none- | D23_1c0065 | NA |
| fig|6666666.60966.peg.65 | CDS | 60470 | 57075 | −2 | − | 3396 | Adenylate cyclase (EC | cAMP signaling in | D23_1c0066 | Neut_0181 |
| 4.6.1.1)/Guanylate | bacteria | |||||||||
| cyclase (EC 4.6.1.2) | ||||||||||
| fig|6666666.60966.peg.66 | CDS | 60633 | 60755 | 3 | + | 123 | hypothetical protein | -none- | D23_1c0067 | NA |
| fig|6666666.60966.peg.67 | CDS | 62853 | 60769 | −3 | − | 2085 | Ubiquinone | Ubiquinone | D23_1c0068 | Neut_0182 |
| biosynthesis | Biosynthesis; | |||||||||
| monooxygenase UbiB | <br>Ubiquinone | |||||||||
| Biosynthesis-gjo | ||||||||||
| fig|6666666.60966.peg.68 | CDS | 63084 | 63821 | 3 | + | 738 | hypothetical protein | -none- | D23_1c0069 | Neut_0183 |
| fig|6666666.60966.peg.69 | CDS | 64515 | 66023 | 3 | + | 1509 | CBSS- | -none- | D23_1c0070 | NA |
| 498211.3.peg.1514: | ||||||||||
| hypothetical protein | ||||||||||
| fig|6666666.60966.peg.70 | CDS | 66074 | 66751 | 2 | + | 678 | FIG039767: | -none- | D23_1c0071 | NA |
| hypothetical protein | ||||||||||
| fig|6666666.60966.peg.71 | CDS | 66741 | 70157 | 3 | + | 3417 | FIG007317: | -none- | D23_1c0072 | NA |
| hypothetical protein | ||||||||||
| fig|6666666.60966.peg.72 | CDS | 70190 | 71326 | 2 | + | 1137 | FIG005429: | -none- | D23_1c0073 | Neut_0184 |
| hypothetical protein | ||||||||||
| fig|6666666.60966.peg.73 | CDS | 71379 | 71939 | 3 | + | 561 | Lipid carrier: UDP-N- | CBSS- | D23_1c0074 | Neut_0185 |
| acetylgalactosaminyltransferase | 296591.1.peg.2330; | |||||||||
| (EC 2.4.1.—) | <br>N-linked | |||||||||
| Glycosylation in Bacteria | ||||||||||
| fig|6666666.60966.peg.74 | CDS | 71949 | 73931 | 3 | + | 1983 | Nucleoside-diphosphate | CBSS-296591.1.peg.2330 | D23_1c0075 | Neut_0186 |
| sugar | ||||||||||
| epimerase/dehydratase | ||||||||||
| fig|6666666.60966.peg.75 | CDS | 74467 | 73949 | −1 | − | 519 | cytidine and | -none- | D23_1c0076 | Neut_0187 |
| deoxycytidylate | ||||||||||
| deaminase family | ||||||||||
| protein | ||||||||||
| fig|6666666.60966.peg.76 | CDS | 74956 | 74594 | −1 | − | 363 | Mobile element protein | -none- | D23_1c0077 | Neut_2499 |
| fig|6666666.60966.peg.77 | CDS | 75263 | 75012 | −2 | − | 252 | Mobile element protein | -none- | D23_1c0078 | Neut_0884 |
| fig|6666666.60966.peg.78 | CDS | 75586 | 76446 | 1 | + | 861 | Flagellar motor rotation | Flagellar motility; | D23_1c0079 | Neut_0188 |
| protein MotA | <br>Flagellum | |||||||||
| fig|6666666.60966.peg.79 | CDS | 76489 | 77433 | 1 | + | 945 | Flagellar motor rotation | Flagellar motility; | D23_1c0080 | Neut_0189 |
| protein MotB | <br>Flagellum | |||||||||
| fig|6666666.60966.peg.80 | CDS | 77408 | 78205 | 2 | + | 798 | FIG00858624: | -none- | D23_1c0081 | Neut_0190 |
| hypothetical protein | ||||||||||
| fig|6666666.60966.peg.81 | CDS | 79621 | 78218 | −1 | − | 1404 | Cysteinyl-tRNA | Zinc regulated enzymes; | D23_1c0082 | Neut_0191 |
| synthetase (EC 6.1.1.16) | <br>tRNA | |||||||||
| aminoacylation, Cys | ||||||||||
| fig|6666666.60966.peg.83 | CDS | 79830 | 80384 | 3 | + | 555 | Peptidyl-prolyl cis-trans | Peptidyl-prolyl cis-trans | D23_1c0083 | Neut_0192 |
| isomerase PpiB (EC | isomerase; | |||||||||
| 5.2.1.8) | <br>Queuosine- | |||||||||
| Archaeosine | ||||||||||
| Biosynthesis | ||||||||||
| fig|6666666.60966.peg.84 | CDS | 80403 | 80894 | 3 | + | 492 | Peptidyl-prolyl cis-trans | Peptidyl-prolyl cis-trans | D23_1c0084 | Neut_0193 |
| isomerase PpiB (EC | isomerase; | |||||||||
| 5.2.1.8) | <br>Queuosine- | |||||||||
| Archaeosine | ||||||||||
| Biosynthesis | ||||||||||
| fig|6666666.60966.peg.85 | CDS | 80972 | 81424 | 2 | + | 453 | Rhodanese-related | -none- | D23_1c0085 | Neut_0194 |
| sulfurtransferase | ||||||||||
| fig|6666666.60966.peg.86 | CDS | 82260 | 81439 | −3 | − | 822 | Undecaprenyl- | -none- | D23_1c0086 | Neut_0195 |
| diphosphatase (EC | ||||||||||
| 3.6.1.27) | ||||||||||
| fig|6666666.60966.peg.87 | CDS | 84206 | 82308 | −2 | − | 1899 | Thiamin biosynthesis | Thiamin biosynthesis | D23_1c0087 | Neut_0196 |
| protein ThiC | ||||||||||
| fig|6666666.60966.peg.88 | CDS | 84412 | 85068 | 1 | + | 657 | Protein-L-isoaspartate | Protein-L-isoaspartate O- | D23_1c0088 | Neut_0197 |
| O-methyltransferase | methyltransferase; | |||||||||
| (EC 2.1.1.77) | <br>Stationary phase | |||||||||
| repair cluster; <br>Ton | ||||||||||
| and Tol transport | ||||||||||
| systems | ||||||||||
| fig|6666666.60966.peg.90 | CDS | 85216 | 86493 | 1 | + | 1278 | Type I secretion outer | Multidrug Resistance | D23_1c0089 | Neut_0198 |
| membrane protein, | Efflux Pumps; <br>Ton | |||||||||
| TolC precursor | and Tol transport | |||||||||
| systems | ||||||||||
| fig|6666666.60966.peg.91 | CDS | 89009 | 86556 | −2 | − | 2454 | ATP-dependent | Proteasome bacterial; | D23_1c0090 | Neut_0199 |
| protease La (EC | <br>Proteolysis in | |||||||||
| 3.4.21.53) Type II | bacteria, ATP-dependent | |||||||||
| fig|6666666.60966.peg.92 | CDS | 89253 | 89375 | 3 | + | 123 | hypothetical protein | -none- | D23_1c0091 | NA |
| fig|6666666.60966.peg.93 | CDS | 89433 | 89579 | 3 | + | 147 | hypothetical protein | -none- | D23_1c0092 | NA |
| fig|6666666.60966.peg.94 | CDS | 90769 | 89555 | −1 | − | 1215 | Serine--pyruvate | Photorespiration | D23_1c0093 | Neut_0200 |
| aminotransferase (EC | (oxidative C2 cycle); | |||||||||
| 2.6.1.51)/L- | <br>Pyruvate Alanine | |||||||||
| alanine:glyoxylate | Serine Interconversions | |||||||||
| aminotransferase (EC | ||||||||||
| 2.6.1.44) | ||||||||||
| fig|6666666.60966.peg.95 | CDS | 93514 | 91088 | −1 | − | 2427 | ATP-dependent | Proteasome bacterial; | D23_1c0095 | Neut_0201 |
| protease La (EC | <br>Proteolysis in | |||||||||
| 3.4.21.53) Type I | bacteria, ATP-dependent | |||||||||
| fig|6666666.60966.peg.96 | CDS | 94903 | 93620 | −1 | − | 1284 | ATP-dependent Clp | Proteasome bacterial; | D23_1c0096 | Neut_0202 |
| protease ATP-binding | <br>Proteolysis in | |||||||||
| subunit ClpX | bacteria, ATP-dependent | |||||||||
| fig|6666666.60966.peg.97 | CDS | 95607 | 94963 | −3 | − | 645 | ATP-dependent Clp | Proteasome bacterial; | D23_1c0097 | Neut_0203 |
| protease proteolytic | <br>Proteolysis in | |||||||||
| subunit (EC 3.4.21.92) | bacteria, ATP- | |||||||||
| dependent; <br>cAMP | ||||||||||
| signaling in bacteria | ||||||||||
| fig|6666666.60966.peg.98 | CDS | 96907 | 95591 | −1 | − | 1317 | Cell division trigger | Bacterial Cell Division | D23_1c0098 | Neut_0204 |
| factor (EC 5.2.1.8) | ||||||||||
| fig|6666666.60966.peg.99 | CDS | 97996 | 97241 | −1 | − | 756 | Short-chain | Transcription repair | D23_1c0100 | Neut_0205 |
| dehydrogenase/reductase | cluster | |||||||||
| SDR | ||||||||||
| fig|6666666.60966.peg.100 | CDS | 99750 | 98107 | −3 | − | 1644 | Heat shock protein 60 | GroEL GroES | D23_1c0101 | Neut_0206 |
| family chaperone GroEL | ||||||||||
| fig|6666666.60966.peg.101 | CDS | 100080 | 99790 | −3 | − | 291 | Heat shock protein 60 | GroEL GroES | D23_1c0102 | Neut_0207 |
| family co-chaperone | ||||||||||
| GroES | ||||||||||
| fig|6666666.60966.peg.102 | CDS | 100244 | 101554 | 2 | + | 1311 | Adenosylmethionine-8- | Biotin biosynthesis; | D23_1c0103 | Neut_0208 |
| amino-7-oxononanoate | <br>Biotin biosynthesis | |||||||||
| aminotransferase (EC | Experimental; <br>Biotin | |||||||||
| 2.6.1.62) | synthesis cluster | |||||||||
| fig|6666666.60966.peg.103 | CDS | 101561 | 102967 | 2 | + | 1407 | Metallo-beta-lactamase | Bacterial RNA- | D23_1c0104 | Neut_0209 |
| family protein, RNA- | metabolizing Zn- | |||||||||
| specific | dependent hydrolases; | |||||||||
| <br>Ribonucleases in | ||||||||||
| Bacillus | ||||||||||
| fig|6666666.60966.peg.104 | CDS | 103374 | 103066 | −3 | − | 309 | Cytochrome c, class I | -none- | D23_1c0105 | Neut_0210 |
| fig|6666666.60966.peg.105 | CDS | 103536 | 104300 | 3 | + | 765 | Exodeoxyribonuclease | DNA repair, bacterial | D23_1c0106 | Neut_0211 |
| III (EC 3.1.11.2) | ||||||||||
| fig|6666666.60966.peg.106 | CDS | 104347 | 105459 | 1 | + | 1113 | Alanine dehydrogenase | Pyruvate Alanine Serine | D23_1c0107 | Neut_0212 |
| (EC 1.4.1.1) | Interconversions | |||||||||
| fig|6666666.60966.peg.107 | CDS | 106118 | 105597 | −2 | − | 522 | Conserved | Tolerance to colicin E2 | D23_1c0108 | Neut_0213 |
| uncharacterized protein | ||||||||||
| CreA | ||||||||||
| fig|6666666.60966.peg.109 | CDS | 107425 | 106253 | −1 | − | 1173 | Permeases of the major | -none- | D23_1c0109 | Neut_0214 |
| facilitator superfamily | ||||||||||
| fig|6666666.60966.peg.110 | CDS | 108032 | 107454 | −2 | − | 579 | Uncharacterized protein | -none- | D23_1c0110 | Neut_0215 |
| family UPF0016 | ||||||||||
| fig|6666666.60966.peg.112 | CDS | 108821 | 109603 | 2 | + | 783 | Ribulose-5-phosphate | -none- | D23_1c0113 | Neut_0218 |
| 4-epimerase and | ||||||||||
| related epimerases and | ||||||||||
| aldolases | ||||||||||
| fig|6666666.60966.peg.113 | CDS | 109609 | 113274 | 1 | + | 3666 | InterPro | -none- | D23_1c0114 | Neut_0219 |
| IPR000014:IPR001789:IPR002106: | ||||||||||
| IPR002570:IPR003594: | ||||||||||
| IPR003660: | ||||||||||
| IPR003661:IPR004358:IPR005467 | ||||||||||
| COGs | ||||||||||
| COG0642 | ||||||||||
| fig|6666666.60966.peg.114 | CDS | 113292 | 114485 | 3 | + | 1194 | Succinyl-CoA ligase | TCA Cycle | D23_1c0115 | Neut_0220 |
| [ADP-forming] beta | ||||||||||
| chain (EC 6.2.1.5) | ||||||||||
| fig|6666666.60966.peg.115 | CDS | 114489 | 115364 | 3 | + | 876 | Succinyl-CoA ligase | TCA Cycle | D23_1c0116 | Neut_0221 |
| [ADP-forming] alpha | ||||||||||
| chain (EC 6.2.1.5) | ||||||||||
| fig|6666666.60966.peg.116 | CDS | 115402 | 115722 | 1 | + | 321 | FIG00858523: | -none- | D23_1c0117 | Neut_0222 |
| hypothetical protein | ||||||||||
| fig|6666666.60966.peg.117 | CDS | 115750 | 117177 | 1 | + | 1428 | D-alanyl-D-alanine | CBSS-84588.1.peg.1247; | D23_1c0118 | Neut_0223 |
| carboxypeptidase (EC | <br>Metallocarboxypeptidases | |||||||||
| 3.4.16.4) | (EC 3.4.17.—); | |||||||||
| <br>Murein Hydrolases; | ||||||||||
| <br>Peptidoglycan | ||||||||||
| Biosynthesis | ||||||||||
| fig|6666666.60966.peg.118 | CDS | 117265 | 118227 | 1 | + | 963 | Mobile element protein | -none- | D23_1c0119 | Neut_1278 |
| fig|6666666.60966.peg.119 | CDS | 120193 | 120056 | −1 | − | 138 | hypothetical protein | -none- | D23_1c0120 | NA |
| fig|6666666.60966.rna.5 | RNA | 118725 | 120255 | 3 | + | 1531 | Small Subunit | |||
| Ribosomal RNA; | -none- | D23_1c0120 | ||||||||
| ssuRNA; SSU rRNA | ||||||||||
| fig|6666666.60966.peg.121 | CDS | 122376 | 122495 | 3 | + | 120 | hypothetical protein | -none- | D23_1c0124 | NA |
| fig|6666666.60966.peg.120 | CDS | 121863 | 121994 | 3 | + | 132 | hypothetical protein | -none- | D23_1c0124 | NA |
| fig|6666666.60966.rna.8 | RNA | 120652 | 123535 | 1 | + | 2884 | Large Subunit | -none- | D23_1c0124 | |
| Ribosomal RNA; | ||||||||||
| IsuRNA; LSU rRNA | ||||||||||
| fig|6666666.60966.rna.9 | RNA | 123600 | 123716 | 3 | + | 117 | 5S RNA | -none- | D23_1c0126 | |
| fig|6666666.60966.peg.123 | CDS | 124878 | 124708 | −3 | − | 171 | hypothetical protein | -none- | D23_1c0127 | NA |
| fig|6666666.60966.peg.124 | CDS | 125317 | 125496 | 1 | + | 180 | hypothetical protein | -none- | D23_1c0129 | Neut_0547 |
| fig|6666666.60966.peg.125 | CDS | 125792 | 126799 | 2 | + | 1008 | NAD-dependent | CBSS-296591.1.peg.2330 | D23_1c0130 | Neut_0225 |
| epimerase/dehydratase | ||||||||||
| fig|6666666.60966.peg.126 | CDS | 126808 | 128082 | 1 | + | 1275 | UDP-glucose | -none- | D23_1c0131 | Neut_0226 |
| dehydrogenase (EC | ||||||||||
| 1.1.1.22) | ||||||||||
| fig|6666666.60966.peg.127 | CDS | 128985 | 128089 | −3 | − | 897 | Permeases of the | -none- | D23_1c0132 | Neut_0227 |
| drug/metabolite | ||||||||||
| transporter (DMT) | ||||||||||
| superfamily | ||||||||||
| fig|6666666.60966.peg.128 | CDS | 129078 | 130283 | 3 | + | 1206 | N-succinyl-L,L- | Lysine Biosynthesis DAP | D23_1c0133 | Neut_0228 |
| diaminopimelate | Pathway, GJO scratch | |||||||||
| aminotransferase | ||||||||||
| alternative (EC 2.6.1.17) | ||||||||||
| fig|6666666.60966.peg.129 | CDS | 130311 | 131132 | 3 | + | 822 | 2,3,4,5- | Lysine Biosynthesis DAP | D23_1c0134 | Neut_0229 |
| tetrahydropyridine-2,6- | Pathway, GJO scratch | |||||||||
| dicarboxylate N- | ||||||||||
| succinyltransferase (EC | ||||||||||
| 2.3.1.117) | ||||||||||
| fig|6666666.60966.peg.130 | CDS | 131322 | 131693 | 3 | + | 372 | FIG00858507: | -none- | D23_1c0135 | Neut_0230 |
| hypothetical protein | ||||||||||
| fig|6666666.60966.peg.131 | CDS | 131801 | 132127 | 2 | + | 327 | FIG00858507: | -none- | D23_1c0136 | Neut_0231 |
| hypothetical protein | ||||||||||
| fig|6666666.60966.peg.132 | CDS | 132190 | 132312 | 1 | + | 123 | hypothetical protein | -none- | D23_1c0137 | NA |
| fig|6666666.60966.peg.133 | CDS | 132314 | 133303 | 2 | + | 990 | Biotin operon repressor/ | Biotin biosynthesis; | D23_1c0138 | Neut_0232 |
| Biotin-protein ligase | <br>Biotin biosynthesis; | |||||||||
| (EC 6.3.4.15) | <br>Biotin synthesis | |||||||||
| cluster; <br>Biotin | ||||||||||
| synthesis cluster | ||||||||||
| fig|6666666.60966.peg.134 | CDS | 133331 | 134104 | 2 | + | 774 | Pantothenate kinase | Coenzyme A | D23_1c0139 | Neut_0233 |
| type III, CoaX-like (EC | Biosynthesis; | |||||||||
| 2.7.1.33) | <br>Coenzyme A | |||||||||
| Biosynthesis cluster | ||||||||||
| fig|6666666.60966.peg.135 | CDS | 134123 | 134794 | 2 | + | 672 | GTP-binding protein | Universal GTPases | D23_1c0140 | Neut_0234 |
| EngB | ||||||||||
| fig|6666666.60966.peg.136 | CDS | 134938 | 135945 | 1 | + | 1008 | Porphobilinogen | Heme and Siroheme | D23_1c0141 | Neut_0235 |
| synthase (EC 4.2.1.24) | Biosynthesis; <br>Zinc | |||||||||
| regulated enzymes | ||||||||||
| fig|6666666.60966.peg.137 | CDS | 136861 | 136064 | −1 | − | 798 | Phosphate transport | High affinity phosphate | D23_1c0142 | Neut_0236 |
| ATP-binding protein | transporter and control | |||||||||
| PstB (TC 3.A.1.7.1) | of PHO regulon; | |||||||||
| <br>Phosphate | ||||||||||
| metabolism | ||||||||||
| fig|6666666.60966.peg.138 | CDS | 137797 | 136871 | −1 | − | 927 | Phosphate transport | High affinity phosphate | D23_1c0143 | Neut_0237 |
| system permease | transporter and control | |||||||||
| protein PstA (TC | of PHO regulon; | |||||||||
| 3.A.1.7.1) | <br>Phosphate | |||||||||
| metabolism | ||||||||||
| fig|6666666.60966.peg.139 | CDS | 138817 | 137876 | −1 | − | 942 | Phosphate transport | High affinity phosphate | D23_1c0144 | Neut_0238 |
| system permease | transporter and control | |||||||||
| protein PstC (TC | of PHO regulon; | |||||||||
| 3.A.1.7.1) | <br>Phosphate | |||||||||
| metabolism | ||||||||||
| fig|6666666.60966.peg.140 | CDS | 139048 | 139299 | 1 | + | 252 | FIG00858998: | -none- | D23_1c0146 | Neut_0239 |
| hypothetical protein | ||||||||||
| fig|6666666.60966.peg.141 | CDS | 140580 | 139432 | −3 | − | 1149 | Cell division protein | Bacterial Cell Division; | D23_1c0147 | Neut_0240 |
| FtsZ (EC 3.4.24.—) | <br>Bacterial | |||||||||
| Cytoskeleton; <br>cell | ||||||||||
| division cluster | ||||||||||
| containing FtsQ; <br>cell | ||||||||||
| division core of larger | ||||||||||
| cluster | ||||||||||
| fig|6666666.60966.peg.142 | CDS | 141909 | 140650 | −3 | − | 1260 | Cell division protein | Bacterial Cell Division; | D23_1c0149 | Neut_0241 |
| FtsA | <br>Bacterial | |||||||||
| Cytoskeleton; <br>cell | ||||||||||
| division cluster | ||||||||||
| containing FtsQ; <br>cell | ||||||||||
| division core of larger | ||||||||||
| cluster | ||||||||||
| fig|6666666.60966.peg.143 | CDS | 142678 | 141950 | −1 | − | 729 | Cell division protein | Bacterial Cell Division; | D23_1c0150 | Neut_0242 |
| FtsQ | <br>Bacterial | |||||||||
| Cytoskeleton; <br>cell | ||||||||||
| division cluster | ||||||||||
| containing FtsQ; <br>cell | ||||||||||
| division core of larger | ||||||||||
| cluster | ||||||||||
| fig|6666666.60966.peg.144 | CDS | 143654 | 142734 | −2 | − | 921 | D-alanine--D-alanine | Peptidoglycan | D23_1c0152 | Neut_0243 |
| ligase (EC 6.3.2.4) | Biosynthesis; | |||||||||
| <br>Peptidoglycan | ||||||||||
| biosynthesis--gjo; | ||||||||||
| <br>cell division cluster | ||||||||||
| containing FtsQ | ||||||||||
| fig|6666666.60966.peg.145 | CDS | 144649 | 143651 | −1 | − | 999 | UDP-N- | Peptidoglycan | D23_1c0153 | Neut_0244 |
| acetylenolpyruvoylglucosamine | Biosynthesis; <br>UDP- | |||||||||
| reductase (EC | N-acetylmuramate from | |||||||||
| 1.1.1.158) | Fructose-6-phosphate | |||||||||
| Biosynthesis | ||||||||||
| fig|6666666.60966.peg.146 | CDS | 146080 | 144659 | −1 | − | 1422 | UDP-N- | Peptidoglycan | D23_1c0154 | Neut_0245 |
| acetylmuramate-- | Biosynthesis; | |||||||||
| alanine ligase (EC | <br>Peptidoglycan | |||||||||
| 6.3.2.8) | biosynthesis--gjo; | |||||||||
| <br>cell division cluster | ||||||||||
| containing FtsQ | ||||||||||
| fig|6666666.60966.peg.147 | CDS | 147159 | 146077 | −3 | − | 1083 | UDP-N- | Peptidoglycan | D23_1c0155 | Neut_0246 |
| acetylglucosamine--N- | Biosynthesis; <br>cell | |||||||||
| acetylmuramyl- | division core of larger | |||||||||
| (pentapeptide) | cluster | |||||||||
| pyrophosphoryl- | ||||||||||
| undecaprenol N- | ||||||||||
| acetylglucosamine | ||||||||||
| transferase (EC | ||||||||||
| 2.4.1.227) | ||||||||||
| fig|6666666.60966.peg.148 | CDS | 148372 | 147212 | −1 | − | 1161 | Cell division protein | Bacterial Cell Division; | D23_1c0156 | Neut_0247 |
| FtsW | <br>Bacterial | |||||||||
| Cytoskeleton; <br>cell | ||||||||||
| division cluster | ||||||||||
| containing FtsQ | ||||||||||
| fig|6666666.60966.peg.149 | CDS | 149789 | 148377 | −2 | − | 1413 | UDP-N- | Peptidoglycan | D23_1c0157 | Neut_0248 |
| acetylmuramoylalanine-- | Biosynthesis; | |||||||||
| D-glutamate ligase (EC | <br>Peptidoglycan | |||||||||
| 6.3.2.9) | biosynthesis--gjo | |||||||||
| fig|6666666.60966.peg.150 | CDS | 150871 | 149786 | −1 | − | 1086 | Phospho-N- | Peptidoglycan | D23_1c0158 | Neut_0249 |
| acetylmuramoyl- | Biosynthesis | |||||||||
| pentapeptide- | ||||||||||
| transferase (EC | ||||||||||
| 2.7.8.13) | ||||||||||
| fig|6666666.60966.peg.151 | CDS | 152316 | 150943 | −3 | − | 1374 | UDP-N- | Peptidoglycan | D23_1c0159 | Neut_0250 |
| acetylmuramoylalanyl- | Biosynthesis; | |||||||||
| D-glutamyl-2,6- | <br>Peptidoglycan | |||||||||
| diaminopimelate--D- | biosynthesis--gjo | |||||||||
| alanyl-D-alanine ligase | ||||||||||
| (EC 6.3.2.10) | ||||||||||
| fig|6666666.60966.peg.152 | CDS | 153875 | 152313 | −2 | − | 1563 | UDP-N- | Peptidoglycan | D23_1c0160 | Neut_0251 |
| acetylmuramoylalanyl- | Biosynthesis; | |||||||||
| D-glutamate--2,6- | <br>Peptidoglycan | |||||||||
| diaminopimelate ligase | biosynthesis--gjo | |||||||||
| (EC 6.3.2.13) | ||||||||||
| fig|6666666.60966.peg.153 | CDS | 155545 | 153872 | −1 | − | 1674 | Cell division protein Ftsl | 16S rRNA modification | D23_1c0161 | Neut_0252 |
| [Peptidoglycan | within P site of | |||||||||
| synthetase] (EC | ribosome; <br>Bacterial | |||||||||
| 2.4.1.129) | Cell Division; | |||||||||
| <br>Bacterial | ||||||||||
| Cytoskeleton; <br>CBSS- | ||||||||||
| 83331.1.peg.3039; | ||||||||||
| <br>Flagellum in | ||||||||||
| Campylobacter; | ||||||||||
| <br>Peptidoglycan | ||||||||||
| Biosynthesis | ||||||||||
| fig|6666666.60966.peg.155 | CDS | 155895 | 155608 | −3 | − | 288 | Cell division protein FtsL | 16S rRNA modification | D23_1c0162 | Neut_0253 |
| within P site of | ||||||||||
| ribosome; <br>Bacterial | ||||||||||
| Cell Division; | ||||||||||
| <br>Bacterial | ||||||||||
| Cytoskeleton; | ||||||||||
| <br>Stationary phase | ||||||||||
| repair cluster | ||||||||||
| fig|6666666.60966.peg.156 | CDS | 156845 | 155892 | −2 | − | 954 | rRNA small subunit | 16S rRNA modification | D23_1c0163 | Neut_0254 |
| methyltransferase H | within P site of | |||||||||
| ribosome; <br>Bacterial | ||||||||||
| Cell Division | ||||||||||
| fig|6666666.60966.peg.157 | CDS | 157094 | 156861 | −2 | − | 234 | Cell division protein | 16S rRNA modification | D23_1c0164 | Neut_0255 |
| MraZ | within P site of | |||||||||
| ribosome; <br>Bacterial | ||||||||||
| Cell Division; | ||||||||||
| <br>Bacterial | ||||||||||
| Cytoskeleton | ||||||||||
| fig|6666666.60966.peg.158 | CDS | 157584 | 157859 | 3 | + | 276 | DNA-3-methyladenine | DNA Repair Base | D23_1c0165 | NA |
| glycosylase II (EC | Excision | |||||||||
| 3.2.2.21) | ||||||||||
| fig|6666666.60966.peg.159 | CDS | 158202 | 158420 | 3 | + | 219 | Rho-specific inhibitor of | Transcription factors | D23_1c0166 | Neut_0257 |
| transcription | bacterial | |||||||||
| termination (YaeO) | ||||||||||
| fig|6666666.60966.peg.160 | CDS | 159328 | 158561 | −1 | − | 768 | InterPro IPR001173 | -none- | D23_1c0167 | Neut_0258 |
| COGs COG0463 | ||||||||||
| fig|6666666.60966.peg.161 | CDS | 159475 | 159924 | 1 | + | 450 | InterPro IPR000086 | -none- | D23_1c0168 | Neut_0259 |
| COGs COG0494 | ||||||||||
| fig|6666666.60966.peg.162 | CDS | 160257 | 160814 | 3 | + | 558 | possible (U92432) ORF4 | -none- | D23_1c0169 | Neut_0260 |
| [Nitrosospira sp. NpAV] | ||||||||||
| fig|6666666.60966.peg.164 | CDS | 160969 | 161451 | 1 | + | 483 | FIG00859298: | -none- | D23_1c0170 | Neut_0261 |
| hypothetical protein | ||||||||||
| fig|6666666.60966.peg.165 | CDS | 161593 | 162063 | 1 | + | 471 | Adenine | Purine conversions; | D23_1c0171 | Neut_0262 |
| phosphoribosyltransferase | <br>cAMP signaling in | |||||||||
| (EC 2.4.2.7) | bacteria | |||||||||
| fig|6666666.60966.peg.166 | CDS | 162260 | 163573 | 2 | + | 1314 | Seryl-tRNA synthetase | CBSS- | D23_1c0172 | Neut_0263 |
| (EC 6.1.1.11) | 326442.4.peg.1852; | |||||||||
| <br>Glycine and Serine | ||||||||||
| Utilization; <br>tRNA | ||||||||||
| aminoacylation, Ser | ||||||||||
| fig|6666666.60966.peg.167 | CDS | 163620 | 164306 | 3 | + | 687 | FIG00858527: | -none- | D23_1c0173 | Neut_0264 |
| hypothetical protein | ||||||||||
| fig|6666666.60966.peg.168 | CDS | 165061 | 164351 | −1 | − | 711 | Phosphoglycerate | Glycolysis and | D23_1c0174 | Neut_0265 |
| mutase (EC 5.4.2.1) | Gluconeogenesis; | |||||||||
| <br>Phosphoglycerate | ||||||||||
| mutase protein family | ||||||||||
| fig|6666666.60966.peg.169 | CDS | 166178 | 165111 | −2 | − | 1068 | InterPro IPR001225 | -none- | D23_1c0175 | Neut_0266 |
| fig|6666666.60966.peg.170 | CDS | 166643 | 166200 | −2 | − | 444 | FIG00858776: | -none- | D23_1c0176 | Neut_0267 |
| hypothetical protein | ||||||||||
| fig|6666666.60966.peg.171 | CDS | 167465 | 166659 | −2 | − | 807 | CTP:Inositol-1- | -none- | D23_1c0177 | Neut_0268 |
| phosphate | ||||||||||
| cytidylyltransferase | ||||||||||
| (2.7.7.—) | ||||||||||
| fig|6666666.60966.peg.172 | CDS | 168669 | 167509 | −3 | − | 1161 | Cysteine desulfurase | Alanine biosynthesis; | D23_1c0178 | Neut_0269 |
| (EC 2.8.1.7) | <br>CBSS- | |||||||||
| 84588.1.peg.1247; | ||||||||||
| <br>mnm5U34 | ||||||||||
| biosynthesis bacteria; | ||||||||||
| <br>tRNA modification | ||||||||||
| Bacteria | ||||||||||
| fig|6666666.60966.peg.174 | CDS | 169251 | 169631 | 3 | + | 381 | FIG048548: ATP | -none- | D23_1c0180 | Neut_0270 |
| synthase protein I2 | ||||||||||
| fig|6666666.60966.peg.175 | CDS | 169720 | 170472 | 1 | + | 753 | ATP synthase A chain | -none- | D23_1c0181 | Neut_0271 |
| (EC 3.6.3.14) | ||||||||||
| fig|6666666.60966.peg.176 | CDS | 170516 | 170788 | 2 | + | 273 | ATP synthase C chain | -none- | D23_1c0182 | Neut_0272 |
| (EC 3.6.3.14) | ||||||||||
| fig|6666666.60966.peg.177 | CDS | 170900 | 171301 | 2 | + | 402 | ATP synthase B chain | -none- | D23_1c0183 | Neut_0273 |
| (EC 3.6.3.14) | ||||||||||
| fig|6666666.60966.peg.178 | CDS | 171302 | 171838 | 2 | + | 537 | ATP synthase delta | -none- | D23_1c0184 | Neut_0274 |
| chain (EC 3.6.3.14) | ||||||||||
| fig|6666666.60966.peg.179 | CDS | 171851 | 173392 | 2 | + | 1542 | ATP synthase alpha | -none- | D23_1c0185 | Neut_0275 |
| chain (EC 3.6.3.14) | ||||||||||
| fig|6666666.60966.peg.180 | CDS | 173396 | 174280 | 2 | + | 885 | ATP synthase gamma | -none- | D23_1c0186 | Neut_0276 |
| chain (EC 3.6.3.14) | ||||||||||
| fig|6666666.60966.peg.181 | CDS | 174311 | 175693 | 2 | + | 1383 | ATP synthase beta chain | -none- | D23_1c0187 | Neut_0277 |
| (EC 3.6.3.14) | ||||||||||
| fig|6666666.60966.peg.182 | CDS | 175842 | 176141 | 3 | + | 300 | ATP synthase epsilon | -none- | D23_1c0188 | Neut_0278 |
| chain (EC 3.6.3.14) | ||||||||||
| fig|6666666.60966.peg.183 | CDS | 176389 | 177765 | 1 | + | 1377 | N-acetylglucosamine-1- | Peptidoglycan | D23_1c0189 | Neut_0279 |
| phosphate | Biosynthesis; | |||||||||
| uridyltransferase (EC | <br>Peptidoglycan | |||||||||
| 2.7.7.23)/ | Biosynthesis; <br>Sialic | |||||||||
| Glucosamine-1- | Acid Metabolism; | |||||||||
| phosphate N- | <br>Sialic Acid | |||||||||
| acetyltransferase (EC | Metabolism; | |||||||||
| 2.3.1.157) | <br>Transcription repair | |||||||||
| cluster; | ||||||||||
| <br>Transcription repair | ||||||||||
| cluster; <br>UDP-N- | ||||||||||
| acetylmuramate from | ||||||||||
| Fructose-6-phosphate | ||||||||||
| Biosynthesis; <br>UDP- | ||||||||||
| N-acetylmuramate from | ||||||||||
| Fructose-6-phosphate | ||||||||||
| Biosynthesis | ||||||||||
| fig|6666666.60966.peg.184 | CDS | 177805 | 179652 | 1 | + | 1848 | Glucosamine-fructose- | Sialic Acid Metabolism; | D23_1c0190 | Neut_0280 |
| 6-phosphate | <br>UDP-N- | |||||||||
| aminotransferase | acetylmuramate from | |||||||||
| [isomerizing] (EC | Fructose-6-phosphate | |||||||||
| 2.6.1.16) | Biosynthesis | |||||||||
| fig|6666666.60966.peg.185 | CDS | 179795 | 180520 | 2 | + | 726 | FIG000859: | Riboflavin, FMN and FAD | D23_1c0191 | Neut_0281 |
| hypothetical protein | metabolism in plants; | |||||||||
| YebC | <br>RuvABC plus a | |||||||||
| hypothetical | ||||||||||
| fig|6666666.60966.peg.186 | CDS | 180523 | 181059 | 1 | + | 537 | Crossover junction | RuvABC plus a | D23_1c0192 | Neut_0282 |
| endodeoxyribonuclease | hypothetical | |||||||||
| RuvC (EC 3.1.22.4) | ||||||||||
| fig|6666666.60966.peg.187 | CDS | 181056 | 181640 | 3 | + | 585 | Holliday junction DNA | RuvABC plus a | D23_1c0193 | Neut_0283 |
| helicase RuvA | hypothetical | |||||||||
| fig|6666666.60966.peg.188 | CDS | 181659 | 182699 | 3 | + | 1041 | Holliday junction DNA | RuvABC plus a | D23_1c0194 | Neut_0284 |
| helicase RuvB | hypothetical | |||||||||
| fig|6666666.60966.peg.189 | CDS | 182760 | 183173 | 3 | + | 414 | 4-hydroxybenzoyl-CoA | Ton and Tol transport | D23_1c0195 | Neut_0285 |
| thioesterase family | systems | |||||||||
| active site | ||||||||||
| fig|6666666.60966.peg.190 | CDS | 183166 | 183870 | 1 | + | 705 | MotA/TolQ/ExbB | Ton and Tol transport | D23_1c0196 | Neut_0286 |
| proton channel family | systems | |||||||||
| protein | ||||||||||
| fig|6666666.60966.peg.191 | CDS | 183867 | 184283 | 3 | + | 417 | Tol biopolymer | Ton and Tol transport | D23_1c0197 | Neut_0287 |
| transport system, TolR | systems | |||||||||
| protein | ||||||||||
| fig|6666666.60966.peg.192 | CDS | 184304 | 185200 | 2 | + | 897 | TolA protein | Ton and Tol transport | D23_1c0198 | Neut_0288 |
| systems | ||||||||||
| fig|6666666.60966.peg.193 | CDS | 185239 | 186510 | 1 | + | 1272 | tolB protein precursor, | Ton and Tol transport | D23_1c0199 | Neut_0289 |
| periplasmic protein | systems | |||||||||
| involved in the tonb- | ||||||||||
| independent uptake of | ||||||||||
| group A colicins | ||||||||||
| fig|6666666.60966.peg.194 | CDS | 186565 | 187086 | 1 | + | 522 | 18K peptidoglycan- | Ton and Tol transport | D23_1c0200 | Neut_0290 |
| associated outer | systems | |||||||||
| membrane lipoprotein; | ||||||||||
| Peptidoglycan- | ||||||||||
| associated lipoprotein | ||||||||||
| precursor; Outer | ||||||||||
| membrane protein P6; | ||||||||||
| OmpA/MotB precursor | ||||||||||
| fig|6666666.60966.peg.195 | CDS | 187086 | 187907 | 3 | + | 822 | TPR repeat containing | Ton and Tol transport | D23_1c0201 | Neut_0291 |
| exported protein; | systems | |||||||||
| Putative periplasmic | ||||||||||
| protein contains a | ||||||||||
| protein | ||||||||||
| prenylyltransferase | ||||||||||
| domain | ||||||||||
| fig|6666666.60966.peg.196 | CDS | 188060 | 188644 | 2 | + | 585 | Queuosine Biosynthesis | Queuosine-Archaeosine | D23_1c0202 | Neut_0292 |
| QueE Radical SAM | Biosynthesis; <br>tRNA | |||||||||
| modification Bacteria | ||||||||||
| fig|6666666.60966.peg.197 | CDS | 188666 | 189346 | 2 | + | 681 | Queuosine Biosynthesis | Queuosine-Archaeosine | D23_1c0203 | Neut_0293 |
| QueC ATPase | Biosynthesis; <br>tRNA | |||||||||
| modification Bacteria | ||||||||||
| fig|6666666.60966.peg.198 | CDS | 189700 | 189347 | −1 | − | 354 | Dihydroneopterin | Folate Biosynthesis | D23_1c0204 | Neut_0294 |
| aldolase (EC 4.1.2.25) | ||||||||||
| fig|6666666.60966.peg.199 | CDS | 189786 | 190388 | 3 | + | 603 | Acyl- | Glycerolipid and | D23_1c0205 | Neut_0295 |
| phosphate:glycerol-3- | Glycerophospholipid | |||||||||
| phosphate O- | Metabolism in Bacteria | |||||||||
| acyltransferase PlsY | ||||||||||
| fig|6666666.60966.peg.200 | CDS | 191422 | 190406 | −1 | − | 1017 | TsaD/Kae1/Qri7 | Bacterial RNA- | D23_1c0206 | Neut_0296 |
| protein, required for | metabolizing Zn- | |||||||||
| threonylcarbamoyladenosine | dependent hydrolases; | |||||||||
| t(6)A37 formation | <br>Macromolecular | |||||||||
| in tRNA | synthesis operon; | |||||||||
| <br>YgjD and YeaZ | ||||||||||
| fig|6666666.60966.peg.201 | CDS | 191698 | 191910 | 1 | + | 213 | SSU ribosomal protein | Macromolecular | D23_1c0207 | Neut_0297 |
| S21p | synthesis operon | |||||||||
| fig|6666666.60966.peg.202 | CDS | 191984 | 192391 | 2 | + | 408 | Transamidase GatB | Macromolecular | D23_1c0208 | Neut_0298 |
| domain protein | synthesis operon | |||||||||
| fig|6666666.60966.peg.203 | CDS | 192486 | 194279 | 3 | + | 1794 | DNA primase (EC 2.7.7.—) | CBSS- | D23_1c0209 | Neut_0299 |
| 349161.4.peg.2417; | ||||||||||
| <br>Macromolecular | ||||||||||
| synthesis operon | ||||||||||
| fig|6666666.60966.peg.204 | CDS | 194461 | 196710 | 1 | + | 2250 | RNA polymerase sigma | CBSS- | D23_1c0210 | Neut_0300 |
| factor RpoD | 349161.4.peg.2417; | |||||||||
| <br>Flagellum; | ||||||||||
| <br>Macromolecular | ||||||||||
| synthesis operon; | ||||||||||
| <br>Transcription | ||||||||||
| initiation, bacterial | ||||||||||
| sigma factors | ||||||||||
| fig|6666666.60966.peg.206 | CDS | 197605 | 197180 | −1 | − | 426 | Mobile element protein | -none- | D23_1c0212 | Neut_0357 |
| fig|6666666.60966.peg.207 | CDS | 198088 | 198819 | 1 | + | 732 | Mobile element protein | -none- | D23_1c0213 | NA |
| fig|6666666.60966.peg.209 | CDS | 200235 | 199564 | −3 | − | 672 | transposase and | -none- | D23_1c0214 | Neut_2192 |
| inactivated derivatives | ||||||||||
| fig|6666666.60966.peg.210 | CDS | 200398 | 200210 | −1 | − | 189 | hypothetical protein | -none- | D23_1c0215 | NA |
| fig|6666666.60966.peg.211 | CDS | 200852 | 200995 | 2 | + | 144 | Mobile element protein | -none- | D23_1c0216 | Neut_0978 |
| fig|6666666.60966.peg.212 | CDS | 201848 | 200970 | −2 | − | 879 | Mobile element protein | -none- | D23_1c0217 | Neut_1720 |
| fig|6666666.60966.peg.213 | CDS | 202240 | 201947 | −1 | − | 294 | Mobile element protein | -none- | D23_1c0218 | Neut_1719 |
| fig|6666666.60966.peg.214 | CDS | 202367 | 203209 | 2 | + | 843 | Mobile element protein | -none- | D23_1c0219 | Neut_1524 |
| fig|6666666.60966.peg.215 | CDS | 203592 | 203461 | −3 | − | 132 | Phage Rha protein | -none- | D23_1c0220 | NA |
| fig|6666666.60966.peg.216 | CDS | 203906 | 203571 | −2 | − | 336 | Mobile element protein | -none- | D23_1c0221 | Neut_2450 |
| fig|6666666.60966.peg.218 | CDS | 204442 | 204113 | −1 | − | 330 | hypothetical protein | -none- | D23_1c0222 | Neut_2449 |
| fig|6666666.60966.peg.219 | CDS | 205381 | 204746 | −1 | − | 636 | Cytochrome c4 | Soluble cytochromes | D23_1c0223 | Neut_0305 |
| and functionally related | ||||||||||
| electron carriers | ||||||||||
| fig|6666666.60966.peg.220 | CDS | 205494 | 206096 | 3 | + | 603 | FIG00859469: | -none- | D23_1c0224 | Neut_0306 |
| hypothetical protein | ||||||||||
| fig|6666666.60966.peg.221 | CDS | 206204 | 207016 | 2 | + | 813 | Methionine | CBSS- | D23_1c0225 | Neut_0307 |
| aminopeptidase (EC | 312309.3.peg.1965; | |||||||||
| 3.4.11.18) | <br>Translation | |||||||||
| termination factors | ||||||||||
| bacterial | ||||||||||
| fig|6666666.60966.peg.222 | CDS | 207076 | 207840 | 1 | + | 765 | Ribonuclease PH (EC | Heat shock dnaK gene | D23_1c0226 | Neut_0308 |
| 2.7.7.56) | cluster extended; | |||||||||
| <br>tRNA processing | ||||||||||
| fig|6666666.60966.peg.223 | CDS | 207825 | 208439 | 3 | + | 615 | Xanthosine/inosine | CBSS-630.2.peg.3360; | D23_1c0227 | Neut_0309 |
| triphosphate | <br>Heat shock dnaK | |||||||||
| pyrophosphatase; | gene cluster extended | |||||||||
| HAM1-like protein | ||||||||||
| fig|6666666.60966.peg.224 | CDS | 208474 | 209709 | 1 | + | 1236 | Radical SAM family | CBSS-630.2.peg.3360; | D23_1c0228 | Neut_0310 |
| enzyme, similar to | <br>Heat shock dnaK | |||||||||
| coproporphyrinogen III | gene cluster extended; | |||||||||
| oxidase, oxygen- | <br>Heme and Siroheme | |||||||||
| independent, clustered | Biosynthesis; | |||||||||
| with nucleoside- | <br>Queuosine- | |||||||||
| triphosphatase RdgB | Archaeosine | |||||||||
| Biosynthesis | ||||||||||
| fig|6666666.60966.peg.225 | CDS | 209741 | 211540 | 2 | + | 1800 | Multicopper oxidase | Copper homeostasis | D23_1c0229 | Neut_0311 |
| fig|6666666.60966.peg.226 | CDS | 211537 | 212352 | 1 | + | 816 | Copper resistance | Copper homeostasis | D23_1c0230 | Neut_0312 |
| protein B | ||||||||||
| fig|6666666.60966.peg.227 | CDS | 213327 | 212398 | −3 | − | 930 | hypothetical protein | -none- | D23_1c0231 | Neut_0313 |
| fig|6666666.60966.peg.228 | CDS | 213918 | 213340 | −3 | − | 579 | LemA PROTEIN | -none- | D23_1c0232 | Neut_1392 |
| fig|6666666.60966.peg.229 | CDS | 214368 | 214553 | 3 | + | 186 | Mobile element protein | -none- | D23_1c0233 | Neut_2500 |
| fig|6666666.60966.peg.230 | CDS | 214610 | 215206 | 2 | + | 597 | Mobile element protein | -none- | D23_1c0234 | Neut_1375 |
| fig|6666666.60966.peg.231 | CDS | 215510 | 215623 | 2 | + | 114 | hypothetical protein | -none- | D23_1c0235 | NA |
| fig|6666666.60966.peg.232 | CDS | 215668 | 215847 | 1 | + | 180 | hypothetical protein | -none- | D23_1c0236 | Neut_0314 |
| fig|6666666.60966.peg.233 | CDS | 217943 | 216069 | −2 | − | 1875 | Glutathione-regulated | Glutathione-regulated | D23_1c0237 | Neut_0315 |
| potassium-efflux system | potassium-efflux system | |||||||||
| ATP-binding protein | and associated | |||||||||
| functions; | ||||||||||
| <br>Potassium | ||||||||||
| homeostasis | ||||||||||
| fig|6666666.60966.peg.234 | CDS | 218233 | 219195 | 1 | + | 963 | Mobile element protein | -none- | D23_1c0238 | Neut_1862 |
| fig|6666666.60966.peg.235 | CDS | 219960 | 219271 | −3 | − | 690 | InterPro IPR001687 | -none- | D23_1c0239 | NA |
| fig|6666666.60966.peg.236 | CDS | 220560 | 222266 | 3 | + | 1707 | Glutathione-regulated | Glutathione-regulated | D23_1c0241 | Neut_0318 |
| potassium-efflux system | potassium-efflux system | |||||||||
| protein KefB | and associated functions | |||||||||
| fig|6666666.60966.peg.237 | CDS | 222848 | 223903 | 2 | + | 1056 | SAM-dependent | -none- | D23_1c0242 | Neut_0320 |
| methyltransferase | ||||||||||
| SCO3452 (UbiE paralog) | ||||||||||
| fig|6666666.60966.peg.238 | CDS | 223971 | 224243 | 3 | + | 273 | Phosphate transport | High affinity phosphate | D23_1c0244 | Neut_0321 |
| system permease | transporter and control | |||||||||
| protein PstA (TC | of PHO regulon; | |||||||||
| 3.A.1.7.1) | <br>Phosphate | |||||||||
| metabolism | ||||||||||
| fig|6666666.60966.peg.239 | CDS | 225095 | 224421 | −2 | − | 675 | tRNA (guanine46-N7-)- | RNA methylation; | D23_1c0245 | Neut_0322 |
| methyltransferase (EC | <br>tRNA modification | |||||||||
| 2.1.1.33) | Bacteria | |||||||||
| fig|6666666.60966.peg.240 | CDS | 225934 | 225128 | −1 | − | 807 | Thiazole biosynthesis | Thiamin biosynthesis | D23_1c0246 | Neut_0323 |
| protein ThiG | ||||||||||
| fig|6666666.60966.peg.241 | CDS | 226194 | 225994 | −3 | − | 201 | Sulfur carrier protein | Thiamin biosynthesis | D23_1c0247 | Neut_0324 |
| ThiS | ||||||||||
| fig|6666666.60966.peg.242 | CDS | 226421 | 227008 | 2 | + | 588 | FIG008443: | CBSS-208964.1.peg.1768 | D23_1c0249 | Neut_0325 |
| hypothetical protein | ||||||||||
| fig|6666666.60966.peg.243 | CDS | 227005 | 228537 | 1 | + | 1533 | FIG139976: | CBSS-208964.1.peg.1768 | D23_1c0250 | Neut_0326 |
| hypothetical protein | ||||||||||
| fig|6666666.60966.peg.244 | CDS | 228587 | 229492 | 2 | + | 906 | FIG002781: Alpha-L- | CBSS-208964.1.peg.1768 | D23_1c0251 | Neut_0327 |
| glutamate ligase family | ||||||||||
| protein | ||||||||||
| fig|6666666.60966.peg.245 | CDS | 231155 | 229677 | −2 | − | 1479 | Cardiolipin synthetase | Cardiolipin synthesis; | D23_1c0252 | Neut_0328 |
| (EC 2.7.8.—) | <br>Glycerolipid and | |||||||||
| Glycerophospholipid | ||||||||||
| Metabolism in Bacteria | ||||||||||
| fig|6666666.60966.peg.246 | CDS | 231229 | 231411 | 1 | + | 183 | hypothetical protein | -none- | D23_1c0253 | NA |
| fig|6666666.60966.peg.248 | CDS | 232352 | 231813 | −2 | − | 540 | Urea channel Urel | Urea decomposition | D23_1c0255 | Neut_0329 |
| fig|6666666.60966.peg.249 | CDS | 232767 | 232585 | −3 | − | 183 | hypothetical protein | -none- | D23_1c0256 | NA |
| fig|6666666.60966.peg.251 | CDS | 233588 | 234748 | 2 | + | 1161 | FIG00855934: | -none- | D23_1c0259 | Neut_0331 |
| hypothetical protein | ||||||||||
| fig|6666666.60966.peg.252 | CDS | 235271 | 234831 | −2 | − | 441 | Mobile element protein | -none- | D23_1c0260 | Neut_0332 |
| fig|6666666.60966.peg.253 | CDS | 235792 | 235397 | −1 | − | 396 | NAD-dependent | Calvin-Benson cycle; | D23_1c0261 | Neut_0333 |
| glyceraldehyde-3- | <br>Glycolysis and | |||||||||
| phosphate | Gluconeogenesis; | |||||||||
| dehydrogenase (EC | <br>Pyridoxin (Vitamin | |||||||||
| 1.2.1.12) | B6) Biosynthesis | |||||||||
| fig|6666666.60966.peg.254 | CDS | 235832 | 236260 | 2 | + | 429 | hypothetical protein | -none- | D23_1c0261 | Neut_0333 |
| fig|6666666.60966.peg.255 | CDS | 237167 | 236592 | −2 | − | 576 | Flagellar basal-body P- | Flagellum | D23_1c0262 | Neut_0334 |
| ring formation protein | ||||||||||
| FlgA | ||||||||||
| fig|6666666.60966.peg.256 | CDS | 237299 | 237415 | 2 | + | 117 | hypothetical protein | -none- | D23_1c0264 | NA |
| fig|6666666.60966.peg.257 | CDS | 237436 | 237924 | 1 | + | 489 | Flagellar basal-body rod | Flagellum; <br>Flagellum | D23_1c0265 | Neut_0335 |
| protein FlgB | in Campylobacter | |||||||||
| fig|6666666.60966.peg.258 | CDS | 237930 | 238334 | 3 | + | 405 | Flagellar basal-body rod | Flagellum; <br>Flagellum | D23_1c0266 | Neut_0336 |
| protein FlgC | in Campylobacter | |||||||||
| fig|6666666.60966.peg.259 | CDS | 238347 | 239021 | 3 | + | 675 | Flagellar basal-body rod | Flagellar motility; | D23_1c0267 | Neut_0337 |
| modification protein | <br>Flagellum | |||||||||
| FlgD | ||||||||||
| fig|6666666.60966.peg.260 | CDS | 239037 | 240296 | 3 | + | 1260 | Flagellar hook protein | Flagellum | D23_1c0268 | Neut_0338 |
| FlgE | ||||||||||
| fig|6666666.60966.peg.261 | CDS | 240337 | 241080 | 1 | + | 744 | Flagellar basal-body rod | Flagellum | D23_1c0269 | Neut_0339 |
| protein FlgF | ||||||||||
| fig|6666666.60966.peg.262 | CDS | 241119 | 241901 | 3 | + | 783 | Flagellar basal-body rod | Flagellum | D23_1c0270 | Neut_0340 |
| protein FlgG | ||||||||||
| fig|6666666.60966.peg.263 | CDS | 242034 | 242828 | 3 | + | 795 | Flagellar L-ring protein | Flagellar motility; | D23_1c0271 | Neut_0341 |
| FlgH | <br>Flagellum | |||||||||
| fig|6666666.60966.peg.264 | CDS | 242850 | 243977 | 3 | + | 1128 | Flagellar P-ring protein | Flagellum | D23_1c0272 | Neut_0342 |
| FlgI | ||||||||||
| fig|6666666.60966.peg.265 | CDS | 243991 | 244998 | 1 | + | 1008 | Flagellar protein FlgJ | Flagellum | D23_1c0273 | Neut_0343 |
| [peptidoglycan | ||||||||||
| hydrolase] (EC 3.2.1.—) | ||||||||||
| fig|6666666.60966.peg.266 | CDS | 245257 | 246660 | 1 | + | 1404 | Flagellar hook- | Flagellum | D23_1c0274 | Neut_0344 |
| associated protein FlgK | ||||||||||
| fig|6666666.60966.peg.267 | CDS | 246638 | 247588 | 2 | + | 951 | Flagellar hook- | Flagellum | D23_1c0275 | Neut_0345 |
| associated protein FlgL | ||||||||||
| fig|6666666.60966.peg.268 | CDS | 247665 | 248210 | 3 | + | 546 | FIG00859049: | -none- | D23_1c0276 | Neut_0346 |
| hypothetical protein | ||||||||||
| fig|6666666.60966.peg.269 | CDS | 249330 | 248200 | −3 | − | 1131 | FIG00859091: | -none- | D23_1c0277 | Neut_0347 |
| hypothetical protein | ||||||||||
| fig|6666666.60966.peg.270 | CDS | 249439 | 249960 | 1 | + | 522 | FIG00859511: | -none- | D23_1c0278 | Neut_0348 |
| hypothetical protein | ||||||||||
| fig|6666666.60966.peg.271 | CDS | 249932 | 250513 | 2 | + | 582 | GCN5-related N- | -none- | D23_1c0279 | Neut_0349 |
| acetyltransferase | ||||||||||
| fig|6666666.60966.peg.272 | CDS | 250589 | 250861 | 2 | + | 273 | FIG001341: Probable | Heat shock dnaK gene | D23_1c0280 | Neut_0350 |
| Fe(2+)-trafficking | cluster extended | |||||||||
| protein YggX | ||||||||||
| fig|6666666.60966.peg.273 | CDS | 250912 | 253038 | 1 | + | 2127 | Polyphosphate kinase | High affinity phosphate | D23_1c0281 | Neut_0351 |
| (EC 2.7.4.1) | transporter and control | |||||||||
| of PHO regulon; | ||||||||||
| <br>Phosphate | ||||||||||
| metabolism; | ||||||||||
| <br>Polyphosphate; | ||||||||||
| <br>Purine conversions | ||||||||||
| fig|6666666.60966.peg.274 | CDS | 254786 | 253059 | −2 | − | 1728 | Sulfate permease | Cysteine Biosynthesis | D23_1c0282 | Neut_0352 |
| fig|6666666.60966.peg.275 | CDS | 255133 | 254783 | −1 | − | 351 | Transcriptional | -none- | D23_1c0283 | Neut_0353 |
| regulator, ArsR family | ||||||||||
| fig|6666666.60966.peg.277 | CDS | 256153 | 255827 | −1 | − | 327 | hypothetical protein | -none- | D23_1c0285 | Neut_0355 |
| fig|6666666.60966.peg.278 | CDS | 256608 | 257603 | 3 | + | 996 | hypothetical protein | -none- | D23_1c0286 | Neut_0356 |
| fig|6666666.60966.peg.279 | CDS | 258986 | 257739 | −2 | − | 1248 | Mobile element protein | -none- | D23_1c0287 | Neut_0357 |
| fig|6666666.60966.peg.280 | CDS | 259004 | 259126 | 2 | + | 123 | patatin family protein | -none- | D23_1c0288 | Neut_1317 |
| fig|6666666.60966.peg.281 | CDS | 259254 | 259123 | −3 | − | 132 | cAMP-binding proteins- | cAMP signaling in | D23_1c0289 | NA |
| catabolite gene | bacteria | |||||||||
| activator and regulatory | ||||||||||
| subunit of cAMP- | ||||||||||
| dependent protein | ||||||||||
| kinases | ||||||||||
| fig|6666666.60966.peg.282 | CDS | 259543 | 260031 | 1 | + | 489 | Cytochrome c' | -none- | D23_1c0291 | NA |
| fig|6666666.60966.peg.283 | CDS | 260060 | 260947 | 2 | + | 888 | Putative diheme | Soluble cytochromes | D23_1c0292 | Neut_1381 |
| cytochrome c-553 | and functionally related | |||||||||
| electron carriers | ||||||||||
| fig|6666666.60966.peg.285 | CDS | 261917 | 261708 | −2 | − | 210 | hypothetical protein | -none- | D23_1c0294 | Neut_0363 |
| fig|6666666.60966.peg.288 | CDS | 262640 | 262440 | −2 | − | 201 | Mobile element protein | -none- | D23_1c0296 | Neut_1696 |
| fig|6666666.60966.peg.289 | CDS | 263106 | 264041 | 3 | + | 936 | hypothetical protein | -none- | D23_1c0297 | NA |
| fig|6666666.60966.peg.290 | CDS | 264137 | 265633 | 2 | + | 1497 | SII1503 protein | -none- | D23_1c0298 | NA |
| fig|6666666.60966.peg.294 | CDS | 266897 | 266760 | −2 | − | 138 | hypothetical protein | -none- | D23_1c0300 | NA |
| fig|6666666.60966.peg.295 | CDS | 267026 | 267370 | 2 | + | 345 | COGs COG3339 | -none- | D23_1c0301 | Neut_0371 |
| fig|6666666.60966.peg.297 | CDS | 268862 | 267765 | −2 | − | 1098 | L-lactate | Lactate utilization; | D23_1c0302 | Neut_0372 |
| dehydrogenase (EC | <br>Respiratory | |||||||||
| 1.1.2.3) | dehydrogenases 1 | |||||||||
| fig|6666666.60966.peg.298 | CDS | 269655 | 268972 | −3 | − | 684 | Iron-uptake factor PiuC | -none- | D23_1c0303 | Neut_0373 |
| fig|6666666.60966.peg.299 | CDS | 271893 | 269683 | −3 | − | 2211 | TonB-dependent | Ton and Tol transport | D23_1c0304 | Neut_0374 |
| siderophore receptor | systems | |||||||||
| fig|6666666.60966.peg.301 | CDS | 272682 | 273740 | 3 | + | 1059 | protein of unknown | -none- | D23_1c0306 | Neut_0377 |
| function DUF81 | ||||||||||
| fig|6666666.60966.peg.302 | CDS | 273758 | 274108 | 2 | + | 351 | hypothetical protein | -none- | D23_1c0307 | NA |
| fig|6666666.60966.peg.303 | CDS | 274775 | 274182 | −2 | − | 594 | InterPro IPR001226 | -none- | D23_1c0308 | Neut_0379 |
| COGs COG0790 | ||||||||||
| fig|6666666.60966.peg.304 | CDS | 274944 | 274792 | −3 | − | 153 | hypothetical protein | -none- | D23_1c0309 | NA |
| fig|6666666.60966.peg.305 | CDS | 276110 | 274986 | −2 | − | 1125 | dNTP | Purine conversions; | D23_1c0310 | Neut_0380 |
| triphosphohydrolase, | <br>dNTP | |||||||||
| broad substrate | triphosphohydrolase | |||||||||
| specificity, subgroup 2 | protein family | |||||||||
| fig|6666666.60966.peg.306 | CDS | 277212 | 276103 | −3 | − | 1110 | 3-dehydroquinate | Chorismate Synthesis; | D23_1c0311 | Neut_0381 |
| synthase (EC 4.2.3.4) | <br>Common Pathway | |||||||||
| For Synthesis of | ||||||||||
| Aromatic Compounds | ||||||||||
| (DAHP synthase to | ||||||||||
| chorismate) | ||||||||||
| fig|6666666.60966.peg.308 | CDS | 277726 | 277896 | 1 | + | 171 | hypothetical protein | -none- | D23_1c0312 | Neut_0382 |
| fig|6666666.60966.peg.307 | CDS | 277692 | 277261 | −3 | − | 432 | Shikimate kinase I (EC | Chorismate Synthesis; | D23_1c0312 | Neut_0382 |
| 2.7.1.71) | <br>Common Pathway | |||||||||
| For Synthesis of | ||||||||||
| Aromatic Compounds | ||||||||||
| (DAHP synthase to | ||||||||||
| chorismate) | ||||||||||
| fig|6666666.60966.peg.309 | CDS | 279343 | 277982 | −1 | − | 1362 | Putative protease | -none- | D23_1c0313 | Neut_0383 |
| fig|6666666.60966.peg.310 | CDS | 279362 | 282934 | 2 | + | 3573 | DNA polymerase III | Phage replication | D23_1c0314 | Neut_0384 |
| alpha subunit (EC | ||||||||||
| 2.7.7.7) | ||||||||||
| fig|6666666.60966.peg.311 | CDS | 283139 | 282948 | −2 | − | 192 | putative | -none- | D23_1c0315 | Neut_0385 |
| transmembrane protein | ||||||||||
| fig|6666666.60966.peg.312 | CDS | 283290 | 284243 | 3 | + | 954 | tRNA | tRNA modification | D23_1c0316 | Neut_0386 |
| dimethylallyltransferase | Bacteria; <br>tRNA | |||||||||
| (EC 2.5.1.75) | processing | |||||||||
| fig|6666666.60966.peg.313 | CDS | 284258 | 284401 | 2 | + | 144 | hypothetical protein | -none- | D23_1c0317 | NA |
| fig|6666666.60966.peg.314 | CDS | 286041 | 284776 | −3 | − | 1266 | Two component, | -none- | D23_1c0320 | Neut_0387 |
| sigma54 specific, | ||||||||||
| transcriptional | ||||||||||
| regulator, Fis family | ||||||||||
| fig|6666666.60966.peg.315 | CDS | 286328 | 286191 | −2 | − | 138 | hypothetical protein | -none- | D23_1c0321 | NA |
| fig|6666666.60966.peg.316 | CDS | 288462 | 286330 | −3 | − | 2133 | Nitrogen regulation | Possible RNA | D23_1c0322 | Neut_0388 |
| protein NtrY (EC 2.7.3.—) | degradation cluster | |||||||||
| fig|6666666.60966.peg.317 | CDS | 289077 | 288514 | −3 | − | 564 | Probable proline rich | -none- | D23_1c0323 | Neut_0389 |
| signal peptide protein | ||||||||||
| fig|6666666.60966.peg.318 | CDS | 290401 | 289121 | −1 | − | 1281 | 16S rRNA | RNA methylation | D23_1c0324 | Neut_0390 |
| (cytosine(967)-C(5))- | ||||||||||
| methyltransferase (EC | ||||||||||
| 2.1.1.176) ## SSU rRNA | ||||||||||
| m5C967 | ||||||||||
| fig|6666666.60966.peg.319 | CDS | 291388 | 290414 | −1 | − | 975 | Methionyl-tRNA | Translation initiation | D23_1c0325 | Neut_0391 |
| formyltransferase (EC | factors bacterial | |||||||||
| 2.1.2.9) | ||||||||||
| fig|6666666.60966.peg.320 | CDS | 291933 | 291427 | −3 | − | 507 | Peptide deformylase | Bacterial RNA- | D23_1c0326 | Neut_0392 |
| (EC 3.5.1.88) | metabolizing Zn- | |||||||||
| dependent hydrolases; | ||||||||||
| <br>Translation | ||||||||||
| termination factors | ||||||||||
| bacterial | ||||||||||
| fig|6666666.60966.peg.321 | CDS | 292108 | 293136 | 1 | + | 1029 | Uncharacterized protein | -none- | D23_1c0327 | Neut_0393 |
| with LysM domain, | ||||||||||
| COG1652 | ||||||||||
| fig|6666666.60966.peg.322 | CDS | 293235 | 294356 | 3 | + | 1122 | Rossmann fold | -none- | D23_1c0328 | Neut_0394 |
| nucleotide-binding | ||||||||||
| protein Smf possibly | ||||||||||
| involved in DNA uptake | ||||||||||
| fig|6666666.60966.peg.323 | CDS | 294438 | 294896 | 3 | + | 459 | Protein of unknown | -none- | D23_1c0329 | Neut_0395 |
| function Smg | ||||||||||
| fig|6666666.60966.peg.324 | CDS | 295024 | 297522 | 1 | + | 2499 | DNA topoisomerase III, | DNA topoisomerases, | D23_1c0330 | Neut_0396 |
| Burkholderia type (EC | Type I, ATP-independent | |||||||||
| 5.99.1.2) | ||||||||||
| fig|6666666.60966.peg.325 | CDS | 297826 | 297575 | −1 | − | 252 | FIG00858730: | -none- | D23_1c0331 | Neut_0397 |
| hypothetical protein | ||||||||||
| fig|6666666.60966.peg.326 | CDS | 298176 | 299477 | 3 | + | 1302 | 5-Enolpyruvylshikimate- | Chorismate Synthesis; | D23_1c0333 | Neut_0398 |
| 3-phosphate synthase | <br>Common Pathway | |||||||||
| (EC 2.5.1.19) | For Synthesis of | |||||||||
| Aromatic Compounds | ||||||||||
| (DAHP synthase to | ||||||||||
| chorismate) | ||||||||||
| fig|6666666.60966.peg.327 | CDS | 299557 | 300228 | 1 | + | 672 | Cytidylate kinase (EC | -none- | D23_1c0335 | Neut_0399 |
| 2.7.4.14) | ||||||||||
| fig|6666666.60966.peg.328 | CDS | 300339 | 302051 | 3 | + | 1713 | SSU ribosomal protein | -none- | D23_1c0336 | Neut_0400 |
| S1p | ||||||||||
| fig|6666666.60966.peg.329 | CDS | 302061 | 302378 | 3 | + | 318 | Integration host factor | DNA structural proteins, | D23_1c0337 | Neut_0401 |
| beta subunit | bacterial | |||||||||
| fig|6666666.60966.peg.330 | CDS | 302493 | 302368 | −3 | − | 126 | hypothetical protein | -none- | D23_1c0338 | NA |
| fig|6666666.60966.peg.33 1 | CDS | 302902 | 303597 | 1 | + | 696 | Orotidine 5'- | De Novo Pyrimidine | D23_1c0339 | Neut_0402 |
| phosphate | Synthesis; <br>Riboflavin | |||||||||
| decarboxylase (EC | synthesis cluster | |||||||||
| 4.1.1.23) | ||||||||||
| fig|6666666.60966.peg.332 | CDS | 304632 | 303592 | −3 | − | 1041 | Squalene synthase (EC | Hopanes | D23_1c0340 | Neut_0403 |
| 2.5.1.21) | ||||||||||
| fig|6666666.60966.peg.333 | CDS | 305907 | 304654 | −3 | − | 1254 | Diaminopimelate | Lysine Biosynthesis DAP | D23_1c0341 | Neut_0404 |
| decarboxylase (EC | Pathway, GJO scratch | |||||||||
| 4.1.1.20) | ||||||||||
| fig|6666666.60966.peg.334 | CDS | 306026 | 305904 | −2 | − | 123 | hypothetical protein | -none- | D23_1c0342 | NA |
| fig|6666666.60966.peg.335 | CDS | 306654 | 306052 | −3 | − | 603 | Probable lipoprotein | -none- | D23_1c0343 | Neut_0405 |
| fig|6666666.60966.peg.336 | CDS | 307556 | 306651 | −2 | − | 906 | ABC-type transport | -none- | D23_1c0344 | Neut_0406 |
| system involved in | ||||||||||
| resistance to organic | ||||||||||
| solvents, periplasmic | ||||||||||
| component | ||||||||||
| fig|6666666.60966.peg.337 | CDS | 308341 | 307583 | −1 | − | 759 | Inositol-1- | -none- | D23_1c0345 | Neut_0407 |
| monophosphatase (EC | ||||||||||
| 3.1.3.25) | ||||||||||
| fig|6666666.60966.peg.339 | CDS | 308500 | 309207 | 1 | + | 708 | tRNA:Cm32/Um32 | RNA methylation; | D23_1c0346 | Neut_0408 |
| methyltransferase | <br>tRNA modification | |||||||||
| Bacteria | ||||||||||
| fig|6666666.60966.peg.340 | CDS | 309905 | 309291 | −2 | − | 615 | Glutathione S- | Glutathione: Non-redox | D23_1c0347 | Neut_0409 |
| transferase family | reactions; <br>Scaffold | |||||||||
| protein | proteins for [4Fe-4S] | |||||||||
| cluster assembly (MRP | ||||||||||
| family) | ||||||||||
| fig|6666666.60966.peg.341 | CDS | 310042 | 311418 | 1 | + | 1377 | Adenylosuccinate lyase | De Novo Purine | D23_1c0348 | Neut_0410 |
| (EC 4.3.2.2) | Biosynthesis; <br>Purine | |||||||||
| conversions | ||||||||||
| fig|6666666.60966.peg.342 | CDS | 311556 | 312146 | 3 | + | 591 | Heat shock protein | GroEL GroES; <br>Heat | D23_1c0349 | Neut_0411 |
| GrpE | shock dnaK gene cluster | |||||||||
| extended; <br>Protein | ||||||||||
| chaperones | ||||||||||
| fig|6666666.60966.peg.343 | CDS | 312210 | 314153 | 3 | + | 1944 | Chaperone protein | GroEL GroES; <br>Heat | D23_1c0350 | Neut_0412 |
| DnaK | shock dnaK gene cluster | |||||||||
| extended; <br>Protein | ||||||||||
| chaperones | ||||||||||
| fig|6666666.60966.peg.344 | CDS | 314344 | 315453 | 1 | + | 1110 | Chaperone protein DnaJ | GroEL GroES; <br>Heat | D23_1c0351 | Neut_0413 |
| shock dnaK gene cluster | ||||||||||
| extended; <br>Protein | ||||||||||
| chaperones | ||||||||||
| fig|6666666.60966.peg.345 | CDS | 318894 | 315550 | −3 | − | 3345 | Potassium efflux system | Potassium homeostasis | D23_1c0352 | Neut_0414 |
| KefA protein/Small- | ||||||||||
| conductance | ||||||||||
| mechanosensitive | ||||||||||
| channel | ||||||||||
| fig|6666666.60966.peg.346 | CDS | 319923 | 319357 | −3 | − | 567 | Transcriptional | -none- | D23_1c0353 | Neut_0415 |
| regulator, TetR family | ||||||||||
| fig|6666666.60966.peg.347 | CDS | 321174 | 319990 | −3 | − | 1185 | InterPro IPR001327 | -none- | D23_1c0354 | Neut_0416 |
| COGs COG2072 | ||||||||||
| fig|6666666.60966.peg.348 | CDS | 321778 | 321236 | −1 | − | 543 | hypothetical protein | -none- | D23_1c0355 | Neut_0417 |
| fig|6666666.60966.peg.349 | CDS | 322196 | 322363 | 2 | + | 168 | hypothetical protein | -none- | D23_1c0356 | NA |
| fig|6666666.60966.peg.350 | CDS | 325140 | 322522 | −3 | − | 2619 | Membrane alanine | Aminopeptidases (EC | D23_1c0357 | Neut_0418 |
| aminopeptidase N (EC | 3.4.11.—) | |||||||||
| 3.4.11.2) | ||||||||||
| fig|6666666.60966.peg.351 | CDS | 325139 | 325255 | 2 | + | 117 | hypothetical protein | -none- | D23_1c0358 | NA |
| fig|6666666.60966.peg.352 | CDS | 326547 | 325213 | −3 | − | 1335 | Peptide methionine | Peptide methionine | D23_1c0359 | Neut_0419 |
| sulfoxide reductase | sulfoxide reductase; | |||||||||
| MsrA (EC 1.8.4.11)/ | <br>Peptide methionine | |||||||||
| Thiol:disulfide | sulfoxide reductase; | |||||||||
| oxidoreductase | <br>Peptide methionine | |||||||||
| associated with MetSO | sulfoxide reductase | |||||||||
| reductase/Peptide | ||||||||||
| Methionine sulfoxide | ||||||||||
| reductase MsrB (EC | ||||||||||
| 1.8.4.12) | ||||||||||
| fig|6666666.60966.peg.354 | CDS | 326909 | 329791 | 2 | + | 2883 | Diguanylate | -none- | D23_1c0360 | Neut_0422 |
| cyclase/phosphodiesterase | ||||||||||
| domain 2 (EAL) | ||||||||||
| fig|6666666.60966.peg.355 | CDS | 331130 | 329874 | −2 | − | 1257 | FIG00858721: | -none- | D23_1c0361 | Neut_0423 |
| hypothetical protein | ||||||||||
| fig|6666666.60966.peg.356 | CDS | 331369 | 332730 | 1 | + | 1362 | O-acetylhomoserine | Methionine | D23_1c0363 | Neut_0424 |
| sulfhydrylase (EC | Biosynthesis; | |||||||||
| 2.5.1.49)/O- | <br>Methionine | |||||||||
| succinylhomoserine | Biosynthesis | |||||||||
| sulfhydrylase (EC | ||||||||||
| 2.5.1.48) | ||||||||||
| fig|6666666.60966.peg.357 | CDS | 334115 | 332718 | −2 | − | 1398 | NnrS protein involved in | Denitrification; | D23_1c0364 | Neut_0425 |
| response to NO | <br>Nitrosative stress; | |||||||||
| <br>Oxidative stress | ||||||||||
| fig|6666666.60966.peg.358 | CDS | 334992 | 334066 | −3 | − | 927 | Serine acetyltransferase | Cysteine Biosynthesis; | D23_1c0365 | Neut_0426 |
| (EC 2.3.1.30) | <br>Methionine | |||||||||
| Biosynthesis | ||||||||||
| fig|6666666.60966.peg.360 | CDS | 335392 | 336399 | 1 | + | 1008 | Glucokinase (EC 2.7.1.2) | Glycolysis and | D23_1c0367 | Neut_0427 |
| Gluconeogenesis | ||||||||||
| fig|6666666.60966.peg.361 | CDS | 336414 | 337073 | 3 | + | 660 | Probable | -none- | D23_1c0368 | Neut_0428 |
| transmembrane protein | ||||||||||
| fig|6666666.60966.peg.362 | CDS | 337412 | 337101 | −2 | − | 312 | FIG00858769: | -none- | D23_1c0369 | Neut_0429 |
| hypothetical protein | ||||||||||
| fig|6666666.60966.peg.363 | CDS | 338169 | 337483 | −3 | − | 687 | 6- | Pentose phosphate | D23_1c0370 | Neut_0430 |
| phosphogluconolactonase | pathway | |||||||||
| (EC 3.1.1.31), | ||||||||||
| eukaryotic type | ||||||||||
| fig|6666666.60966.peg.364 | CDS | 338807 | 338151 | −2 | − | 657 | hydrolase, haloacid | -none- | D23_1c0371 | Neut_0431 |
| dehalogenase-like | ||||||||||
| family | ||||||||||
| fig|6666666.60966.peg.365 | CDS | 339746 | 338814 | −2 | − | 933 | NAD-dependent | CBSS-296591.1.peg.2330 | D23_1c0372 | Neut_0432 |
| epimerase/dehydratase | ||||||||||
| fig|6666666.60966.peg.366 | CDS | 340674 | 339739 | −3 | − | 936 | D-3-phosphoglycerate | Glycine and Serine | D23_1c0373 | Neut_0433 |
| dehydrogenase (EC | Utilization; | |||||||||
| 1.1.1.95) | <br>Pyridoxin (Vitamin | |||||||||
| B6) Biosynthesis; | ||||||||||
| <br>Serine Biosynthesis | ||||||||||
| fig|6666666.60966.peg.367 | CDS | 341432 | 340671 | −2 | − | 762 | 2,4-dihydroxyhept-2- | -none- | D23_1c0374 | Neut_0434 |
| ene-1,7-dioic acid | ||||||||||
| aldolase (EC 4.1.2.—) | ||||||||||
| fig|6666666.60966.peg.368 | CDS | 342202 | 341444 | −1 | − | 759 | 3-deoxy-manno- | KDO2-Lipid A | D23_1c0375 | Neut_0435 |
| octulosonate | biosynthesis cluster 2 | |||||||||
| cytidylyltransferase (EC | ||||||||||
| 2.7.7.38) | ||||||||||
| fig|6666666.60966.peg.370 | CDS | 342384 | 342509 | 3 | + | 126 | hypothetical protein | -none- | D23_1c0376 | NA |
| fig|6666666.60966.peg.371 | CDS | 342506 | 343585 | 2 | + | 1080 | Glycosyl transferase, | -none- | D23_1c0377 | Neut_0436 |
| group 2 family protein | ||||||||||
| fig|6666666.60966.peg.372 | CDS | 343660 | 344931 | 1 | + | 1272 | O-antigen ligase | -none- | D23_1c0378 | Neut_0437 |
| fig|6666666.60966.peg.373 | CDS | 344931 | 345620 | 3 | + | 690 | O-methyltransferase | -none- | D23_1c0379 | Neut_0438 |
| family protein [C1] | ||||||||||
| fig|6666666.60966.peg.374 | CDS | 345673 | 345930 | 1 | + | 258 | FIG00859064: | -none- | D23_1c0380 | Neut_0439 |
| hypothetical protein | ||||||||||
| fig|6666666.60966.peg.375 | CDS | 345980 | 346498 | 2 | + | 519 | Mlr4354 like protein | -none- | D23_1c0381 | Neut_0440 |
| fig|6666666.60966.peg.376 | CDS | 346511 | 346858 | 2 | + | 348 | Arsenate reductase (EC | Anaerobic respiratory | D23_1c0382 | Neut_0441 |
| 1.20.4.1) | reductases; | |||||||||
| <br>Transcription repair | ||||||||||
| cluster | ||||||||||
| fig|6666666.60966.peg.377 | CDS | 347305 | 346916 | −1 | − | 390 | LSU ribosomal protein | -none- | D23_1c0383 | Neut_0442 |
| L19p | ||||||||||
| fig|6666666.60966.peg.378 | CDS | 348122 | 347277 | −2 | − | 846 | tRNA (Guanine37-N1)- | RNA methylation; | D23_1c0384 | Neut_0443 |
| methyltransferase (EC | <br>Ribosome | |||||||||
| 2.1.1.31) | biogenesis bacterial; | |||||||||
| <br>tRNA modification | ||||||||||
| Bacteria | ||||||||||
| fig|6666666.60966.peg.379 | CDS | 348636 | 348130 | −3 | − | 507 | 16S rRNA processing | Ribosome biogenesis | D23_1c0385 | Neut_0444 |
| protein RimM | bacterial | |||||||||
| fig|6666666.60966.peg.381 | CDS | 349157 | 350437 | 2 | + | 1281 | Glycolate | Glycolate, glyoxylate | D23_1c0386 | Neut_0446 |
| dehydrogenase (EC | interconversions; | |||||||||
| 1.1.99.14), iron-sulfur | <br>Photorespiration | |||||||||
| subunit GlcF | (oxidative C2 cycle) | |||||||||
| fig|6666666.60966.peg.382 | CDS | 350492 | 351118 | 2 | + | 627 | Uncharacterized | Ubiquinone Biosynthesis- | D23_1c0387 | Neut_0447 |
| hydroxylase PA0655 | gjo | |||||||||
| fig|6666666.60966.peg.383 | CDS | 351152 | 351712 | 2 | + | 561 | UPF0301 protein YqgE | -none- | D23_1c0388 | Neut_0448 |
| fig|6666666.60966.peg.384 | CDS | 351705 | 352178 | 3 | + | 474 | Putative Holliday | -none- | D23_1c0389 | Neut_0449 |
| junction resolvase (EC | ||||||||||
| 3.1.—.—) | ||||||||||
| fig|6666666.60966.peg.385 | CDS | 352165 | 352668 | 1 | + | 504 | Uracil | De Novo Pyrimidine | D23_1c0390 | Neut_0450 |
| phosphoribosyltransferase | Synthesis; <br>De Novo | |||||||||
| (EC 2.4.2.9)/ | Pyrimidine Synthesis; | |||||||||
| Pyrimidine operon | <br>pyrimidine | |||||||||
| regulatory protein PyrR | conversions | |||||||||
| fig|6666666.60966.peg.386 | CDS | 352856 | 353806 | 2 | + | 951 | Aspartate | De Novo Pyrimidine | D23_1c0391 | Neut_0451 |
| carbamoyltransferase | Synthesis | |||||||||
| (EC 2.1.3.2) | ||||||||||
| fig|6666666.60966.peg.387 | CDS | 353822 | 355093 | 2 | + | 1272 | Dihydroorotase (EC | De Novo Pyrimidine | D23_1c0392 | Neut_0452 |
| 3.5.2.3) | Synthesis; <br>Zinc | |||||||||
| regulated enzymes | ||||||||||
| fig|6666666.60966.peg.388 | CDS | 355217 | 357322 | 2 | + | 2106 | Oligopeptidase A (EC | Protein degradation | D23_1c0393 | Neut_0453 |
| 3.4.24.70) | ||||||||||
| fig|6666666.60966.peg.389 | CDS | 357558 | 358709 | 3 | + | 1152 | Carbamoyl-phosphate | De Novo Pyrimidine | D23_1c0394 | Neut_0454 |
| synthase small chain | Synthesis; | |||||||||
| (EC 6.3.5.5) | <br>Macromolecular | |||||||||
| synthesis operon | ||||||||||
| fig|6666666.60966.peg.390 | CDS | 358735 | 361932 | 1 | + | 3198 | Carbamoyl-phosphate | De Novo Pyrimidine | D23_1c0395 | Neut_0455 |
| synthase large chain (EC | Synthesis; | |||||||||
| 6.3.5.5) | <br>Macromolecular | |||||||||
| synthesis operon | ||||||||||
| fig|6666666.60966.peg.391 | CDS | 362117 | 362593 | 2 | + | 477 | Transcription | Transcription factors | D23_1c0396 | Neut_0456 |
| elongation factor GreA | bacterial | |||||||||
| fig|6666666.60966.peg.392 | CDS | 363579 | 362608 | −3 | − | 972 | ErfK/YbiS/YcfS/YnhG | -none- | D23_1c0397 | Neut_0457 |
| family protein | ||||||||||
| fig|6666666.60966.peg.393 | CDS | 364226 | 366052 | 2 | + | 1827 | Long-chain-fatty-acid-- | Biotin biosynthesis; | D23_1c0398 | Neut_0458 |
| CoA ligase (EC 6.2.1.3) | <br>Biotin synthesis | |||||||||
| cluster; <br>Fatty acid | ||||||||||
| metabolism cluster | ||||||||||
| fig|6666666.60966.peg.394 | CDS | 366141 | 367064 | 3 | + | 924 | FIG010773: NAD- | -none- | D23_1c0399 | Neut_0459 |
| dependent | ||||||||||
| epimerase/dehydratase | ||||||||||
| fig|6666666.60966.peg.395 | CDS | 367176 | 367430 | 3 | + | 255 | phosphopantetheine- | -none- | D23_1c0400 | Neut_0460 |
| binding | ||||||||||
| fig|6666666.60966.peg.396 | CDS | 367430 | 368617 | 2 | + | 1188 | Aminotransferase class | -none- | D23_1c0401 | Neut_0461 |
| II, serine | ||||||||||
| palmitoyltransferase | ||||||||||
| like (EC 2.3.1.50) | ||||||||||
| fig|6666666.60966.peg.397 | CDS | 368669 | 369427 | 2 | + | 759 | COG1496: | -none- | D23_1c0402 | Neut_0462 |
| Uncharacterized | ||||||||||
| conserved protein | ||||||||||
| fig|6666666.60966.peg.398 | CDS | 369615 | 370427 | 3 | + | 813 | Zinc transporter, ZIP | -none- | D23_1c0403 | Neut_0463 |
| family | ||||||||||
| fig|6666666.60966.peg.399 | CDS | 373049 | 370434 | −2 | − | 2616 | Dolichyl-phosphate | -none- | D23_1c0404 | Neut_0464 |
| beta-D- | ||||||||||
| mannosyltransferase | ||||||||||
| (EC: 2.4.1.83) | ||||||||||
| fig|6666666.60966.peg.400 | CDS | 374173 | 373157 | −1 | − | 1017 | FIG004453: protein | CBSS- | D23_1c0405 | Neut_0465 |
| YceG like | 323097.3.peg.2594; | |||||||||
| <br>Cluster containing | ||||||||||
| Alanyl-tRNA synthetase; | ||||||||||
| <br>tRNA modification | ||||||||||
| Bacteria | ||||||||||
| fig|6666666.60966.peg.401 | CDS | 374277 | 374140 | −3 | − | 138 | hypothetical protein | -none- | D23_1c0406 | NA |
| fig|6666666.60966.peg.402 | CDS | 375542 | 374301 | −2 | − | 1242 | 3-oxoacyl-[acyl-carrier- | Fatty Acid Biosynthesis | D23_1c0407 | Neut_0466 |
| protein] synthase, KASII | FASII | |||||||||
| (EC 2.3.1.41) | ||||||||||
| fig|6666666.60966.peg.403 | CDS | 375822 | 375577 | −3 | − | 246 | Acyl carrier protein | Fatty Acid Biosynthesis | D23_1c0408 | Neut_0467 |
| FASII; <br>Glycerolipid | ||||||||||
| and Glycerophospholipid | ||||||||||
| Metabolism in Bacteria | ||||||||||
| fig|6666666.60966.peg.405 | CDS | 376731 | 375988 | −3 | − | 744 | 3-oxoacyl-[acyl-carrier | Fatty Acid Biosynthesis | D23_1c0409 | Neut_0468 |
| protein] reductase (EC | FASII | |||||||||
| 1.1.1.100) | ||||||||||
| fig|6666666.60966.peg.406 | CDS | 377726 | 376788 | −2 | − | 939 | Malonyl CoA-acyl | Fatty Acid Biosynthesis | D23_1c0410 | Neut_0469 |
| carrier protein | FASII | |||||||||
| transacylase (EC | ||||||||||
| 2.3.1.39) | ||||||||||
| fig|6666666.60966.peg.407 | CDS | 378692 | 377730 | −2 | − | 963 | 3-oxoacyl-[acyl-carrier- | Fatty Acid Biosynthesis | D23_1c0411 | Neut_0470 |
| protein] synthase, | FASII | |||||||||
| KASIII (EC 2.3.1.41) | ||||||||||
| fig|6666666.60966.peg.408 | CDS | 379722 | 378703 | −3 | − | 1020 | Phosphate:acyl-ACP | Glycerolipid and | D23_1c0412 | Neut_0471 |
| acyltransferase PlsX | Glycerophospholipid | |||||||||
| Metabolism in Bacteria | ||||||||||
| fig|6666666.60966.peg.409 | CDS | 379982 | 379800 | −2 | − | 183 | LSU ribosomal protein | -none- | D23_1c0414 | Neut_0472 |
| L32p | ||||||||||
| fig|6666666.60966.peg.410 | CDS | 380510 | 380007 | −2 | − | 504 | COG1399 protein, | -none- | D23_1c0415 | Neut_0473 |
| clustered with | ||||||||||
| ribosomal protein L32p | ||||||||||
| fig|6666666.60966.peg.411 | CDS | 380534 | 381175 | 2 | + | 642 | FIG146278: | -none- | D23_1c0416 | Neut_0474 |
| Maf/YceF/YhdE family | ||||||||||
| protein | ||||||||||
| fig|6666666.60966.peg.412 | CDS | 381292 | 381684 | 1 | + | 393 | FIG00858587: | -none- | D23_1c0417 | Neut_0475 |
| hypothetical protein | ||||||||||
| fig|6666666.60966.peg.413 | CDS | 381793 | 383217 | 1 | + | 1425 | Heavy metal RND efflux | Cobalt-zinc-cadmium | D23_1c0418 | Neut_0476 |
| outer membrane | resistance | |||||||||
| protein, CzcC family | ||||||||||
| fig|6666666.60966.peg.414 | CDS | 383214 | 384710 | 3 | + | 1497 | Cobalt/zinc/cadmium | Cobalt-zinc-cadmium | D23_1c0419 | Neut_0477 |
| efflux RND transporter, | resistance | |||||||||
| membrane fusion | ||||||||||
| protein, CzcB family | ||||||||||
| fig|6666666.60966.peg.415 | CDS | 384811 | 388020 | 1 | + | 3210 | Cobalt-zinc-cadmium | Cobalt-zinc-cadmium | D23_1c0421 | Neut_0478 |
| resistance protein CzcA; | resistance; <br>Cobalt- | |||||||||
| Cation efflux system | zinc-cadmium resistance | |||||||||
| protein CusA | ||||||||||
| fig|6666666.60966.peg.416 | CDS | 388294 | 388731 | 1 | + | 438 | FIG00858457: | -none- | D23_1c0423 | Neut_0479 |
| hypothetical protein | ||||||||||
| fig|6666666.60966.peg.417 | CDS | 388756 | 389043 | 1 | + | 288 | FIG00858508: | -none- | D23_1c0424 | Neut_0480 |
| hypothetical protein | ||||||||||
| fig|6666666.60966.peg.418 | CDS | 389040 | 389948 | 3 | + | 909 | FIG00858931: | -none- | D23_1c0425 | Neut_0481 |
| hypothetical protein | ||||||||||
| fig|6666666.60966.peg.419 | CDS | 389941 | 391068 | 1 | + | 1128 | hypothetical protein | -none- | D23_1c0426 | Neut_0482 |
| fig|6666666.60966.peg.420 | CDS | 392521 | 391079 | −1 | − | 1443 | Mg/Co/Ni transporter | Magnesium transport | D23_1c0427 | Neut_0483 |
| MgtE/CBS domain | ||||||||||
| fig|6666666.60966.peg.424 | CDS | 394723 | 393761 | −1 | − | 963 | Mobile element protein | -none- | D23_1c0430 | Neut_1746 |
| fig|6666666.60966.peg.425 | CDS | 394947 | 394834 | −3 | − | 114 | hypothetical protein | -none- | D23_1c0431 | NA |
| fig|6666666.60966.peg.426 | CDS | 394946 | 395251 | 2 | + | 306 | hypothetical protein | -none- | D23_1c0432 | Neut_0486 |
| fig|6666666.60966.peg.427 | CDS | 395968 | 395309 | −1 | − | 660 | COG1272: Predicted | -none- | D23_1c0433 | Neut_0487 |
| membrane protein | ||||||||||
| hemolysin III homolog | ||||||||||
| fig|6666666.60966.peg.428 | CDS | 396481 | 396179 | −1 | − | 303 | hypothetical protein | -none- | D23_1c0434 | Neut_0488 |
| fig|6666666.60966.peg.430 | CDS | 397189 | 396863 | −1 | − | 327 | hypothetical protein | -none- | D23_1c0435 | Neut_0490 |
| fig|6666666.60966.peg.433 | CDS | 397653 | 398393 | 3 | + | 741 | cAMP-binding proteins- | cAMP signaling in | D23_1c0436 | Neut_0491 |
| catabolite gene | bacteria | |||||||||
| activator and regulatory | ||||||||||
| subunit of cAMP- | ||||||||||
| dependent protein | ||||||||||
| kinases | ||||||||||
| fig|6666666.60966.peg.434 | CDS | 398690 | 398424 | −2 | − | 267 | Putative lipoprotein | -none- | D23_1c0437 | Neut_0492 |
| fig|6666666.60966.peg.435 | CDS | 399146 | 398973 | −2 | − | 174 | hypothetical protein | -none- | D23_1c0438 | NA |
| fig|6666666.60966.peg.436 | CDS | 399498 | 399373 | −3 | − | 126 | hypothetical protein | -none- | D23_1c0439 | NA |
| fig|6666666.60966.peg.437 | CDS | 400841 | 399609 | −2 | − | 1233 | hypothetical protein | -none- | D23_1c0440 | Neut_0494 |
| fig|6666666.60966.peg.438 | CDS | 401592 | 400858 | −3 | − | 735 | Monofunctional | Peptidoglycan | D23_1c0441 | Neut_0495 |
| biosynthetic | Biosynthesis | |||||||||
| peptidoglycan | ||||||||||
| transglycosylase (EC | ||||||||||
| 2.4.2.—) | ||||||||||
| fig|6666666.60966.peg.439 | CDS | 402422 | 401589 | −2 | − | 834 | Shikimate 5- | Chorismate Synthesis; | D23_1c0442 | Neut_0496 |
| dehydrogenase I alpha | <br>Cluster containing | |||||||||
| (EC 1.1.1.25) | Alanyl-tRNA synthetase; | |||||||||
| <br>Common Pathway | ||||||||||
| For Synthesis of | ||||||||||
| Aromatic Compounds | ||||||||||
| (DAHP synthase to | ||||||||||
| chorismate) | ||||||||||
| fig|6666666.60966.peg.440 | CDS | 403340 | 402456 | −2 | − | 885 | TonB protein | -none- | D23_1c0443 | Neut_0497 |
| fig|6666666.60966.peg.441 | CDS | 405237 | 403378 | −3 | − | 1860 | Exoribonuclease II (EC | RNA processing and | D23_1c0444 | Neut_0498 |
| 3.1.13.1) | degradation, bacterial | |||||||||
| fig|6666666.60966.peg.443 | CDS | 405594 | 406985 | 3 | + | 1392 | Glutamyl-tRNA | Heme and Siroheme | D23_1c0445 | Neut_0499 |
| synthetase (EC 6.1.1.17) | Biosynthesis; <br>tRNA | |||||||||
| aminoacylation, Glu and | ||||||||||
| Gln | ||||||||||
| fig|6666666.60966.peg.444 | CDS | 407045 | 410752 | 2 | + | 3708 | 5- | Methionine Biosynthesis | D23_1c0446 | Neut_0500 |
| methyltetrahydrofolate-- | ||||||||||
| homocysteine | ||||||||||
| methyltransferase (EC | ||||||||||
| 2.1.1.13) | ||||||||||
| fig|6666666.60966.peg.445 | CDS | 410924 | 412267 | 2 | + | 1344 | NADP-specific | Arginine and Ornithine | D23_1c0447 | Neut_0501 |
| glutamate | Degradation; | |||||||||
| dehydrogenase (EC | <br>Glutamate | |||||||||
| 1.4.1.4) | dehydrogenases; | |||||||||
| <br>Glutamine, | ||||||||||
| Glutamate, Aspartate | ||||||||||
| and Asparagine | ||||||||||
| Biosynthesis; | ||||||||||
| <br>Proline Synthesis | ||||||||||
| fig|6666666.60966.peg.446 | CDS | 412461 | 414368 | 3 | + | 1908 | Soluble lytic murein | Murein Hydrolases | D23_1c0449 | Neut_0502 |
| transglycosylase | ||||||||||
| precursor (EC 3.2.1.—) | ||||||||||
| fig|6666666.60966.peg.447 | CDS | 414379 | 415617 | 1 | + | 1239 | tRNA | A cluster relating to | D23_1c0450 | Neut_0503 |
| nucleotidyltransferase | Tryptophanyl-tRNA | |||||||||
| (EC 2.7.7.21) (EC | synthetase; | |||||||||
| 2.7.7.25) | <br>Polyadenylation | |||||||||
| bacterial; <br>tRNA | ||||||||||
| nucleotidyltransferase | ||||||||||
| fig|6666666.60966.peg.448 | CDS | 417316 | 415592 | −1 | − | 1725 | Phospholipid- | N-linked Glycosylation in | D23_1c0451 | Neut_0504 |
| lipopolysaccharide ABC | Bacteria | |||||||||
| transporter | ||||||||||
| fig|6666666.60966.peg.449 | CDS | 418171 | 417335 | −1 | − | 837 | Diaminopimelate | CBSS-84588.1.peg.1247; | D23_1c0452 | Neut_0505 |
| epimerase (EC 5.1.1.7) | <br>Lysine Biosynthesis | |||||||||
| DAP Pathway, GJO | ||||||||||
| scratch | ||||||||||
| fig|6666666.60966.peg.450 | CDS | 418345 | 418193 | −1 | − | 153 | hypothetical protein | -none- | D23_1c0453 | NA |
| fig|6666666.60966.peg.451 | CDS | 418574 | 419011 | 2 | + | 438 | Predicted secretion | Predicted secretion | D23_1c0454 | Neut_0506 |
| system X protein GspG- | system X | |||||||||
| like 3 | ||||||||||
| fig|6666666.60966.peg.452 | CDS | 419030 | 420214 | 2 | + | 1185 | Predicted secretion | Predicted secretion | D23_1c0455 | Neut_0507 |
| system X protein GspF- | system X | |||||||||
| like | ||||||||||
| fig|6666666.60966.peg.453 | CDS | 420211 | 421905 | 1 | + | 1695 | Predicted secretion | Predicted secretion | D23_1c0456 | Neut_0508 |
| system X protein GspE- | system X | |||||||||
| like | ||||||||||
| fig|6666666.60966.peg.454 | CDS | 421910 | 422731 | 2 | + | 822 | Predicted secretion | Predicted secretion | D23_1c0457 | Neut_0509 |
| system X FIG084745: | system X | |||||||||
| hypothetical protein | ||||||||||
| fig|6666666.60966.peg.455 | CDS | 422772 | 423260 | 3 | + | 489 | Predicted secretion | Predicted secretion | D23_1c0458 | Neut_0510 |
| system X | system X | |||||||||
| transmembrane protein 1 | ||||||||||
| fig|6666666.60966.peg.472 | CDS | 440367 | 440753 | 3 | + | 387 | Mobile element protein | -none- | D23_1c0476 | Neut_0884 |
| fig|6666666.60966.peg.473 | CDS | 440716 | 441171 | 1 | + | 456 | Mobile element protein | -none- | D23_1c0477 | Neut_2502 |
| fig|6666666.60966.peg.474 | CDS | 441829 | 441158 | −1 | − | 672 | Gluconate 2- | D-gluconate and | D23_1c0478 | NA |
| dehydrogenase (EC | ketogluconates | |||||||||
| 1.1.99.3), membrane- | metabolism | |||||||||
| bound, gamma subunit | ||||||||||
| fig|6666666.60966.peg.475 | CDS | 444093 | 441973 | −3 | − | 2121 | diguanylate | -none- | D23_1c0479 | Neut_0525 |
| cyclase/phosphodiesterase | ||||||||||
| (GGDEF & EAL | ||||||||||
| domains) with PAS/PAC | ||||||||||
| sensor(s) | ||||||||||
| fig|6666666.60966.peg.476 | CDS | 444457 | 444311 | −1 | − | 147 | hypothetical protein | -none- | D23_1c0480 | NA |
| fig|6666666.60966.peg.478 | CDS | 444629 | 445810 | 2 | + | 1182 | NAD(FAD)-utilizing | -none- | D23_1c0481 | Neut_0526 |
| dehydrogenases | ||||||||||
| fig|6666666.60966.peg.479 | CDS | 446569 | 445952 | −1 | — | 618 | Methionine | -none- | D23_1c0482 | Neut_0527 |
| biosynthesis protein | ||||||||||
| MetW | ||||||||||
| fig|6666666.60966.peg.480 | CDS | 447733 | 446600 | −1 | − | 1134 | Homoserine O- | Methionine Biosynthesis | D23_1c0483 | Neut_0528 |
| acetyltransferase (EC | ||||||||||
| 2.3.1.31) | ||||||||||
| fig|6666666.60966.peg.481 | CDS | 449559 | 447832 | −3 | − | 1728 | Phosphoenolpyruvate- | -none- | D23_1c0484 | Neut_0529 |
| protein | ||||||||||
| phosphotransferase of | ||||||||||
| PTS system (EC 2.7.3.9) | ||||||||||
| fig|6666666.60966.peg.482 | CDS | 449825 | 449556 | −2 | − | 270 | Phosphocarrier protein, | -none- | D23_1c0485 | Neut_0530 |
| nitrogen regulation | ||||||||||
| associated | ||||||||||
| fig|6666666.60966.peg.483 | CDS | 450219 | 449815 | −3 | − | 405 | Sugar transport PTS | -none- | D23_1c0486 | Neut_0531 |
| system IIa component | ||||||||||
| fig|6666666.60966.peg.484 | CDS | 450568 | 451605 | 1 | + | 1038 | Phosphatidylglycerophosphatase | Glycerolipid and | D23_1c0488 | Neut_0532 |
| B (EC 3.1.3.27) | Glycerophospholipid | |||||||||
| Metabolism in Bacteria | ||||||||||
| fig|6666666.60966.peg.485 | CDS | 451971 | 451705 | −3 | − | 267 | HrgA protein | -none- | D23_1c0489 | Neut_2454 |
| fig|6666666.60966.peg.486 | CDS | 452384 | 453631 | 2 | + | 1248 | Mobile element protein | -none- | D23_1c0490 | Neut_0357 |
| fig|6666666.60966.peg.487 | CDS | 455203 | 454049 | −1 | − | 1155 | hypothetical protein | -none- | D23_1c0491 | NA |
| fig|6666666.60966.peg.488 | CDS | 455538 | 455371 | −3 | − | 168 | hypothetical protein | -none- | D23_1c0492 | NA |
| fig|6666666.60966.peg.489 | CDS | 455581 | 456603 | 1 | + | 1023 | Lipolytic enzyme, G-D-S-L | -none- | D23_1c0493 | Neut_0534 |
| fig|6666666.60966.peg.490 | CDS | 457214 | 456669 | −2 | − | 546 | N-acetylmuramoyl-L- | Recycling of | D23_1c0494 | Neut_0535 |
| alanine amidase (EC | Peptidoglycan Amino | |||||||||
| 3.5.1.28) AmpD | Acids | |||||||||
| fig|6666666.60966.peg.491 | CDS | 457304 | 457951 | 2 | + | 648 | Thymidylate kinase (EC | pyrimidine conversions | D23_1c0495 | Neut_0536 |
| 2.7.4.9) | ||||||||||
| fig|6666666.60966.peg.492 | CDS | 461332 | 458087 | −1 | − | 3246 | Type I restriction- | Restriction-Modification | D23_1c0496 | Neut_0537 |
| modification system, | System; <br>Type I | |||||||||
| restriction subunit R (EC | Restriction-Modification | |||||||||
| 3.1.21.3) | ||||||||||
| fig|6666666.60966.peg.493 | CDS | 462292 | 461345 | −1 | − | 948 | Putative DNA-binding | Restriction-Modification | D23_1c0497 | NA |
| protein in cluster with | System | |||||||||
| Type I restriction- | ||||||||||
| modification system | ||||||||||
| fig|6666666.60966.peg.494 | CDS | 462416 | 462285 | −2 | − | 132 | hypothetical protein | -none- | D23_1c0498 | NA |
| fig|6666666.60966.peg.495 | CDS | 463405 | 462413 | −1 | − | 993 | hypothetical protein | -none- | D23_1c0499 | NA |
| fig|6666666.60966.peg.496 | CDS | 464694 | 463405 | −3 | − | 1290 | Type I restriction- | Restriction-Modification | D23_1c0500 | Neut_0540 |
| modification system, | System; <br>Type I | |||||||||
| specificity subunit S (EC | Restriction-Modification | |||||||||
| 3.1.21.3) | ||||||||||
| fig|6666666.60966.peg.497 | CDS | 466246 | 464684 | −1 | − | 1563 | Type I restriction- | Restriction-Modification | D23_1c0501 | Neut_0541 |
| modification system, | System; <br>Type I | |||||||||
| DNA-methyltransferase | Restriction-Modification | |||||||||
| subunit M (EC 2.1.1.72) | ||||||||||
| fig|6666666.60966.peg.498 | CDS | 467880 | 466453 | −3 | − | 1428 | Na+/H+ antiporter | -none- | D23_1c0502 | Neut_0542 |
| NhaC | ||||||||||
| fig|6666666.60966.peg.499 | CDS | 468057 | 467896 | −3 | − | 162 | hypothetical protein | -none- | D23_1c0503 | NA |
| fig|6666666.60966.peg.500 | CDS | 468126 | 469190 | 3 | + | 1065 | DNA polymerase III | -none- | D23_1c0504 | Neut_0543 |
| delta prime subunit (EC | ||||||||||
| 2.7.7.7) | ||||||||||
| fig|6666666.60966.peg.501 | CDS | 469691 | 469194 | −2 | − | 498 | hypothetical protein | -none- | D23_1c0505 | Neut_0544 |
| fig|6666666.60966.peg.502 | CDS | 469703 | 469870 | 2 | + | 168 | hypothetical protein | -none- | D23_1c0506 | NA |
| fig|6666666.60966.peg.503 | CDS | 470025 | 471155 | 3 | + | 1131 | Magnesium and cobalt | Magnesium transport | D23_1c0508 | Neut_0545 |
| transport protein CorA | ||||||||||
| fig|6666666.60966.peg.504 | CDS | 471202 | 471447 | 1 | + | 246 | Mobile element protein | -none- | D23_1c0509 | Neut_0884 |
| fig|6666666.60966.peg.505 | CDS | 471504 | 471617 | 3 | + | 114 | hypothetical protein | -none- | D23_1c0510 | Neut_0547 |
| fig|6666666.60966.peg.506 | CDS | 471862 | 473013 | 1 | + | 1152 | conserved hypothetical | -none- | D23_1c0511 | Neut_0548 |
| protein | ||||||||||
| fig|6666666.60966.peg.507 | CDS | 473412 | 473957 | 3 | + | 546 | Uncharacterized protein | -none- | D23_1c0512 | Neut_0550 |
| conserved in bacteria | ||||||||||
| fig|6666666.60966.peg.508 | CDS | 474111 | 474269 | 3 | + | 159 | Mobile element protein | -none- | D23_1c0513 | NA |
| fig|6666666.60966.peg.510 | CDS | 474450 | 474653 | 3 | + | 204 | hypothetical protein | -none- | D23_1c0514 | NA |
| fig|6666666.60966.peg.512 | CDS | 475553 | 476005 | 2 | + | 453 | SSU ribosomal protein | Mycobacterium | D23_1c0515 | Neut_0554 |
| S7p (S5e) | virulence operon | |||||||||
| involved in protein | ||||||||||
| synthesis (SSU ribosomal | ||||||||||
| proteins) | ||||||||||
| fig|6666666.60966.peg.513 | CDS | 476121 | 478166 | 3 | + | 2046 | Translation elongation | Mycobacterium | D23_1c0516 | Neut_0555 |
| factor G | virulence operon | |||||||||
| involved in protein | ||||||||||
| synthesis (SSU ribosomal | ||||||||||
| proteins); | ||||||||||
| <br>Translation | ||||||||||
| elongation factor G | ||||||||||
| family; <br>Translation | ||||||||||
| elongation factors | ||||||||||
| bacterial; <br>Universal | ||||||||||
| GTPases | ||||||||||
| fig|6666666.60966.peg.514 | CDS | 478196 | 479386 | 2 | + | 1191 | Translation elongation | Mycobacterium | D23_1c0517 | Neut_0556 |
| factor Tu | virulence operon | |||||||||
| involved in protein | ||||||||||
| synthesis (SSU ribosomal | ||||||||||
| proteins); | ||||||||||
| <br>Translation | ||||||||||
| elongation factors | ||||||||||
| bacterial; <br>Universal | ||||||||||
| GTPases | ||||||||||
| fig|6666666.60966.peg.515 | CDS | 479569 | 479775 | 1 | + | 207 | SSU ribosomal protein | -none- | D23_1c0518 | Neut_0557 |
| S10p (S20e) | ||||||||||
| fig|6666666.60966.peg.516 | CDS | 479823 | 480476 | 3 | + | 654 | LSU ribosomal protein | -none- | D23_1c0519 | Neut_0558 |
| L3p (L3e) | ||||||||||
| fig|6666666.60966.peg.517 | CDS | 480494 | 481114 | 2 | + | 621 | LSU ribosomal protein | -none- | D23_1c0520 | Neut_0559 |
| L4p (L1e) | ||||||||||
| fig|6666666.60966.peg.518 | CDS | 481111 | 481446 | 1 | + | 336 | LSU ribosomal protein | -none- | D23_1c0521 | Neut_0560 |
| L23p (L23Ae) | ||||||||||
| fig|6666666.60966.peg.519 | CDS | 481446 | 482279 | 3 | + | 834 | LSU ribosomal protein | -none- | D23_1c0522 | Neut_0561 |
| L2p (L8e) | ||||||||||
| fig|6666666.60966.peg.520 | CDS | 482948 | 483595 | 2 | + | 648 | SSU ribosomal protein | -none- | D23_1c0523 | Neut_0564 |
| S3p (S3e) | ||||||||||
| fig|6666666.60966.peg.521 | CDS | 483680 | 484096 | 2 | + | 417 | LSU ribosomal protein | -none- | D23_1c0524 | Neut_0565 |
| L16p (L10e) | ||||||||||
| fig|6666666.60966.peg.524 | CDS | 485008 | 485331 | 1 | + | 324 | LSU ribosomal protein | -none- | D23_1c0525 | Neut_0569 |
| L24p (L26e) | ||||||||||
| fig|6666666.60966.peg.525 | CDS | 485458 | 485886 | 1 | + | 429 | LSU ribosomal protein | -none- | D23_1c0526 | Neut_0570 |
| L5p (L11e) | ||||||||||
| fig|6666666.60966.peg.526 | CDS | 486881 | 487222 | 2 | + | 342 | LSU ribosomal protein | -none- | D23_1c0527 | Neut_0573 |
| L6p (L9e) | ||||||||||
| fig|6666666.60966.peg.527 | CDS | 487678 | 488151 | 1 | + | 474 | SSU ribosomal protein | -none- | D23_1c0528 | Neut_0575 |
| S5p (S2e) | ||||||||||
| fig|6666666.60966.peg.528 | CDS | 488796 | 490118 | 3 | + | 1323 | Preprotein translocase | -none- | D23_1c0530 | Neut_0578 |
| secY subunit (TC | ||||||||||
| 3.A.5.1.1) | ||||||||||
| fig|6666666.60966.peg.530 | CDS | 491337 | 491963 | 3 | + | 627 | SSU ribosomal protein | -none- | D23_1c0531 | Neut_0582 |
| S4p (S9e) | ||||||||||
| fig|6666666.60966.peg.531 | CDS | 492065 | 492997 | 2 | + | 933 | DNA-directed RNA | RNA polymerase | D23_1c0532 | Neut_0583 |
| polymerase alpha | bacterial | |||||||||
| subunit (EC 2.7.7.6) | ||||||||||
| fig|6666666.60966.peg.532 | CDS | 494213 | 493998 | −2 | − | 216 | Putative oligoketide | Possible RNA | D23_1c0534 | Neut_0586 |
| cyclase/dehydratase or | degradation cluster | |||||||||
| lipid transport protein | ||||||||||
| YfjG | ||||||||||
| fig|6666666.60966.peg.533 | CDS | 494546 | 494995 | 2 | + | 450 | tmRNA-binding protein | Heat shock dnaK gene | D23_1c0535 | Neut_0587 |
| SmpB | cluster extended; | |||||||||
| <br>Translation | ||||||||||
| termination factors | ||||||||||
| bacterial | ||||||||||
| fig|6666666.60966.peg.534 | CDS | 495005 | 496075 | 2 | + | 1071 | Heme A synthase, | Biogenesis of | D23_1c0536 | Neut_0588 |
| cytochrome oxidase | cytochrome c oxidases | |||||||||
| biogenesis protein | ||||||||||
| Cox15-CtaA | ||||||||||
| fig|6666666.60966.peg.535 | CDS | 496163 | 496582 | 2 | + | 420 | Probable | -none- | D23_1c0537 | Neut_0589 |
| transmembrane protein | ||||||||||
| fig|6666666.60966.peg.537 | CDS | 496945 | 498528 | 1 | + | 1584 | DNA polymerase III | DNA processing cluster | D23_1c0538 | Neut_0590 |
| subunits gamma and | ||||||||||
| tau (EC 2.7.7.7) | ||||||||||
| fig|6666666.60966.peg.538 | CDS | 498545 | 498868 | 2 | + | 324 | FIG000557: | DNA processing cluster | D23_1c0539 | Neut_0591 |
| hypothetical protein co- | ||||||||||
| occurring with RecR | ||||||||||
| fig|6666666.60966.peg.539 | CDS | 498922 | 499740 | 1 | + | 819 | Pseudouridine synthase | -none- | D23_1c0540 | Neut_0592 |
| family protein | ||||||||||
| fig|6666666.60966.peg.540 | CDS | 500690 | 499770 | −2 | − | 921 | Protein-N(5)-glutamine | -none- | D23_1c0541 | Neut_0593 |
| methyltransferase | ||||||||||
| PrmB, methylates LSU | ||||||||||
| ribosomal protein L3p | ||||||||||
| fig|6666666.60966.peg.541 | CDS | 500738 | 501241 | 2 | + | 504 | tRNA-specific | tRNA modification | D23_1c0542 | Neut_0594 |
| adenosine-34 | Bacteria; <br>tRNA | |||||||||
| deaminase (EC 3.5.4.—) | processing | |||||||||
| fig|6666666.60966.peg.542 | CDS | 501238 | 501717 | 1 | + | 480 | Conserved domain | -none- | D23_1c0543 | Neut_0595 |
| protein | ||||||||||
| fig|6666666.60966.peg.543 | CDS | 501779 | 503389 | 2 | + | 1611 | NAD-dependent malic | Pyruvate metabolism I: | D23_1c0544 | Neut_0596 |
| enzyme (EC 1.1.1.38) | anaplerotic reactions, | |||||||||
| PEP | ||||||||||
| fig|6666666.60966.peg.544 | CDS | 504268 | 503438 | −1 | − | 831 | Phosphoserine | Glycine and Serine | D23_1c0545 | Neut_0597 |
| phosphatase (EC | Utilization; <br>Serine | |||||||||
| 3.1.3.3) | Biosynthesis; <br>Serine | |||||||||
| Biosynthesis | ||||||||||
| fig|6666666.60966.peg.545 | CDS | 505831 | 504356 | −1 | − | 1476 | FIG00858790: | -none- | D23_1c0546 | Neut_0598 |
| hypothetical protein | ||||||||||
| fig|6666666.60966.peg.547 | CDS | 506088 | 507581 | 3 | + | 1494 | Cytosol aminopeptidase | Aminopeptidases (EC | D23_1c0547 | Neut_0599 |
| PepA (EC 3.4.11.1) | 3.4.11.—); | |||||||||
| <br>Dehydrogenase | ||||||||||
| complexes | ||||||||||
| fig|6666666.60966.peg.548 | CDS | 507615 | 508043 | 3 | + | 429 | DNA polymerase III chi | -none- | D23_1c0548 | Neut_0600 |
| subunit (EC 2.7.7.7) | ||||||||||
| fig|6666666.60966.peg.549 | CDS | 508116 | 508517 | 3 | + | 402 | FIG00859089: | -none- | D23_1c0549 | Neut_0601 |
| hypothetical protein | ||||||||||
| fig|6666666.60966.peg.550 | CDS | 508581 | 511334 | 3 | + | 2754 | Valyl-tRNA synthetase | tRNA aminoacylation, | D23_1c0550 | Neut_0602 |
| (EC 6.1.1.9) | Val | |||||||||
| fig|6666666.60966.peg.551 | CDS | 511430 | 512500 | 2 | + | 1071 | Uroporphyrinogen III | Heme and Siroheme | D23_1c0551 | Neut_0603 |
| decarboxylase (EC | Biosynthesis | |||||||||
| 4.1.1.37) | ||||||||||
| fig|6666666.60966.peg.552 | CDS | 513466 | 512660 | −1 | − | 807 | Maebl | -none- | D23_1c0552 | Neut_0604 |
| fig|6666666.60966.peg.553 | CDS | 514503 | 513616 | −3 | − | 888 | Succinyl-CoA ligase | TCA Cycle | D23_1c0553 | Neut_0605 |
| [ADP-forming] alpha | ||||||||||
| chain (EC 6.2.1.5) | ||||||||||
| fig|6666666.60966.peg.554 | CDS | 515705 | 514533 | −2 | − | 1173 | Succinyl-CoA ligase | TCA Cycle | D23_1c0554 | Neut_0606 |
| [ADP-forming] beta | ||||||||||
| chain (EC 6.2.1.5) | ||||||||||
| fig|6666666.60966.peg.555 | CDS | 516828 | 515878 | −3 | − | 951 | Malyl-CoA lyase (EC | Photorespiration | D23_1c0555 | Neut_0607 |
| 4.1.3.24) | (oxidative C2 cycle) | |||||||||
| fig|6666666.60966.peg.557 | CDS | 518554 | 517079 | −1 | − | 1476 | Glycogen synthase, | Glycogen metabolism | D23_1c0557 | Neut_0608 |
| ADP-glucose | ||||||||||
| transglucosylase (EC | ||||||||||
| 2.4.1.21) | ||||||||||
| fig|6666666.60966.peg.558 | CDS | 520242 | 518608 | −3 | − | 1635 | Glucose-6-phosphate | Glycolysis and | D23_1c0558 | Neut_0609 |
| isomerase (EC 5.3.1.9) | Gluconeogenesis | |||||||||
| fig|6666666.60966.peg.559 | CDS | 521449 | 520271 | −1 | − | 1179 | 3-ketoacyl-CoA thiolase | Acetyl-CoA fermentation | D23_1c0559 | Neut_0610 |
| (EC 2.3.1.16) @ Acetyl- | to Butyrate; <br>Biotin | |||||||||
| CoA acetyltransferase | biosynthesis; <br>Biotin | |||||||||
| (EC 2.3.1.9) | synthesis cluster; | |||||||||
| <br>Butanol | ||||||||||
| Biosynthesis; | ||||||||||
| <br>Butyrate | ||||||||||
| metabolism cluster; | ||||||||||
| <br>Fatty acid | ||||||||||
| metabolism cluster; | ||||||||||
| <br>Isoprenoid | ||||||||||
| Biosynthesis; | ||||||||||
| <br>Polyhydroxybutyrate | ||||||||||
| metabolism; | ||||||||||
| <br>Polyhydroxybutyrate | ||||||||||
| metabolism | ||||||||||
| fig|6666666.60966.peg.560 | CDS | 522790 | 521459 | −1 | − | 1332 | ATP-dependent hsl | Proteasome bacterial; | D23_1c0560 | Neut_0611 |
| protease ATP-binding | <br>Proteolysis in | |||||||||
| subunit HslU | bacteria, ATP-dependent | |||||||||
| fig|6666666.60966.peg.561 | CDS | 523346 | 522825 | −2 | − | 522 | ATP-dependent | Proteasome bacterial; | D23_1c0561 | Neut_0612 |
| protease HslV (EC | <br>Proteolysis in | |||||||||
| 3.4.25.—) | bacteria, ATP-dependent | |||||||||
| fig|6666666.60966.peg.563 | CDS | 523758 | 523555 | −3 | − | 204 | DNA-directed RNA | RNA polymerase | D23_1c0562 | Neut_0613 |
| polymerase omega | bacterial | |||||||||
| subunit (EC 2.7.7.6) | ||||||||||
| fig|6666666.60966.peg.564 | CDS | 524414 | 523809 | −2 | − | 606 | Guanylate kinase (EC | CBSS- | D23_1c0563 | Neut_0614 |
| 2.7.4.8) | 323097.3.peg.2594; | |||||||||
| <br>Purine conversions | ||||||||||
| fig|6666666.60966.peg.565 | CDS | 525166 | 524684 | −1 | − | 483 | Dihydroneopterin | Folate Biosynthesis | D23_1c0565 | Neut_0615 |
| triphosphate | ||||||||||
| pyrophosphohydrolase | ||||||||||
| type 2 (nudB) | ||||||||||
| fig|6666666.60966.peg.566 | CDS | 526961 | 525180 | −2 | − | 1782 | Aspartyl-tRNA | tRNA aminoacylation, | D23_1c0566 | Neut_0616 |
| synthetase (EC 6.1.1.12) | Asp and Asn; <br>tRNA | |||||||||
| @ Aspartyl-tRNA(Asn) | aminoacylation, Asp and | |||||||||
| synthetase (EC 6.1.1.23) | Asn | |||||||||
| fig|6666666.60966.peg.567 | CDS | 527054 | 527206 | 2 | + | 153 | hypothetical protein | -none- | D23_1c0567 | NA |
| fig|6666666.60966.peg.568 | CDS | 528907 | 527456 | −1 | − | 1452 | Mannose-1-phosphate | Mannose Metabolism; | D23_1c0569 | Neut_0618 |
| guanylyltransferase | <br>Mannose | |||||||||
| (GDP) (EC 2.7.7.22)/ | Metabolism | |||||||||
| Mannose-6-phosphate | ||||||||||
| isomerase (EC 5.3.1.8) | ||||||||||
| fig|6666666.60966.peg.569 | CDS | 530083 | 528971 | −1 | − | 1113 | UDP-N- | CMP-N- | D23_1c0570 | Neut_0619 |
| acetylglucosamine 2- | acetylneuraminate | |||||||||
| epimerase (EC 5.1.3.14) | Biosynthesis; <br>Sialic | |||||||||
| Acid Metabolism | ||||||||||
| fig|6666666.60966.peg.570 | CDS | 530171 | 530284 | 2 | + | 114 | hypothetical protein | -none- | D23_1c0571 | NA |
| fig|6666666.60966.peg.571 | CDS | 530407 | 530535 | 1 | + | 129 | hypothetical protein | -none- | D23_1c0572 | NA |
| fig|6666666.60966.peg.572 | CDS | 530637 | 531041 | 3 | + | 405 | Truncated hemoglobins | -none- | D23_1c0573 | Neut_0620 |
| fig|6666666.60966.peg.573 | CDS | 531034 | 532257 | 1 | + | 1224 | NnrS protein involved in | Denitrification; | D23_1c0574 | Neut_0621 |
| response to NO | <br>Nitrosative stress; | |||||||||
| <br>Oxidative stress | ||||||||||
| fig|6666666.60966.peg.574 | CDS | 532298 | 532738 | 2 | + | 441 | putative membrane | -none- | D23_1c0575 | Neut_0622 |
| protein | ||||||||||
| fig|6666666.60966.peg.575 | CDS | 532841 | 533326 | 2 | + | 486 | FIG001943: | Broadly distributed | D23_1c0576 | Neut_0623 |
| hypothetical protein | proteins not in | |||||||||
| YajQ | subsystems | |||||||||
| fig|6666666.60966.peg.576 | CDS | 534972 | 533485 | −3 | − | 1488 | FIG00859034: | -none- | D23_1c0577 | Neut_0624 |
| hypothetical protein | ||||||||||
| fig|6666666.60966.peg.577 | CDS | 535028 | 535240 | 2 | + | 213 | hypothetical protein | -none- | D23_1c0578 | NA |
| fig|6666666.60966.peg.578 | CDS | 536092 | 535289 | −1 | − | 804 | FIG00858513: | -none- | D23_1c0579 | Neut_0626 |
| hypothetical protein | ||||||||||
| fig|6666666.60966.peg.579 | CDS | 537497 | 536616 | −2 | − | 882 | hypothetical protein | -none- | D23_1c0581 | NA |
| fig|6666666.60966.peg.580 | CDS | 538547 | 537726 | −2 | − | 822 | hypothetical protein | -none- | D23_1c0582 | NA |
| fig|6666666.60966.peg.581 | CDS | 539856 | 538789 | −3 | − | 1068 | Conserved domain | -none- | D23_1c0583 | NA |
| protein | ||||||||||
| fig|6666666.60966.peg.582 | CDS | 540712 | 539849 | −1 | − | 864 | Conserved domain | -none- | D23_1c0584 | NA |
| protein | ||||||||||
| fig|6666666.60966.peg.583 | CDS | 541704 | 540841 | −3 | − | 864 | possible long-chain N- | -none- | D23_1c0585 | Neut_0638 |
| acyl amino acid | ||||||||||
| synthase | ||||||||||
| fig|6666666.60966.peg.584 | CDS | 541934 | 541812 | −2 | − | 123 | hypothetical protein | -none- | D23_1c0586 | NA |
| fig|6666666.60966.peg.586 | CDS | 542270 | 542467 | 2 | + | 198 | conserved hypothetical | -none- | D23_1c0587 | Neut_0639 |
| protein | ||||||||||
| fig|6666666.60966.peg.587 | CDS | 542451 | 542618 | 3 | + | 168 | hypothetical protein | -none- | D23_1c0588 | Neut_0640 |
| fig|6666666.60966.peg.588 | CDS | 542602 | 542724 | 1 | + | 123 | hypothetical protein | -none- | D23_1c0589 | Neut_0641 |
| fig|6666666.60966.peg.590 | CDS | 543111 | 544673 | 3 | + | 1563 | Putative inner | -none- | D23_1c0590 | Neut_0642 |
| membrane protein | ||||||||||
| fig|6666666.60966.peg.591 | CDS | 544721 | 544834 | 2 | + | 114 | hypothetical protein | -none- | D23_1c0591 | NA |
| fig|6666666.60966.peg.592 | CDS | 545193 | 546098 | 3 | + | 906 | Membrane-bound lytic | CBSS-228410.1.peg.134; | D23_1c0592 | Neut_0643 |
| murein transglycosylase | <br>CBSS- | |||||||||
| D precursor (EC 3.2.1.—) | 342610.3.peg.1536; | |||||||||
| <br>Murein Hydrolases | ||||||||||
| fig|6666666.60966.peg.593 | CDS | 546933 | 546274 | −3 | − | 660 | Endonuclease III (EC | DNA Repair Base | D23_1c0593 | Neut_0644 |
| 4.2.99.18) | Excision | |||||||||
| fig|6666666.60966.peg.594 | CDS | 547586 | 546930 | −2 | − | 657 | Electron transport | -none- | D23_1c0594 | Neut_0645 |
| complex protein RnfB | ||||||||||
| fig|6666666.60966.peg.595 | CDS | 548604 | 547576 | −3 | − | 1029 | Dihydroorotate | De Novo Pyrimidine | D23_1c0595 | Neut_0646 |
| dehydrogenase (EC | Synthesis | |||||||||
| 1.3.3.1) | ||||||||||
| fig|6666666.60966.peg.596 | CDS | 549246 | 548605 | −3 | − | 642 | Arginine-tRNA-protein | Protein degradation | D23_1c0596 | Neut_0647 |
| transferase (EC 2.3.2.8) | ||||||||||
| fig|6666666.60966.peg.597 | CDS | 550041 | 549343 | −3 | − | 699 | Leucyl/phenylalanyl- | Protein degradation | D23_1c0597 | Neut_0648 |
| tRNA-protein | ||||||||||
| transferase (EC 2.3.2.6) | ||||||||||
| fig|6666666.60966.peg.598 | CDS | 550783 | 550328 | −1 | − | 456 | Mobile element protein | -none- | D23_1c0598 | Neut_2502 |
| fig|6666666.60966.peg.599 | CDS | 551132 | 550746 | −2 | − | 387 | Mobile element protein | -none- | D23_1c0599 | Neut_0884 |
| fig|6666666.60966.peg.600 | CDS | 551404 | 551517 | 1 | + | 114 | hypothetical protein | -none- | D23_1c0600 | NA |
| fig|6666666.60966.peg.601 | CDS | 551625 | 552500 | 3 | + | 876 | FIG00859053: | -none- | D23_1c0601 | Neut_0650 |
| hypothetical protein | ||||||||||
| fig|6666666.60966.peg.602 | CDS | 554066 | 552684 | −2 | − | 1383 | UDP-N- | Peptidoglycan | D23_1c0602 | Neut_0651 |
| acetylmuramate:L- | biosynthesis--gjo; | |||||||||
| alanyl-gamma-D- | <br>Recycling of | |||||||||
| glutamyl-meso- | Peptidoglycan Amino | |||||||||
| diaminopimelate ligase | Acids | |||||||||
| (EC 6.3.2.—) | ||||||||||
| fig|6666666.60966.peg.603 | CDS | 554191 | 555363 | 1 | + | 1173 | NADH dehydrogenase | Respiratory | D23_1c0603 | Neut_0652 |
| (EC 1.6.99.3) | dehydrogenases 1; | |||||||||
| <br>Riboflavin synthesis | ||||||||||
| cluster | ||||||||||
| fig|6666666.60966.peg.604 | CDS | 556325 | 555387 | −2 | − | 939 | Mutator mutT protein | Nudix proteins | D23_1c0604 | Neut_0653 |
| (7,8-dihydro-8- | (nucleoside triphosphate | |||||||||
| oxoguanine- | hydrolases); <br>Nudix | |||||||||
| triphosphatase) (EC | proteins (nucleoside | |||||||||
| 3.6.1.—)/Thiamin- | triphosphate hydrolases) | |||||||||
| phosphate | ||||||||||
| pyrophosphorylase-like | ||||||||||
| protein | ||||||||||
| fig|6666666.60966.peg.605 | CDS | 557210 | 556338 | −2 | − | 873 | putative ATP/GTP- | -none- | D23_1c0605 | Neut_0654 |
| binding protein | ||||||||||
| fig|6666666.60966.peg.606 | CDS | 558441 | 557212 | −3 | − | 1230 | Glutamate N- | Arginine Biosynthesis-- | D23_1c0607 | Neut_0655 |
| acetyltransferase (EC | gjo; <br>Arginine | |||||||||
| 2.3.1.35)/N- | Biosynthesis--gjo; | |||||||||
| acetylglutamate | <br>Arginine | |||||||||
| synthase (EC 2.3.1.1) | Biosynthesis extended; | |||||||||
| <br>Arginine | ||||||||||
| Biosynthesis extended | ||||||||||
| fig|6666666.60966.peg.607 | CDS | 558602 | 559015 | 2 | + | 414 | FIG136845: Rhodanese- | Glutaredoxin 3 | D23_1c0608 | Neut_0656 |
| related | containing cluster | |||||||||
| sulfurtransferase | ||||||||||
| fig|6666666.60966.peg.608 | CDS | 559045 | 559302 | 1 | + | 258 | Glutaredoxin 3 (Grx3) | Glutaredoxin 3 | D23_1c0609 | Neut_0657 |
| containing cluster; | ||||||||||
| <br>Glutaredoxins; | ||||||||||
| <br>Glutathione: Redox | ||||||||||
| cycle | ||||||||||
| fig|6666666.60966.peg.609 | CDS | 559377 | 559862 | 3 | + | 486 | Protein export | Glutaredoxin 3 | D23_1c0610 | Neut_0658 |
| cytoplasm chaperone | containing cluster | |||||||||
| protein (SecB, | ||||||||||
| maintains protein to be | ||||||||||
| exported in unfolded | ||||||||||
| state) | ||||||||||
| fig|6666666.60966.peg.610 | CDS | 559866 | 560345 | 3 | + | 480 | FIG00859406: | -none- | D23_1c0611 | Neut_0659 |
| hypothetical protein | ||||||||||
| fig|6666666.60966.peg.611 | CDS | 560342 | 561331 | 2 | + | 990 | Glycerol-3-phosphate | Glutaredoxin 3 | D23_1c0612 | Neut_0660 |
| dehydrogenase | containing cluster; | |||||||||
| [NAD(P)+] (EC 1.1.1.94) | <br>Glycerol and | |||||||||
| Glycerol-3-phosphate | ||||||||||
| Uptake and Utilization; | ||||||||||
| <br>Glycerolipid and | ||||||||||
| Glycerophospholipid | ||||||||||
| Metabolism in Bacteria | ||||||||||
| fig|6666666.60966.peg.612 | CDS | 561519 | 561791 | 3 | + | 273 | DNA-binding protein | DNA structural proteins, | D23_1c0613 | Neut_0661 |
| HU-beta | bacterial | |||||||||
| fig|6666666.60966.peg.614 | CDS | 562230 | 564023 | 3 | + | 1794 | Peptidyl-prolyl cis-trans | Peptidyl-prolyl cis-trans | D23_1c0616 | Neut_0662 |
| isomerase PpiD (EC | isomerase | |||||||||
| 5.2.1.8) | ||||||||||
| fig|6666666.60966.peg.615 | CDS | 564844 | 564050 | −1 | − | 795 | Enoyl-[acyl-carrier- | Fatty Acid Biosynthesis | D23_1c0617 | Neut_0663 |
| protein] reductase | FASII | |||||||||
| [NADH] (EC 1.3.1.9) | ||||||||||
| fig|6666666.60966.peg.616 | CDS | 565168 | 564959 | −1 | − | 210 | hypothetical protein | -none- | D23_1c0618 | NA |
| fig|6666666.60966.peg.617 | CDS | 565170 | 567587 | 3 | + | 2418 | Transcription accessory | CBSS-243265.1.peg.198; | D23_1c0619 | Neut_0664 |
| protein (S1 RNA-binding | <br>Transcription | |||||||||
| domain) | factors bacterial | |||||||||
| fig|6666666.60966.peg.618 | CDS | 567598 | 567975 | 1 | + | 378 | hypothetical protein | -none- | D23_1c0620 | Neut_0682 |
| fig|6666666.60966.peg.619 | CDS | 567977 | 568255 | 2 | + | 279 | hypothetical protein | -none- | D23_1c0621 | Neut_0682 |
| fig|6666666.60966.peg.621 | CDS | 568500 | 568871 | 3 | + | 372 | hypothetical protein | -none- | D23_1c0622 | Neut_0683 |
| fig|6666666.60966.peg.622 | CDS | 569150 | 568989 | −2 | − | 162 | hypothetical protein | -none- | D23_1c0623 | Neut_0684 |
| fig|6666666.60966.peg.623 | CDS | 570485 | 569238 | −2 | − | 1248 | Mobile element protein | -none- | D23_1c0624 | Neut_0357 |
| fig|6666666.60966.peg.624 | CDS | 571236 | 570577 | −3 | − | 660 | N-hydroxyarylamine O- | -none- | D23_1c0626 | Neut_0684 |
| acetyltransferase (EC | ||||||||||
| 2.3.1.118) | ||||||||||
| fig|6666666.60966.peg.625 | CDS | 572209 | 571295 | −1 | − | 915 | Permease of the | Queuosine-Archaeosine | D23_1c0627 | Neut_0685 |
| drug/metabolite | Biosynthesis | |||||||||
| transporter (DMT) | ||||||||||
| superfamily | ||||||||||
| fig|6666666.60966.peg.626 | CDS | 573622 | 572339 | −1 | − | 1284 | TRAP dicarboxylate | TRAP Transporter | D23_1c0628 | Neut_0686 |
| transporter, DctM | unknown substrate 6 | |||||||||
| subunit, unknown | ||||||||||
| substrate 6 | ||||||||||
| fig|6666666.60966.peg.627 | CDS | 574259 | 573705 | −2 | − | 555 | TRAP dicarboxylate | TRAP Transporter | D23_1c0629 | Neut_0687 |
| transporter, DctQ | unknown substrate 6 | |||||||||
| subunit, unknown | ||||||||||
| substrate 6 | ||||||||||
| fig|6666666.60966.peg.628 | CDS | 575698 | 574334 | −1 | − | 1365 | TldE protein, part of | Putative TldE-TldD | D23_1c0630 | Neut_0688 |
| TldE/TldD proteolytic | proteolytic complex | |||||||||
| complex | ||||||||||
| fig|6666666.60966.peg.629 | CDS | 575950 | 576474 | 1 | + | 525 | FIG138315: Putative | Putative TldE-TldD | D23_1c0632 | Neut_0689 |
| alpha helix protein | proteolytic complex | |||||||||
| fig|6666666.60966.peg.630 | CDS | 576475 | 576609 | 1 | + | 135 | hypothetical protein | -none- | D23_1c0633 | NA |
| fig|6666666.60966.peg.631 | CDS | 576740 | 577006 | 2 | + | 267 | FIG00859002: | -none- | D23_1c0635 | Neut_0690 |
| hypothetical protein | ||||||||||
| fig|6666666.60966.peg.632 | CDS | 577046 | 577804 | 2 | + | 759 | Exodeoxyribonuclease | DNA repair, bacterial | D23_1c0636 | Neut_0691 |
| III (EC 3.1.11.2) | ||||||||||
| fig|6666666.60966.peg.633 | CDS | 577801 | 579195 | 1 | + | 1395 | AmpG permease | Recycling of | D23_1c0637 | Neut_0692 |
| Peptidoglycan Amino | ||||||||||
| Acids | ||||||||||
| fig|6666666.60966.peg.636 | CDS | 580217 | 579867 | −2 | − | 351 | Cytochrome O | Terminal cytochrome O | D23_1c0638 | Neut_0694 |
| ubiquinol oxidase | ubiquinol oxidase; | |||||||||
| subunit IV (EC 1.10.3.—) | <br>Terminal | |||||||||
| cytochrome oxidases | ||||||||||
| fig|6666666.60966.peg.637 | CDS | 580885 | 580214 | −1 | − | 672 | Cytochrome O | Terminal cytochrome O | D23_1c0639 | Neut_0695 |
| ubiquinol oxidase | ubiquinol oxidase; | |||||||||
| subunit III (EC 1.10.3.—) | <br>Terminal | |||||||||
| cytochrome oxidases | ||||||||||
| fig|6666666.60966.peg.638 | CDS | 582993 | 580882 | −3 | − | 2112 | Cytochrome O | Terminal cytochrome O | D23_1c0640 | Neut_0696 |
| ubiquinol oxidase | ubiquinol oxidase; | |||||||||
| subunit 1 (EC 1.10.3.—) | <br>Terminal | |||||||||
| cytochrome oxidases | ||||||||||
| fig|6666666.60966.peg.639 | CDS | 583998 | 582997 | −3 | − | 1002 | Cytochrome O | Terminal cytochrome O | D23_1c0641 | Neut_0697 |
| ubiquinol oxidase | ubiquinol oxidase; | |||||||||
| subunit II (EC 1.10.3.—) | <br>Terminal | |||||||||
| cytochrome oxidases | ||||||||||
| fig|6666666.60966.peg.640 | CDS | 585484 | 584237 | −1 | − | 1248 | Mobile element protein | -none- | D23_1c0642 | Neut_0357 |
| fig|6666666.60966.peg.641 | CDS | 585502 | 585633 | 1 | + | 132 | patatin family protein | -none- | D23_1c0643 | Neut_1317 |
| fig|6666666.60966.peg.642 | CDS | 585643 | 586530 | 1 | + | 888 | UTP--glucose-1- | -none- | D23_1c0644 | Neut_0698 |
| phosphate | ||||||||||
| uridylyltransferase (EC | ||||||||||
| 2.7.7.9) | ||||||||||
| fig|6666666.60966.peg.643 | CDS | 586705 | 587817 | 1 | + | 1113 | FIG00859666: | -none- | D23_1c0645 | Neut_0699 |
| hypothetical protein | ||||||||||
| fig|6666666.60966.peg.644 | CDS | 587837 | 589201 | 2 | + | 1365 | Succinate-semialdehyde | -none- | D23_1c0646 | Neut_0700 |
| dehydrogenase [NAD] | ||||||||||
| (EC 1.2.1.24); Succinate- | ||||||||||
| semialdehyde | ||||||||||
| dehydrogenase | ||||||||||
| [NADP+] (EC 1.2.1.16) | ||||||||||
| fig|6666666.60966.peg.645 | CDS | 589224 | 590942 | 3 | + | 1719 | InterPro IPR001440 | -none- | D23_1c0647 | Neut_0701 |
| COGs COG0457 | ||||||||||
| fig|6666666.60966.peg.646 | CDS | 592871 | 591033 | −2 | − | 1839 | Long-chain-fatty-acid-- | Biotin biosynthesis; | D23_1c0648 | Neut_0702 |
| CoA ligase (EC 6.2.1.3) | <br>Biotin synthesis | |||||||||
| cluster; <br>Fatty acid | ||||||||||
| metabolism cluster | ||||||||||
| fig|6666666.60966.peg.647 | CDS | 595204 | 592868 | −1 | − | 2337 | Butyryl-CoA | -none- | D23_1c0649 | Neut_0703 |
| dehydrogenase (EC | ||||||||||
| 1.3.99.2) | ||||||||||
| fig|6666666.60966.peg.648 | CDS | 595489 | 595223 | −1 | − | 267 | hypothetical protein | -none- | D23_1c0650 | Neut_0704 |
| fig|6666666.60966.peg.649 | CDS | 596053 | 595673 | −1 | − | 381 | Putative membrane | -none- | D23_1c0651 | Neut_0705 |
| protein | ||||||||||
| fig|6666666.60966.peg.650 | CDS | 596962 | 596099 | −1 | − | 864 | Pirin | -none- | D23_1c0652 | Neut_0706 |
| fig|6666666.60966.peg.651 | CDS | 597098 | 598030 | 2 | + | 933 | Transcriptional | -none- | D23_1c0653 | Neut_0707 |
| regulator, LysR family | ||||||||||
| fig|6666666.60966.peg.652 | CDS | 598202 | 599338 | 2 | + | 1137 | hypothetical protein | -none- | D23_1c0655 | Neut_0708 |
| fig|6666666.60966.peg.653 | CDS | 599418 | 599657 | 3 | + | 240 | Flavodoxin reductases | Anaerobic respiratory | D23_1c0656 | Neut_0709 |
| (ferredoxin-NADPH | reductases | |||||||||
| reductases) family 1 | ||||||||||
| fig|6666666.60966.peg.654 | CDS | 599689 | 600114 | 1 | + | 426 | Flavodoxin reductases | Anaerobic respiratory | D23_1c0657 | Neut_0709 |
| (ferredoxin-NADPH | reductases | |||||||||
| reductases) family 1 | ||||||||||
| fig|6666666.60966.peg.655 | CDS | 601243 | 600251 | −1 | − | 993 | Multicopper oxidase | Copper homeostasis | D23_1c0658 | Neut_0710 |
| fig|6666666.60966.peg.656 | CDS | 602188 | 601454 | −1 | − | 735 | FIG00859807: | -none- | D23_1c0659 | Neut_0711 |
| hypothetical protein | ||||||||||
| fig|6666666.60966.peg.657 | CDS | 602534 | 602346 | −2 | − | 189 | hypothetical protein | -none- | D23_1c0660 | Neut_0712 |
| fig|6666666.60966.peg.658 | CDS | 602837 | 602700 | −2 | − | 138 | Putative NAD(P)- | -none- | D23_1c0661 | Neut_0990 |
| dependent | ||||||||||
| oxidoreductase EC- | ||||||||||
| YbbO | ||||||||||
| fig|6666666.60966.peg.659 | CDS | 603148 | 602882 | −1 | − | 267 | ABC-type multidrug | CBSS-196164.1.peg.1690 | D23_1c0662 | Neut_0713 |
| transport system, | ||||||||||
| permease component | ||||||||||
| fig|6666666.60966.peg.660 | CDS | 603362 | 605239 | 2 | + | 1878 | 1,4-alpha-glucan | -none- | D23_1c0663 | Neut_0714 |
| branching enzyme (EC | ||||||||||
| 2.4.1.18) | ||||||||||
| fig|6666666.60966.peg.661 | CDS | 605497 | 605619 | 1 | + | 123 | Glutathione peroxidase | Glutathione: Redox cycle | D23_1c0664 | Neut_0715 |
| (EC 1.11.1.9) | ||||||||||
| fig|6666666.60966.peg.662 | CDS | 607768 | 605882 | −1 | − | 1887 | TonB-dependent hemin, | Ton and Tol transport | D23_1c0665 | Neut_0716 |
| ferrichrome receptor | systems | |||||||||
| fig|6666666.60966.peg.663 | CDS | 609583 | 607862 | −1 | − | 1722 | hypothetical protein | -none- | D23_1c0666 | Neut_0717 |
| fig|6666666.60966.peg.664 | CDS | 610957 | 609656 | −1 | − | 1302 | Membrane protein | -none- | D23_1c0667 | Neut_0718 |
| involved in colicin | ||||||||||
| uptake | ||||||||||
| fig|6666666.60966.peg.665 | CDS | 611184 | 612413 | 3 | + | 1230 | FIG00858430: | -none- | D23_1c0668 | Neut_0719 |
| hypothetical protein | ||||||||||
| fig|6666666.60966.peg.666 | CDS | 612533 | 615022 | 2 | + | 2490 | TonB-dependent | Ton and Tol transport | D23_1c0669 | Neut_0720 |
| receptor | systems | |||||||||
| fig|6666666.60966.peg.667 | CDS | 615143 | 615012 | −2 | − | 132 | hypothetical protein | -none- | D23_1c0670 | NA |
| fig|6666666.60966.peg.668 | CDS | 615337 | 617457 | 1 | + | 2121 | TonB-dependent | Ton and Tol transport | D23_1c0672 | Neut_0721 |
| receptor | systems | |||||||||
| fig|6666666.60966.peg.669 | CDS | 617524 | 618762 | 1 | + | 1239 | putative signal peptide | -none- | D23_1c0673 | Neut_0722 |
| protein | ||||||||||
| fig|6666666.60966.peg.670 | CDS | 618762 | 619262 | 3 | + | 501 | InterPro IPR000063 | -none- | D23_1c0674 | Neut_0723 |
| COGs COG0526 | ||||||||||
| fig|6666666.60966.peg.671 | CDS | 619459 | 621978 | 1 | + | 2520 | Enoyl-CoA hydratase | Acetyl-CoA fermentation | D23_1c0675 | Neut_0724 |
| (EC 4.2.1.17)/3,2- | to Butyrate; <br>Acetyl- | |||||||||
| trans-enoyl-CoA | CoA fermentation to | |||||||||
| isomerase (EC 5.3.3.8)/ | Butyrate; <br>Butanol | |||||||||
| 3-hydroxyacyl-CoA | Biosynthesis; | |||||||||
| dehydrogenase (EC | <br<Butyrate | |||||||||
| 1.1.1.35) | metabolism cluster; | |||||||||
| <br>Butyrate | ||||||||||
| metabolism cluster; | ||||||||||
| <br>Fatty acid | ||||||||||
| metabolism cluster; | ||||||||||
| <br>Fatty acid | ||||||||||
| metabolism cluster; | ||||||||||
| <br>Polyhydroxybutyrate | ||||||||||
| metabolism; | ||||||||||
| <br>Polyhydroxybutyrate | ||||||||||
| metabolism | ||||||||||
| fig|6666666.60966.peg.672 | CDS | 622043 | 623245 | 2 | + | 1203 | 3-ketoacyl-CoA thiolase | Acetyl-CoA fermentation | D23_1c0676 | Neut_0725 |
| (EC 2.3.1.16) @ Acetyl- | to Butyrate; <br>Biotin | |||||||||
| CoA acetyltransferase | biosynthesis; <br>Biotin | |||||||||
| (EC 2.3.1.9) | synthesis cluster; | |||||||||
| <br>Butanol | ||||||||||
| Biosynthesis; | ||||||||||
| <br>Butyrate | ||||||||||
| metabolism cluster; | ||||||||||
| <br>Fatty acid | ||||||||||
| metabolism cluster; | ||||||||||
| <br>Isoprenoid | ||||||||||
| Biosynthesis; | ||||||||||
| <br>Polyhydroxybutyrate | ||||||||||
| metabolism; | ||||||||||
| <br>Polyhydroxybutyrate | ||||||||||
| metabolism | ||||||||||
| fig|6666666.60966.peg.673 | CDS | 623639 | 623301 | −2 | − | 339 | FIG00859796: | -none- | D23_1c0677 | Neut_0726 |
| hypothetical protein | ||||||||||
| fig|6666666.60966.peg.674 | CDS | 623711 | 623827 | 2 | + | 117 | hypothetical protein | -none- | D23_1c0678 | NA |
| fig|6666666.60966.peg.675 | CDS | 624186 | 624479 | 3 | + | 294 | Mobile element protein | -none- | D23_1c0680 | Neut_1719 |
| fig|6666666.60966.peg.676 | CDS | 624578 | 625456 | 2 | + | 879 | Mobile element protein | -none- | D23_1c0681 | Neut_1720 |
| fig|6666666.60966.peg.677 | CDS | 626009 | 625605 | −2 | − | 405 | hypothetical protein | -none- | D23_1c0682 | NA |
| fig|6666666.60966.peg.678 | CDS | 626270 | 628669 | 2 | + | 2400 | Predicted hydrolase of | -none- | D23_1c0684 | Neut_0728 |
| the metallo-beta- | ||||||||||
| lactamase superfamily, | ||||||||||
| clustered with KDO2- | ||||||||||
| Lipid A biosynthesis | ||||||||||
| genes | ||||||||||
| fig|6666666.60966.peg.679 | CDS | 628866 | 629183 | 3 | + | 318 | Flagellar transcriptional | Flagellum | D23_1c0685 | Neut_0729 |
| activator FlhD | ||||||||||
| fig|6666666.60966.peg.680 | CDS | 629210 | 629785 | 2 | + | 576 | Flagellar transcriptional | Flagellum | D23_1c0686 | Neut_0730 |
| activator FlhC | ||||||||||
| fig|6666666.60966.peg.681 | CDS | 630020 | 631549 | 2 | + | 1530 | Proposed peptidoglycan | Peptidoglycan lipid II | D23_1c0687 | Neut_0731 |
| lipid II flippase MurJ | flippase | |||||||||
| fig|6666666.60966.peg.683 | CDS | 633437 | 632277 | −2 | − | 1161 | Outer membrane | Lipopolysaccharide | D23_1c0688 | Neut_0732 |
| protein NlpB, | assembly | |||||||||
| lipoprotein component | ||||||||||
| of the protein assembly | ||||||||||
| complex (forms a | ||||||||||
| complex with YaeT, | ||||||||||
| YfiO, and YfgL); | ||||||||||
| Lipoprotein-34 | ||||||||||
| precursor | ||||||||||
| fig|6666666.60966.peg.684 | CDS | 634289 | 633447 | −2 | − | 843 | Dihydrodipicolinate | -none- | D23_1c0689 | Neut_0733 |
| synthase (EC 4.2.1.52) | ||||||||||
| fig|6666666.60966.peg.685 | CDS | 637007 | 634416 | −2 | − | 2592 | ClpB protein | Protein chaperones; | D23_1c0690 | Neut_0734 |
| <br>Proteolysis in | ||||||||||
| bacteria, ATP-dependent | ||||||||||
| fig|6666666.60966.peg.686 | CDS | 637484 | 637326 | −2 | − | 159 | hypothetical protein | -none- | D23_1c0693 | NA |
| fig|6666666.60966.peg.687 | CDS | 638994 | 637501 | −3 | − | 1494 | Ferredoxin-dependent | Ammonia assimilation; | D23_1c0694 | Neut_0735 |
| glutamate synthase (EC | <br>Glutamine, | |||||||||
| 1.4.7.1) | Glutamate, Aspartate | |||||||||
| and Asparagine | ||||||||||
| Biosynthesis | ||||||||||
| fig|6666666.60966.peg.688 | CDS | 639034 | 639930 | 1 | + | 897 | Quinolinate | Mycobacterium | D23_1c0695 | NA |
| phosphoribosyltransferase | virulence operon | |||||||||
| [decarboxylating] | possibly involved in | |||||||||
| (EC 2.4.2.19) | quinolinate biosynthesis; | |||||||||
| <br>NAD and NADP | ||||||||||
| cofactor biosynthesis | ||||||||||
| global | ||||||||||
| fig|6666666.60966.peg.689 | CDS | 641903 | 640635 | −2 | − | 1269 | Flagellar hook-length | Flagellum | D23_1c0696 | Neut_0740 |
| control protein FliK | ||||||||||
| fig|6666666.60966.peg.690 | CDS | 642413 | 641961 | −2 | − | 453 | Flagellar protein FliJ | Flagellum | D23_1c0697 | Neut_0741 |
| fig|6666666.60966.peg.691 | CDS | 643836 | 642430 | −3 | − | 1407 | Flagellum-specific ATP | Flagellar motility; | D23_1c0698 | Neut_0742 |
| synthase Flil | <br>Flagellum | |||||||||
| fig|6666666.60966.peg.692 | CDS | 644577 | 643858 | −3 | − | 720 | Flagellar assembly | Flagellum | D23_1c0699 | Neut_0743 |
| protein FliH | ||||||||||
| fig|6666666.60966.peg.693 | CDS | 645764 | 644769 | −2 | − | 996 | Flagellar motor switch | Flagellum | D23_1c0700 | Neut_0744 |
| protein FliG | ||||||||||
| fig|6666666.60966.peg.694 | CDS | 647397 | 645754 | −3 | − | 1644 | Flagellar M-ring protein | Flagellum | D23_1C0701 | Neut_0745 |
| FliF | ||||||||||
| fig|6666666.60966.peg.695 | CDS | 647548 | 647402 | −1 | − | 147 | hypothetical protein | -none- | D23_1c0702 | NA |
| fig|6666666.60966.peg.696 | CDS | 647628 | 648872 | 3 | + | 1245 | Flagellar sensor | Flagellum | D23_1c0703 | Neut_0746 |
| histidine kinase FleS | ||||||||||
| fig|6666666.60966.peg.697 | CDS | 648876 | 650189 | 3 | + | 1314 | InterPro | -none- | D23_1c0704 | Neut_0747 |
| IPR001789:IPR002078:IPR002197: | ||||||||||
| IPR003593 | ||||||||||
| COGs COG2204 | ||||||||||
| fig|6666666.60966.peg.698 | CDS | 650217 | 650546 | 3 | + | 330 | Flagellar hook-basal | Flagellum; <br>Flagellum | D23_1c0705 | Neut_0748 |
| body complex protein | in Campylobacter | |||||||||
| FliE | ||||||||||
| fig|6666666.60966.peg.699 | CDS | 650581 | 651390 | 1 | + | 810 | FIG00858443: | -none- | D23_1c0706 | Neut_0749 |
| hypothetical protein | ||||||||||
| fig|6666666.60966.peg.700 | CDS | 651752 | 651411 | −2 | − | 342 | Flagellar biosynthesis | Flagellar motility; | D23_1c0707 | Neut_0750 |
| protein FlhB | <br>Flagellum | |||||||||
| fig|6666666.60966.peg.701 | CDS | 652764 | 651739 | −3 | − | 1026 | FIG00726091: | -none- | D23_1c0708 | Neut_0751 |
| hypothetical protein | ||||||||||
| fig|6666666.60966.peg.702 | CDS | 652766 | 652948 | 2 | + | 183 | hypothetical protein | -none- | D23_1c0709 | NA |
| fig|6666666.60966.peg.703 | CDS | 653125 | 653517 | 1 | + | 393 | hypothetical protein | -none- | D23_1c0710 | Neut_2449 |
| fig|6666666.60966.peg.704 | CDS | 653664 | 653810 | 3 | + | 147 | Mobile element protein | -none- | D23_1c0711 | Neut_1756 |
| fig|6666666.60966.peg.705 | CDS | 654316 | 653858 | −1 | − | 459 | Cytochrome c family | -none- | D23_1c0712 | Neut_0754 |
| protein | ||||||||||
| fig|6666666.60966.peg.706 | CDS | 654869 | 654345 | −2 | − | 525 | CopG protein | Copper homeostasis | D23_1c0713 | Neut_0755 |
| fig|6666666.60966.peg.707 | CDS | 655268 | 656209 | 2 | + | 942 | tRNA(Cytosine32)-2- | CBSS- | D23_1c0714 | Neut_0756 |
| thiocytidine synthetase | 326442.4.peg.1852; | |||||||||
| <br>tRNA modification | ||||||||||
| Bacteria | ||||||||||
| fig|6666666.60966.peg.708 | CDS | 657180 | 656236 | −3 | − | 945 | Lipoate synthase | Lipoic acid metabolism; | D23_1c0715 | Neut_0757 |
| <br>Lipoic acid synthesis | ||||||||||
| cluster; <br>Possible | ||||||||||
| RNA degradation cluster | ||||||||||
| fig|6666666.60966.peg.709 | CDS | 657847 | 657170 | −1 | − | 678 | Octanoate-[acyl-carrier- | Lipoic acid metabolism; | D23_1c0716 | Neut_0758 |
| protein]-protein-N- | <br>Lipoic acid synthesis | |||||||||
| octanoyltransferase | cluster | |||||||||
| fig|6666666.60966.peg.710 | CDS | 658198 | 657935 | −1 | − | 264 | Proposed lipoate | Lipoicacid metabolism; | D23_1c0717 | Neut_0759 |
| regulatory protein YbeD | <br>Lipoic acid synthesis | |||||||||
| cluster | ||||||||||
| fig|6666666.60966.peg.711 | CDS | 659068 | 658208 | −1 | − | 861 | D-alanine | Pyruvate Alanine Serine | D23_1c0718 | Neut_0760 |
| aminotransferase (EC | Interconversions | |||||||||
| 2.6.1.21) | ||||||||||
| fig|6666666.60966.peg.712 | CDS | 660251 | 659088 | −2 | − | 1164 | D-alanyl-D-alanine | CBSS-84588.1.peg.1247; | D23_1c0719 | Neut_0761 |
| carboxypeptidase (EC | <br>Metallocarboxypeptidases | |||||||||
| 3.4.16.4) | (EC 3.4.17.—); | |||||||||
| <br>Murein Hydrolases; | ||||||||||
| <br>Peptidoglycan | ||||||||||
| Biosynthesis | ||||||||||
| fig|6666666.60966.peg.713 | CDS | 660353 | 660787 | 2 | + | 435 | LSU ribosomal protein | -none- | D23_1c0720 | Neut_0762 |
| L13p (L13Ae) | ||||||||||
| fig|6666666.60966.peg.714 | CDS | 660799 | 661191 | 1 | + | 393 | SSU ribosomal protein | -none- | D23_1c0721 | Neut_0763 |
| S9p (S16e) | ||||||||||
| fig|6666666.60966.peg.715 | CDS | 661324 | 662352 | 1 | + | 1029 | N-acetyl-gamma- | Arginine Biosynthesis-- | D23_1c0722 | Neut_0764 |
| glutamyl-phosphate | gjo; <br>Arginine | |||||||||
| reductase (EC 1.2.1.38) | Biosynthesis extended | |||||||||
| fig|6666666.60966.peg.716 | CDS | 662454 | 663221 | 3 | + | 768 | putative integral | -none- | D23_1c0723 | Neut_0765 |
| membrane protein | ||||||||||
| fig|6666666.60966.peg.717 | CDS | 663202 | 663627 | 1 | + | 426 | Integral membrane | -none- | D23_1c0724 | Neut_0766 |
| protein CcmA involved | ||||||||||
| in cell shape | ||||||||||
| determination | ||||||||||
| fig|6666666.60966.peg.718 | CDS | 665316 | 663655 | −3 | − | 1662 | DNA repair protein | DNA repair, bacterial | D23_1c0725 | Neut_0767 |
| RecN | ||||||||||
| fig|6666666.60966.peg.719 | CDS | 666357 | 665326 | −3 | − | 1032 | NAD kinase (EC | NAD and NADP cofactor | D23_1c0726 | Neut_0768 |
| 2.7.1.23) | biosynthesis global | |||||||||
| fig|6666666.60966.peg.720 | CDS | 666433 | 667449 | 1 | + | 1017 | Heat-inducible | GroEL GroES; <br>Heat | D23_1c0727 | Neut_0769 |
| transcription repressor | shock dnaK gene cluster | |||||||||
| HrcA | extended | |||||||||
| fig|6666666.60966.peg.721 | CDS | 667469 | 668566 | 2 | + | 1098 | Ferrochelatase, | Heme and Siroheme | D23_1c0728 | Neut_0770 |
| protoheme ferro-lyase | Biosynthesis | |||||||||
| (EC 4.99.1.1) | ||||||||||
| fig|6666666.60966.peg.722 | CDS | 668678 | 669469 | 2 | + | 792 | Zn-dependent protease | -none- | D23_1c0729 | Neut_0771 |
| with chaperone | ||||||||||
| function PA4632 | ||||||||||
| fig|6666666.60966.peg.723 | CDS | 669589 | 670461 | 1 | + | 873 | Phosphoribulokinase | Calvin-Benson cycle | D23_1c0730 | Neut_0772 |
| (EC 2.7.1.19) | ||||||||||
| fig|6666666.60966.peg.724 | CDS | 670525 | 672771 | 1 | + | 2247 | ATP-dependent DNA | DNA repair, bacterial | D23_1c0731 | Neut_0773 |
| helicase UvrD/PcrA | UvrD and related | |||||||||
| helicases | ||||||||||
| fig|6666666.60966.peg.725 | CDS | 673569 | 672778 | −3 | − | 792 | Possible | -none- | D23_1c0732 | Neut_0774 |
| transmembrane protein | ||||||||||
| fig|6666666.60966.peg.726 | CDS | 674610 | 673660 | −3 | − | 951 | Homoserine kinase (EC | CBSS- | D23_1c0733 | Neut_0775 |
| 2.7.1.39) | 269482.1.peg.1294; | |||||||||
| <br>Methionine | ||||||||||
| Biosynthesis; | ||||||||||
| <br>Threonine and | ||||||||||
| Homoserine | ||||||||||
| Biosynthesis | ||||||||||
| fig|6666666.60966.peg.727 | CDS | 674585 | 674716 | 2 | + | 132 | hypothetical protein | -none- | D23_1c0734 | NA |
| fig|6666666.60966.peg.728 | CDS | 675030 | 674704 | −3 | − | 327 | FIG00858562: | -none- | D23_1c0735 | Neut_0776 |
| hypothetical protein | ||||||||||
| fig|6666666.60966.peg.729 | CDS | 675190 | 674996 | −1 | − | 195 | hypothetical protein | -none- | D23_1c0736 | NA |
| fig|6666666.60966.peg.730 | CDS | 675866 | 675147 | −2 | − | 720 | FIG00859241: | -none- | D23_1c0737 | Neut_0777 |
| hypothetical protein | ||||||||||
| fig|6666666.60966.peg.731 | CDS | 675882 | 678602 | 3 | + | 2721 | DNA polymerase I (EC | DNA Repair Base | D23_1c0738 | Neut_0778 |
| 2.7.7.7) | Excision | |||||||||
| fig|6666666.60966.peg.732 | CDS | 678725 | 679912 | 2 | + | 1188 | Fatty acid desaturase | -none- | D23_1c0739 | Neut_0779 |
| (EC 1.14.19.1); Delta-9 | ||||||||||
| fatty acid desaturase | ||||||||||
| (EC 1.14.19.1) | ||||||||||
| fig|6666666.60966.peg.733 | CDS | 680149 | 679994 | −1 | − | 156 | LSU ribosomal protein | -none- | D23_1c0740 | Neut_0780 |
| L33p @ LSU ribosomal | ||||||||||
| protein L33p, zinc- | ||||||||||
| independent | ||||||||||
| fig|6666666.60966.peg.734 | CDS | 680390 | 680190 | −2 | − | 201 | LSU ribosomal protein | -none- | D23_1c0741 | Neut_0781 |
| L28p | ||||||||||
| fig|6666666.60966.peg.735 | CDS | 681169 | 680495 | −1 | − | 675 | DNA repair protein | Bacterial cell division | D23_1c0742 | Neut_0782 |
| RadC | cluster; <br>DNA repair, | |||||||||
| bacterial | ||||||||||
| fig|6666666.60966.peg.736 | CDS | 681339 | 682508 | 3 | + | 1170 | Phosphopantothenoylcysteine | Coenzyme A | D23_1c0743 | Neut_0783 |
| decarboxylase | Biosynthesis; | |||||||||
| (EC 4.1.1.36)/ | <br>Coenzyme A | |||||||||
| Phosphopantothenoylcysteine | Biosynthesis | |||||||||
| synthetase (EC | ||||||||||
| 6.3.2.5) | ||||||||||
| fig|6666666.60966.peg.737 | CDS | 682518 | 682967 | 3 | + | 450 | Deoxyuridine 5'- | Housecleaning | D23_1c0744 | Neut_0784 |
| triphosphate | nucleoside triphosphate | |||||||||
| nucleotidohydrolase (EC | pyrophosphatases; | |||||||||
| 3.6.1.23) | <br>Nudix proteins | |||||||||
| (nucleoside triphosphate | ||||||||||
| hydrolases) | ||||||||||
| fig|6666666.60966.peg.738 | CDS | 682961 | 683386 | 2 | + | 426 | exported protein | -none- | D23_1c0745 | Neut_0785 |
| fig|6666666.60966.peg.739 | CDS | 685816 | 683759 | −1 | − | 2058 | Pyrophosphate- | Phosphate metabolism | D23_1c0746 | Neut_0786 |
| energized proton pump | ||||||||||
| (EC 3.6.1.1) | ||||||||||
| fig|6666666.60966.peg.740 | CDS | 687229 | 685970 | −1 | − | 1260 | 6-phosphofructokinase | Glycolysis and | D23_1c0747 | Neut_0787 |
| (EC 2.7.1.11) | Gluconeogenesis | |||||||||
| fig|6666666.60966.peg.741 | CDS | 687933 | 687400 | −3 | − | 534 | Adenylate kinase (EC | Purine conversions | D23_1c0748 | NA |
| 2.7.4.3) | ||||||||||
| fig|6666666.60966.peg.742 | CDS | 688328 | 689359 | 2 | + | 1032 | RecA protein | DNA repair, bacterial; | D23_1c0749 | Neut_0789 |
| <br>DNA repair system | ||||||||||
| including RecA, MutS | ||||||||||
| and a hypothetical | ||||||||||
| protein; <br>RecA and | ||||||||||
| RecX | ||||||||||
| fig|6666666.60966.peg.743 | CDS | 689362 | 689802 | 1 | + | 441 | Regulatory protein RecX | DNA repair system | D23_1c0750 | Neut_0790 |
| including RecA, MutS | ||||||||||
| and a hypothetical | ||||||||||
| protein; <br>RecA and | ||||||||||
| RecX | ||||||||||
| fig|6666666.60966.peg.744 | CDS | 689820 | 692411 | 3 | + | 2592 | Alanyl-tRNA synthetase | Cluster containing | D23_1c0751 | Neut_0791 |
| (EC 6.1.1.7) | Alanyl-tRNA synthetase; | |||||||||
| <br>tRNA | ||||||||||
| aminoacylation, Ala | ||||||||||
| fig|6666666.60966.peg.745 | CDS | 692450 | 693403 | 2 | + | 954 | Thioredoxin reductase | Thioredoxin-disulfide | D23_1c0752 | Neut_0792 |
| (EC 1.8.1.9) | reductase; | |||||||||
| <br>pyrimidine | ||||||||||
| conversions | ||||||||||
| fig|6666666.60966.peg.746 | CDS | 693409 | 6939991 | 1 | + | 591 | Smr domain | -none- | D23_1c0753 | Neut_0793 |
| fig|6666666.60966.peg.747 | CDS | 694203 | 694349 | 3 | + | 147 | Carbonic anhydrase (EC | Zinc regulated enzymes | D23_1c0754 | Neut_0794 |
| 4.2.1.1) | ||||||||||
| fig|6666666.60966.peg.750 | CDS | 695056 | 695208 | 1 | + | 153 | hypothetical protein | -none- | D23_1c0755 | Neut_1255 |
| fig|6666666.60966.peg.751 | CDS | 695216 | 695383 | 2 | + | 168 | hypothetical protein | -none- | D23_1c0756 | Neut_2449 |
| fig|6666666.60966.peg.752 | CDS | 695522 | 695986 | 2 | + | 465 | Mobile element protein | -none- | D23_1c0758 | Neut_1256 |
| fig|6666666.60966.peg.753 | CDS | 696281 | 696072 | −2 | − | 210 | Chemotaxis regulator- | Flagellar motility | D23_1c0759 | Neut_0796 |
| transmits | ||||||||||
| chemoreceptor signals | ||||||||||
| to flagelllar motor | ||||||||||
| components CheY | ||||||||||
| fig|6666666.60966.peg.754 | CDS | 696491 | 696619 | 2 | + | 129 | hypothetical protein | -none- | D23_1c0760 | Neut_0797 |
| fig|6666666.60966.peg.755 | CDS | 696639 | 696812 | 3 | + | 174 | Mobile element protein | -none- | D23_1c0760 | Neut_0797 |
| fig|6666666.60966.peg.756 | CDS | 696806 | 696934 | 2 | + | 129 | Mobile element protein | -none- | D23_1c0761 | NA |
| fig|6666666.60966.peg.757 | CDS | 697179 | 698426 | 3 | + | 1248 | Mobile element protein | -none- | D23_1c0762 | Neut_0357 |
| fig|6666666.60966.peg.758 | CDS | 698760 | 700454 | 3 | + | 1695 | NADH dehydrogenase, | Respiratory Complex I | D23_1c0763 | Neut_0799 |
| subunit 5 | ||||||||||
| fig|6666666.60966.peg.759 | CDS | 700473 | 701258 | 3 | + | 786 | hypothetical protein | -none- | D23_1c0765 | Neut_0800 |
| fig|6666666.60966.peg.760 | CDS | 701243 | 704371 | 2 | + | 3129 | Hypothetical | CO2 uptake, | D23_1c0766 | Neut_0801 |
| transmembrane protein | carboxysome; | |||||||||
| coupled to NADH- | <br>Respiratory | |||||||||
| ubiquinone | Complex I | |||||||||
| oxidoreductase chain 5 | ||||||||||
| homolog | ||||||||||
| fig|6666666.60966.peg.761 | CDS | 704368 | 704694 | 1 | + | 327 | Nitrogen regulatory | Ammonia assimilation | D23_1c0767 | Neut_0802 |
| protein P-II | ||||||||||
| fig|6666666.60966.peg.762 | CDS | 704850 | 705059 | 3 | + | 210 | hypothetical protein | -none- | D23_1c0768 | Neut_0800 |
| fig|6666666.60966.peg.763 | CDS | 705044 | 708184 | 2 | + | 3141 | Hypothetical | CO2 uptake, | D23_1c0769 | Neut_0801 |
| transmembrane protein | carboxysome; | |||||||||
| coupled to NADH- | <br>Respiratory | |||||||||
| ubiquinone | Complex I | |||||||||
| oxidoreductase chain 5 | ||||||||||
| homolog | ||||||||||
| fig|6666666.60966.peg.764 | CDS | 708181 | 708507 | 1 | + | 327 | Nitrogen regulatory | Ammonia assimilation | D23_1c0770 | Neut_0802 |
| protein P-II | ||||||||||
| fig|6666666.60966.peg.765 | CDS | 709429 | 708509 | −1 | − | 921 | RuBisCO operon | CO2 uptake, | D23_1c0771 | Neut_0803 |
| transcriptional | carboxysome | |||||||||
| regulator CbbR | ||||||||||
| fig|6666666.60966.peg.766 | CDS | 709628 | 711049 | 2 | + | 1422 | Ribulose bisphosphate | CO2 uptake, | D23_1c0772 | Neut_0804 |
| carboxylase large chain | carboxysome; | |||||||||
| (EC 4.1.1.39) | <br>Calvin-Benson cycle; | |||||||||
| <br>Photorespiration | ||||||||||
| (oxidative C2 cycle) | ||||||||||
| fig|6666666.60966.peg.767 | CDS | 711134 | 711460 | 2 | + | 327 | Ribulose bisphosphate | CO2 uptake, | D23_1c0773 | Neut_0805 |
| carboxylase small chain | carboxysome; | |||||||||
| (EC 4.1.1.39) | <br>Calvin-Benson cycle; | |||||||||
| <br>Photorespiration | ||||||||||
| (oxidative C2 cycle) | ||||||||||
| fig|6666666.60966.peg.768 | CDS | 711860 | 711645 | −2 | − | 216 | hypothetical protein | -none- | D23_1c0774 | Neut_0806 |
| fig|6666666.60966.peg.769 | CDS | 711868 | 714264 | 1 | + | 2397 | carboxysome shell | CO2 uptake, | D23_1c0774 | Neut_0806 |
| protein CsoS2 | carboxysome | |||||||||
| fig|6666666.60966.peg.770 | CDS | 714275 | 715804 | 2 | + | 1530 | carboxysome shell | CO2 uptake, | D23_1c0775 | Neut_0807 |
| protein CsoS3 | carboxysome | |||||||||
| fig|6666666.60966.peg.771 | CDS | 715825 | 716082 | 1 | + | 258 | putative carboxysome | CO2 uptake, | D23_1c0776 | Neut_0808 |
| peptide A | carboxysome | |||||||||
| fig|6666666.60966.peg.772 | CDS | 716082 | 716330 | 3 | + | 249 | putative carboxysome | CO2 uptake, | D23_1c0777 | Neut_0809 |
| peptide B | carboxysome | |||||||||
| fig|6666666.60966.peg.773 | CDS | 716439 | 716735 | 3 | + | 297 | carboxysome shell | CO2 uptake, | D23_1c0778 | Neut_0810 |
| protein CsoS1 | carboxysome | |||||||||
| fig|6666666.60966.peg.774 | CDS | 716777 | 717124 | 2 | + | 348 | carboxysome shell | CO2 uptake, | D23_1c0779 | Neut_0811 |
| protein CsoS1 | carboxysome | |||||||||
| fig|6666666.60966.peg.775 | CDS | 717145 | 717567 | 1 | + | 423 | bacterioferritin possible | -none- | D23_1c0780 | Neut_0812 |
| associated with | ||||||||||
| carboxysome | ||||||||||
| fig|6666666.60966.peg.776 | CDS | 717576 | 717842 | 3 | + | 267 | Possible pterin-4 alpha- | CO2 uptake, | D23_1c0781 | Neut_0813 |
| carbinolamine | carboxysome | |||||||||
| dehydratase-like | ||||||||||
| protein | ||||||||||
| fig|6666666.60966.peg.777 | CDS | 717911 | 718483 | 2 | + | 573 | Chromosome (plasmid) | Bacterial Cell Division; | D23_1c0782 | Neut_0814 |
| partitioning protein | <br>Bacterial | |||||||||
| ParA | Cytoskeleton; <br>Cell | |||||||||
| Division Subsystem | ||||||||||
| including YidCD; | ||||||||||
| <br>RNA modification | ||||||||||
| and chromosome | ||||||||||
| partitioning cluster | ||||||||||
| fig|6666666.60966.peg.778 | CDS | 718480 | 718674 | 1 | + | 195 | hypothetical protein | -none- | D23_1c0783 | NA |
| fig|6666666.60966.peg.779 | CDS | 718681 | 719631 | 1 | + | 951 | Rubisco activation | CO2 uptake, | D23_1c0784 | Neut_0815 |
| protein CbbQ | carboxysome | |||||||||
| fig|6666666.60966.peg.780 | CDS | 719654 | 722014 | 2 | + | 2361 | Rubisco activation | CO2 uptake, | D23_1c0785 | Neut_0816 |
| protein CbbO | carboxysome | |||||||||
| fig|6666666.60966.peg.781 | CDS | 722027 | 722659 | 2 | + | 633 | FIG00852745: | -none- | D23_1c0786 | Neut_0817 |
| hypothetical protein | ||||||||||
| fig|6666666.60966.peg.782 | CDS | 722704 | 723528 | 1 | + | 825 | FIG00853400: | -none- | D23_1c0787 | Neut_0818 |
| hypothetical protein | ||||||||||
| fig|6666666.60966.peg.783 | CDS | 723822 | 723676 | −3 | − | 147 | Mobile element protein | -none- | D23_1c0788 | NA |
| fig|6666666.60966.peg.784 | CDS | 723900 | 724055 | 3 | + | 156 | hypothetical protein | -none- | D23_1c0790 | NA |
| fig|6666666.60966.peg.785 | CDS | 724125 | 724304 | 3 | + | 180 | Rubisco activation | CO2 uptake, | D23_1c0791 | NA |
| protein CbbO | carboxysome | |||||||||
| fig|6666666.60966.peg.786 | CDS | 724415 | 724621 | 2 | + | 207 | Rubisco activation | CO2 uptake, | D23_1c0792 | Neut_0816 |
| protein CbbO | carboxysome | |||||||||
| fig|6666666.60966.peg.787 | CDS | 724700 | 724975 | 2 | + | 276 | Nitric oxide reductase | Denitrification; | D23_1c0793 | Neut_0816 |
| activation protein NorD | <br>Denitrifying | |||||||||
| reductase gene clusters | ||||||||||
| fig|6666666.60966.peg.788 | CDS | 724985 | 725104 | 2 | + | 120 | hypothetical protein | -none- | D23_1c0794 | Neut_0816 |
| fig|6666666.60966.peg.789 | CDS | 725079 | 725336 | 3 | + | 258 | Nitric oxide reductase | Denitrification; | D23_1c0794 | Neut_0816 |
| activation protein NorD | <br>Denitrifying | |||||||||
| reductase gene clusters | ||||||||||
| fig|6666666.60966.peg.790 | CDS | 725493 | 725657 | 3 | + | 165 | hypothetical protein | -none- | D23_1c0795 | Neut_0821 |
| fig|6666666.60966.peg.791 | CDS | 727182 | 725782 | −3 | − | 1401 | FIG00861154: | -none- | D23_1c0796 | Neut_1550 |
| hypothetical protein | ||||||||||
| fig|6666666.60966.peg.792 | CDS | 727830 | 727411 | −3 | − | 420 | FIG00859219: | -none- | D23_1c0797 | Neut_0823 |
| hypothetical protein | ||||||||||
| fig|6666666.60966.peg.793 | CDS | 729449 | 728481 | −2 | − | 969 | Octaprenyl diphosphate | Isoprenoid Biosynthesis; | D23_1c0800 | Neut_0825 |
| synthase (EC 2.5.1.90)/ | <br>Isoprenoid | |||||||||
| Dimethylallyltransferase | Biosynthesis; | |||||||||
| (EC 2.5.1.1)/(2E,6E)- | <br>Isoprenoid | |||||||||
| farnesyl diphosphate | Biosynthesis: | |||||||||
| synthase (EC 2.5.1.10)/ | Interconversions; | |||||||||
| Geranylgeranyl | <br>Isoprenoinds for | |||||||||
| diphosphate synthase | Quinones; | |||||||||
| (EC 2.5.1.29) | <br>Isoprenoinds for | |||||||||
| Quinones; | ||||||||||
| <br>Isoprenoinds for | ||||||||||
| Quinones; | ||||||||||
| <br>Isoprenoinds for | ||||||||||
| Quinones; | ||||||||||
| <br>Polyprenyl | ||||||||||
| Diphosphate | ||||||||||
| Biosynthesis; | ||||||||||
| <br>Polyprenyl | ||||||||||
| Diphosphate | ||||||||||
| Biosynthesis; | ||||||||||
| <br>Polyprenyl | ||||||||||
| Diphosphate | ||||||||||
| Biosynthesis | ||||||||||
| fig|6666666.60966.peg.795 | CDS | 729633 | 730886 | 3 | + | 1254 | Glutamyl-tRNA | A Gammaproteobacteria | D23_1c0801 | Neut_0826 |
| reductase (EC 1.2.1.70) | Cluster Relating to | |||||||||
| Translation; <br>Heme | ||||||||||
| and Siroheme | ||||||||||
| Biosynthesis | ||||||||||
| fig|6666666.60966.peg.796 | CDS | 730883 | 731962 | 2 | + | 1080 | Peptide chain release | A Gammaproteobacteria | D23_1c0802 | Neut_0827 |
| factor 1 | Cluster Relating to | |||||||||
| Translation; <br>CBSS- | ||||||||||
| 216600.3.peg.802; | ||||||||||
| <br>Translation | ||||||||||
| termination factors | ||||||||||
| bacterial | ||||||||||
| fig|6666666.60966.peg.797 | CDS | 731959 | 732840 | 1 | + | 882 | Protein-N(5)-glutamine | A Gammaproteobacteria | D23_1c0803 | Neut_0828 |
| methyltransferase | Cluster Relating to | |||||||||
| PrmC, methylates | Translation; <br>CBSS- | |||||||||
| polypeptide chain | 216600.3.peg.802; | |||||||||
| release factors RF1 and | <br>Translation | |||||||||
| RF2 | termination factors | |||||||||
| bacterial | ||||||||||
| fig|6666666.60966.peg.798 | CDS | 732995 | 733303 | 2 | + | 309 | Glutaredoxin-related | Glutaredoxins | D23_1c0805 | Neut_0829 |
| protein | ||||||||||
| fig|6666666.60966.peg.799 | CDS | 733743 | 733324 | −3 | − | 420 | Putative membrane | -none- | D23_1c0806 | Neut_0830 |
| protein | ||||||||||
| fig|6666666.60966.peg.800 | CDS | 734018 | 734161 | 2 | + | 144 | hypothetical protein | -none- | D23_1c0807 | NA |
| fig|6666666.60966.peg.801 | CDS | 734194 | 734826 | 1 | + | 633 | Glutathione S- | Glutathione: Non-redox | D23_1c0808 | Neut_0831 |
| transferase (EC | reactions | |||||||||
| 2.5.1.18) | ||||||||||
| fig|6666666.60966.peg.802 | CDS | 735097 | 735381 | 1 | + | 285 | conserved hypothetical | -none- | D23_1c0809 | Neut_0832 |
| protein | ||||||||||
| fig|6666666.60966.peg.803 | CDS | 735730 | 736488 | 1 | + | 759 | hypothetical protein | -none- | D23_1c0810 | Neut_0833 |
| fig|6666666.60966.peg.804 | CDS | 737600 | 736485 | −2 | − | 1116 | COGs COG1502 | -none- | D23_1c0811 | Neut_0834 |
| fig|6666666.60966.peg.805 | CDS | 738943 | 737585 | −1 | − | 1359 | hypothetical protein | -none- | D23_1c0812 | Neut_0835 |
| fig|6666666.60966.peg.806 | CDS | 739386 | 739240 | −3 | − | 147 | hypothetical protein | -none- | D23_1c0813 | NA |
| fig|6666666.60966.peg.807 | CDS | 740790 | 739585 | −3 | − | 1206 | DnaJ domain protein | -none- | D23_1c0814 | Neut_0836 |
| fig|6666666.60966.peg.809 | CDS | 742340 | 741159 | −2 | − | 1182 | Putative | -none- | D23_1c0815 | Neut_0837 |
| aminotransferase | ||||||||||
| fig|6666666.60966.peg.810 | CDS | 744454 | 742337 | −1 | − | 2118 | Conserved domain | -none- | D23_1c0816 | Neut_0838 |
| protein | ||||||||||
| fig|6666666.60966.peg.811 | CDS | 744823 | 744647 | −1 | − | 177 | hypothetical protein | -none- | D23_1c0817 | NA |
| fig|6666666.60966.peg.812 | CDS | 745953 | 745228 | −3 | − | 726 | hypothetical protein | -none- | D23_1c0818 | Neut_0840 |
| fig|6666666.60966.peg.814 | CDS | 748473 | 746350 | −3 | − | 2124 | InterPro IPR000209 | -none- | D23_1c0820 | Neut_0841 |
| COGs COG1404 | ||||||||||
| fig|6666666.60966.peg.815 | CDS | 748862 | 749245 | 2 | + | 384 | ApaG protein | EC49-61 | D23_1c0822 | Neut_0842 |
| fig|6666666.60966.peg.816 | CDS | 749258 | 749992 | 2 | + | 735 | Tetrapyrrole methylase | -none- | D23_1c0823 | Neut_0843 |
| family protein | ||||||||||
| fig|6666666.60966.peg.817 | CDS | 751297 | 750077 | −1 | − | 1221 | Proton/glutamate | Glutamate and | D23_1c0824 | Neut_0844 |
| symport protein @ | Aspartate uptake in | |||||||||
| Sodium/glutamate | Bacteria | |||||||||
| symport protein | ||||||||||
| fig|6666666.60966.peg.818 | CDS | 752156 | 751611 | −2 | − | 546 | Cytochrome c-type | Biogenesis of c-type | D23_1c0825 | Neut_0845 |
| biogenesis protein ResA | cytochromes | |||||||||
| fig|6666666.60966.peg.819 | CDS | 754247 | 752304 | −2 | − | 1944 | Cytochrome c-type | Biogenesis of c-type | D23_1c0826 | Neut_0846 |
| biogenesis protein | cytochromes; | |||||||||
| DsbD, protein-disulfide | <br>Periplasmic disulfide | |||||||||
| reductase (EC 1.8.1.8) | interchange | |||||||||
| fig|6666666.60966.peg.820 | CDS | 754631 | 754260 | −2 | − | 372 | Periplasmic divalent | Copper homeostasis: | D23_1c0827 | Neut_0847 |
| cation tolerance protein | copper tolerance | |||||||||
| CutA | ||||||||||
| fig|6666666.60966.peg.821 | CDS | 754715 | 754909 | 2 | + | 195 | FIG00859483: | -none- | D23_1c0828 | Neut_0848 |
| hypothetical protein | ||||||||||
| fig|6666666.60966.peg.822 | CDS | 754952 | 755695 | 2 | + | 744 | FIG00859295: | -none- | D23_1c0829 | Neut_0849 |
| hypothetical protein | ||||||||||
| fig|6666666.60966.peg.823 | CDS | 756608 | 755733 | −2 | − | 876 | Staphylococcus | -none- | D23_1c0830 | Neut_0850 |
| nuclease (SNase) | ||||||||||
| domain | ||||||||||
| fig|6666666.60966.peg.824 | CDS | 756650 | 757549 | 2 | + | 900 | Methionine ABC | Methionine | D23_1c0831 | Neut_0851 |
| transporter ATP-binding | Biosynthesis; | |||||||||
| protein | <br>Methionine | |||||||||
| Degradation | ||||||||||
| fig|6666666.60966.peg.825 | CDS | 757674 | 758384 | 3 | + | 711 | Uncharacterized ABC | Lipopolysaccharide | D23_1c0832 | Neut_0852 |
| transporter, permease | assembly | |||||||||
| component YrbE | ||||||||||
| fig|6666666.60966.peg.826 | CDS | 758396 | 758863 | 2 | + | 468 | Uncharacterized ABC | Lipopolysaccharide | D23_1c0833 | Neut_0853 |
| transporter, periplasmic | assembly | |||||||||
| component YrbD | ||||||||||
| fig|6666666.60966.peg.827 | CDS | 758879 | 759496 | 2 | + | 618 | Uncharacterized ABC | Lipopolysaccharide | D23_1c0834 | Neut_0854 |
| transporter, auxiliary | assembly | |||||||||
| component YrbC | ||||||||||
| fig|6666666.60966.peg.828 | CDS | 759503 | 759817 | 2 | + | 315 | STAS domain | -none- | D23_1c0835 | Neut_0855 |
| fig|6666666.60966.peg.829 | CDS | 759879 | 760793 | 3 | + | 915 | ABC-type multidrug | CBSS-196164.1.peg.1690 | D23_1c0836 | Neut_0856 |
| transport system, | ||||||||||
| ATPase component | ||||||||||
| fig|6666666.60966.peg.830 | CDS | 760790 | 761545 | 2 | + | 756 | ABC-type multidrug | CBSS-196164.1.peg.1690 | D23_1c0837 | Neut_0857 |
| transport system, | ||||||||||
| permease component | ||||||||||
| fig|6666666.60966.peg.831 | CDS | 761590 | 761844 | 1 | + | 255 | YrbA protein | Broadly distributed | D23_1c0838 | Neut_0858 |
| proteins not in | ||||||||||
| subsystems | ||||||||||
| fig|6666666.60966.peg.832 | CDS | 763192 | 761900 | −1 | − | 1293 | Dihydrolipoamide | Dehydrogenase | D23_1c0839 | Neut_0859 |
| succinyltransferase | complexes; <br>TCA | |||||||||
| component (E2) of 2- | Cycle | |||||||||
| oxoglutarate | ||||||||||
| dehydrogenase | ||||||||||
| complex (EC 2.3.1.61) | ||||||||||
| fig|6666666.60966.peg.833 | CDS | 766072 | 763214 | −1 | − | 2859 | 2-oxoglutarate | Dehydrogenase | D23_1c0840 | Neut_0860 |
| dehydrogenase E1 | complexes; <br>TCA | |||||||||
| component (EC 1.2.4.2) | Cycle | |||||||||
| fig|6666666.60966.peg.834 | CDS | 767529 | 766234 | −3 | − | 1296 | Citrate synthase (si) (EC | TCA Cycle | D23_1c0841 | Neut_0861 |
| 2.3.3.1) | ||||||||||
| fig|6666666.60966.peg.835 | CDS | 767808 | 767575 | −3 | − | 234 | YgfY COG2938 | -none- | D23_1c0842 | Neut_0862 |
| fig|6666666.60966.peg.836 | CDS | 768500 | 767805 | −2 | − | 696 | Succinate | 5-FCL-like protein; | D23_1c0843 | Neut_0863 |
| dehydrogenase iron- | <br>Succinate | |||||||||
| sulfur protein (EC | dehydrogenase; | |||||||||
| 1.3.99.1) | <br>TCA Cycle | |||||||||
| fig|6666666.60966.peg.837 | CDS | 770059 | 768629 | −1 | − | 1431 | Threonine synthase (EC | Threonine and | D23_1c0844 | Neut_0864 |
| 4.2.3.1) | Homoserine | |||||||||
| Biosynthesis | ||||||||||
| fig|6666666.60966.peg.839 | CDS | 771500 | 770184 | −2 | − | 1317 | Homoserine | Methionine | D23_1c0845 | Neut_0865 |
| dehydrogenase (EC | Biosynthesis; | |||||||||
| 1.1.1.3) | <br>Threonine and | |||||||||
| Homoserine | ||||||||||
| Biosynthesis | ||||||||||
| fig|6666666.60966.peg.840 | CDS | 772833 | 771607 | −3 | − | 1227 | Aspartate | CBSS-216591.1.peg.168; | D23_1c0846 | Neut_0866 |
| aminotransferase (EC | <br>Glutamine, | |||||||||
| 2.6.1.1) | Glutamate, Aspartate | |||||||||
| and Asparagine | ||||||||||
| Biosynthesis; | ||||||||||
| <br>Threonine and | ||||||||||
| Homoserine | ||||||||||
| Biosynthesis | ||||||||||
| fig|6666666.60966.peg.841 | CDS | 773025 | 773147 | 3 | + | 123 | hypothetical protein | -none- | D23_1c0847 | NA |
| fig|6666666.60966.peg.842 | CDS | 773125 | 773508 | 1 | + | 384 | Membrane protein | -none- | D23_1c0848 | Neut_0867 |
| fig|6666666.60966.peg.843 | CDS | 773605 | 775980 | 1 | + | 2376 | Phosphoenolpyruvate | A Hypothetical that | D23_1c0849 | Neut_0868 |
| synthase (EC 2.7.9.2) | Clusters with PEP | |||||||||
| Synthase; <br>Glycolysis | ||||||||||
| and Gluconeogenesis; | ||||||||||
| <br>Pyruvate | ||||||||||
| metabolism I: | ||||||||||
| anaplerotic reactions, | ||||||||||
| PEP | ||||||||||
| fig|6666666.60966.peg.844 | CDS | 775985 | 776812 | 2 | + | 828 | FIG137360: | A Hypothetical that | D23_1c0850 | Neut_0869 |
| hypothetical protein | Clusters with PEP | |||||||||
| Synthase | ||||||||||
| fig|6666666.60966.peg.845 | CDS | 777372 | 776854 | −3 | − | 519 | NLP/P60 | -none- | D23_1c0851 | Neut_0870 |
| fig|6666666.60966.peg.846 | CDS | 779204 | 777507 | −2 | − | 1698 | Glutaminyl-tRNA | tRNA aminoacylation, | D23_1c0852 | Neut_0871 |
| synthetase (EC 6.1.1.18) | Glu and Gln | |||||||||
| fig|6666666.60966.peg.847 | CDS | 779394 | 779245 | −3 | − | 150 | hypothetical protein | -none- | D23_1c0853 | NA |
| fig|6666666.60966.peg.848 | CDS | 779393 | 780991 | 2 | + | 1599 | Lysyl-tRNA synthetase | tRNA aminoacylation, | D23_1c0854 | Neut_0872 |
| (class II) (EC 6.1.1.6) | Lys | |||||||||
| fig|6666666.60966.peg.849 | CDS | 781093 | 781749 | 1 | + | 657 | FIG00858849: | -none- | D23_1c0855 | Neut_0873 |
| hypothetical protein | ||||||||||
| fig|6666666.60966.peg.850 | CDS | 781999 | 782385 | 1 | + | 387 | hypothetical protein | -none- | D23_1c0856 | NA |
| fig|6666666.60966.peg.851 | CDS | 782415 | 782747 | 3 | + | 333 | Mobile element protein | -none- | D23_1c0857 | NA |
| fig|6666666.60966.peg.852 | CDS | 782952 | 783485 | 3 | + | 534 | hypothetical protein | -none- | D23_1c0858 | Neut_0875 |
| fig|6666666.60966.peg.853 | CDS | 783597 | 783767 | 3 | + | 171 | hypothetical protein | -none- | D23_1c0859 | NA |
| fig|6666666.60966.peg.854 | CDS | 784671 | 784048 | −3 | − | 624 | Trp repressor binding | -none- | D23_1c0860 | Neut_0876 |
| protein | ||||||||||
| fig|6666666.60966.peg.855 | CDS | 785041 | 784757 | −1 | − | 285 | Mobile element protein | -none- | D23_1c0861 | NA |
| fig|6666666.60966.peg.857 | CDS | 787300 | 785558 | −1 | − | 1743 | Beta-glucosidase (EC | -none- | D23_1c0862 | Neut_0879 |
| 3.2.1.21) | ||||||||||
| fig|6666666.60966.peg.858 | CDS | 788430 | 787327 | −3 | − | 1104 | Mobile element protein | -none- | D23_1c0863 | Neut_1278 |
| fig|6666666.60966.peg.859 | CDS | 789557 | 789045 | −2 | − | 513 | Mobile element protein | -none- | D23_1c0864 | Neut_1624 |
| fig|6666666.60966.peg.860 | CDS | 789894 | 789589 | −3 | − | 306 | Mobile element protein | -none- | D23_1c0865 | Neut_1371 |
| fig|6666666.60966.peg.861 | CDS | 790136 | 789951 | −2 | − | 186 | Mobile element protein | -none- | D23_1c0866 | Neut_2500 |
| fig|6666666.60966.peg.863 | CDS | 792236 | 790869 | −2 | − | 1368 | ATP-dependent RNA | ATP-dependent RNA | D23_1c0869 | Neut_0889 |
| helicase RhlE | helicases, bacterial | |||||||||
| fig|6666666.60966.peg.865 | CDS | 794169 | 792502 | −3 | − | 1668 | ATPase components of | -none- | D23_1c0871 | Neut_0890 |
| ABC transporters with | ||||||||||
| duplicated ATPase | ||||||||||
| domains | ||||||||||
| fig|6666666.60966.peg.867 | CDS | 794389 | 794568 | 1 | + | 180 | hypothetical protein | -none- | D23_1c0872 | NA |
| fig|6666666.60966.peg.868 | CDS | 795019 | 795636 | 1 | + | 618 | FIG123464: | Cell wall related cluster | D23_1c0873 | Neut_0891 |
| Polysaccharide export | ||||||||||
| protein | ||||||||||
| fig|6666666.60966.peg.869 | CDS | 795679 | 797223 | 1 | + | 1545 | Lipopolysaccharide | Cell wall related cluster | D23_1c0874 | Neut_0892 |
| biosynthesis chain | ||||||||||
| length determinant | ||||||||||
| protein | ||||||||||
| fig|6666666.60966.peg.870 | CDS | 797305 | 798243 | 1 | + | 939 | Protein-tyrosine kinase | Cell wall related cluster | D23_1c0875 | Neut_0893 |
| (EC 2.7.1.112) | ||||||||||
| fig|6666666.60966.peg.871 | CDS | 798243 | 799823 | 3 | + | 1581 | Glycine-rich cell wall | Cell wall related cluster | D23_1c0876 | Neut_0894 |
| structural protein | ||||||||||
| precursor | ||||||||||
| fig|6666666.60966.peg.872 | CDS | 799837 | 800670 | 1 | + | 834 | FIG022606: AAA ATPase | Cell wall related cluster | D23_1c0877 | Neut_0895 |
| fig|6666666.60966.peg.873 | CDS | 800676 | 801515 | 3 | + | 840 | FIG004655: | Cell wall related cluster | D23_1c0878 | Neut_0896 |
| Polysaccharide | ||||||||||
| deacetylase | ||||||||||
| fig|6666666.60966.peg.875 | CDS | 801827 | 802591 | 2 | + | 765 | FIG070318: | Cell wall related cluster | D23_1c0879 | Neut_0897 |
| hypothetical protein | ||||||||||
| fig|6666666.60966.peg.876 | CDS | 802597 | 803808 | 1 | + | 1212 | FIG137776: | Cell wall related cluster | D23_1c0880 | Neut_0898 |
| Glycosyltransferase | ||||||||||
| fig|6666666.60966.peg.877 | CDS | 803877 | 805457 | 3 | + | 1581 | Eight transmembrane | Cell wall related cluster; | D23_1c0881 | Neut_0899 |
| protein EpsH/EpsI | <br>Cell wall related | |||||||||
| protein | cluster | |||||||||
| fig|6666666.60966.peg.878 | CDS | 805493 | 806635 | 2 | + | 1143 | FIG040338: Glycosyl | Cell wall related cluster | D23_1c0882 | Neut_0900 |
| transferase | ||||||||||
| fig|6666666.60966.peg.879 | CDS | 806677 | 808611 | 1 | + | 1935 | Asparagine synthetase | Cell wall related cluster; | D23_1c0884 | Neut_0901 |
| [glutamine-hydrolyzing] | <br>Glutamine, | |||||||||
| (EC 6.3.5.4) AsnH | Glutamate, Aspartate | |||||||||
| and Asparagine | ||||||||||
| Biosynthesis | ||||||||||
| fig|6666666.60966.peg.880 | CDS | 808662 | 809654 | 3 | + | 993 | FIG00859061: | -none- | D23_1c0885 | Neut_0902 |
| hypothetical protein | ||||||||||
| fig|6666666.60966.peg.881 | CDS | 809654 | 810592 | 2 | + | 939 | FIG00859041: | -none- | D23_1c0886 | Neut_0903 |
| hypothetical protein | ||||||||||
| fig|6666666.60966.peg.882 | CDS | 810623 | 811849 | 2 | + | 1227 | hypothetical protein | -none- | D23_1c0887 | Neut_0903 |
| fig|6666666.60966.peg.883 | CDS | 812814 | 811852 | −3 | − | 963 | Mobile element protein | -none- | D23_1c0888 | Neut_1746 |
| fig|6666666.60966.peg.884 | CDS | 813957 | 813094 | −3 | − | 864 | Mobile element protein | -none- | D23_1c0889 | Neut_2192 |
| fig|6666666.60966.peg.885 | CDS | 814250 | 813954 | −2 | − | 297 | hypothetical protein | -none- | D23_1c0890 | Neut_2193 |
| fig|6666666.60966.peg.887 | CDS | 814624 | 815706 | 1 | + | 1083 | glycosyltransferase | -none- | D23_1c0891 | NA |
| fig|6666666.60966.peg.888 | CDS | 817016 | 816339 | −2 | − | 678 | hypothetical protein | -none- | D23_1c0892 | NA |
| fig|6666666.60966.peg.889 | CDS | 818253 | 817114 | −3 | − | 1140 | hypothetical protein | -none- | D23_1c0893 | Neut_0906 |
| fig|6666666.60966.peg.890 | CDS | 819313 | 818282 | −1 | − | 1032 | hypothetical protein | -none- | D23_1c0894 | Neut_2116 |
| fig|6666666.60966.peg.891 | CDS | 820446 | 819313 | −3 | − | 1134 | hypothetical protein | -none- | D23_1c0895 | Neut_0905 |
| fig|6666666.60966.peg.892 | CDS | 821935 | 820481 | −1 | − | 1455 | hypothetical protein | -none- | D23_1c0896 | Neut_0909 |
| fig|6666666.60966.peg.893 | CDS | 823840 | 822074 | −1 | − | 1767 | Asparagine synthetase | Cyanophycin | D23_1c0897 | Neut_0910 |
| [glutamine-hydrolyzing] | Metabolism; | |||||||||
| (EC 6.3.5.4) | <br>Glutamate and | |||||||||
| Aspartate uptake in | ||||||||||
| Bacteria; <br>Glutamine, | ||||||||||
| Glutamate, Aspartate | ||||||||||
| and Asparagine | ||||||||||
| Biosynthesis | ||||||||||
| fig|6666666.60966.peg.895 | CDS | 824361 | 825170 | 3 | + | 810 | hypothetical protein | -none- | D23_1c0898 | Neut_0911 |
| fig|6666666.60966.peg.896 | CDS | 825186 | 826454 | 3 | + | 1269 | hypothetical protein | -none- | D23_1c0899 | Neut_0912 |
| fig|6666666.60966.peg.897 | CDS | 827356 | 826457 | −1 | − | 900 | hypothetical protein | -none- | D23_1c0900 | Neut_0913 |
| fig|6666666.60966.peg.898 | CDS | 827907 | 827404 | −3 | − | 504 | Low molecular weight | LMPTP YfkJ cluster; | D23_1c0901 | Neut_0914 |
| protein tyrosine | <br>Protein deglycation | |||||||||
| phosphatase (EC | ||||||||||
| 3.1.3.48) | ||||||||||
| fig|6666666.60966.peg.899 | CDS | 828032 | 829777 | 2 | + | 1746 | ABC transporter, fused | -none- | D23_1c0902 | Neut_0915 |
| permease and ATPase | ||||||||||
| domains | ||||||||||
| fig|6666666.60966.peg.900 | CDS | 830559 | 829798 | −3 | − | 762 | Sulfur carrier protein | Thiamin biosynthesis | D23_1c0903 | Neut_0916 |
| adenylyltransferase | ||||||||||
| ThiF | ||||||||||
| fig|6666666.60966.peg.901 | CDS | 832018 | 830588 | −1 | − | 1431 | Carboxyl-terminal | Phosphoglycerate | D23_1c0904 | Neut_0917 |
| protease (EC | mutase protein family | |||||||||
| 3.4.21.102) | ||||||||||
| fig|6666666.60966.peg.902 | CDS | 833380 | 832100 | −1 | − | 1281 | Lipoprotein NlpD | Stationary phase repair | D23_1c0905 | Neut_0918 |
| cluster | ||||||||||
| fig|6666666.60966.peg.903 | CDS | 834129 | 833380 | −3 | − | 750 | Phosphoglycerate | Glycolysis and | D23_1c0906 | Neut_0919 |
| mutase (EC 5.4.2.1) | Gluconeogenesis; | |||||||||
| <br>Phosphoglycerate | ||||||||||
| mutase protein family | ||||||||||
| fig|6666666.60966.peg.904 | CDS | 834328 | 835086 | 1 | + | 759 | Triosephosphate | CBSS- | D23_1c0907 | Neut_0920 |
| isomerase (EC 5.3.1.1) | 331978.3.peg.2915; | |||||||||
| <br>Calvin-Benson cycle; | ||||||||||
| <br>Glycolysis and | ||||||||||
| Gluconeogenesis | ||||||||||
| fig|6666666.60966.peg.905 | CDS | 835105 | 835470 | 1 | + | 366 | Preprotein translocase | CBSS-331978.3.peg.2915 | D23_1c0908 | Neut_0921 |
| subunit SecG (TC | ||||||||||
| 3.A.5.1.1) | ||||||||||
| fig|6666666.60966.peg.906 | CDS | 835677 | 836045 | 3 | + | 369 | NADH ubiquinone | NADH ubiquinone | D23_1c0910 | Neut_0922 |
| oxidoreductase chain A | oxidoreductase; | |||||||||
| (EC 1.6.5.3) | <br>Respiratory | |||||||||
| Complex I | ||||||||||
| fig|6666666.60966.peg.907 | CDS | 836049 | 836525 | 3 | + | 477 | NADH-ubiquinone | NADH ubiquinone | D23_1c0911 | Neut_0923 |
| oxidoreductase chain B | oxidoreductase; | |||||||||
| (EC 1.6.5.3) | <br>Respiratory | |||||||||
| Complex I | ||||||||||
| fig|6666666.60966.peg.908 | CDS | 836535 | 837155 | 3 | + | 621 | NADH-ubiquinone | NADH ubiquinone | D23_1c0912 | Neut_0924 |
| oxidoreductase chain C | oxidoreductase; | |||||||||
| (EC 1.6.5.3) | <br>Respiratory | |||||||||
| Complex I | ||||||||||
| fig|6666666.60966.peg.909 | CDS | 837213 | 838466 | 3 | + | 1254 | NADH-ubiquinone | NADH ubiquinone | D23_1c0913 | Neut_0925 |
| oxidoreductase chain D | oxidoreductase; | |||||||||
| (EC 1.6.5.3) | <br>Respiratory | |||||||||
| Complex I | ||||||||||
| fig|6666666.60966.peg.910 | CDS | 838475 | 838951 | 2 | + | 477 | NADH-ubiquinone | NADH ubiquinone | D23_1c0914 | Neut_0926 |
| oxidoreductase chain E | oxidoreductase; | |||||||||
| (EC 1.6.5.3) | <br>Respiratory | |||||||||
| Complex I | ||||||||||
| fig|6666666.60966.peg.911 | CDS | 838948 | 840225 | 1 | + | 1278 | NADH-ubiquinone | NADH ubiquinone | D23_1c0915 | Neut_0927 |
| oxidoreductase chain F | oxidoreductase; | |||||||||
| (EC 1.6.5.3) | <br>Respiratory | |||||||||
| Complex I | ||||||||||
| fig|6666666.60966.peg.912 | CDS | 840287 | 842692 | 2 | + | 2406 | NADH-ubiquinone | NADH ubiquinone | D23_1c0917 | Neut_0928 |
| oxidoreductase chain G | oxidoreductase; | |||||||||
| (EC 1.6.5.3) | <br>Respiratory | |||||||||
| Complex I | ||||||||||
| fig|6666666.60966.peg.913 | CDS | 842717 | 843814 | 2 | + | 1098 | NADH-ubiquinone | NADH ubiquinone | D23_1c0918 | Neut_0929 |
| oxidoreductase chain H | oxidoreductase; | |||||||||
| (EC 1.6.5.3) | <br>Respiratory | |||||||||
| Complex I | ||||||||||
| fig|6666666.60966.peg.914 | CDS | 843832 | 844320 | 1 | + | 489 | NADH-ubiquinone | NADH ubiquinone | D23_1c0919 | Neut_0930 |
| oxidoreductase chain I | oxidoreductase; | |||||||||
| (EC 1.6.5.3) | <br>Respiratory | |||||||||
| Complex I | ||||||||||
| fig|6666666.60966.peg.915 | CDS | 844339 | 844944 | 1 | + | 606 | NADH-ubiquinone | NADH ubiquinone | D23_1c0920 | Neut_0931 |
| oxidoreductase chain J | oxidoreductase; | |||||||||
| (EC 1.6.5.3) | <br>Respiratory | |||||||||
| Complex I | ||||||||||
| fig|6666666.60966.peg.916 | CDS | 845000 | 845305 | 2 | + | 306 | NADH-ubiquinone | NADH ubiquinone | D23_1c0921 | Neut_0932 |
| oxidoreductase chain K | oxidoreductase; | |||||||||
| (EC 1.6.5.3) | <br>Respiratory | |||||||||
| Complex I | ||||||||||
| fig|6666666.60966.peg.917 | CDS | 845366 | 847312 | 2 | + | 1947 | NADH-ubiquinone | NADH ubiquinone | D23_1c0922 | Neut_0933 |
| oxidoreductase chain L | oxidoreductase; | |||||||||
| (EC 1.6.5.3) | <br>Respiratory | |||||||||
| Complex I | ||||||||||
| fig|6666666.60966.peg.918 | CDS | 847401 | 848882 | 3 | + | 1482 | NADH-ubiquinone | NADH ubiquinone | D23_1c0923 | Neut_0934 |
| oxidoreductase chain M | oxidoreductase; | |||||||||
| (EC 1.6.5.3) | <br>Respiratory | |||||||||
| Complex I | ||||||||||
| fig|6666666.60966.peg.919 | CDS | 848945 | 850390 | 2 | + | 1446 | NADH-ubiquinone | NADH ubiquinone | D23_1c0924 | Neut_0935 |
| oxidoreductase chain N | oxidoreductase; | |||||||||
| (EC 1.6.5.3) | <br>Respiratory | |||||||||
| Complex I | ||||||||||
| fig|6666666.60966.peg.920 | CDS | 851362 | 850412 | −1 | − | 951 | L-sorbosone | -none- | D23_1c0925 | Neut_0936 |
| dehydrogenase | ||||||||||
| fig|6666666.60966.peg.921 | CDS | 851619 | 853541 | 3 | + | 1923 | Chaperone protein | Protein chaperones | D23_1c0926 | Neut_0937 |
| HtpG | ||||||||||
| fig|6666666.60966.peg.922 | CDS | 853878 | 854918 | 3 | + | 1041 | WD40 domain protein | -none- | D23_1c0927 | Neut_0938 |
| beta Propeller | ||||||||||
| fig|6666666.60966.peg.924 | CDS | 855176 | 855598 | 2 | + | 423 | Mobile element protein | -none- | D23_1c0929 | Neut_0939 |
| fig|6666666.60966.peg.925 | CDS | 855805 | 858447 | 1 | + | 2643 | Hopanoid-associated | Hopanes | D23_1c0930 | Neut_0940 |
| RND transporter, HpnN | ||||||||||
| fig|6666666.60966.peg.926 | CDS | 859079 | 858483 | −2 | − | 597 | DedA protein | Colicin V and Bacteriocin | D23_1c0931 | Neut_0941 |
| Production Cluster; | ||||||||||
| <br>DedA family of inner | ||||||||||
| membrane proteins; | ||||||||||
| <br>Uptake of selenate | ||||||||||
| and selenite | ||||||||||
| fig|6666666.60966.peg.928 | CDS | 861652 | 859424 | −1 | − | 2229 | Probable | -none- | D23_1c0933 | Neut_0942 |
| transmembrane protein | ||||||||||
| fig|6666666.60966.peg.929 | CDS | 861629 | 861754 | 2 | + | 126 | hypothetical protein | -none- | D23_1c0934 | NA |
| fig|6666666.60966.peg.930 | CDS | 861857 | 861720 | −2 | − | 138 | hypothetical protein | -none- | D23_1c0935 | NA |
| fig|6666666.60966.peg.931 | CDS | 861928 | 862341 | 1 | + | 414 | Protoporphyrinogen IX | Heme and Siroheme | D23_1c0936 | Neut_0943 |
| oxidase, novel form, | Biosynthesis | |||||||||
| HemJ (EC 1.3.—.—) | ||||||||||
| fig|6666666.60966.peg.932 | CDS | 862893 | 862363 | −3 | − | 531 | Peptide deformylase | Bacterial RNA- | D23_1c0937 | Neut_0944 |
| (EC 3.5.1.88) | metabolizing Zn- | |||||||||
| dependent hydrolases; | ||||||||||
| <br>Translation | ||||||||||
| termination factors | ||||||||||
| bacterial | ||||||||||
| fig|6666666.60966.peg.933 | CDS | 863632 | 862886 | −1 | − | 747 | 5'- | -none- | D23_1c0938 | Neut_0945 |
| methylthioadenosine | ||||||||||
| phosphorylase (EC | ||||||||||
| 2.4.2.28) | ||||||||||
| fig|6666666.60966.peg.934 | CDS | 865800 | 863752 | −3 | − | 2049 | DNA ligase (EC 6.5.1.2) | DNA Repair Base | D23_1c0939 | Neut_0946 |
| Excision | ||||||||||
| fig|6666666.60966.peg.935 | CDS | 865959 | 866654 | 3 | + | 696 | hypothetical protein | -none- | D23_1c0940 | Neut_0947 |
| fig|6666666.60966.peg.936 | CDS | 867392 | 867021 | −2 | − | 372 | Flagellar biosynthesis | Flagellum | D23_1c0941 | Neut_0948 |
| protein FliT | ||||||||||
| fig|6666666.60966.peg.937 | CDS | 867859 | 867389 | −1 | − | 471 | Flagellar biosynthesis | Flagellum | D23_1c0942 | Neut_0949 |
| protein FliS | ||||||||||
| fig|6666666.60966.peg.938 | CDS | 869359 | 867917 | −1 | − | 1443 | Flagellar hook- | Flagellum | D23_1c0943 | Neut_0950 |
| associated protein FliD | ||||||||||
| fig|6666666.60966.peg.939 | CDS | 870186 | 869716 | −3 | − | 471 | hypothetical protein | -none- | D23_1c0944 | Neut_0951 |
| fig|6666666.60966.peg.940 | CDS | 870616 | 870891 | 1 | + | 276 | hypothetical protein | -none- | D23_1c0945 | Neut_0952 |
| fig|6666666.60966.peg.941 | CDS | 871905 | 870955 | −3 | − | 951 | Glutathione synthetase | Glutathione: | D23_1c0946 | Neut_0953 |
| (EC 6.3.2.3) | Biosynthesis and | |||||||||
| gamma-glutamyl cycle; | ||||||||||
| <br>Heat shock dnaK | ||||||||||
| gene cluster extended | ||||||||||
| fig|6666666.60966.peg.942 | CDS | 873212 | 871902 | −2 | − | 1311 | Glutamate--cysteine | Glutathione: | D23_1c0947 | Neut_0954 |
| ligase (EC 6.3.2.2), | Biosynthesis and | |||||||||
| divergent, of Alpha- and | gamma-glutamyl cycle | |||||||||
| Beta-proteobacteria | ||||||||||
| type | ||||||||||
| fig|6666666.60966.peg.944 | CDS | 873411 | 873722 | 3 | + | 312 | LSU ribosomal protein | CBSS-176279.3.peg.868 | D23_1c0949 | Neut_0955 |
| L21p | ||||||||||
| fig|6666666.60966.peg.945 | CDS | 873734 | 873991 | 2 | + | 258 | LSU ribosomal protein | CBSS-176279.3.peg.868 | D23_1c0950 | Neut_0956 |
| L27p | ||||||||||
| fig|6666666.60966.peg.946 | CDS | 873991 | 874104 | 1 | + | 114 | hypothetical protein | -none- | D23_1c0951 | NA |
| fig|6666666.60966.peg.947 | CDS | 874121 | 875152 | 2 | + | 1032 | GTP-binding protein | CBSS-176279.3.peg.868; | D23_1c0952 | Neut_0957 |
| Obg | <br>Universal GTPases | |||||||||
| fig|6666666.60966.peg.948 | CDS | 875158 | 876279 | 1 | + | 1122 | Glutamate 5-kinase (EC | Proline Synthesis; | D23_1c0953 | Neut_0958 |
| 2.7.2.11)/RNA-binding | <br>Proline Synthesis | |||||||||
| C-terminal domain PUA | ||||||||||
| fig|6666666.60966.peg.949 | CDS | 876330 | 877331 | 3 | + | 1002 | InterPro IPR000379 | -none- | D23_1c0954 | Neut_0959 |
| COGs COG0429 | ||||||||||
| fig|6666666.60966.peg.950 | CDS | 877428 | 878744 | 3 | + | 1317 | Phosphate regulon | High affinity phosphate | D23_1c0955 | Neut_0960 |
| sensor protein PhoR | transporter and control | |||||||||
| (SphS) (EC 2.7.13.3) | of PHO regulon; | |||||||||
| <br>PhoR-PhoB two- | ||||||||||
| component regulatory | ||||||||||
| system; <br>Phosphate | ||||||||||
| metabolism | ||||||||||
| fig|6666666.60966.peg.951 | CDS | 879101 | 879343 | 2 | + | 243 | RNA-binding protein | Hfl operon; | D23_1c0957 | Neut_0961 |
| Hfq | <br>Polyadenylation | |||||||||
| bacterial; <br>Possible | ||||||||||
| RNA degradation cluster | ||||||||||
| fig|6666666.60966.peg.952 | CDS | 879345 | 880478 | 3 | + | 1134 | GTP-binding protein | Hfl operon; <br>Possible | D23_1c0958 | Neut_0962 |
| HflX | RNA degradation cluster; | |||||||||
| <br>Universal GTPases | ||||||||||
| fig|6666666.60966.peg.953 | CDS | 880535 | 881725 | 2 | + | 1191 | HflK protein | Hfl operon; <br>Scaffold | D23_1c0959 | Neut_0963 |
| proteins for [4Fe—4S] | ||||||||||
| cluster assembly (MRP | ||||||||||
| family) | ||||||||||
| fig|6666666.60966.peg.954 | CDS | 881725 | 882603 | 1 | + | 879 | HflC protein | Hfl operon; <br>Scaffold | D23_1c0960 | Neut_0964 |
| proteins for [4Fe—4S] | ||||||||||
| cluster assembly (MRP | ||||||||||
| family) | ||||||||||
| fig|6666666.60966.peg.955 | CDS | 882732 | 882917 | 3 | + | 186 | Putative inner | Hfl operon | D23_1c0961 | Neut_0965 |
| membrane protein YjeT | ||||||||||
| (clustered with HflC) | ||||||||||
| fig|6666666.60966.peg.956 | CDS | 882992 | 884164 | 2 | + | 1173 | ATP | Histidine Biosynthesis | D23_1c0962 | Neut_0966 |
| phosphoribosyltransferase | ||||||||||
| regulatory subunit | ||||||||||
| (EC 2.4.2.17) | ||||||||||
| fig|6666666.60966.peg.957 | CDS | 884298 | 885596 | 3 | + | 1299 | Adenylosuccinate | Purine conversions | D23_1c0963 | Neut_0967 |
| synthetase (EC 6.3.4.4) | ||||||||||
| fig|6666666.60966.peg.958 | CDS | 885982 | 885665 | −1 | − | 318 | FIG00858510: | -none- | D23_1c0964 | Neut_0968 |
| hypothetical protein | ||||||||||
| fig|6666666.60966.peg.959 | CDS | 886361 | 886164 | −2 | − | 198 | FIG00859475: | -none- | D23_1c0966 | Neut_0969 |
| hypothetical protein | ||||||||||
| fig|6666666.60966.peg.961 | CDS | 889010 | 886635 | −2 | − | 2376 | ATP-dependent | Proteasome bacterial; | D23_1c0967 | Neut_0970 |
| protease La (EC | <br>Proteolysis in | |||||||||
| 3.4.21.53) Type I | bacteria, ATP-dependent | |||||||||
| fig|6666666.60966.peg.962 | CDS | 889609 | 889160 | −1 | − | 450 | CBS domain protein | -none- | D23_1c0968 | Neut_0971 |
| fig|6666666.60966.peg.963 | CDS | 890160 | 889657 | −3 | − | 504 | hypothetical protein | -none- | D23_1c0969 | Neut_0972 |
| fig|6666666.60966.peg.964 | CDS | 890193 | 890345 | 3 | + | 153 | hypothetical protein | -none- | D23_1c0970 | NA |
| fig|6666666.60966.peg.965 | CDS | 890326 | 890442 | 1 | + | 117 | hypothetical protein | -none- | D23_1c0971 | NA |
| fig|6666666.60966.peg.966 | CDS | 890503 | 891663 | 1 | + | 1161 | ABC-transporter | -none- | D23_1c0972 | Neut_0973 |
| permease protein | ||||||||||
| fig|6666666.60966.peg.967 | CDS | 891663 | 892352 | 3 | + | 690 | ABC transporter, ATP- | -none- | D23_1c0973 | Neut_0974 |
| binding protein | ||||||||||
| fig|6666666.60966.peg.968 | CDS | 892533 | 893492 | 3 | + | 960 | Membrane protein | -none- | D23_1c0974 | Neut_0975 |
| fig|6666666.60966.peg.969 | CDS | 895517 | 893706 | −2 | − | 1812 | Sodium/hydrogen | -none- | D23_1c0976 | Neut_0976 |
| exchanger family | ||||||||||
| protein | ||||||||||
| fig|6666666.60966.peg.970 | CDS | 895888 | 896574 | 1 | + | 687 | FIG00859851: | -none- | D23_1c0978 | Neut_0977 |
| hypothetical protein | ||||||||||
| fig|6666666.60966.peg.971 | CDS | 897991 | 897029 | −1 | − | 963 | Mobile element protein | -none- | D23_1c0979 | Neut_0978 |
| fig|6666666.60966.peg.972 | CDS | 899539 | 898112 | −1 | − | 1428 | Pyruvate kinase (EC | Glycerate metabolism; | D23_1c0980 | Neut_0979 |
| 2.7.1.40) | <br>Glycolysis and | |||||||||
| Gluconeogenesis; | ||||||||||
| <br>Pyruvate | ||||||||||
| metabolism I: | ||||||||||
| anaplerotic reactions, | ||||||||||
| PEP | ||||||||||
| fig|6666666.60966.peg.973 | CDS | 899838 | 899563 | −3 | − | 276 | hypothetical protein | -none- | D23_1c0981 | Neut_0980 |
| fig|6666666.60966.peg.974 | CDS | 900234 | 900398 | 3 | + | 165 | hypothetical protein | -none- | D23_1c0982 | NA |
| fig|6666666.60966.peg.975 | CDS | 903871 | 900686 | −1 | − | 3186 | TonB-dependent | Ton and Tol transport | D23_1c0983 | Neut_1076 |
| receptor | systems | |||||||||
| fig|6666666.60966.peg.976 | CDS | 904856 | 903873 | −2 | − | 984 | hypothetical protein | -none- | D23_1c0984 | Neut_1077 |
| fig|6666666.60966.peg.977 | CDS | 906168 | 904861 | −3 | − | 1308 | putative helicase | -none- | D23_1c0985 | Neut_1078 |
| fig|6666666.60966.peg.978 | CDS | 908497 | 906392 | −1 | − | 2106 | sucrose synthase | -none- | D23_1c0988 | Neut_1079 |
| fig|6666666.60966.peg.979 | CDS | 910925 | 908787 | −2 | − | 2139 | Sucrose phosphate | -none- | D23_1c0989 | Neut_1080 |
| synthase | ||||||||||
| fig|6666666.60966.peg.980 | CDS | 911865 | 910936 | −3 | − | 930 | Fructokinase (EC | -none- | D23_1c0990 | Neut_1081 |
| 2.7.1.4) | ||||||||||
| fig|6666666.60966.peg.981 | CDS | 914147 | 912060 | −2 | − | 2088 | Excinuclease ABC | DNA repair, UvrABC | D23_1c0991 | Neut_1082 |
| subunit B | system | |||||||||
| fig|6666666.60966.peg.982 | CDS | 914226 | 915419 | 3 | + | 1194 | Aspartate | CBSS-216591.1.peg.168; | D23_1c0992 | Neut_1083 |
| aminotransferase (EC | <br>Glutamine, | |||||||||
| 2.6.1.1) | Glutamate, Aspartate | |||||||||
| and Asparagine | ||||||||||
| Biosynthesis; | ||||||||||
| <br>Threonine and | ||||||||||
| Homoserine | ||||||||||
| Biosynthesis | ||||||||||
| fig|6666666.60966.peg.983 | CDS | 915551 | 915688 | 2 | + | 138 | hypothetical protein | -none- | D23_1c0993 | NA |
| fig|6666666.60966.peg.984 | CDS | 915891 | 916277 | 3 | + | 387 | Mobile element protein | -none- | D23_1c0994 | Neut_0884 |
| fig|6666666.60966.peg.985 | CDS | 916240 | 916695 | 1 | + | 456 | Mobile element protein | -none- | D23_1c0995 | Neut_2502 |
| fig|6666666.60966.peg.986 | CDS | 916764 | 917726 | 3 | + | 963 | Mobile element protein | -none- | D23_1c0996 | Neut_1862 |
| fig|6666666.60966.peg.987 | CDS | 918535 | 918419 | −1 | − | 117 | hypothetical protein | -none- | D23_1c0997 | NA |
| fig|6666666.60966.peg.988 | CDS | 919358 | 918504 | −2 | − | 855 | DNA-directed RNA | RNA polymerase | D23_1c0998 | NA |
| polymerase alpha | bacterial | |||||||||
| subunit (EC 2.7.7.6) | ||||||||||
| fig|6666666.60966.peg.989 | CDS | 919525 | 919409 | −1 | − | 117 | hypothetical protein | -none- | D23_1c0999 | Neut_1085 |
| fig|6666666.60966.peg.990 | CDS | 919587 | 919787 | 3 | + | 201 | Glutathione synthetase | Glutathione: | D23_1c0999 | Neut_1085 |
| (EC 6.3.2.3) | Biosynthesis and | |||||||||
| gamma-glutamyl cycle; | ||||||||||
| <br>Heat shock dnaK | ||||||||||
| gene cluster extended | ||||||||||
| fig|6666666.60966.peg.991 | CDS | 919919 | 920287 | 2 | + | 369 | FIG00858546: | -none- | D23_1c1000 | Neut_1086 |
| hypothetical protein | ||||||||||
| fig|6666666.60966.peg.992 | CDS | 920496 | 921119 | 3 | + | 624 | bacteriocin resistance | -none- | D23_1c1001 | Neut_1087 |
| protein, putative | ||||||||||
| fig|6666666.60966.peg.993 | CDS | 921168 | 921644 | 3 | + | 477 | FIG00859915: | -none- | D23_1c1002 | Neut_1088 |
| hypothetical protein | ||||||||||
| fig|6666666.60966.peg.994 | CDS | 921659 | 923050 | 2 | + | 1392 | FIG00858837: | -none- | D23_1c1003 | Neut_1089 |
| hypothetical protein | ||||||||||
| fig|6666666.60966.peg.995 | CDS | 923533 | 923105 | −1 | − | 429 | Zn-dependent | -none- | D23_1c1004 | Neut_1090 |
| hydrolases, including | ||||||||||
| glyoxylases | ||||||||||
| fig|6666666.60966.peg.996 | CDS | 923845 | 924936 | 1 | + | 1092 | Diaminohydroxyphosphoribosylaminopyrimidine | Riboflavin, FMN and FAD | D23_1c1005 | Neut_1091 |
| deaminase (EC | metabolism; | |||||||||
| 3.5.4.26)/5-amino-6- | <br>Riboflavin, FMN and | |||||||||
| (5- | FAD metabolism; | |||||||||
| phosphoribosylamino)uracil | <br>Riboflavin, FMN and | |||||||||
| reductase (EC | FAD metabolism in | |||||||||
| 1.1.1.193) | plants; <br>Riboflavin, | |||||||||
| FMN and FAD | ||||||||||
| metabolism in plants; | ||||||||||
| <br>Riboflavin synthesis | ||||||||||
| cluster; <br>Riboflavin | ||||||||||
| synthesis cluster | ||||||||||
| fig|6666666.60966.peg.997 | CDS | 925042 | 926262 | 1 | + | 1221 | Glycosyl transferase, | -none- | D23_1c1006 | Neut_1092 |
| group 1 | ||||||||||
| fig|6666666.60966.peg.998 | CDS | 926363 | 927685 | 2 | + | 1323 | UDP-glucose | -none- | D23_1c1007 | Neut_1093 |
| dehydrogenase (EC | ||||||||||
| 1.1.1.22) | ||||||||||
| fig|6666666.60966.peg.999 | CDS | 928127 | 928318 | 2 | + | 192 | hypothetical protein | -none- | D23_1c1009 | Neut_1095 |
| fig|6666666.60966.peg.1000 | CDS | 928500 | 928315 | −3 | − | 186 | hypothetical protein | -none- | D23_1c1010 | NA |
| fig|6666666.60966.peg.1002 | CDS | 929085 | 930362 | 3 | + | 1278 | InterPro IPR001296 | -none- | D23_1c1011 | Neut_1096 |
| COGs COG0438 | ||||||||||
| fig|6666666.60966.peg.1003 | CDS | 930467 | 931729 | 2 | + | 1263 | Coenzyme F390 | -none- | D23_1c1012 | Neut_1097 |
| synthetase | ||||||||||
| fig|6666666.60966.peg.1004 | CDS | 932351 | 931731 | −2 | − | 621 | exopolysaccharide | -none- | D23_1c1013 | Neut_1098 |
| synthesis protein ExoD- | ||||||||||
| related protein | ||||||||||
| fig|6666666.60966.peg.1005 | CDS | 932631 | 933110 | 3 | + | 480 | FIG00859304: | -none- | D23_1c1014 | Neut_1099 |
| hypothetical protein | ||||||||||
| fig|6666666.60966.peg.1006 | CDS | 933200 | 934357 | 2 | + | 1158 | FIG010505: | -none- | D23_1c1015 | Neut_1100 |
| hypothetical protein | ||||||||||
| fig|6666666.60966.peg.1007 | CDS | 934409 | 935224 | 2 | + | 816 | FIG00858774: | -none- | D23_1c1016 | Neut_1101 |
| hypothetical protein | ||||||||||
| fig|6666666.60966.peg.1008 | CDS | 935243 | 936316 | 2 | + | 1074 | Probable | -none- | D23_1c1017 | Neut_1102 |
| transmembrane protein | ||||||||||
| fig|6666666.60966.peg.1009 | CDS | 936361 | 937383 | 1 | + | 1023 | FIG000906: Predicted | -none- | D23_1c1018 | Neut_1103 |
| Permease | ||||||||||
| fig|6666666.60966.peg.1010 | CDS | 937391 | 938608 | 2 | + | 1218 | CDP-alcohol | -none- | D23_1c1019 | Neut_1104 |
| phosphatidyltransferase | ||||||||||
| fig|6666666.60966.peg.1011 | CDS | 938637 | 939593 | 3 | + | 957 | FIG00480695: | -none- | D23_1c1020 | Neut_1105 |
| hypothetical protein | ||||||||||
| fig|6666666.60966.peg.1012 | CDS | 939607 | 940575 | 1 | + | 969 | FIG00859274: | -none- | D23_1c1021 | Neut_1106 |
| hypothetical protein | ||||||||||
| fig|6666666.60966.peg.1013 | CDS | 940636 | 941283 | 1 | + | 648 | FIG00859276: | -none- | D23_1c1022 | Neut_1107 |
| hypothetical protein | ||||||||||
| fig|6666666.60966.peg.1014 | CDS | 941749 | 941294 | −1 | − | 456 | Zn-ribbon-containing, | DNA replication cluster 1 | D23_1c1023 | Neut_1108 |
| possibly RNA-binding | ||||||||||
| protein and truncated | ||||||||||
| derivatives | ||||||||||
| fig|6666666.60966.peg.1016 | CDS | 942037 | 942186 | 1 | + | 150 | hypothetical protein | -none- | D23_1c1024 | NA |
| fig|6666666.60966.peg.1017 | CDS | 942242 | 944971 | 2 | + | 2730 | Protein export | -none- | D23_1c1025 | Neut_1109 |
| cytoplasm protein SecA | ||||||||||
| ATPase RNA helicase | ||||||||||
| (TC 3.A.5.1.1) | ||||||||||
| fig|6666666.60966.peg.1018 | CDS | 945151 | 945756 | 1 | + | 606 | Ubiquinol-cytochrome C | Ubiquinone | D23_1c1026 | Neut_1110 |
| reductase iron-sulfur | Menaquinone- | |||||||||
| subunit (EC 1.10.2.2) | cytochrome c reductase | |||||||||
| complexes | ||||||||||
| fig|6666666.60966.peg.1019 | CDS | 945758 | 947005 | 2 | + | 1248 | Ubiquinol--cytochrome | Ubiquinone | D23_1c1027 | Neut_1111 |
| c reductase, | Menaquinone- | |||||||||
| cytochrome B subunit | cytochrome c reductase | |||||||||
| (EC 1.10.2.2) | complexes | |||||||||
| fig|6666666.60966.peg.1020 | CDS | 947002 | 947706 | 1 | + | 705 | ubiquinol cytochrome C | Ubiquinone | D23_1c1028 | Neut_1112 |
| oxidoreductase, | Menaquinone- | |||||||||
| cytochrome C1 subunit | cytochrome c reductase | |||||||||
| complexes | ||||||||||
| fig|6666666.60966.peg.1021 | CDS | 947758 | 948357 | 1 | + | 600 | Stringent starvation | Carbon Starvation | D23_1c1029 | Neut_1113 |
| protein A | ||||||||||
| fig|6666666.60966.peg.1023 | CDS | 949015 | 949215 | 1 | + | 201 | hypothetical protein | -none- | D23_1c1031 | Neut_2449 |
| fig|6666666.60966.peg.1024 | CDS | 949203 | 949682 | 3 | + | 480 | Mobile element protein | -none- | D23_1c1032 | Neut_2417 |
| fig|6666666.60966.peg.1025 | CDS | 950361 | 950651 | 3 | + | 291 | Mobile element protein | -none- | D23_1c1034 | Neut_2190 |
| fig|6666666.60966.peg.1026 | CDS | 951943 | 950696 | −1 | − | 1248 | Mobile element protein | -none- | D23_1c1035 | Neut_0357 |
| fig|6666666.60966.peg.1027 | CDS | 952378 | 952208 | −1 | − | 171 | hypothetical protein | -none- | D23_1c1036 | NA |
| fig|6666666.60966.peg.1028 | CDS | 953114 | 952689 | −2 | − | 426 | C4-type zinc finger | Zinc regulated enzymes | D23_1c1037 | Neut_1117 |
| protein, DksA/TraR | ||||||||||
| family | ||||||||||
| fig|6666666.60966.peg.1029 | CDS | 955194 | 953479 | −3 | − | 1716 | Adenylate cyclase (EC | cAMP signaling in | D23_1c1038 | Neut_1118 |
| 4.6.1.1) | bacteria | |||||||||
| fig|6666666.60966.peg.1030 | CDS | 956008 | 955157 | −1 | − | 852 | HD domain | -none- | D23_1c1039 | Neut_1119 |
| fig|6666666.60966.peg.1032 | CDS | 956563 | 957111 | 1 | + | 549 | InterPro IPR000345 | -none- | D23_1c1042 | Neut_1126 |
| fig|6666666.60966.peg.1033 | CDS | 958663 | 957200 | −1 | − | 1464 | 3-polyprenyl-4- | Ubiquinone | D23_1c1043 | Neut_1127 |
| hydroxybenzoate | Biosynthesis; | |||||||||
| carboxy-lyase (EC | <br>Ubiquinone | |||||||||
| 4.1.1.—) | Biosynthesis-gjo | |||||||||
| fig|6666666.60966.peg.1034 | CDS | 959616 | 958756 | −3 | − | 861 | 4-hydroxybenzoate | Ubiquinone | D23_1c1045 | Neut_1128 |
| polyprenyltransferase | Biosynthesis; | |||||||||
| (EC 2.5.1.39) | <br>Ubiquinone | |||||||||
| Biosynthesis-gjo | ||||||||||
| fig|6666666.60966.peg.1035 | CDS | 960159 | 959695 | −3 | − | 465 | Chorismate--pyruvate | Ubiquinone | D23_1c1046 | Neut_1129 |
| lyase (EC 4.1.3.40) | Biosynthesis; | |||||||||
| <br>Ubiquinone | ||||||||||
| Biosynthesis-gjo | ||||||||||
| fig|6666666.60966.peg.1036 | CDS | 960706 | 960299 | −1 | − | 408 | twitching motility | -none- | D23_1c1047 | Neut_1130 |
| protein PilG | ||||||||||
| fig|6666666.60966.peg.1037 | CDS | 962283 | 960874 | −3 | − | 1410 | Potassium uptake | Hyperosmotic potassium | D23_1c1048 | Neut_1131 |
| protein TrkH | uptake; <br>Potassium | |||||||||
| homeostasis; | ||||||||||
| <br>Potassium | ||||||||||
| homeostasis | ||||||||||
| fig|6666666.60966.peg.1038 | CDS | 963803 | 962355 | −2 | − | 1449 | Trk system potassium | Bacterial RNA- | D23_1c1049 | Neut_1132 |
| uptake protein TrkA | metabolizing Zn- | |||||||||
| dependent hydrolases; | ||||||||||
| <br>Hyperosmotic | ||||||||||
| potassium uptake; | ||||||||||
| <br>Possible RNA | ||||||||||
| degradation cluster; | ||||||||||
| <br>Potassium | ||||||||||
| homeostasis; | ||||||||||
| <br>Potassium | ||||||||||
| homeostasis | ||||||||||
| fig|6666666.60966.peg.1039 | CDS | 965344 | 964070 | −1 | − | 1275 | FIG00858490: | -none- | D23_1c1050 | Neut_1133 |
| hypothetical protein | ||||||||||
| fig|6666666.60966.peg.1040 | CDS | 965355 | 965495 | 3 | + | 141 | hypothetical protein | -none- | D23_1c1051 | NA |
| fig|6666666.60966.peg.1041 | CDS | 965968 | 965477 | −1 | − | 492 | Starvation lipoprotein | Carbon Starvation | D23_1c1052 | Neut_1134 |
| Slp paralog | ||||||||||
| fig|6666666.60966.peg.1042 | CDS | 966371 | 967021 | 2 | + | 651 | Septum site- | Bacterial Cell Division; | D23_1c1054 | Neut_1135 |
| determining protein | <br>Bacterial | |||||||||
| MinC | Cytoskeleton; | |||||||||
| <br>Bacterial cell | ||||||||||
| division cluster; | ||||||||||
| <br>Septum site- | ||||||||||
| determining cluster Min | ||||||||||
| fig|6666666.60966.peg.1043 | CDS | 967047 | 967856 | 3 | + | 810 | Septum site- | Bacterial Cell Division; | D23_1c1055 | Neut_1136 |
| determining protein | <br>Bacterial | |||||||||
| MinD | Cytoskeleton; | |||||||||
| <br>Bacterial cell | ||||||||||
| division cluster; | ||||||||||
| <br>Septum site- | ||||||||||
| determining cluster Min | ||||||||||
| fig|6666666.60966.peg.1044 | CDS | 967856 | 968152 | 2 | + | 297 | Cell division topological | Bacterial Cell Division; | D23_1c1056 | Neut_1137 |
| specificity factor MinE | <br>Bacterial | |||||||||
| Cytoskeleton; | ||||||||||
| <br>Bacterial cell | ||||||||||
| division cluster; | ||||||||||
| <br>Septum site- | ||||||||||
| determining cluster Min | ||||||||||
| fig|6666666.60966.peg.1045 | CDS | 968284 | 968895 | 1 | + | 612 | Outer membrane | A Gammaproteobacteria | D23_1c1057 | Neut_1138 |
| lipoprotein LolB | Cluster Relating to | |||||||||
| Translation; | ||||||||||
| <br>Lipopolysaccharide | ||||||||||
| assembly; | ||||||||||
| <br>Lipoprotein sorting | ||||||||||
| system | ||||||||||
| fig|6666666.60966.peg.1046 | CDS | 968920 | 969756 | 1 | + | 837 | 4-diphosphocytidyl-2-C- | A Gammaproteobacteria | D23_1c1058 | Neut_1139 |
| methyl-D-erythritol | Cluster Relating to | |||||||||
| kinase (EC 2.7.1.148) | Translation; | |||||||||
| <br>Isoprenoid | ||||||||||
| Biosynthesis; | ||||||||||
| <br>Nonmevalonate | ||||||||||
| Branch of Isoprenoid | ||||||||||
| Biosynthesis | ||||||||||
| fig|6666666.60966.peg.1047 | CDS | 969932 | 970882 | 2 | + | 951 | Ribose-phosphate | A Gammaproteobacteria | D23_1c1060 | Neut_1140 |
| pyrophosphokinase (EC | Cluster Relating to | |||||||||
| 2.7.6.1) | Translation; <br>De | |||||||||
| Novo Purine | ||||||||||
| Biosynthesis; | ||||||||||
| <br>Pentose phosphate | ||||||||||
| pathway; | ||||||||||
| <br>Transcription repair | ||||||||||
| cluster | ||||||||||
| fig|6666666.60966.peg.1048 | CDS | 970936 | 971544 | 1 | + | 609 | LSU ribosomal protein | Transcription repair | D23_1c1061 | Neut_1141 |
| L25p | cluster | |||||||||
| fig|6666666.60966.peg.1049 | CDS | 971667 | 972236 | 3 | + | 570 | Peptidyl-tRNA | Sporulation-associated | D23_1c1062 | Neut_1142 |
| hydrolase (EC 3.1.1.29) | proteins with broader | |||||||||
| functions; | ||||||||||
| <br>Transcription repair | ||||||||||
| cluster; <br>Translation | ||||||||||
| termination factors | ||||||||||
| bacterial | ||||||||||
| fig|6666666.60966.peg.1050 | CDS | 972291 | 973382 | 3 | + | 1092 | GTP-binding and nucleic | Universal GTPases | D23_1c1063 | Neut_1143 |
| acid-binding protein | ||||||||||
| YchF | ||||||||||
| fig|6666666.60966.peg.1051 | CDS | 973589 | 973461 | −2 | − | 129 | hypothetical protein | -none- | D23_1c1064 | NA |
| fig|6666666.60966.peg.1052 | CDS | 973891 | 975303 | 1 | + | 1413 | 3-isopropylmalate | Branched-Chain Amino | D23_1c1066 | Neut_1144 |
| dehydratase large | Acid Biosynthesis; | |||||||||
| subunit (EC 4.2.1.33) | <br>Leucine | |||||||||
| Biosynthesis | ||||||||||
| fig|6666666.60966.peg.1053 | CDS | 975336 | 975464 | 3 | + | 129 | FIG00858504: | -none- | D23_1c1067 | Neut_1145 |
| hypothetical protein | ||||||||||
| fig|6666666.60966.peg.1054 | CDS | 975470 | 976108 | 2 | + | 639 | 3-isopropylmalate | Branched-Chain Amino | D23_1c1068 | Neut_1146 |
| dehydratase small | Acid Biosynthesis; | |||||||||
| subunit (EC 4.2.1.33) | <br>Leucine | |||||||||
| Biosynthesis | ||||||||||
| fig|6666666.60966.peg.1055 | CDS | 976133 | 977203 | 2 | + | 1071 | 3-isopropylmalate | Branched-Chain Amino | D23_1c1069 | Neut_1147 |
| dehydrogenase (EC | Acid Biosynthesis; | |||||||||
| 1.1.1.85) | <br>Leucine | |||||||||
| Biosynthesis | ||||||||||
| fig|6666666.60966.peg.1056 | CDS | 977333 | 978457 | 2 | + | 1125 | Aspartate- | Lysine Biosynthesis DAP | D23_1c1070 | Neut_1148 |
| semialdehyde | Pathway, GJO scratch; | |||||||||
| dehydrogenase (EC | <br>Threonine and | |||||||||
| 1.2.1.11) | Homoserine | |||||||||
| Biosynthesis | ||||||||||
| fig|6666666.60966.peg.1057 | CDS | 978574 | 980970 | 1 | + | 2397 | hypothetical protein | -none- | D23_1c1071 | Neut_1149 |
| fig|6666666.60966.peg.1058 | CDS | 981084 | 981917 | 3 | + | 834 | tRNA pseudouridine | Colicin V and Bacteriocin | D23_1c1072 | Neut_1150 |
| synthase A (EC 4.2.1.70) | Production Cluster; | |||||||||
| <br>RNA pseudouridine | ||||||||||
| syntheses; <br>tRNA | ||||||||||
| modification Bacteria; | ||||||||||
| <br>tRNA processing | ||||||||||
| fig|6666666.60966.peg.1059 | CDS | 981929 | 982555 | 2 | + | 627 | Phosphoribosylanthranilate | Auxin biosynthesis; | D23_1c1073 | Neut_1151 |
| isomerase (EC | <br>Chorismate: | |||||||||
| 5.3.1.24) | Intermediate for | |||||||||
| synthesis of Tryptophan, | ||||||||||
| PAPA antibiotics, PABA, | ||||||||||
| 3-hydroxyanthranilate | ||||||||||
| and more.; | ||||||||||
| <br>Tryptophan | ||||||||||
| synthesis | ||||||||||
| fig|6666666.60966.peg.1060 | CDS | 982542 | 983741 | 3 | + | 1200 | Tryptophan synthase | Auxin biosynthesis; | D23_1c1074 | Neut_1152 |
| beta chain (EC 4.2.1.20) | <br>Chorismate: | |||||||||
| Intermediate for | ||||||||||
| synthesis of Tryptophan, | ||||||||||
| PAPA antibiotics, PABA, | ||||||||||
| 3-hydroxyanthranilate | ||||||||||
| and more.; | ||||||||||
| <br>Tryptophan | ||||||||||
| synthesis | ||||||||||
| fig|6666666.60966.peg.1061 | CDS | 983794 | 984618 | 1 | + | 825 | Tryptophan synthase | Auxin biosynthesis; | D23_1c1075 | Neut_1153 |
| alpha chain (EC | <br>Chorismate: | |||||||||
| 4.2.1.20) | Intermediate for | |||||||||
| synthesis of Tryptophan, | ||||||||||
| PAPA antibiotics, PABA, | ||||||||||
| 3-hydroxyanthranilate | ||||||||||
| and more.; | ||||||||||
| <br>Tryptophan | ||||||||||
| synthesis | ||||||||||
| fig|6666666.60966.peg.1062 | CDS | 984623 | 985513 | 2 | + | 891 | Acetyl-coenzyme A | Colicin V and Bacteriocin | D23_1c1076 | Neut_1154 |
| carboxyl transferase | Production Cluster; | |||||||||
| beta chain (EC 6.4.1.2) | <br>Fatty Acid | |||||||||
| Biosynthesis FASII | ||||||||||
| fig|6666666.60966.peg.1063 | CDS | 985642 | 986925 | 1 | + | 1284 | Dihydrofolate synthase | Colicin V and Bacteriocin | D23_1c1077 | Neut_1155 |
| (EC 6.3.2.12)/ | Production Cluster; | |||||||||
| Folylpolyglutamate | <br>Colicin V and | |||||||||
| synthase (EC 6.3.2.17) | Bacteriocin Production | |||||||||
| Cluster; <br>Folate | ||||||||||
| Biosynthesis; <br>Folate | ||||||||||
| Biosynthesis | ||||||||||
| fig|6666666.60966.peg.1064 | CDS | 986945 | 987616 | 2 | + | 672 | DedD protein | Colicin V and Bacteriocin | D23_1c1078 | Neut_1156 |
| Production Cluster | ||||||||||
| fig|6666666.60966.peg.1065 | CDS | 987613 | 988107 | 1 | + | 495 | Colicin V production | Colicin V and Bacteriocin | D23_1c1079 | Neut_1157 |
| protein | Production Cluster | |||||||||
| fig|6666666.60966.peg.1066 | CDS | 988214 | 989731 | 2 | + | 1518 | Amidophosphoribosyltransferase | Colicin V and Bacteriocin | D23_1c1080 | Neut_1158 |
| (EC 2.4.2.14) | Production Cluster; | |||||||||
| <br>De Novo Purine | ||||||||||
| Biosynthesis | ||||||||||
| fig|6666666.60966.peg.1067 | CDS | 989748 | 990923 | 3 | + | 1176 | O-acetylhomoserine | Methionine | D23_1c1081 | Neut_1159 |
| sulfhydrylase (EC | Biosynthesis; | |||||||||
| 2.5.1.49)/O- | <br>Methionine | |||||||||
| succinylhomoserine | Biosynthesis | |||||||||
| sulfhydrylase (EC | ||||||||||
| 2.5.1.48) | ||||||||||
| fig|6666666.60966.peg.1068 | CDS | 991043 | 992554 | 2 | + | 1512 | Threonine dehydratase | Branched-Chain Amino | D23_1c1082 | Neut_1160 |
| biosynthetic (EC | Acid Biosynthesis | |||||||||
| 4.3.1.19) | ||||||||||
| fig|6666666.60966.peg.1069 | CDS | 992670 | 992536 | −3 | − | 135 | hypothetical protein | -none- | D23_1c1083 | NA |
| fig|6666666.60966.peg.1070 | CDS | 993016 | 994950 | 1 | + | 1935 | twitching motility | -none- | D23_1c1084 | Neut_1161 |
| protein PilJ | ||||||||||
| fig|6666666.60966.peg.1071 | CDS | 995179 | 995054 | −1 | − | 126 | hypothetical protein | -none- | D23_1c1085 | Neut_1162 |
| fig|6666666.60966.peg.1072 | CDS | 995174 | 1000177 | 2 | + | 5004 | Signal transduction | Flagellar motility | D23_1c1085 | Neut_1162 |
| histidine kinase CheA | ||||||||||
| (EC 2.7.3.—) | ||||||||||
| fig|6666666.60966.peg.1073 | CDS | 1000248 | 1002095 | 3 | + | 1848 | ParB-like nuclease | -none- | D23_1c1086 | Neut_1163 |
| domain | ||||||||||
| fig|6666666.60966.peg.1074 | CDS | 1003717 | 1002203 | −1 | − | 1515 | Ubiquinone | Ubiquinone | D23_1c1087 | Neut_1164 |
| biosynthesis | Biosynthesis; | |||||||||
| monooxygenase UbiB | <br>Ubiquinone | |||||||||
| Biosynthesis-gjo | ||||||||||
| fig|6666666.60966.peg.1075 | CDS | 1004439 | 1003807 | −3 | − | 633 | Protein YigP (COG3165) | Ubiquinone | D23_1c1088 | Neut_1165 |
| clustered with | Biosynthesis; | |||||||||
| ubiquinone biosynthetic | <br>Ubiquinone | |||||||||
| genes | Biosynthesis-gjo | |||||||||
| fig|6666666.60966.peg.1076 | CDS | 1004959 | 1004528 | −1 | − | 432 | FIG00858586: | -none- | D23_1c1089 | Neut_1166 |
| hypothetical protein | ||||||||||
| fig|6666666.60966.peg.1077 | CDS | 1005165 | 1004962 | −3 | − | 204 | hypothetical protein | -none- | D23_1c1090 | NA |
| fig|6666666.60966.peg.1078 | CDS | 1005185 | 1007323 | 2 | + | 2139 | Signal transduction | Flagellar motility | D23_1c1091 | Neut_1167 |
| histidine kinase CheA | ||||||||||
| (EC 2.7.3.—) | ||||||||||
| fig|6666666.60966.peg.1079 | CDS | 1007395 | 1007916 | 1 | + | 522 | Positive regulator of | -none- | D23_1c1092 | Neut_1168 |
| CheA protein activity | ||||||||||
| (CheW) | ||||||||||
| fig|6666666.60966.peg.1080 | CDS | 1008003 | 1010258 | 3 | + | 2256 | Methyl-accepting | -none- | D23_1c1093 | Neut_1169 |
| chemotaxis protein I | ||||||||||
| (serine chemoreceptor | ||||||||||
| protein) | ||||||||||
| fig|6666666.60966.peg.1082 | CDS | 1010399 | 1012744 | 2 | + | 2346 | Methyl-accepting | -none- | D23_1c1094 | Neut_1170 |
| chemotaxis protein I | ||||||||||
| (serine chemoreceptor | ||||||||||
| protein) | ||||||||||
| fig|6666666.60966.peg.1083 | CDS | 1012932 | 1013807 | 3 | + | 876 | Chemotaxis protein | -none- | D23_1c1095 | Neut_1171 |
| methyltransferase CheR | ||||||||||
| (EC 2.1.1.80) | ||||||||||
| fig|6666666.60966.peg.1084 | CDS | 1013887 | 1014471 | 1 | + | 585 | Chemotaxis protein | -none- | D23_1c1096 | Neut_1172 |
| CheD | ||||||||||
| fig|6666666.60966.peg.1085 | CDS | 1014502 | 1015569 | 1 | + | 1068 | Chemotaxis response | -none- | D23_1c1097 | Neut_1173 |
| regulator protein- | ||||||||||
| glutamate | ||||||||||
| methylesterase CheB | ||||||||||
| (EC 3.1.1.61) | ||||||||||
| fig|6666666.60966.peg.1087 | CDS | 1017858 | 1016338 | −3 | − | 1521 | Ferredoxin reductase | Anaerobic respiratory | D23_1c1099 | Neut_1175 |
| reductases | ||||||||||
| fig|6666666.60966.peg.1088 | CDS | 1018141 | 1019145 | 1 | + | 1005 | Fructose-1,6- | Calvin-Benson cycle; | D23_1c1100 | Neut_1176 |
| bisphosphatase, type I | <br>Glycolysis and | |||||||||
| (EC 3.1.3.11) | Gluconeogenesis | |||||||||
| fig|6666666.60966.peg.1089 | CDS | 1020142 | 1019183 | −1 | − | 960 | Glutathione S- | Glutathione: Non-redox | D23_1c1101 | Neut_1177 |
| transferase, omega (EC | reactions | |||||||||
| 2.5.1.18) | ||||||||||
| fig|6666666.60966.peg.1090 | CDS | 1020604 | 1020146 | −1 | − | 459 | Membrane protein, | -none- | D23_1c1102 | Neut_1178 |
| distant similarity to | ||||||||||
| thiosulphate:quinone | ||||||||||
| oxidoreductase DoxD | ||||||||||
| fig|6666666.60966.peg.1091 | CDS | 1020710 | 1020862 | 2 | + | 153 | hypothetical protein | -none- | D23_1c1103 | NA |
| fig|6666666.60966.peg.1092 | CDS | 1022088 | 1021138 | −3 | − | 951 | COGs COG0726 | -none- | D23_1c1104 | Neut_1179 |
| fig|6666666.60966.peg.1093 | CDS | 1022664 | 1022212 | −3 | − | 453 | Phosphohistidine | -none- | D23_1c1105 | Neut_1180 |
| phosphatase SixA | ||||||||||
| fig|6666666.60966.peg.1094 | CDS | 1023442 | 1022753 | −1 | − | 690 | COGs COG1814 | -none- | D23_1c1106 | Neut_1181 |
| fig|6666666.60966.peg.1095 | CDS | 1024149 | 1023445 | −3 | − | 705 | probable | -none- | D23_1c1107 | Neut_1182 |
| carboxylesterase | ||||||||||
| fig|6666666.60966.peg.1096 | CDS | 1024228 | 1025334 | 1 | + | 1107 | InterPro IPR002931 | -none- | D23_1c1108 | Neut_1183 |
| COGs COG1305 | ||||||||||
| fig|6666666.60966.peg.1097 | CDS | 1027262 | 1025541 | −2 | − | 1722 | Sulfite reductase | Cysteine Biosynthesis; | D23_1c1109 | Neut_1184 |
| [NADPH] hemoprotein | <br>Inorganic Sulfur | |||||||||
| beta-component (EC | Assimilation | |||||||||
| 1.8.1.2) | ||||||||||
| fig|6666666.60966.peg.1098 | CDS | 1029106 | 1027271 | −1 | − | 1836 | Sulfite reductase | Cysteine Biosynthesis; | D23_1c1110 | Neut_1185 |
| [NADPH] flavoprotein | <br>Inorganic Sulfur | |||||||||
| alpha-component (EC | Assimilation | |||||||||
| 1.8.1.2) | ||||||||||
| fig|6666666.60966.peg.1100 | CDS | 1030580 | 1029651 | −2 | − | 930 | Cys regulon | Cysteine Biosynthesis; | D23_1c1111 | Neut_1186 |
| transcriptional activator | <br>LysR-family proteins | |||||||||
| CysB | in Escherichia coli | |||||||||
| fig|6666666.60966.peg.1101 | CDS | 1030815 | 1031513 | 3 | + | 699 | Phosphoadenylyl- | Cysteine Biosynthesis; | D23_1c1112 | Neut_1187 |
| sulfate reductase | <br>Inorganic Sulfur | |||||||||
| [thioredoxin] (EC | Assimilation; | |||||||||
| 1.8.4.8)/Adenylyl- | <br>Inorganic Sulfur | |||||||||
| sulfate reductase | Assimilation | |||||||||
| [thioredoxin] (EC | ||||||||||
| 1.8.4.10) | ||||||||||
| fig|6666666.60966.peg.1102 | CDS | 1031599 | 1032447 | 1 | + | 849 | Sulfate | Cysteine Biosynthesis; | D23_1c1113 | Neut_1188 |
| adenylyltransferase | <br>Inorganic Sulfur | |||||||||
| subunit 2 (EC 2.7.7.4) | Assimilation | |||||||||
| fig|6666666.60966.peg.1103 | CDS | 1032508 | 1033791 | 1 | + | 1284 | Sulfate | Cysteine Biosynthesis; | D23_1c1114 | Neut_1189 |
| adenylyltransferase | <br>Inorganic Sulfur | |||||||||
| subunit 1 (EC 2.7.7.4) | Assimilation | |||||||||
| fig|6666666.60966.peg.1105 | CDS | 1033967 | 1037446 | 2 | + | 3480 | Glutamate synthase | Ammonia assimilation; | D23_1c1115 | Neut_1190 |
| [NADPH] small chain | <br>Glutamine, | |||||||||
| (EC 1.4.1.13) | Glutamate, Aspartate | |||||||||
| and Asparagine | ||||||||||
| Biosynthesis | ||||||||||
| fig|6666666.60966.peg.1106 | CDS | 1037596 | 1038723 | 1 | + | 1128 | NAD(P) | Phosphate metabolism | D23_1c1116 | Neut_1191 |
| transhydrogenase alpha | ||||||||||
| subunit (EC 1.6.1.2) | ||||||||||
| fig|6666666.60966.peg.1107 | CDS | 1038778 | 1039086 | 1 | + | 309 | NAD(P) | Phosphate metabolism | D23_1c1117 | Neut_1192 |
| transhydrogenase alpha | ||||||||||
| subunit (EC 1.6.1.2) | ||||||||||
| fig|6666666.60966.peg.1108 | CDS | 1039087 | 1040466 | 1 | + | 1380 | NAD(P) | Phosphate metabolism | D23_1c1118 | Neut_1193 |
| transhydrogenase | ||||||||||
| subunit beta (EC | ||||||||||
| 1.6.1.2) | ||||||||||
| fig|6666666.60966.peg.1109 | CDS | 1041147 | 1040488 | −3 | − | 660 | FIG00858826: | -none- | D23_1c1119 | Neut_1194 |
| hypothetical protein | ||||||||||
| fig|6666666.60966.peg.1110 | CDS | 1042046 | 1041582 | −2 | − | 465 | Bacterioferritin | -none- | D23_1c1120 | Neut_1195 |
| fig|6666666.60966.peg.1112 | CDS | 1043119 | 1043253 | 1 | + | 135 | hypothetical protein | -none- | D23_1c1121 | NA |
| fig|6666666.60966.peg.1113 | CDS | 1043368 | 1043511 | 1 | + | 144 | hypothetical protein | -none- | D23_1c1122 | NA |
| fig|6666666.60966.peg.1115 | CDS | 1043900 | 1043736 | −2 | − | 165 | hypothetical protein | -none- | D23_1c1123 | NA |
| fig|6666666.60966.peg.1116 | CDS | 1043900 | 1044847 | 2 | + | 948 | 2,3- | -none- | D23_1c1124 | Neut_1198 |
| bisphosphoglycerate- | ||||||||||
| independent | ||||||||||
| phosphoglycerate | ||||||||||
| mutase | ||||||||||
| fig|6666666.60966.peg.1117 | CDS | 1044958 | 1045530 | 1 | + | 573 | InterPro | -none- | D23_1c1125 | Neut_1199 |
| IPR000014:IPR001633 | ||||||||||
| COGs COG2200 | ||||||||||
| fig|6666666.60966.peg.1118 | CDS | 1045566 | 1045859 | 3 | + | 294 | Mobile element protein | -none- | D23_1c1126 | Neut_1719 |
| fig|6666666.60966.peg.1119 | CDS | 1045958 | 1046836 | 2 | + | 879 | Mobile element protein | -none- | D23_1c1127 | Neut_1720 |
| fig|6666666.60966.peg.1120 | CDS | 1046891 | 1047784 | 2 | + | 894 | InterPro | -none- | D23_1c1128 | Neut_1199 |
| IPR000014:IPR001633 | ||||||||||
| COGs COG2200 | ||||||||||
| fig|6666666.60966.peg.1121 | CDS | 1048688 | 1047801 | −2 | − | 888 | Phosphoribosylaminoimidazole- | De Novo Purine | D23_1c1129 | Neut_1200 |
| succinocarboxamide | Biosynthesis | |||||||||
| synthase (EC 6.3.2.6) | ||||||||||
| fig|6666666.60966.peg.1122 | CDS | 1049856 | 1048726 | −3 | − | 1131 | Phosphoribosylaminoimidazole | De Novo Purine | D23_1c1130 | Neut_1201 |
| carboxylase | Biosynthesis | |||||||||
| ATPase subunit (EC | ||||||||||
| 4.1.1.21) | ||||||||||
| fig|6666666.60966.peg.1123 | CDS | 1050317 | 1049847 | −2 | − | 471 | Phosphoribosylaminoimidazole | De Novo Purine | D23_1c1131 | Neut_1202 |
| carboxylase | Biosynthesis | |||||||||
| catalytic subunit (EC | ||||||||||
| 4.1.1.21) | ||||||||||
| fig|6666666.60966.peg.1124 | CDS | 1050521 | 1050955 | 2 | + | 435 | Biopolymer transport | Ton and Tol transport | D23_1c1133 | Neut_1203 |
| protein ExbD/TolR | systems | |||||||||
| fig|6666666.60966.peg.1125 | CDS | 1050942 | 1051664 | 3 | + | 723 | Superoxide dismutase | Oxidative stress; | D23_1c1134 | Neut_1204 |
| [Fe] (EC 1.15.1.1) | <br>Protection from | |||||||||
| Reactive Oxygen Species | ||||||||||
| fig|6666666.60966.peg.1126 | CDS | 1051674 | 1052324 | 3 | + | 651 | ATP | Histidine Biosynthesis; | D23_1c1135 | Neut_1205 |
| phosphoribosyltransferase | <br>Riboflavin synthesis | |||||||||
| (EC 2.4.2.17) | cluster | |||||||||
| fig|6666666.60966.peg.1127 | CDS | 1052409 | 1053644 | 3 | + | 1236 | Histidinol | Histidine Biosynthesis | D23_1c1136 | Neut_1206 |
| dehydrogenase (EC | ||||||||||
| 1.1.1.23) | ||||||||||
| fig|6666666.60966.peg.1128 | CDS | 1053708 | 1054883 | 3 | + | 1176 | 2-octaprenyl-6- | CBSS-87626.3.peg.3639; | D23_1c1137 | Neut_1207 |
| methoxyphenol | <br>Ubiquinone | |||||||||
| hydroxylase (EC | Biosynthesis; | |||||||||
| 1.14.13.—) | <br>Ubiquinone | |||||||||
| Biosynthesis-gjo | ||||||||||
| fig|6666666.60966.peg.1129 | CDS | 1055047 | 1056060 | 1 | + | 1014 | tRNA dihydrouridine | Possible RNA | D23_1c1138 | Neut_1208 |
| synthase B (EC 1.—.—.—) | degradation cluster; | |||||||||
| <br>tRNA modification | ||||||||||
| Bacteria | ||||||||||
| fig|6666666.60966.peg.1130 | CDS | 1056057 | 1056299 | 3 | + | 243 | DNA-binding protein Fis | DNA structural proteins, | D23_1c1139 | Neut_1209 |
| bacterial | ||||||||||
| fig|6666666.60966.peg.1131 | CDS | 1056309 | 1057871 | 3 | + | 1563 | IMP cyclohydrolase (EC | 5-FCL-like protein; | D23_1c1140 | Neut_1210 |
| 3.5.4.10)/ | <br>De Novo Purine | |||||||||
| Phosphoribosylaminoimidazolecarboxamide | Biosynthesis; <br>De | |||||||||
| formyltransferase (EC | Novo Purine | |||||||||
| 2.1.2.3) | Biosynthesis | |||||||||
| fig|6666666.60966.peg.1132 | CDS | 1057947 | 1059233 | 3 | + | 1287 | Phosphoribosylamine- | De Novo Purine | D23_1c1141 | Neut_1211 |
| glycine ligase (EC | Biosynthesis | |||||||||
| 6.3.4.13) | ||||||||||
| fig|6666666.60966.peg.1133 | CDS | 1059226 | 1060497 | 1 | + | 1272 | FIG00858582: | -none- | D23_1c1142 | Neut_1213 |
| hypothetical protein | ||||||||||
| fig|6666666.60966.peg.1134 | CDS | 1061025 | 1060582 | −3 | − | 444 | TPR repeat precursor | -none- | D23_1c1143 | Neut_1214 |
| fig|6666666.60966.peg.1135 | CDS | 1061496 | 1061041 | −3 | − | 456 | Mobile element protein | -none- | D23_1c1144 | Neut_2502 |
| fig|6666666.60966.peg.1136 | CDS | 1061839 | 1061459 | −1 | − | 381 | Mobile element protein | -none- | D23_1c1145 | Neut_0884 |
| fig|6666666.60966.peg.1137 | CDS | 1062885 | 1061836 | −3 | − | 1050 | TPR repeat precursor | -none- | D23_1c1146 | Neut_0701 |
| fig|6666666.60966.peg.1138 | CDS | 1064906 | 1062960 | −2 | − | 1947 | DinG family ATP- | DNA repair, bacterial | D23_1c1148 | Neut_1215 |
| dependent helicase | DinG and relatives | |||||||||
| YoaA | ||||||||||
| fig|6666666.60966.peg.1139 | CDS | 1065051 | 1064932 | −3 | − | 120 | hypothetical protein | -none- | D23_1c1149 | NA |
| fig|6666666.60966.peg.1140 | CDS | 1065126 | 1067303 | 3 | + | 2178 | Outer membrane | EC49-61; <br>ECSIG4- | D23_1c1150 | Neut_1216 |
| protein Imp, required | SIG7; | |||||||||
| for envelope biogenesis/ | <br>Lipopolysaccharide | |||||||||
| Organic solvent | assembly | |||||||||
| tolerance protein | ||||||||||
| precursor | ||||||||||
| fig|6666666.60966.peg.1141 | CDS | 1067300 | 1068643 | 2 | + | 1344 | Survival protein SurA | EC49-61; <br>ECSIG4- | D23_1c1151 | Neut_1217 |
| precursor (Peptidyl- | SIG7; | |||||||||
| prolyl cis-trans | <br>Lipopolysaccharide | |||||||||
| isomerase SurA) (EC | assembly; <br>Peptidyl- | |||||||||
| 5.2.1.8) | prolyl cis-trans | |||||||||
| isomerase; | ||||||||||
| <br>Periplasmic Stress | ||||||||||
| Response | ||||||||||
| fig|6666666.60966.peg.1142 | CDS | 1068713 | 1069750 | 2 | + | 1038 | 4-hydroxythreonine-4- | EC49-61; <br>ECSIG4- | D23_1c1152 | Neut_1218 |
| phosphate | SIG7; <br>Pyridoxin | |||||||||
| dehydrogenase (EC | (Vitamin B6) | |||||||||
| 1.1.1.262) | Biosynthesis | |||||||||
| fig|6666666.60966.peg.1143 | CDS | 1069754 | 1070524 | 2 | + | 771 | SSU rRNA | EC49-61; <br>ECSIG4- | D23_1c1153 | Neut_1219 |
| (adenine(1518)- | SIG7; <br>RNA | |||||||||
| N(6)/adenine(1519)- | methylation; | |||||||||
| N(6))- | <br>Ribosome | |||||||||
| dimethyltransferase (EC | biogenesis bacterial | |||||||||
| 2.1.1.182) ## SSU rRNA | ||||||||||
| m6,m6-A1518-1519 | ||||||||||
| fig|6666666.60966.peg.1144 | CDS | 1071020 | 1070517 | −2 | − | 504 | Methylated-DNA-- | DNA repair, bacterial | D23_1c1154 | Neut_1220 |
| protein-cysteine | ||||||||||
| methyltransferase (EC | ||||||||||
| 2.1.1.63) | ||||||||||
| fig|6666666.60966.peg.1145 | CDS | 1071346 | 1071080 | −1 | − | 267 | ADA regulatory protein/ | DNA repair, bacterial; | D23_1c1155 | Neut_1221 |
| Methylated-DNA-- | <br>DNA repair, | |||||||||
| protein-cysteine | bacterial | |||||||||
| methyltransferase (EC | ||||||||||
| 2.1.1.63) | ||||||||||
| fig|6666666.60966.peg.1146 | CDS | 1072448 | 1071324 | −2 | − | 1125 | ADA regulatory protein/ | DNA repair, bacterial; | D23_1c1156 | Neut_1221 |
| Methylated-DNA-- | <br>DNA repair, | |||||||||
| protein-cysteine | bacterial | |||||||||
| methyltransferase (EC | ||||||||||
| 2.1.1.63) | ||||||||||
| fig|6666666.60966.peg.1149 | CDS | 1073291 | 1073809 | 2 | + | 519 | Helix-turn-helix motif | -none- | D23_1c1157 | Neut_1223 |
| fig|6666666.60966.peg.1150 | CDS | 1075783 | 1074353 | −1 | − | 1431 | Siroheme synthase/ | Heme and Siroheme | D23_1c1159 | Neut_1002 |
| Precorrin-2 oxidase (EC | Biosynthesis; <br>Heme | |||||||||
| 1.3.1.76)/ | and Siroheme | |||||||||
| Sirohydrochlorin | Biosynthesis; <br>Heme | |||||||||
| ferrochelatase (EC | and Siroheme | |||||||||
| 4.99.1.4)/ | Biosynthesis | |||||||||
| Uroporphyrinogen-III | ||||||||||
| methyltransferase (EC | ||||||||||
| 2.1.1.107) | ||||||||||
| fig|6666666.60966.peg.1151 | CDS | 1076939 | 1075926 | −2 | − | 1014 | Phosphate ABC | High affinity phosphate | D23_1c1160 | Neut_1001 |
| transporter, periplasmic | transporter and control | |||||||||
| phosphate-binding | of PHO regulon; | |||||||||
| protein PstS (TC | <br>PhoR-PhoB two- | |||||||||
| 3.A.1.7.1) | component regulatory | |||||||||
| system; <br>Phosphate | ||||||||||
| metabolism | ||||||||||
| fig|6666666.60966.peg.1152 | CDS | 1078435 | 1077059 | −1 | − | 1377 | Phosphoglucosamine | Sialic Acid Metabolism; | D23_1c1161 | Neut_1000 |
| mutase (EC 5.4.2.10) | <br>UDP-N- | |||||||||
| acetylmuramate from | ||||||||||
| Fructose-6-phosphate | ||||||||||
| Biosynthesis | ||||||||||
| fig|6666666.60966.peg.1153 | CDS | 1079505 | 1078603 | −3 | − | 903 | Dihydropteroate | Folate Biosynthesis | D23_1c1162 | Neut_0999 |
| synthase (EC 2.5.1.15) | ||||||||||
| fig|6666666.60966.peg.1154 | CDS | 1081457 | 1079529 | −2 | − | 1929 | Cell division protein | Bacterial Cell Division | D23_1c1163 | Neut_0998 |
| FtsH (EC 3.4.24.—) | ||||||||||
| fig|6666666.60966.peg.1155 | CDS | 1082161 | 1081541 | −1 | − | 621 | Cell division protein FtsJ/ | Bacterial Cell Division; | D23_1c1164 | Neut_0997 |
| Ribosomal RNA large | <br>RNA methylation | |||||||||
| subunit | ||||||||||
| methyltransferase E (EC | ||||||||||
| 2.1.1.—) ## LSU rRNA | ||||||||||
| Um2552 | ||||||||||
| fig|6666666.60966.peg.1156 | CDS | 1082195 | 1082575 | 2 | + | 381 | FIG004454: RNA | -none- | D23_1c1165 | Neut_0996 |
| binding protein | ||||||||||
| fig|6666666.60966.peg.1157 | CDS | 1082674 | 1083084 | 1 | + | 411 | CBS domain | -none- | D23_1c1166 | Neut_0995 |
| fig|6666666.60966.peg.1158 | CDS | 1083081 | 1083464 | 3 | + | 384 | tRNA | A cluster relating to | D23_1c1167 | Neut_0994 |
| nucleotidyltransferase, | Tryptophanyl-tRNA | |||||||||
| A-adding (EC 2.7.7.25) | synthetase; | |||||||||
| <br>Polyadenylation | ||||||||||
| bacterial; <br>tRNA | ||||||||||
| nucleotidyltransferase | ||||||||||
| fig|6666666.60966.peg.1159 | CDS | 1084218 | 1083646 | −3 | − | 573 | DNA-3-methyladenine | DNA Repair Base | D23_1c1168 | Neut_0993 |
| glycosylase II (EC | Excision | |||||||||
| 3.2.2.21) | ||||||||||
| fig|6666666.60966.peg.1160 | CDS | 1084717 | 1084241 | −1 | − | 477 | Glutathione peroxidase | Glutathione: Redox cycle | D23_1c1169 | Neut_0992 |
| (EC 1.11.1.9) | ||||||||||
| fig|6666666.60966.peg.1161 | CDS | 1084748 | 1085341 | 2 | + | 594 | Carbonic anhydrase, | Zinc regulated enzymes | D23_1c1170 | Neut_0991 |
| gamma class (EC | ||||||||||
| 4.2.1.1) | ||||||||||
| fig|6666666.60966.peg.1162 | CDS | 1085402 | 1086241 | 2 | + | 840 | Putative NAD(P)- | -none- | D23_1c1171 | Neut_0990 |
| dependent | ||||||||||
| oxidoreductase EC- | ||||||||||
| YbbO | ||||||||||
| fig|6666666.60966.peg.1163 | CDS | 1086401 | 1087885 | 2 | + | 1485 | alpha amylase, catalytic | -none- | D23_1c1172 | Neut_0989 |
| region | ||||||||||
| fig|6666666.60966.peg.1164 | CDS | 1090985 | 1087899 | −2 | − | 3087 | RND multidrug efflux | Multidrug Resistance | D23_1c1173 | Neut_0988 |
| transporter; Acriflavin | Efflux Pumps | |||||||||
| resistance protein | ||||||||||
| fig|6666666.60966.peg.1165 | CDS | 1092079 | 1090982 | −1 | − | 1098 | Membrane fusion | Multidrug Resistance | D23_1c1174 | Neut_0987 |
| protein of RND family | Efflux Pumps | |||||||||
| multidrug efflux pump | ||||||||||
| fig|6666666.60966.peg.1168 | CDS | 1092982 | 1092851 | −1 | − | 132 | hypothetical protein | -none- | D23_1c1175 | NA |
| fig|6666666.60966.peg.1169 | CDS | 1094042 | 1093413 | −2 | − | 630 | Nicotinamidase family | NAD and NADP cofactor | D23_1c1176 | NA |
| protein YcaC | biosynthesis global | |||||||||
| fig|6666666.60966.peg.1170 | CDS | 1094408 | 1094223 | −2 | − | 186 | Mobile element protein | -none- | D23_1c1178 | Neut_1984 |
| fig|6666666.60966.peg.1171 | CDS | 1094750 | 1094514 | −2 | − | 237 | Mobile element protein | -none- | D23_1c1179 | Neut_1353 |
| fig|6666666.60966.peg.1172 | CDS | 1095334 | 1094984 | −1 | − | 351 | hypothetical protein | -none- | D23_1c1180 | NA |
| fig|6666666.60966.peg.1173 | CDS | 1095854 | 1095486 | −2 | − | 369 | Mobile element protein | -none- | D23_1c1181 | Neut_2502 |
| fig|6666666.60966.peg.1175 | CDS | 1096049 | 1095933 | −2 | − | 117 | Mobile element protein | -none- | D23_1c1182 | Neut_0884 |
| fig|6666666.60966.peg.1176 | CDS | 1096623 | 1096288 | −3 | − | 336 | putative (AJ245540) | -none- | D23_1c1183 | Neut_1054 |
| NrfJ [Wolinella | ||||||||||
| succinogenes] | ||||||||||
| fig|6666666.60966.peg.1177 | CDS | 1098408 | 1096669 | −3 | − | 1740 | FIG00859793: | -none- | D23_1c1184 | Neut_1053 |
| hypothetical protein | ||||||||||
| fig|6666666.60966.peg.1178 | CDS | 1098651 | 1100255 | 3 | + | 1605 | Multicopper oxidase | Copper homeostasis | D23_1c1185 | Neut_1052 |
| fig|6666666.60966.peg.1179 | CDS | 1101152 | 1100349 | −2 | − | 804 | Inositol-1- | -none- | D23_1c1186 | Neut_1051 |
| monophosphatase (EC | ||||||||||
| 3.1.3.25) | ||||||||||
| fig|6666666.60966.peg.1180 | CDS | 1101712 | 1101155 | −1 | − | 558 | Alkyl hydroperoxide | -none- | D23_1c1187 | Neut_1050 |
| reductase and/or thiol- | ||||||||||
| specific antioxidant | ||||||||||
| family (AhpC/TSA) | ||||||||||
| protein | ||||||||||
| fig|6666666.60966.peg.1181 | CDS | 1101810 | 1102571 | 3 | + | 762 | Ribosomal RNA small | Heat shock dnaK gene | D23_1c1188 | Neut_1049 |
| subunit | cluster extended; | |||||||||
| methyltransferase E (EC | <br>RNA methylation | |||||||||
| 2.1.1.—) | ||||||||||
| fig|6666666.60966.peg.1182 | CDS | 1102595 | 1103929 | 2 | + | 1335 | N-acetylglutamate | Arginine Biosynthesis-- | D23_1c1189 | Neut_1048 |
| synthase (EC 2.3.1.1) | gjo; <br>Arginine | |||||||||
| Biosynthesis extended | ||||||||||
| fig|6666666.60966.peg.1183 | CDS | 1104924 | 1104208 | −3 | − | 717 | FIG002842: | -none- | D23_1c1190 | Neut_1046 |
| hypothetical protein | ||||||||||
| fig|6666666.60966.peg.1184 | CDS | 1105647 | 1105036 | −3 | − | 612 | Dephospho-CoA kinase | Coenzyme A | D23_1c1191 | Neut_1045 |
| (EC 2.7.1.24) | Biosynthesis | |||||||||
| fig|6666666.60966.peg.1185 | CDS | 1106511 | 1105651 | −3 | − | 861 | Leader peptidase | -none- | D23_1c1192 | Neut_1044 |
| (Prepilin peptidase) (EC | ||||||||||
| 3.4.23.43)/N- | ||||||||||
| methyltransferase (EC | ||||||||||
| 2.1.1.—) | ||||||||||
| fig|6666666.60966.peg.1186 | CDS | 1107775 | 1106555 | −1 | − | 1221 | Type IV fimbrial | -none- | D23_1c1193 | Neut_1043 |
| assembly protein PilC | ||||||||||
| fig|6666666.60966.peg.1187 | CDS | 1108692 | 1107835 | −3 | − | 858 | Nucleoside- | CBSS-296591.1.peg.2330 | D23_1c1194 | Neut_1042 |
| diphosphate-sugar | ||||||||||
| epimerases | ||||||||||
| fig|6666666.60966.peg.1189 | CDS | 1108961 | 1109818 | 2 | + | 858 | 2-polyprenylphenol | -none- | D23_1c1195 | Neut_1041 |
| hydroxylase and related | ||||||||||
| flavodoxin | ||||||||||
| oxidoreductases/CDP- | ||||||||||
| 6-deoxy-delta-3,4- | ||||||||||
| glucoseen reductase- | ||||||||||
| like | ||||||||||
| fig|6666666.60966.peg.1190 | CDS | 1111006 | 1109825 | −1 | − | 1182 | Homolog of E. coli | -none- | D23_1c1196 | Neut_1040 |
| HemY protein | ||||||||||
| fig|6666666.60966.peg.1191 | CDS | 1112031 | 1111003 | −3 | − | 1029 | Uroporphyrinogen-III | Heme and Siroheme | D23_1c1197 | Neut_1039 |
| methyltransferase (EC | Biosynthesis | |||||||||
| 2.1.1.107) | ||||||||||
| fig|6666666.60966.peg.1192 | CDS | 1112828 | 1112046 | −2 | − | 783 | Uroporphyrinogen-III | Heme and Siroheme | D23_1c1198 | Neut_1038 |
| synthase (EC 4.2.1.75) | Biosynthesis | |||||||||
| fig|6666666.60966.peg.1193 | CDS | 1113852 | 1112848 | −3 | − | 1005 | Porphobilinogen | Heme and Siroheme | D23_1c1199 | Neut_1037 |
| deaminase (EC 2.5.1.61) | Biosynthesis | |||||||||
| fig|6666666.60966.peg.1194 | CDS | 1113898 | 1116699 | 1 | + | 2802 | Phosphoenolpyruvate | Pyruvate metabolism I: | D23_1c1200 | Neut_1036 |
| carboxylase (EC | anaplerotic reactions, | |||||||||
| 4.1.1.31) | PEP | |||||||||
| fig|6666666.60966.peg.1195 | CDS | 1116922 | 1118904 | 1 | + | 1983 | FIG00858706: | -none- | D23_1c1201 | Neut_1035 |
| hypothetical protein | ||||||||||
| fig|6666666.60966.peg.1196 | CDS | 1120329 | 1118899 | −3 | − | 1431 | probable integral | -none- | D23_1c1202 | Neut_1034 |
| membrane protein | ||||||||||
| NMA1898 | ||||||||||
| fig|6666666.60966.peg.1197 | CDS | 1121723 | 1120329 | −2 | − | 1395 | FIG00859415: | -none- | D23_1c1203 | Neut_1033 |
| hypothetical protein | ||||||||||
| fig|6666666.60966.peg.1198 | CDS | 1121909 | 1121763 | −2 | − | 147 | hypothetical protein | -none- | D23_1c1204 | NA |
| fig|6666666.60966.peg.1199 | CDS | 1121985 | 1122698 | 3 | + | 714 | COGs COG0518 | -none- | D23_1c1205 | Neut_1032 |
| fig|6666666.60966.peg.1200 | CDS | 1123590 | 1122748 | −3 | − | 843 | RNA polymerase sigma | Heat shock Cell division | D23_1c1206 | Neut_1031 |
| factor RpoH | Proteases and a | |||||||||
| Methyltransferase; | ||||||||||
| <br>Heat shock dnaK | ||||||||||
| gene cluster extended; | ||||||||||
| <br>Transcription | ||||||||||
| initiation, bacterial | ||||||||||
| sigma factors | ||||||||||
| fig|6666666.60966.peg.1201 | CDS | 1124005 | 1124823 | 1 | + | 819 | Cytochrome c family | -none- | D23_1c1207 | NA |
| protein | ||||||||||
| fig|6666666.60966.peg.1203 | CDS | 1125802 | 1127289 | 1 | + | 1488 | FIG00858881: | -none- | D23_1c1209 | Neut_1029 |
| hypothetical protein | ||||||||||
| fig|6666666.60966.peg.1204 | CDS | 1127318 | 1128325 | 2 | + | 1008 | Sulfate-binding protein | Inorganic Sulfur | D23_1c1210 | Neut_1028 |
| Sbp | Assimilation | |||||||||
| fig|6666666.60966.peg.1205 | CDS | 1128452 | 1128580 | 2 | + | 129 | hypothetical protein | -none- | D23_1c1211 | NA |
| fig|6666666.60966.peg.1206 | CDS | 1128661 | 1129494 | 1 | + | 834 | Sulfate transport | Cysteine Biosynthesis; | D23_1c1212 | Neut_1026 |
| system permease | <br>Inorganic Sulfur | |||||||||
| protein CysT | Assimilation | |||||||||
| fig|6666666.60966.peg.1207 | CDS | 1129502 | 1130371 | 2 | + | 870 | Sulfate transport | Cysteine Biosynthesis; | D23_1c1213 | Neut_1025 |
| system permease | <br>Inorganic Sulfur | |||||||||
| protein CysW | Assimilation | |||||||||
| fig|6666666.60966.peg.1208 | CDS | 1130383 | 1131471 | 1 | + | 1089 | Sulfate and thiosulfate | Cysteine Biosynthesis; | D23_1c1214 | Neut_1024 |
| import ATP-binding | <br>Inorganic Sulfur | |||||||||
| protein CysA (EC | Assimilation; | |||||||||
| 3.6.3.25) | <br>Uptake of selenate | |||||||||
| and selenite | ||||||||||
| fig|6666666.60966.peg.1209 | CDS | 1131827 | 1131510 | −2 | − | 318 | possible lipase | -none- | D23_1c1215 | Neut_1023 |
| fig|6666666.60966.peg.1210 | CDS | 1133403 | 1131859 | −3 | − | 1545 | Aminopeptidase PepA- | -none- | D23_1c1216 | Neut_1022 |
| related protein | ||||||||||
| fig|6666666.60966.peg.1211 | CDS | 1133455 | 1134249 | 1 | + | 795 | Thymidylate synthase | Folate Biosynthesis; | D23_1c1217 | Neut_1021 |
| (EC 2.1.1.45) | <br>pyrimidine | |||||||||
| conversions | ||||||||||
| fig|6666666.60966.peg.1212 | CDS | 1134246 | 1134776 | 3 | + | 531 | Dihydrofolate reductase | 5-FCL-like protein; | D23_1c1218 | Neut_1020 |
| (EC 1.5.1.3) | <br>EC49-61; <br>Folate | |||||||||
| Biosynthesis | ||||||||||
| fig|6666666.60966.peg.1213 | CDS | 1136053 | 1134809 | −1 | − | 1245 | Response regulator | -none- | D23_1c1219 | Neut_1019 |
| fig|6666666.60966.peg.1215 | CDS | 1136321 | 1136785 | 2 | + | 465 | Mobile element protein | -none- | D23_1c1220 | Neut_0357 |
| fig|6666666.60966.peg.1216 | CDS | 1136808 | 1137512 | 3 | + | 705 | Mobile element protein | -none- | D23_1c1221 | Neut_1318 |
| fig|6666666.60966.peg.1217 | CDS | 1137576 | 1138703 | 3 | + | 1128 | Catalase (EC 1.11.1.6) | Oxidative stress; | D23_1c1222 | NA |
| <br>Photorespiration | ||||||||||
| (oxidative C2cycle); | ||||||||||
| <br>Protection from | ||||||||||
| Reactive Oxygen Species | ||||||||||
| fig|6666666.60966.peg.1218 | CDS | 1139453 | 1138773 | −2 | − | 681 | Mobile element protein | -none- | D23_1c1223 | Neut_1318 |
| fig|6666666.60966.peg.1219 | CDS | 1139703 | 1139837 | 3 | + | 135 | Mobile element protein | -none- | D23_1c1224 | Neut_2500 |
| fig|6666666.60966.peg.1220 | CDS | 1139894 | 1140238 | 2 | + | 345 | Mobile element protein | -none- | D23_1c1225 | Neut_1375 |
| fig|6666666.60966.peg.1221 | CDS | 1141157 | 1140195 | −2 | − | 963 | Mobile element protein | -none- | D23_1c1226 | Neut_1278 |
| fig|6666666.60966.peg.1222 | CDS | 1141250 | 1141762 | 2 | + | 513 | Mobile element protein | -none- | D23_1c1227 | Neut_1624 |
| fig|6666666.60966.peg.1223 | CDS | 1142310 | 1141846 | −3 | − | 465 | Mobile element protein | -none- | D23_1c1228 | Neut_0357 |
| fig|6666666.60966.peg.1224 | CDS | 1142882 | 1142409 | −2 | − | 474 | Mobile element protein | -none- | D23_1c1229 | Neut_0883 |
| fig|6666666.60966.peg.1225 | CDS | 1144087 | 1143419 | −1 | − | 669 | hypothetical protein | -none- | D23_1c1230 | NA |
| fig|6666666.60966.peg.1226 | CDS | 1144329 | 1144078 | −3 | − | 252 | ABC-type antimicrobial | -none- | D23_1c1231 | NA |
| peptide transport | ||||||||||
| system, permease | ||||||||||
| component | ||||||||||
| fig|6666666.60966.peg.1227 | CDS | 1144623 | 1145231 | 3 | + | 609 | Transcriptional | -none- | D23_1c1232 | Neut_1011 |
| regulator, TetR family | ||||||||||
| fig|6666666.60966.peg.1228 | CDS | 1145317 | 1146351 | 1 | + | 1035 | Predicted membrane | ATP-dependent efflux | D23_1c1233 | Neut_1010 |
| fusion protein (MFP) | pump transporter Ybh | |||||||||
| component of efflux | ||||||||||
| pump, membrane | ||||||||||
| anchor protein YbhG | ||||||||||
| fig|6666666.60966.peg.1229 | CDS | 1146341 | 1148125 | 2 | + | 1785 | ABC transporter | ATP-dependent efflux | D23_1c1234 | Neut_1009 |
| multidrug efflux pump, | pump transporter Ybh | |||||||||
| fused ATP-binding | ||||||||||
| domains | ||||||||||
| fig|6666666.60966.peg.1230 | CDS | 1148122 | 1149270 | 1 | + | 1149 | ABC transport system, | ATP-dependent efflux | D23_1c1235 | Neut_1008 |
| permease component | pump transporter Ybh | |||||||||
| YbhS | ||||||||||
| fig|6666666.60966.peg.1231 | CDS | 1149276 | 1150400 | 3 | + | 1125 | ABC transport system, | ATP-dependent efflux | D23_1c1236 | Neut_1007 |
| permease component | pump transporter Ybh | |||||||||
| YbhR | ||||||||||
| fig|6666666.60966.peg.1232 | CDS | 1150415 | 1150546 | 2 | + | 132 | hypothetical protein | -none- | D23_1c1237 | NA |
| fig|6666666.60966.peg.1233 | CDS | 1150719 | 1150507 | −3 | − | 213 | hypothetical protein | -none- | D23_1c1238 | NA |
| fig|6666666.60966.peg.1234 | CDS | 1150690 | 1150875 | 1 | + | 186 | hypothetical protein | -none- | D23_1c1239 | Neut_1006 |
| fig|6666666.60966.peg.1235 | CDS | 1150882 | 1151043 | 1 | + | 162 | hypothetical protein | -none- | D23_1c1240 | NA |
| fig|6666666.60966.peg.1236 | CDS | 1151054 | 1151923 | 2 | + | 870 | hypothetical protein | -none- | D23_1c1241 | Neut_1006 |
| fig|6666666.60966.peg.1237 | CDS | 1151916 | 1152278 | 3 | + | 363 | hypothetical protein | -none- | D23_1c1242 | NA |
| fig|6666666.60966.peg.1239 | CDS | 1152362 | 1152703 | 2 | + | 342 | hypothetical protein | -none- | D23_1c1243 | Neut_1005 |
| fig|6666666.60966.peg.1240 | CDS | 1153760 | 1152756 | −2 | − | 1005 | Mobile element protein | -none- | D23_1c1244 | Neut_1862 |
| fig|6666666.60966.peg.1241 | CDS | 1153821 | 1154177 | 3 | + | 357 | Putative transport | -none- | D23_1c1245 | Neut_1004 |
| system permease | ||||||||||
| protein | ||||||||||
| fig|6666666.60966.peg.1242 | CDS | 1154289 | 1154441 | 3 | + | 153 | FIG00626672: | -none- | D23_1c1246 | Neut_1003 |
| hypothetical protein | ||||||||||
| fig|6666666.60966.peg.1243 | CDS | 1154607 | 1154476 | −3 | − | 132 | hypothetical protein | -none- | D23_1c1247 | Neut_1226 |
| fig|6666666.60966.peg.1244 | CDS | 1156287 | 1154728 | −3 | − | 1560 | amino acid transporter | -none- | D23_1c1248 | Neut_1227 |
| fig|6666666.60966.peg.1245 | CDS | 1157495 | 1156611 | −2 | − | 885 | DNA recombination- | DNA repair, bacterial | D23_1c1250 | Neut_1228 |
| dependent growth | ||||||||||
| factor C | ||||||||||
| fig|6666666.60966.peg.1246 | CDS | 1158541 | 1157738 | −1 | − | 804 | Probable component of | Lipopolysaccharide | D23_1c1252 | Neut_1229 |
| the lipoprotein | assembly | |||||||||
| assembly complex | ||||||||||
| (forms a complex with | ||||||||||
| YaeT, YfgL, and NlpB) | ||||||||||
| fig|6666666.60966.peg.1247 | CDS | 1158543 | 1159571 | 3 | + | 1029 | Ribosomal large subunit | RNA pseudouridine | D23_1c1253 | Neut_1230 |
| pseudouridine synthase | syntheses; | |||||||||
| D (EC 4.2.1.70) | <br>Ribosome | |||||||||
| biogenesis bacterial | ||||||||||
| fig|6666666.60966.peg.1248 | CDS | 1159795 | 1161201 | 1 | + | 1407 | Glutamine synthetase | Ammonia assimilation; | D23_1c1254 | Neut_1231 |
| type I (EC 6.3.1.2) | <br>Glutamine, | |||||||||
| Glutamate, Aspartate | ||||||||||
| and Asparagine | ||||||||||
| Biosynthesis; | ||||||||||
| <br>Glutamine | ||||||||||
| synthetases; | ||||||||||
| <br>Peptidoglycan | ||||||||||
| Biosynthesis | ||||||||||
| fig|6666666.60966.peg.1249 | CDS | 1161356 | 1161826 | 2 | + | 471 | FIG00858905: | -none- | D23_1c1256 | Neut_1232 |
| hypothetical protein | ||||||||||
| fig|6666666.60966.peg.1250 | CDS | 1161926 | 1161813 | −2 | − | 114 | hypothetical protein | -none- | D23_1c1257 | NA |
| fig|6666666.60966.peg.1251 | CDS | 1162096 | 1162263 | 1 | + | 168 | hypothetical protein | -none- | D23_1c1258 | NA |
| fig|6666666.60966.peg.1252 | CDS | 1162260 | 1162415 | 3 | + | 156 | hypothetical protein | -none- | D23_1c1259 | NA |
| fig|6666666.60966.peg.1253 | CDS | 1162412 | 1163191 | 2 | + | 780 | Putative sulfate | Inorganic Sulfur | D23_1c1260 | Neut_1235 |
| permease | Assimilation | |||||||||
| fig|6666666.60966.peg.1254 | CDS | 1163827 | 1163267 | −1 | − | 561 | Iron-sulfur cluster | -none- | D23_1c1261 | Neut_1236 |
| assembly scaffold | ||||||||||
| protein IscU/NifU-like | ||||||||||
| for SUF system, SufE3 | ||||||||||
| fig|6666666.60966.peg.1255 | CDS | 1164319 | 1163837 | −1 | − | 483 | Putative iron-sulfur | -none- | D23_1c1262 | Neut_1237 |
| cluster assembly | ||||||||||
| scaffold protein for SUF | ||||||||||
| system, SufE2 | ||||||||||
| fig|6666666.60966.peg.1256 | CDS | 1165584 | 1164316 | −3 | − | 1269 | Cysteine desulfurase | Alanine biosynthesis; | D23_1c1263 | Neut_1238 |
| (EC 2.8.1.7), SufS | <br>mnm5U34 | |||||||||
| subfamily | biosynthesis bacteria; | |||||||||
| <br>tRNA modification | ||||||||||
| Bacteria | ||||||||||
| fig|6666666.60966.peg.1257 | CDS | 1166895 | 1165588 | −3 | − | 1308 | Iron-sulfur cluster | CBSS- | D23_1c1264 | Neut_1239 |
| assembly protein SufD | 196164.1.peg.1690; | |||||||||
| <br>tRNA modification | ||||||||||
| Bacteria | ||||||||||
| fig|6666666.60966.peg.1258 | CDS | 1167683 | 1166892 | −2 | − | 792 | Iron-sulfur cluster | CBSS- | D23_1c1265 | Neut_1240 |
| assembly ATPase | 196164.1.peg.1690; | |||||||||
| protein SufC | <br>tRNA modification | |||||||||
| Bacteria | ||||||||||
| fig|6666666.60966.peg.1259 | CDS | 1169116 | 1167680 | −1 | − | 1437 | Iron-sulfur cluster | CBSS- | D23_1c1266 | Neut_1241 |
| assembly protein SufB | 196164.1.peg.1690; | |||||||||
| <br>tRNA modification | ||||||||||
| Bacteria | ||||||||||
| fig|6666666.60966.peg.1260 | CDS | 1169465 | 1169136 | −2 | − | 330 | Iron binding protein | Alanine biosynthesis; | D23_1c1267 | Neut_1242 |
| IscA for iron-sulfur | <br>tRNA modification | |||||||||
| cluster assembly | Bacteria | |||||||||
| fig|6666666.60966.peg.1261 | CDS | 1169958 | 1169491 | −3 | − | 468 | Iron-sulfur cluster | Alanine biosynthesis; | D23_1c1268 | Neut_1243 |
| regulator IscR | <br>Rrf2 family | |||||||||
| transcriptional | ||||||||||
| regulators | ||||||||||
| fig|6666666.60966.peg.1262 | CDS | 1170306 | 1171838 | 3 | + | 1533 | 2-isopropylmalate | Branched-Chain Amino | D23_1c1270 | Neut_1244 |
| synthase (EC 2.3.3.13) | Acid Biosynthesis; | |||||||||
| <br>Leucine | ||||||||||
| Biosynthesis | ||||||||||
| fig|6666666.60966.peg.1263 | CDS | 1171964 | 1172467 | 2 | + | 504 | Cytochrome c-type | Biogenesis of c-type | D23_1c1271 | Neut_1245 |
| biogenesis protein ResA | cytochromes | |||||||||
| fig|6666666.60966.peg.1264 | CDS | 1173081 | 1172488 | −3 | − | 594 | FIG016425: Soluble lytic | -none- | D23_1c1272 | Neut_1246 |
| murein transglycosylase | ||||||||||
| and related regulatory | ||||||||||
| proteins (some contain | ||||||||||
| LysM/invasin domains) | ||||||||||
| fig|6666666.60966.peg.1265 | CDS | 1174775 | 1173069 | −2 | − | 1707 | Prolyl-tRNA synthetase | tRNA aminoacylation, | D23_1c1273 | Neut_1247 |
| (EC 6.1.1.15), bacterial | Pro | |||||||||
| type | ||||||||||
| fig|6666666.60966.peg.1266 | CDS | 1175004 | 1175567 | 3 | + | 564 | Adenosine (5')- | CBSS- | D23_1c1274 | Neut_1248 |
| pentaphospho- | 364106.7.peg.3204; | |||||||||
| (5'')- | <br>Nudix proteins | |||||||||
| adenosine | (nucleoside triphosphate | |||||||||
| pyrophosphohydrolase | hydrolases); | |||||||||
| (EC 3.6.1.—) | <br>Phosphoglycerate | |||||||||
| mutase protein family | ||||||||||
| fig|6666666.60966.peg.1267 | CDS | 1175673 | 1176677 | 3 | + | 1005 | Cytochrome c551 | Protection from Reactive | D23_1c1275 | Neut_1249 |
| peroxidase (EC 1.11.1.5) | Oxygen Species | |||||||||
| fig|6666666.60966.peg.1269 | CDS | 1176892 | 1178190 | 1 | + | 1299 | Sensor histidine kinase | Global Two-component | D23_1c1276 | Neut_1250 |
| PrrB (RegB) (EC 2.7.3.—) | Regulator PrrBA in | |||||||||
| Proteobacteria | ||||||||||
| fig|6666666.60966.peg.1270 | CDS | 1178205 | 1178750 | 3 | + | 546 | Dna binding response | Global Two-component | D23_1c1277 | Neut_1251 |
| regulator PrrA (RegA) | Regulator PrrBA in | |||||||||
| Proteobacteria | ||||||||||
| fig|6666666.60966.peg.1271 | CDS | 1181021 | 1178853 | −2 | − | 2169 | Ferrichrome-iron | -none- | D23_1c1278 | Neut_1252 |
| receptor | ||||||||||
| fig|6666666.60966.peg.1272 | CDS | 1181355 | 1181558 | 3 | + | 204 | hypothetical protein | -none- | D23_1c1279 | NA |
| fig|6666666.60966.peg.1273 | CDS | 1181609 | 1181776 | 2 | + | 168 | hypothetical protein | -none- | D23_1c1280 | NA |
| fig|6666666.60966.peg.1274 | CDS | 1181748 | 1181981 | 3 | + | 234 | Mobile element protein | -none- | D23_1c1281 | NA |
| fig|6666666.60966.peg.1275 | CDS | 1182136 | 1181990 | −1 | − | 147 | hypothetical protein | -none- | D23_1c1282 | NA |
| fig|6666666.60966.peg.1277 | CDS | 1182799 | 1182386 | −1 | − | 414 | hypothetical protein | -none- | D23_1c1283 | Neut_1254 |
| fig|6666666.60966.peg.1278 | CDS | 1182892 | 1183920 | 1 | + | 1029 | Mobile element protein | -none- | D23_1c1284 | Neut_1746 |
| fig|6666666.60966.peg.1280 | CDS | 1185348 | 1184569 | −3 | − | 780 | CDP-diacylglycerol-- | Glycerolipid and | D23_1c1285 | Neut_1258 |
| serine O- | Glycerophospholipid | |||||||||
| phosphatidyltransferase | Metabolism in Bacteria | |||||||||
| (EC 2.7.8.8) | ||||||||||
| fig|6666666.60966.peg.1281 | CDS | 1186028 | 1185378 | −2 | − | 651 | Phosphatidylserine | Glycerolipid and | D23_1c1286 | Neut_1259 |
| decarboxylase (EC | Glycerophospholipid | |||||||||
| 4.1.1.65) | Metabolism in Bacteria | |||||||||
| fig|6666666.60966.peg.1282 | CDS | 1187049 | 1186033 | −3 | − | 1017 | Ketol-acid | Branched-Chain Amino | D23_1c1287 | Neut_1260 |
| reductoisomerase (EC | Acid Biosynthesis; | |||||||||
| 1.1.1.86) | <br>Coenzyme A | |||||||||
| Biosynthesis | ||||||||||
| fig|6666666.60966.peg.1283 | CDS | 1187629 | 1187138 | −1 | − | 492 | Acetolactate synthase | Acetolactate synthase | D23_1c1288 | Neut_1261 |
| small subunit (EC | subunits; <br>Branched- | |||||||||
| 2.2.1.6) | Chain Amino Acid | |||||||||
| Biosynthesis | ||||||||||
| fig|6666666.60966.peg.1284 | CDS | 1189337 | 1187634 | −2 | − | 1704 | Acetolactate synthase | Acetolactate synthase | D23_1c1289 | Neut_1262 |
| large subunit (EC | subunits; <br>Branched- | |||||||||
| 2.2.1.6) | Chain Amino Acid | |||||||||
| Biosynthesis | ||||||||||
| fig|6666666.60966.peg.1285 | CDS | 1189440 | 1189327 | −3 | − | 114 | hypothetical protein | -none- | D23_1c1290 | NA |
| fig|6666666.60966.peg.1287 | CDS | 1191111 | 1189663 | −3 | − | 1449 | TldD protein, part of | CBSS-316057.3.peg.563; | D23_1c1292 | Neut_1263 |
| TldE/TldD proteolytic | <br>CBSS- | |||||||||
| complex | 354.1.peg.2917; | |||||||||
| <br>Putative TldE-TldD | ||||||||||
| proteolytic complex | ||||||||||
| fig|6666666.60966.peg.1288 | CDS | 1192101 | 1191238 | −3 | − | 864 | FIG003879: Predicted | CBSS-354.1.peg.2917 | D23_1c1293 | Neut_1264 |
| amidohydrolase/ | ||||||||||
| Aliphatic amidase AmiE | ||||||||||
| (EC 3.5.1.4) | ||||||||||
| fig|6666666.60966.peg.1289 | CDS | 1196193 | 1192303 | −3 | − | 3891 | FIG005080: Possible | CBSS-354.1.peg.2917 | D23_1c1294 | Neut_1265 |
| exported protein | ||||||||||
| fig|6666666.60966.peg.1290 | CDS | 1196421 | 1199210 | 3 | + | 2790 | Glutamate-ammonia- | Ammonia assimilation; | D23_1c1295 | Neut_1266 |
| ligase | <br>CBSS- | |||||||||
| adenylyltransferase (EC | 316057.3.peg.3521 | |||||||||
| 2.7.7.42) | ||||||||||
| fig|6666666.60966.peg.1291 | CDS | 1200720 | 1200058 | −3 | − | 663 | FIG00859512: | -none- | D23_1c1300 | Neut_1268 |
| hypothetical protein | ||||||||||
| fig|6666666.60966.peg.1292 | CDS | 1200901 | 1200761 | −1 | − | 141 | hypothetical protein | -none- | D23_1c1301 | NA |
| fig|6666666.60966.peg.1293 | CDS | 1200921 | 1202306 | 3 | + | 1386 | Argininosuccinate lyase | Arginine Biosynthesis-- | D23_1c1302 | Neut_1269 |
| (EC 4.3.2.1) | gjo; <br>Arginine | |||||||||
| Biosynthesis extended | ||||||||||
| fig|6666666.60966.peg.1294 | CDS | 1202336 | 1203241 | 2 | + | 906 | Ribulosamine/erythrulosamine | Protein deglycation | D23_1c1303 | Neut_1270 |
| 3-kinase | ||||||||||
| potentially involved in | ||||||||||
| protein deglycation | ||||||||||
| fig|6666666.60966.peg.1295 | CDS | 1203386 | 1204876 | 2 | + | 1491 | FIG00807778: | -none- | D23_1c1304 | Neut_1271 |
| hypothetical protein | ||||||||||
| fig|6666666.60966.peg.1297 | CDS | 1205984 | 1205553 | −2 | − | 432 | hypothetical protein | -none- | D23_1c1305 | Neut_1272 |
| fig|6666666.60966.peg.1298 | CDS | 1206313 | 1205987 | −1 | − | 327 | hypothetical protein | -none- | D23_1c1306 | Neut_1273 |
| fig|6666666.60966.peg.1299 | CDS | 1206643 | 1206329 | −1 | − | 315 | CrcB protein | -none- | D23_1c1307 | Neut_1274 |
| fig|6666666.60966.peg.1300 | CDS | 1206663 | 1206902 | 3 | + | 240 | hypothetical protein | -none- | D23_1c1308 | NA |
| fig|6666666.60966.peg.1301 | CDS | 1207586 | 1206945 | −2 | − | 642 | Chemotaxis response- | -none- | D23_1c1309 | Neut_1275 |
| phosphatase CheZ | ||||||||||
| fig|6666666.60966.peg.1302 | CDS | 1208030 | 1207635 | −2 | − | 396 | Chemotaxis regulator- | Flagellar motility | D23_1c1310 | Neut_1276 |
| transmits | ||||||||||
| chemoreceptor signals | ||||||||||
| to flagelllar motor | ||||||||||
| components CheY | ||||||||||
| fig|6666666.60966.peg.1303 | CDS | 1209139 | 1208375 | −1 | − | 765 | Mobile element protein | -none- | D23_1c1311 | NA |
| fig|6666666.60966.peg.1305 | CDS | 1210466 | 1210134 | −2 | − | 333 | hypothetical protein | -none- | D23_1c1313 | NA |
| fig|6666666.60966.peg.1306 | CDS | 1210482 | 1210661 | 3 | + | 180 | hypothetical protein | -none- | D23_1c1314 | Neut_1280 |
| fig|6666666.60966.peg.1307 | CDS | 1212693 | 1210768 | −3 | − | 1926 | Cytochrome c, class I | -none- | D23_1c1315 | Neut_1281 |
| fig|6666666.60966.peg.1308 | CDS | 1213523 | 1213044 | −2 | − | 480 | FIG00858481: | -none- | D23_1c1317 | Neut_1282 |
| hypothetical protein | ||||||||||
| fig|6666666.60966.peg.1309 | CDS | 1213544 | 1214608 | 2 | + | 1065 | Folate-dependent | -none- | D23_1c1318 | Neut_1283 |
| protein for Fe/S cluster | ||||||||||
| synthesis/repair in | ||||||||||
| oxidative stress | ||||||||||
| fig|6666666.60966.peg.1310 | CDS | 1215290 | 1214631 | −2 | − | 660 | FOG: Ankyrin repeat | -none- | D23_1c1319 | Neut_1284 |
| fig|6666666.60966.peg.1311 | CDS | 1215984 | 1215292 | −3 | − | 693 | Putative | YcfH | D23_1c1320 | Neut_1285 |
| deoxyribonuclease YcfH | ||||||||||
| fig|6666666.60966.peg.1313 | CDS | 1216517 | 1216125 | −2 | − | 393 | Queuosine biosynthesis | Queuosine-Archaeosine | D23_1c1321 | Neut_1286 |
| QueD, PTPS-I | Biosynthesis; <br>Zinc | |||||||||
| regulated enzymes; | ||||||||||
| <br>tRNA modification | ||||||||||
| Bacteria | ||||||||||
| fig|6666666.60966.peg.1315 | CDS | 1216624 | 1217484 | 1 | + | 861 | Radical SAM domain | -none- | D23_1c1322 | Neut_1287 |
| protein | ||||||||||
| fig|6666666.60966.peg.1316 | CDS | 1217801 | 1217514 | −2 | − | 288 | FIG00858571: | -none- | D23_1c1323 | Neut_1288 |
| hypothetical protein | ||||||||||
| fig|6666666.60966.peg.1318 | CDS | 1219170 | 1218214 | −3 | − | 957 | Cobalt-zinc-cadmium | Cobalt-zinc-cadmium | D23_1c1325 | Neut_1289 |
| resistance protein CzcD | resistance | |||||||||
| fig|6666666.60966.peg.1319 | CDS | 1221684 | 1219195 | −3 | − | 2490 | Lead, cadmium, zinc | Copper Transport | D23_1c1326 | Neut_1290 |
| and mercury | System; <br>Copper | |||||||||
| transporting ATPase (EC | homeostasis | |||||||||
| 3.6.3.3) (EC 3.6.3.5); | ||||||||||
| Copper-translocating P- | ||||||||||
| type ATPase (EC 3.6.3.4) | ||||||||||
| fig|6666666.60966.peg.1320 | CDS | 1223842 | 1221797 | −1 | − | 2046 | 1,4-alpha-glucan | Glycogen metabolism | D23_1c1327 | Neut_1291 |
| (glycogen) branching | ||||||||||
| enzyme, GH-13-type (EC | ||||||||||
| 2.4.1.18) | ||||||||||
| fig|6666666.60966.peg.1321 | CDS | 1223815 | 1224054 | 1 | + | 240 | hypothetical protein | -none- | D23_1c1328 | NA |
| fig|6666666.60966.peg.1322 | CDS | 1224141 | 1225418 | 3 | + | 1278 | Glucose-1-phosphate | Glycogen metabolism | D23_1c1329 | Neut_1292 |
| adenylyltransferase (EC | ||||||||||
| 2.7.7.27) | ||||||||||
| fig|6666666.60966.peg.1323 | CDS | 1225484 | 1227202 | 2 | + | 1719 | Amylopullulanase (EC | -none- | D23_1c1330 | Neut_1293 |
| 3.2.1.1)/(EC 3.2.1.41) | ||||||||||
| fig|6666666.60966.peg.1324 | CDS | 1227268 | 1229292 | 1 | + | 2025 | Alpha-amylase (EC | -none- | D23_1c1331 | Neut_1294 |
| 3.2.1.1) | ||||||||||
| fig|6666666.60966.peg.1325 | CDS | 1229324 | 1232014 | 2 | + | 2691 | hypothetical protein | -none- | D23_1c1332 | Neut_1295 |
| fig|6666666.60966.peg.1326 | CDS | 1232973 | 1232236 | −3 | − | 738 | Uracil-DNA glycosylase, | Uracil-DNA glycosylase | D23_1c1334 | Neut_1296 |
| family 4 | ||||||||||
| fig|6666666.60966.peg.1327 | CDS | 1233520 | 1233032 | −1 | − | 489 | Ribosomal-protein- | Bacterial RNA- | D23_1c1335 | Neut_1297 |
| S18p-alanine | metabolizing Zn- | |||||||||
| acetyltransferase (EC | dependent hydrolases; | |||||||||
| 2.3.1.—) | <br>Ribosome | |||||||||
| biogenesis bacterial | ||||||||||
| fig|6666666.60966.peg.1328 | CDS | 1234194 | 1233523 | −3 | − | 672 | Inactive homolog of | -none- | D23_1c1336 | Neut_1298 |
| metal-dependent | ||||||||||
| proteases, putative | ||||||||||
| molecular chaperone | ||||||||||
| fig|6666666.60966.peg.1329 | CDS | 1234742 | 1234209 | −2 | − | 534 | 2'-5' RNA | RNA processing orphans | D23_1c1337 | Neut_1299 |
| ligase | ||||||||||
| fig|6666666.60966.peg.1330 | CDS | 1235245 | 1234742 | −1 | − | 504 | 2-C-methyl-D-erythritol | Isoprenoid Biosynthesis; | D23_1c1338 | Neut_1300 |
| 2,4-cyclodiphosphate | <br>Nonmevalonate | |||||||||
| synthase (EC 4.6.1.12) | Branch of Isoprenoid | |||||||||
| Biosynthesis; | ||||||||||
| <br>Possible RNA | ||||||||||
| degradation cluster; | ||||||||||
| <br>Stationary phase | ||||||||||
| repair cluster | ||||||||||
| fig|6666666.60966.peg.1331 | CDS | 1235544 | 1235356 | −3 | − | 189 | hypothetical protein | -none- | D23_1c1339 | Neut_0314 |
| fig|6666666.60966.peg.1332 | CDS | 1235706 | 1235566 | −3 | − | 141 | hypothetical protein | -none- | D23_1c1340 | Neut_0314 |
| fig|6666666.60966.peg.1335 | CDS | 1236565 | 1236008 | −1 | − | 558 | Translation elongation | Translation elongation | D23_1c1341 | Neut_1302 |
| factor P | factors bacterial | |||||||||
| fig|6666666.60966.peg.1336 | CDS | 1237794 | 1236640 | −3 | − | 1155 | hypothetical protein | -none- | D23_1c1342 | Neut_1303 |
| fig|6666666.60966.peg.1337 | CDS | 1237927 | 1238928 | 1 | + | 1002 | D-lactate | Fermentations: Lactate | D23_1c1343 | Neut_1304 |
| dehydrogenase (EC | ||||||||||
| 1.1.1.28) | ||||||||||
| fig|6666666.60966.peg.1338 | CDS | 1240296 | 1239037 | −3 | − | 1260 | putative membrane | -none- | D23_1c1344 | Neut_1315 |
| protein | ||||||||||
| fig|6666666.60966.peg.1339 | CDS | 1241400 | 1240354 | −3 | − | 1047 | Peptide chain release | Programmed frameshift; | D23_1c1345 | Neut_1316 |
| factor 2; programmed | <br>Programmed | |||||||||
| frameshift-containing | frameshift; | |||||||||
| <br>Translation | ||||||||||
| termination factors | ||||||||||
| bacterial | ||||||||||
| fig|6666666.60966.peg.1340 | CDS | 1243378 | 1241576 | −1 | − | 1803 | patatin family protein | -none- | D23_1c1346 | Neut_1317 |
| fig|6666666.60966.peg.1341 | CDS | 1244736 | 1243531 | −3 | − | 1206 | Catalase (EC 1.11.1.6) | Oxidative stress; | D23_1c1348 | NA |
| <br>Photorespiration | ||||||||||
| (oxidative C2 cycle); | ||||||||||
| <br>Protection from | ||||||||||
| Reactive Oxygen Species | ||||||||||
| fig|6666666.60966.peg.1342 | CDS | 1246268 | 1244739 | −2 | − | 1530 | Peroxidase (EC 1.11.1.7) | Oxidative stress; | D23_1c1349 | NA |
| <br>Protection from | ||||||||||
| Reactive Oxygen Species | ||||||||||
| fig|6666666.60966.peg.1343 | CDS | 1247585 | 1246281 | −2 | − | 1305 | Peroxidase (EC 1.11.1.7) | Oxidative stress; | D23_1c1350 | NA |
| <br>Protection from | ||||||||||
| Reactive Oxygen Species | ||||||||||
| fig|6666666.60966.peg.1344 | CDS | 1248078 | 1247623 | −3 | − | 456 | hypothetical protein | -none- | D23_1c1351 | NA |
| fig|6666666.60966.peg.1345 | CDS | 1248448 | 1251117 | 1 | + | 2670 | FIG00860108: | -none- | D23_1c1352 | Neut_0141 |
| hypothetical protein | ||||||||||
| fig|6666666.60966.peg.1346 | CDS | 1251218 | 1253155 | 2 | + | 1938 | Choline dehydrogenase | -none- | D23_1c1353 | NA |
| (EC 1.1.99.1) | ||||||||||
| fig|6666666.60966.peg.1347 | CDS | 1256051 | 1253184 | −2 | − | 2868 | Peroxidase (EC 1.11.1.8) | -none- | D23_1c1354 | NA |
| fig|6666666.60966.peg.1348 | CDS | 1257505 | 1256081 | −1 | − | 1425 | Hemagglutinin | -none- | D23_1c1355 | NA |
| fig|6666666.60966.peg.1349 | CDS | 1258257 | 1257547 | −3 | − | 711 | hypothetical protein | -none- | D23_1c1356 | NA |
| fig|6666666.60966.peg.1350 | CDS | 1259233 | 1258262 | −1 | − | 972 | hypothetical protein | -none- | D23_1c1357 | NA |
| fig|6666666.60966.peg.1351 | CDS | 1261078 | 1259246 | −1 | − | 1833 | hypothetical protein | -none- | D23_1c1358 | NA |
| fig|6666666.60966.peg.1352 | CDS | 1262776 | 1261109 | −1 | − | 1668 | Arachidonate 15- | -none- | D23_1c1359 | NA |
| lipoxygenase (EC | ||||||||||
| 1.13.11.33) | ||||||||||
| fig|6666666.60966.peg.1353 | CDS | 1264449 | 1262845 | −3 | − | 1605 | putative | -none- | D23_1c1360 | NA |
| cyclooxygenase-2 | ||||||||||
| fig|6666666.60966.peg.1354 | CDS | 1266134 | 1264638 | −2 | − | 1497 | hypothetical protein | -none- | D23_1c1361 | NA |
| fig|6666666.60966.peg.1355 | CDS | 1266382 | 1266167 | −1 | − | 216 | hypothetical protein | -none- | D23_1c1362 | NA |
| fig|6666666.60966.peg.1356 | CDS | 1266704 | 1266444 | −2 | − | 261 | hypothetical protein | -none- | D23_1c1363 | NA |
| fig|6666666.60966.peg.1357 | CDS | 1267804 | 1266983 | −1 | − | 822 | Kazal-type serine | -none- | D23_1c1364 | NA |
| protease inhibitor | ||||||||||
| domain | ||||||||||
| fig|6666666.60966.peg.1358 | CDS | 1268650 | 1267970 | −1 | − | 681 | Kazal-type serine | -none- | D23_1c1365 | NA |
| protease inhibitor | ||||||||||
| domain | ||||||||||
| fig|6666666.60966.peg.1359 | CDS | 1268913 | 1268800 | −3 | − | 114 | hypothetical protein | -none- | D23_1c1366 | NA |
| fig|6666666.60966.peg.1360 | CDS | 1269830 | 1269126 | −2 | − | 705 | Mobile element protein | -none- | D23_1c1367 | Neut_1318 |
| fig|6666666.60966.peg.1361 | CDS | 1270083 | 1269853 | −3 | − | 231 | Mobile element protein | -none- | D23_1c1368 | Neut_1318 |
| fig|6666666.60966.peg.1362 | CDS | 1270317 | 1270111 | −3 | − | 207 | Mobile element protein | -none- | D23_1c1369 | Neut_2405 |
| fig|6666666.60966.peg.1363 | CDS | 1271332 | 1270409 | −1 | − | 924 | alpha/beta hydrolase | -none- | D23_1c1370 | NA |
| fold | ||||||||||
| fig|6666666.60966.peg.1364 | CDS | 1271721 | 1271329 | −3 | − | 393 | hypothetical protein | -none- | D23_1c1371 | NA |
| fig|6666666.60966.peg.1365 | CDS | 1272160 | 1273251 | 1 | + | 1092 | Putrescine transport | Polyamine Metabolism | D23_1c1372 | Neut_1328 |
| ATP-binding protein | ||||||||||
| PotA (TC 3.A.1.11.1) | ||||||||||
| fig|6666666.60966.peg.1366 | CDS | 1273248 | 1274150 | 3 | + | 903 | Spermidine Putrescine | Polyamine Metabolism | D23_1c1373 | Neut_1329 |
| ABC transporter | ||||||||||
| permease component | ||||||||||
| PotB (TC 3.A.1.11.1) | ||||||||||
| fig|6666666.60966.peg.1367 | CDS | 1274170 | 1274955 | 1 | + | 786 | Spermidine Putrescine | Polyamine Metabolism | D23_1c1374 | Neut_1330 |
| ABC transporter | ||||||||||
| permease component | ||||||||||
| potC (TC_3.A.1.11.1) | ||||||||||
| fig|6666666.60966.peg.1368 | CDS | 1274952 | 1276061 | 3 | + | 1110 | ABC transporter, | Polyamine Metabolism | D23_1c1375 | Neut_1331 |
| periplasmic spermidine | ||||||||||
| putrescine-binding | ||||||||||
| protein PotD (TC | ||||||||||
| 3.A.1.11.1) | ||||||||||
| fig|6666666.60966.peg.1369 | CDS | 1276066 | 1276374 | 1 | + | 309 | Ferredoxin, 2Fe—2S | Alanine biosynthesis; | D23_1c1376 | Neut_1332 |
| <br>Soluble | ||||||||||
| cytochromes and | ||||||||||
| functionally related | ||||||||||
| electron carriers; | ||||||||||
| <br>tRNA modification | ||||||||||
| Bacteria | ||||||||||
| fig|6666666.60966.peg.1370 | CDS | 1278030 | 1276423 | −3 | − | 1608 | Type I restriction- | Restriction-Modification | D23_1c1377 | Neut_0541 |
| modification system, | System; <br>Type I | |||||||||
| DNA-methyltransferase | Restriction-Modification | |||||||||
| subunit M (EC 2.1.1.72) | ||||||||||
| fig|6666666.60966.peg.1371 | CDS | 1279031 | 1278027 | −2 | − | 1005 | Putative DNA-binding | Restriction-Modification | D23_1c1378 | NA |
| protein in cluster with | System | |||||||||
| Type I restriction- | ||||||||||
| modification system | ||||||||||
| fig|6666666.60966.peg.1372 | CDS | 1282963 | 1279028 | −1 | − | 3936 | Type I restriction- | Restriction-Modification | D23_1c1379 | Neut_0537 |
| modification system, | System; <br>Type I | |||||||||
| restriction subunit R (EC | Restriction-Modification | |||||||||
| 3.1.21.3) | ||||||||||
| fig|6666666.60966.peg.1373 | CDS | 1283272 | 1282982 | −1 | − | 291 | Type I restriction- | Restriction-Modification | D23_1c1380 | NA |
| modification system, | System; <br>Type I | |||||||||
| restriction subunit R (EC | Restriction-Modification | |||||||||
| 3.1.21.3) | ||||||||||
| fig|6666666.60966.peg.1374 | CDS | 1287342 | 1283581 | −3 | − | 3762 | macromolecule | -none- | D23_1c1381 | Neut_1336 |
| metabolism; | ||||||||||
| macromolecule | ||||||||||
| synthesis, modification; | ||||||||||
| dna-replication, repair, | ||||||||||
| restr./modif. | ||||||||||
| fig|6666666.60966.peg.1375 | CDS | 1287828 | 1287349 | −3 | − | 480 | FIG00858549: | -none- | D23_1c1382 | Neut_1337 |
| hypothetical protein | ||||||||||
| fig|6666666.60966.peg.1376 | CDS | 1288968 | 1287859 | −3 | − | 1110 | 2-keto-3-deoxy-D- | Chorismate Synthesis; | D23_1c1383 | Neut_1338 |
| arabino-heptulosonate- | <br>Common Pathway | |||||||||
| 7-phosphate synthase I | For Synthesis of | |||||||||
| alpha (EC 2.5.1.54) | Aromatic Compounds | |||||||||
| (DAHP synthase to | ||||||||||
| chorismate) | ||||||||||
| fig|6666666.60966.peg.1377 | CDS | 1290768 | 1289113 | −3 | − | 1656 | MutS domain protein, | DNA repair, bacterial | D23_1c1384 | Neut_1339 |
| family 6 | MutL-MutS system | |||||||||
| fig|6666666.60966.peg.1378 | CDS | 1290915 | 1291493 | 3 | + | 579 | FIG00858435: | -none- | D23_1c1385 | Neut_1340 |
| hypothetical protein | ||||||||||
| fig|6666666.60966.peg.1379 | CDS | 1291506 | 1292660 | 3 | + | 1155 | Probable Co/Zn/Cd | Cobalt-zinc-cadmium | D23_1c1386 | Neut_1341 |
| efflux system | resistance | |||||||||
| membrane fusion | ||||||||||
| protein | ||||||||||
| fig|6666666.60966.peg.1380 | CDS | 1292693 | 1293328 | 2 | + | 636 | ABC transporter ATP- | -none- | D23_1c1387 | Neut_1342 |
| binding protein YvcR | ||||||||||
| fig|6666666.60966.peg.1381 | CDS | 1293325 | 1294527 | 1 | + | 1203 | ABC transporter | -none- | D23_1c1388 | Neut_1343 |
| permease protein | ||||||||||
| fig|6666666.60966.peg.1382 | CDS | 1294533 | 1295732 | 3 | + | 1200 | putative ABC | -none- | D23_1c1389 | Neut_1344 |
| transporter protein | ||||||||||
| fig|6666666.60966.peg.1383 | CDS | 1296266 | 1295742 | −2 | − | 525 | FIG00859169: | -none- | D23_1c1390 | Neut_1345 |
| hypothetical protein | ||||||||||
| fig|6666666.60966.peg.1385 | CDS | 1296862 | 1297086 | 1 | + | 225 | ADA regulatory protein/ | DNA repair, bacterial; | D23_1c1391 | Neut_1346 |
| Methylated-DNA-- | <br>DNA repair, | |||||||||
| protein-cysteine | bacterial | |||||||||
| methyltransferase (EC | ||||||||||
| 2.1.1.63) | ||||||||||
| fig|6666666.60966.peg.1386 | CDS | 1297089 | 1297802 | 3 | + | 714 | hypothetical protein | -none- | D23_1c1392 | Neut_1347 |
| fig|6666666.60966.peg.1387 | CDS | 1298101 | 1297967 | −1 | − | 135 | hypothetical protein | -none- | D23_1c1393 | NA |
| fig|6666666.60966.peg.1389 | CDS | 1298212 | 1298838 | 1 | + | 627 | Alkylated DNA repair | -none- | D23_1c1395 | Neut_1349 |
| protein | ||||||||||
| fig|6666666.60966.peg.1390 | CDS | 1300170 | 1298923 | −3 | − | 1248 | Mobile element protein | -none- | D23_1c1396 | Neut_0357 |
| fig|6666666.60966.peg.1391 | CDS | 1300681 | 1300355 | −1 | − | 327 | hypothetical protein | -none- | D23_1c1397 | Neut_1350 |
| fig|6666666.60966.peg.1392 | CDS | 1301157 | 1300963 | −3 | − | 195 | Glutaredoxin | Glutaredoxins; | D23_1c1398 | Neut_1351 |
| <br>Glutathione: Redox | ||||||||||
| cycle; <br>Phage DNA | ||||||||||
| synthesis | ||||||||||
| fig|6666666.60966.peg.1393 | CDS | 1302170 | 1301697 | −2 | − | 474 | Mobile element protein | -none- | D23_1c1399 | Neut_1353 |
| fig|6666666.60966.peg.1394 | CDS | 1303008 | 1302400 | −3 | − | 609 | Glutathione S- | Glutathione: Non-redox | D23_1c1400 | Neut_1354 |
| transferase (EC | reactions | |||||||||
| 2.5.1.18) | ||||||||||
| fig|6666666.60966.peg.1395 | CDS | 1303729 | 1303556 | −1 | − | 174 | hypothetical protein | -none- | D23_1c1402 | NA |
| fig|6666666.60966.peg.1396 | CDS | 1303948 | 1307514 | 1 | + | 3567 | Exodeoxyribonuclease V | DNA repair, bacterial | D23_1c1403 | Neut_1355 |
| gamma chain (EC | RecBCD pathway | |||||||||
| 3.1.11.5) | ||||||||||
| fig|6666666.60966.peg.1397 | CDS | 1307530 | 1311216 | 1 | + | 3687 | Exodeoxyribonuclease V | DNA repair, bacterial | D23_1c1404 | Neut_1356 |
| beta chain (EC 3.1.11.5) | RecBCD pathway | |||||||||
| fig|6666666.60966.peg.1398 | CDS | 1311213 | 1313258 | 3 | + | 2046 | Exodeoxyribonuclease V | DNA repair, bacterial | D23_1c1405 | Neut_1357 |
| alpha chain (EC | RecBCD pathway | |||||||||
| 3.1.11.5) | ||||||||||
| fig|6666666.60966.peg.1399 | CDS | 1314581 | 1313277 | −2 | − | 1305 | Aspartyl | -none- | D23_1c1406 | Neut_1358 |
| aminopeptidase | ||||||||||
| fig|6666666.60966.peg.1400 | CDS | 1315032 | 1314604 | −3 | − | 429 | PIN domain family | -none- | D23_1c1407 | Neut_1359 |
| protein | ||||||||||
| fig|6666666.60966.peg.1401 | CDS | 1315334 | 1315032 | −2 | − | 303 | DNA-binding protein, | -none- | D23_1c1408 | Neut_1360 |
| CopG family | ||||||||||
| fig|6666666.60966.peg.1402 | CDS | 1316699 | 1315362 | −2 | − | 1338 | Sensor protein PhoQ | -none- | D23_1c1409 | Neut_1361 |
| (EC 2.7.13.3) | ||||||||||
| fig|6666666.60966.peg.1403 | CDS | 1317382 | 1316696 | −1 | − | 687 | DNA-binding response | -none- | D23_1c1410 | Neut_1362 |
| regulator | ||||||||||
| fig|6666666.60966.peg.1404 | CDS | 1317741 | 1317451 | −3 | − | 291 | hypothetical protein | -none- | D23_1c1411 | Neut_1363 |
| fig|6666666.60966.peg.1405 | CDS | 1318192 | 1317827 | −1 | − | 366 | Putative metal | G3E family of P-loop | D23_1c1412 | NA |
| chaperone, involved in | GTPases (metallocenter | |||||||||
| Zn homeostasis, GTPase | biosynthesis); <br>Zinc | |||||||||
| of COG0523 family | regulated enzymes | |||||||||
| fig|6666666.60966.peg.1406 | CDS | 1318485 | 1319036 | 3 | + | 552 | Protein of unknown | -none- | D23_1c1413 | Neut_1365 |
| function DUF924 | ||||||||||
| fig|6666666.60966.peg.1407 | CDS | 1320160 | 1319171 | −1 | − | 990 | Integron integrase | Integrons | D23_1c1414 | Neut_1366 |
| IntlPac | ||||||||||
| fig|6666666.60966.peg.1408 | CDS | 1320314 | 1321651 | 2 | + | 1338 | DNA modification | -none- | D23_1c1415 | NA |
| methyltransferase | ||||||||||
| fig|6666666.60966.peg.1409 | CDS | 1321654 | 1322532 | 1 | + | 879 | hypothetical protein | -none- | D23_1c1416 | NA |
| fig|6666666.60966.peg.1410 | CDS | 1322665 | 1322880 | 1 | + | 216 | hypothetical protein | -none- | D23_1c1417 | NA |
| fig|6666666.60966.peg.1411 | CDS | 1323474 | 1324154 | 3 | + | 681 | ThiJ/Pfpl family protein | -none- | D23_1c1418 | NA |
| fig|6666666.60966.peg.1412 | CDS | 1324808 | 1324990 | 2 | + | 183 | hypothetical protein | -none- | D23_1c1419 | NA |
| fig|6666666.60966.peg.1413 | CDS | 1325941 | 1324979 | −1 | − | 963 | Mobile element protein | -none- | D23_1c1420 | Neut_1746 |
| fig|6666666.60966.peg.1415 | CDS | 1326558 | 1328531 | 3 | + | 1974 | Monoamine oxidase | Auxin biosynthesis; | D23_1c1421 | NA |
| (1.4.3.4) | <br>Glycine and Serine | |||||||||
| Utilization; | ||||||||||
| <br>Threonine | ||||||||||
| degradation | ||||||||||
| fig|6666666.60966.peg.1417 | CDS | 1328848 | 1328711 | −1 | − | 138 | Mobile element protein | -none- | D23_1c1422 | Neut_2501 |
| fig|6666666.60966.peg.1418 | CDS | 1329144 | 1328821 | −3 | − | 324 | Mobile element protein | -none- | D23_1c1423 | Neut_1624 |
| fig|6666666.60966.peg.1419 | CDS | 1329566 | 1329129 | −2 | − | 438 | Mobile element protein | -none- | D23_1c1424 | Neut_1888 |
| fig|6666666.60966.peg.1420 | CDS | 1330200 | 1329892 | −3 | − | 309 | Death on curing | Phd-Doc, YdcE-YdcD | D23_1c1425 | NA |
| protein, Doc toxin | toxin-antitoxin | |||||||||
| (programmed cell death) | ||||||||||
| systems | ||||||||||
| fig|6666666.60966.peg.1421 | CDS | 1330677 | 1330231 | −3 | − | 447 | Prevent host death | Phd-Doc, YdcE-YdcD | D23_1c1426 | NA |
| protein, Phd antitoxin | toxin-antitoxin | |||||||||
| (programmed cell death) | ||||||||||
| systems | ||||||||||
| fig|6666666.60966.peg.1423 | CDS | 1331253 | 1331387 | 3 | + | 135 | Mobile element protein | -none- | D23_1c1427 | Neut_2500 |
| fig|6666666.60966.peg.1424 | CDS | 1331444 | 1332292 | 2 | + | 849 | Mobile element protein | -none- | D23_1c1428 | Neut_1888 |
| fig|6666666.60966.peg.1425 | CDS | 1332744 | 1333214 | 3 | + | 471 | 3-demethylubiquinone- | -none- | D23_1c1429 | Neut_1376 |
| 9 3-methyltransferase | ||||||||||
| fig|6666666.60966.peg.1426 | CDS | 1333410 | 1335026 | 3 | + | 1617 | Dihydroxyacetone | Dihydroxyacetone | D23_1c1431 | Neut_1377 |
| kinase, ATP-dependent | kinases | |||||||||
| (EC 2.7.1.29) | ||||||||||
| fig|6666666.60966.peg.1427 | CDS | 1335644 | 1335210 | −2 | − | 435 | hypothetical protein | -none- | D23_1c1432 | Neut_1378 |
| fig|6666666.60966.peg.1428 | CDS | 1339065 | 1335670 | −3 | − | 3396 | PDZ domain | -none- | D23_1c1433 | Neut_1379 |
| fig|6666666.60966.peg.1429 | CDS | 1339241 | 1340350 | 2 | + | 1110 | COGs COG0823 | -none- | D23_1c1435 | Neut_1380 |
| fig|6666666.60966.peg.1430 | CDS | 1341715 | 1340438 | −1 | − | 1278 | Putative diheme | Soluble cytochromes | D23_1c1436 | Neut_1381 |
| cytochrome c-553 | and functionally related | |||||||||
| electron carriers | ||||||||||
| fig|6666666.60966.peg.1431 | CDS | 1342431 | 1341712 | −3 | − | 720 | Probable cytochrome c2 | Soluble cytochromes | D23_1c1437 | Neut_1382 |
| and functionally related | ||||||||||
| electron carriers | ||||||||||
| fig|6666666.60966.peg.1432 | CDS | 1342445 | 1342963 | 2 | + | 519 | FIG00859968: | -none- | D23_1c1438 | Neut_1383 |
| hypothetical protein | ||||||||||
| fig|6666666.60966.peg.1433 | CDS | 1344805 | 1342952 | −1 | − | 1854 | Cell division protein | Bacterial Cell Division | D23_1c1439 | Neut_1384 |
| FtsH (EC 3.4.24.—) | ||||||||||
| fig|6666666.60966.peg.1434 | CDS | 1345012 | 1346118 | 1 | + | 1107 | S- | Glutathione-dependent | D23_1c1440 | Neut_1385 |
| (hydroxymethyl)glutathione | pathway of | |||||||||
| dehydrogenase (EC | formaldehyde | |||||||||
| 1.1.1.284) | detoxification | |||||||||
| fig|6666666.60966.peg.1435 | CDS | 1346131 | 1347000 | 1 | + | 870 | S-formylglutathione | Glutathione-dependent | D23_1c1441 | Neut_1386 |
| hydrolase (EC 3.1.2.12) | pathway of | |||||||||
| formaldehyde | ||||||||||
| detoxification | ||||||||||
| fig|6666666.60966.peg.1436 | CDS | 1348436 | 1347264 | −2 | − | 1173 | Ornithine | Arginine and Ornithine | D23_1c1442 | Neut_1387 |
| decarboxylase (EC | Degradation; | |||||||||
| 4.1.1.17)/Arginine | <br>Arginine and | |||||||||
| decarboxylase (EC | Ornithine Degradation; | |||||||||
| 4.1.1.19) | <br>Polyamine | |||||||||
| Metabolism; | ||||||||||
| <br>Polyamine | ||||||||||
| Metabolism | ||||||||||
| fig|6666666.60966.peg.1437 | CDS | 1348961 | 1349230 | 2 | + | 270 | FIG00858492: | -none- | D23_1c1443 | Neut_1388 |
| hypothetical protein | ||||||||||
| fig|6666666.60966.peg.1438 | CDS | 1349336 | 1349214 | −2 | − | 123 | hypothetical protein | -none- | D23_1c1444 | NA |
| fig|6666666.60966.peg.1439 | CDS | 1349660 | 1350622 | 2 | + | 963 | Mobile element protein | -none- | D23_1c1446 | Neut_1862 |
| fig|6666666.60966.peg.1440 | CDS | 1350742 | 1352079 | 1 | + | 1338 | Ribosomal protein S12p | Methylthiotransferases; | D23_1c1447 | Neut_1389 |
| Asp88 (E. coli) | <br>Ribosomal protein | |||||||||
| methylthiotransferase | S12p Asp | |||||||||
| methylthiotransferase | ||||||||||
| fig|6666666.60966.peg.1441 | CDS | 1353046 | 1352255 | −1 | − | 792 | hypothetical protein | -none- | D23_1c1448 | Neut_1390 |
| fig|6666666.60966.peg.1442 | CDS | 1353301 | 1353618 | 1 | + | 318 | Cell division protein | Bacterial Cell Division | D23_1c1449 | Neut_1391 |
| BolA | ||||||||||
| fig|6666666.60966.peg.1443 | CDS | 1353569 | 1354282 | 2 | + | 714 | LemA family protein | -none- | D23_1c1450 | Neut_1392 |
| fig|6666666.60966.peg.1444 | CDS | 1354309 | 1355193 | 1 | + | 885 | Beta-propeller domains | -none- | D23_1c1451 | Neut_1393 |
| of methanol | ||||||||||
| dehydrogenase type | ||||||||||
| fig|6666666.60966.peg.1445 | CDS | 1355207 | 1355710 | 2 | + | 504 | FIG004694: | -none- | D23_1c1452 | Neut_1394 |
| Hypothetical protein | ||||||||||
| fig|6666666.60966.peg.1446 | CDS | 1356010 | 1356513 | 1 | + | 504 | DNA-directed RNA | -none- | D23_1c1454 | Neut_1395 |
| polymerase specialized | ||||||||||
| sigma subunit, sigma24- | ||||||||||
| like | ||||||||||
| fig|6666666.60966.peg.1447 | CDS | 1356510 | 1357232 | 3 | + | 723 | FIG00859011: | -none- | D23_1c1455 | Neut_1396 |
| hypothetical protein | ||||||||||
| fig|6666666.60966.peg.1448 | CDS | 1357326 | 1359644 | 3 | + | 2319 | ABC transporter, | -none- | D23_1c1456 | Neut_1397 |
| transmembrane | ||||||||||
| region: ABC transporter | ||||||||||
| related | ||||||||||
| fig|6666666.60966.peg.1449 | CDS | 1359641 | 1360108 | 2 | + | 468 | DUF1854 domain- | -none- | D23_1c1457 | Neut_1398 |
| containing protein | ||||||||||
| fig|6666666.60966.peg.1451 | CDS | 1360927 | 1362021 | 1 | + | 1095 | hypothetical protein | -none- | D23_1c1458 | Neut_1860 |
| fig|6666666.60966.peg.1452 | CDS | 1362049 | 1362342 | 1 | + | 294 | Mobile element protein | -none- | D23_1c1459 | Neut_1719 |
| fig|6666666.60966.peg.1453 | CDS | 1362441 | 1363319 | 3 | + | 879 | Mobile element protein | -none- | D23_1c1460 | Neut_1720 |
| fig|6666666.60966.peg.1454 | CDS | 1363397 | 1365250 | 2 | + | 1854 | hypothetical protein | -none- | D23_1c1461 | NA |
| fig|6666666.60966.peg.1455 | CDS | 1365453 | 1365262 | −3 | − | 192 | Mobile element protein | -none- | D23_1c1462 | Neut_2502 |
| fig|6666666.60966.peg.1456 | CDS | 1365648 | 1367945 | 3 | + | 2298 | Cyanophycin synthase | Cyanophycin | D23_1c1463 | Neut_1401 |
| (EC 6.3.2.29)(EC | Metabolism | |||||||||
| 6.3.2.30) | ||||||||||
| fig|6666666.60966.peg.1457 | CDS | 1367966 | 1370572 | 2 | + | 2607 | Cyanophycin synthase | Cyanophycin | D23_1c1464 | Neut_1402 |
| (EC 6.3.2.29)(EC | Metabolism | |||||||||
| 6.3.2.30) | ||||||||||
| fig|6666666.60966.peg.1458 | CDS | 1371664 | 1370720 | −1 | − | 945 | Copper-containing | Denitrification; | D23_1c1465 | Neut_1403 |
| nitrite reductase (EC | <br>Denitrifying | |||||||||
| 1.7.2.1) | reductase gene clusters | |||||||||
| fig|6666666.60966.peg.1459 | CDS | 1372091 | 1371708 | −2 | − | 384 | cytochrome c, class IC | -none- | D23_1c1466 | Neut_1404 |
| fig|6666666.60966.peg.1460 | CDS | 1372789 | 1372091 | −1 | − | 699 | Cytochrome c, class I | -none- | D23_1c1467 | Neut_1405 |
| fig|6666666.60966.peg.1461 | CDS | 1373888 | 1372827 | −2 | − | 1062 | Multicopper oxidase | Copper homeostasis | D23_1c1468 | Neut_1406 |
| fig|6666666.60966.peg.1462 | CDS | 1374021 | 1374137 | 3 | + | 117 | hypothetical protein | -none- | D23_1c1469 | NA |
| fig|6666666.60966.peg.1463 | CDS | 1374189 | 1374653 | 3 | + | 465 | Nitrite-sensitive | Nitrosative stress; | D23_1c1470 | Neut_1407 |
| transcriptional | <br>Oxidative stress; | |||||||||
| repressor NsrR | <br>Rrf2 family | |||||||||
| transcriptional | ||||||||||
| regulators | ||||||||||
| fig|6666666.60966.peg.1464 | CDS | 1378537 | 1374641 | −1 | − | 3897 | FIG00858660: | -none- | D23_1c1471 | Neut_1408 |
| hypothetical protein | ||||||||||
| fig|6666666.60966.peg.1465 | CDS | 1380248 | 1378539 | −2 | − | 1710 | Outer membrane | -none- | D23_1c1472 | Neut_1409 |
| protein | ||||||||||
| fig|6666666.60966.peg.1466 | CDS | 1380471 | 1380340 | −3 | − | 132 | hypothetical protein | -none- | D23_1c1473 | NA |
| fig|6666666.60966.peg.1467 | CDS | 1380491 | 1381141 | 2 | + | 651 | Uracil-DNA glycosylase, | Uracil-DNA glycosylase | D23_1c1474 | Neut_1410 |
| family 5 | ||||||||||
| fig|6666666.60966.peg.1468 | CDS | 1381162 | 1381350 | 1 | + | 189 | putative isomerase | -none- | D23_1c1475 | Neut_1411 |
| fig|6666666.60966.peg.1469 | CDS | 1381364 | 1383178 | 2 | + | 1815 | Excinuclease ABC | DNA repair, UvrABC | D23_1c1476 | Neut_1412 |
| subunit C | system | |||||||||
| fig|6666666.60966.peg.1470 | CDS | 1383321 | 1384283 | 3 | + | 963 | Mobile element protein | -none- | D23_1c1477 | Neut_1746 |
| fig|6666666.60966.peg.1471 | CDS | 1384401 | 1384814 | 3 | + | 414 | ABC-type multidrug | CBSS-196164.1.peg.1690 | D23_1c1478 | NA |
| transport system, | ||||||||||
| permease component | ||||||||||
| fig|6666666.60966.peg.1472 | CDS | 1384811 | 1385149 | 2 | + | 339 | ABC-type multidrug | CBSS-196164.1.peg.1690 | D23_1c1479 | NA |
| transport system, | ||||||||||
| permease component | ||||||||||
| fig|6666666.60966.peg.1474 | CDS | 1385894 | 1388275 | 2 | + | 2382 | Penicillin acylase II | -none- | D23_1c1480 | Neut_1415 |
| fig|6666666.60966.peg.1475 | CDS | 1388559 | 1388395 | −3 | − | 165 | hypothetical protein | -none- | D23_1c1481 | NA |
| fig|6666666.60966.peg.1476 | CDS | 1388615 | 1389973 | 2 | + | 1359 | Response regulatory | -none- | D23_1c1482 | Neut_1416 |
| protein | ||||||||||
| fig|6666666.60966.peg.1477 | CDS | 1390014 | 1391603 | 3 | + | 1590 | Long-chain-fatty-acid-- | Biotin biosynthesis; | D23_1c1483 | Neut_1417 |
| CoAligase (EC 6.2.1.3) | <br>Biotin synthesis | |||||||||
| cluster; <br>Fatty acid | ||||||||||
| metabolism cluster | ||||||||||
| fig|6666666.60966.peg.1478 | CDS | 1391630 | 1392835 | 2 | + | 1206 | Diaminopimelate | Lysine Biosynthesis DAP | D23_1c1484 | Neut_1418 |
| decarboxylase (EC | Pathway, GJO scratch | |||||||||
| 4.1.1.20) | ||||||||||
| fig|6666666.60966.peg.1479 | CDS | 1392996 | 1394843 | 3 | + | 1848 | Asparagine synthetase | Cyanophycin | D23_1c1485 | Neut_1419 |
| [glutamine-hydrolyzing] | Metabolism; | |||||||||
| (EC 6.3.5.4) | <br>Glutamate and | |||||||||
| Aspartate uptake in | ||||||||||
| Bacteria; <br>Glutamine, | ||||||||||
| Glutamate, Aspartate | ||||||||||
| and Asparagine | ||||||||||
| Biosynthesis | ||||||||||
| fig|6666666.60966.peg.1480 | CDS | 1394795 | 1394911 | 2 | + | 117 | hypothetical protein | -none- | D23_1c1486 | NA |
| fig|6666666.60966.peg.1482 | CDS | 1395163 | 1395975 | 1 | + | 813 | FIG00858746: | -none- | D23_1c1488 | Neut_1420 |
| hypothetical protein | ||||||||||
| fig|6666666.60966.peg.1483 | CDS | 1397102 | 1396140 | −2 | − | 963 | Mobile element protein | -none- | D23_1c1490 | Neut_1746 |
| fig|6666666.60966.peg.1484 | CDS | 1397178 | 1397462 | 3 | + | 285 | COGs COG0226 | -none- | D23_1c1491 | Neut_1423 |
| fig|6666666.60966.peg.1485 | CDS | 1397455 | 1398681 | 1 | + | 1227 | FIG00859800: | -none- | D23_1c1492 | Neut_1424 |
| hypothetical protein | ||||||||||
| fig|6666666.60966.peg.1486 | CDS | 1398693 | 1401635 | 3 | + | 2943 | diguanylate | -none- | D23_1c1493 | Neut_1425 |
| cyclase/phosphodiesterase | ||||||||||
| (GGDEF & EAL | ||||||||||
| domains) with PAS/PAC | ||||||||||
| sensor(s) | ||||||||||
| fig|6666666.60966.peg.1488 | CDS | 1402082 | 1401924 | −2 | − | 159 | hypothetical protein | -none- | D23_1c1494 | NA |
| fig|6666666.60966.peg.1489 | CDS | 1402531 | 1402115 | −1 | − | 417 | OsmC/Ohr family | -none- | D23_1c1495 | Neut_1426 |
| protein | ||||||||||
| fig|6666666.60966.peg.1490 | CDS | 1403584 | 1402532 | −1 | − | 1053 | DNA polymerase III | CBSS-208964.1.peg.3988 | D23_1c1496 | Neut_1427 |
| delta subunit (EC | ||||||||||
| 2.7.7.7) | ||||||||||
| fig|6666666.60966.peg.1491 | CDS | 1404106 | 1403612 | −1 | − | 495 | LPS-assembly | CBSS- | D23_1c1497 | Neut_1428 |
| lipoprotein RlpB | 208964.1.peg.3988; | |||||||||
| precursor (Rare | <br>Lipopolysaccharide | |||||||||
| lipoprotein B) | assembly | |||||||||
| fig|6666666.60966.peg.1492 | CDS | 1406732 | 1404126 | −2 | − | 2607 | Leucyl-tRNA synthetase | CBSS- | D23_1c1498 | Neut_1429 |
| (EC 6.1.1.4) | 208964.1.peg.3988; | |||||||||
| <br>tRNA | ||||||||||
| aminoacylation, Leu | ||||||||||
| fig|6666666.60966.peg.1493 | CDS | 1406756 | 1407925 | 2 | + | 1170 | S- | CBSS- | D23_1c1499 | Neut_1430 |
| adenosylmethionine:tRNA | 211586.1.peg.2832; | |||||||||
| ribosyltransferase- | <br>Queuosine- | |||||||||
| isomerase (EC 5.—.—.—) | Archaeosine | |||||||||
| Biosynthesis; | ||||||||||
| <br>Scaffold proteins for | ||||||||||
| [4Fe—4S] cluster | ||||||||||
| assembly (MRP family); | ||||||||||
| <br>tRNA modification | ||||||||||
| Bacteria | ||||||||||
| fig|6666666.60966.peg.1494 | CDS | 1407922 | 1409007 | 1 | + | 1086 | tRNA-guanine | CBSS- | D23_1c1500 | Neut_1431 |
| transglycosylase (EC | 211586.1.peg.2832; | |||||||||
| 2.4.2.29) | <br>Queuosine- | |||||||||
| Archaeosine | ||||||||||
| Biosynthesis; | ||||||||||
| <br>Scaffold proteins for | ||||||||||
| [4Fe—4S] cluster | ||||||||||
| assembly (MRP family); | ||||||||||
| <br>tRNA modification | ||||||||||
| Bacteria | ||||||||||
| fig|6666666.60966.peg.1495 | CDS | 1409072 | 1409536 | 2 | + | 465 | Preprotein translocase | CBSS-211586.1.peg.2832 | D23_1c1501 | Neut_1432 |
| subunit YajC (TC | ||||||||||
| 3.A.5.1.1) | ||||||||||
| fig|6666666.60966.peg.1496 | CDS | 1409575 | 1411470 | 1 | + | 1896 | Protein-export | CBSS-211586.1.peg.2832 | D23_1c1502 | Neut_1433 |
| membrane protein | ||||||||||
| SecD (TC 3.A.5.1.1) | ||||||||||
| fig|6666666.60966.peg.1497 | CDS | 1411495 | 1412427 | 1 | + | 933 | Protein-export | CBSS-211586.1.peg.2832 | D23_1c1503 | Neut_1434 |
| membrane protein SecF | ||||||||||
| (TC 3.A.5.1.1) | ||||||||||
| fig|6666666.60966.peg.1498 | CDS | 1412467 | 1412844 | 1 | + | 378 | FIG028220: | -none- | D23_1c1504 | Neut_1435 |
| hypothetical protein co- | ||||||||||
| occurring with HEAT | ||||||||||
| repeat protein | ||||||||||
| fig|6666666.60966.peg.1499 | CDS | 1412897 | 1413628 | 2 | + | 732 | Ubiquinone/menaquinone | Menaquinone and | D23_1c1505 | Neut_1436 |
| biosynthesis | Phylloquinone | |||||||||
| methyltransferase UbiE | Biosynthesis; | |||||||||
| (EC 2.1.1.—) | <br>Ubiquinone | |||||||||
| Biosynthesis; | ||||||||||
| <br>Ubiquinone | ||||||||||
| Biosynthesis-gjo | ||||||||||
| fig|6666666.60966.peg.1500 | CDS | 1413802 | 1413680 | −1 | − | 123 | Agmatinase (EC | Arginine and Ornithine | D23_1c1506 | Neut_1437 |
| 3.5.3.11) | Degradation; | |||||||||
| <br>Polyamine | ||||||||||
| Metabolism | ||||||||||
| fig|6666666.60966.peg.1501 | CDS | 1414650 | 1413808 | −3 | − | 843 | Agmatinase (EC | Arginine and Ornithine | D23_1c1507 | Neut_1437 |
| 3.5.3.11) | Degradation; | |||||||||
| <br>Polyamine | ||||||||||
| Metabolism | ||||||||||
| fig|6666666.60966.peg.1502 | CDS | 1415255 | 1414815 | −2 | − | 441 | Lipoprotein signal | Lipoprotein Biosynthesis; | D23_1c1509 | Neut_1438 |
| peptidase (EC 3.4.23.36) | <br>Signal peptidase | |||||||||
| fig|6666666.60966.peg.1503 | CDS | 1415346 | 1415224 | −3 | − | 123 | hypothetical protein | -none- | D23_1c1510 | NA |
| fig|6666666.60966.peg.1504 | CDS | 1418173 | 1415339 | −1 | − | 2835 | Isoleucyl-tRNA | tRNA aminoacylation, Ile | D23_1c1511 | Neut_1439 |
| synthetase (EC 6.1.1.5) | ||||||||||
| fig|6666666.60966.peg.1505 | CDS | 1418945 | 1418148 | −2 | − | 798 | Riboflavin kinase (EC | Riboflavin, FMN and FAD | D23_1c1512 | Neut_1440 |
| 2.7.1.26)/FMN | metabolism; | |||||||||
| adenylyltransferase (EC | <br>Riboflavin, FMN and | |||||||||
| 2.7.7.2) | FAD metabolism; | |||||||||
| <br>Riboflavin, FMN and | ||||||||||
| FAD metabolism in | ||||||||||
| plants; <br>Riboflavin, | ||||||||||
| FMN and FAD | ||||||||||
| metabolism in plants; | ||||||||||
| <br>riboflavin to FAD; | ||||||||||
| <br>riboflavin to FAD | ||||||||||
| fig|6666666.60966.peg.1506 | CDS | 1419539 | 1419237 | −2 | − | 303 | possible sec- | -none- | D23_1c1513 | Neut_1441 |
| independent protein | ||||||||||
| translocase protein | ||||||||||
| TatC | ||||||||||
| fig|6666666.60966.peg.1507 | CDS | 1420011 | 1419886 | −3 | − | 126 | hypothetical protein | -none- | D23_1c1514 | Neut_1442 |
| fig|6666666.60966.peg.1508 | CDS | 1420112 | 1422079 | 2 | + | 1968 | Dipeptide-binding ABC | ABC transporter | D23_1c1514 | Neut_1442 |
| transporter, periplasmic | dipeptide (TC 3.A.1.5.2) | |||||||||
| substrate-binding | ||||||||||
| component (TC | ||||||||||
| 3.A.1.5.2) | ||||||||||
| fig|6666666.60966.peg.1509 | CDS | 1422089 | 1423066 | 2 | + | 978 | Oligopeptide transport | ABC transporter | D23_1c1515 | Neut_1443 |
| system permease | oligopeptide (TC | |||||||||
| protein OppB (TC | 3.A.1.5.1) | |||||||||
| 3.A.1.5.1) | ||||||||||
| fig|6666666.60966.peg.1511 | CDS | 1423196 | 1424851 | 2 | + | 1656 | DnaJ-class molecular | Protein chaperones | D23_1c1516 | Neut_1444 |
| chaperone CbpA | ||||||||||
| fig|6666666.60966.peg.1512 | CDS | 1424900 | 1425844 | 2 | + | 945 | DnaJ-class molecular | Protein chaperones | D23_1c1517 | Neut_1445 |
| chaperone CbpA | ||||||||||
| fig|6666666.60966.peg.1513 | CDS | 1425856 | 1426152 | 1 | + | 297 | InterPro IPR000551 | -none- | D23_1c1518 | Neut_1446 |
| fig|6666666.60966.peg.1514 | CDS | 1426240 | 1427103 | 1 | + | 864 | FIG00858431: | -none- | D23_1c1519 | Neut_1447 |
| hypothetical protein | ||||||||||
| fig|6666666.60966.peg.1515 | CDS | 1427120 | 1427659 | 2 | + | 540 | FAD pyrophosphatase | -none- | D23_1c1520 | Neut_1448 |
| (EC 3.6.1.18), projected | ||||||||||
| from PMID:18815383 | ||||||||||
| fig|6666666.60966.peg.1516 | CDS | 1428946 | 1428491 | −1 | − | 456 | Mobile element protein | -none- | D23_1c1522 | Neut_2502 |
| fig|6666666.60966.peg.1517 | CDS | 1429295 | 1428909 | −2 | − | 387 | Mobile element protein | -none- | D23_1c1523 | Neut_0884 |
| fig|6666666.60966.peg.1518 | CDS | 1430487 | 1429300 | −3 | − | 1188 | Mobile element protein | -none- | D23_1c1524 | Neut_2405 |
| fig|6666666.60966.peg.1519 | CDS | 1430505 | 1430621 | 3 | + | 117 | patatin family protein | -none- | D23_1c1525 | Neut_1317 |
| fig|6666666.60966.peg.1520 | CDS | 1430834 | 1430670 | −2 | − | 165 | hypothetical protein | -none- | D23_1c1526 | NA |
| fig|6666666.60966.peg.1521 | CDS | 1431909 | 1431424 | −3 | − | 486 | hypothetical protein | -none- | D23_1c1527 | Neut_1449 |
| fig|6666666.60966.peg.1522 | CDS | 1432156 | 1431899 | −1 | − | 258 | hypothetical protein | -none- | D23_1c1528 | Neut_1450 |
| fig|6666666.60966.peg.1523 | CDS | 1432650 | 1432159 | −3 | − | 492 | phage-related | -none- | D23_1c1529 | Neut_1451 |
| hypothetical protein | ||||||||||
| fig|6666666.60966.peg.1524 | CDS | 1432970 | 1432650 | −2 | − | 321 | hypothetical protein | -none- | D23_1c1530 | Neut_1452 |
| fig|6666666.60966.peg.1525 | CDS | 1433143 | 1432967 | −1 | − | 177 | hypothetical protein | -none- | D23_1c1531 | Neut_1453 |
| fig|6666666.60966.peg.1526 | CDS | 1434487 | 1433552 | −1 | − | 936 | hypothetical protein | -none- | D23_1c1533 | Neut_1454 |
| fig|6666666.60966.peg.1527 | CDS | 1437226 | 1434497 | −1 | − | 2730 | hypothetical protein | -none- | D23_1c1534 | Neut_1455 |
| fig|6666666.60966.peg.1528 | CDS | 1437449 | 1437267 | −2 | − | 183 | Phage protein | -none- | D23_1c1535 | Neut_1456 |
| fig|6666666.60966.peg.1529 | CDS | 1437694 | 1437467 | −1 | − | 228 | hypothetical protein | -none- | D23_1c1536 | Neut_1457 |
| fig|6666666.60966.peg.1530 | CDS | 1438472 | 1437702 | −2 | − | 771 | hypothetical protein | -none- | D23_1c1537 | Neut_1458 |
| fig|6666666.60966.peg.1531 | CDS | 1439638 | 1438469 | −1 | − | 1170 | hypothetical protein | -none- | D23_1c1538 | Neut_1459 |
| fig|6666666.60966.peg.1532 | CDS | 1441511 | 1439631 | −2 | − | 1881 | Phage tail length tape- | Phage tail proteins; | D23_1c1539 | Neut_1460 |
| measure protein | <br>Phage tail proteins 2 | |||||||||
| fig|6666666.60966.peg.1533 | CDS | 1442755 | 1441508 | −1 | − | 1248 | Mobile element protein | -none- | D23_1c1540 | Neut_0357 |
| fig|6666666.60966.peg.1534 | CDS | 1443390 | 1442854 | −3 | − | 537 | Phage protein | -none- | D23_1c1541 | Neut_1460 |
| fig|6666666.60966.peg.1535 | CDS | 1443638 | 1443390 | −2 | − | 249 | hypothetical protein | -none- | D23_1c1542 | Neut_1461 |
| fig|6666666.60966.peg.1536 | CDS | 1444027 | 1443677 | −1 | − | 351 | Phage protein | -none- | D23_1c1543 | Neut_1462 |
| fig|6666666.60966.peg.1537 | CDS | 1444752 | 1444036 | −3 | − | 717 | major tail protein, | -none- | D23_1c1544 | Neut_1463 |
| putative | ||||||||||
| fig|6666666.60966.peg.1538 | CDS | 1445120 | 1444758 | −2 | − | 363 | hypothetical protein | -none- | D23_1c1545 | Neut_1464 |
| fig|6666666.60966.peg.1539 | CDS | 1445638 | 1445117 | −1 | − | 522 | FIG00959132: | -none- | D23_1c1546 | Neut_1465 |
| hypothetical protein | ||||||||||
| fig|6666666.60966.peg.1540 | CDS | 1445985 | 1445650 | −3 | − | 336 | Phage protein | -none- | D23_1c1547 | Neut_1466 |
| fig|6666666.60966.peg.1541 | CDS | 1446544 | 1445987 | −1 | − | 558 | Similar to Gene Transfer | -none- | D23_1c1548 | Neut_1467 |
| Agent (GTA) ORFG06 | ||||||||||
| fig|6666666.60966.peg.1542 | CDS | 1446900 | 1446601 | −3 | − | 300 | hypothetical protein | -none- | D23_1c1549 | Neut_1468 |
| fig|6666666.60966.peg.1543 | CDS | 1448136 | 1446910 | −3 | − | 1227 | Phage major capsid | Phage capsid proteins | D23_1c1550 | Neut_1469 |
| protein | ||||||||||
| fig|6666666.60966.peg.1544 | CDS | 1448949 | 1448218 | −3 | − | 732 | Prophage Clp protease- | cAMP signaling in | D23_1c1551 | Neut_1470 |
| like protein | bacteria | |||||||||
| fig|6666666.60966.peg.1545 | CDS | 1450207 | 1448915 | −1 | − | 1293 | Phage portal protein | Phage packaging | D23_1c1552 | Neut_1471 |
| machinery | ||||||||||
| fig|6666666.60966.peg.1546 | CDS | 1451877 | 1450204 | −3 | − | 1674 | Phage terminase large | Phage packaging | D23_1c1553 | Neut_1472 |
| subunit | machinery | |||||||||
| fig|6666666.60966.peg.1547 | CDS | 1452346 | 1451882 | −1 | − | 465 | Phage terminase, small | Phage packaging | D23_1c1554 | Neut_1473 |
| subunit | machinery | |||||||||
| fig|6666666.60966.peg.1548 | CDS | 1452801 | 1452478 | −3 | − | 324 | Phage holin | -none- | D23_1c1555 | Neut_1474 |
| fig|6666666.60966.peg.1549 | CDS | 1453267 | 1452887 | −1 | − | 381 | hypothetical protein | -none- | D23_1c1556 | Neut_1475 |
| fig|6666666.60966.peg.1550 | CDS | 1453430 | 1453269 | −2 | − | 162 | hypothetical protein | -none- | D23_1c1557 | NA |
| fig|6666666.60966.peg.1551 | CDS | 1453630 | 1453451 | −1 | − | 180 | hypothetical protein | -none- | D23_1c1558 | NA |
| fig|6666666.60966.peg.1552 | CDS | 1453862 | 1453623 | −2 | − | 240 | hypothetical protein | -none- | D23_1c1559 | Neut_1477 |
| fig|6666666.60966.peg.1553 | CDS | 1456504 | 1454171 | −1 | − | 2334 | DNA primase, phage | -none- | D23_1c1560 | Neut_1478 |
| associated # P4-type | ||||||||||
| fig|6666666.60966.peg.1554 | CDS | 1456740 | 1456501 | −3 | − | 240 | hypothetical protein | -none- | D23_1c1561 | NA |
| fig|6666666.60966.peg.1555 | CDS | 1456744 | 1456887 | 1 | + | 144 | Phage-related protein | -none- | D23_1c1562 | Neut_1480 |
| fig|6666666.60966.peg.1556 | CDS | 1456894 | 1457172 | 1 | + | 279 | Helix-turn-helix motif | -none- | D23_1c1563 | Neut_1481 |
| fig|6666666.60966.peg.1557 | CDS | 1457678 | 1457277 | −2 | − | 402 | hypothetical protein | -none- | D23_1c1564 | NA |
| fig|6666666.60966.peg.1558 | CDS | 1458137 | 1458478 | 2 | + | 342 | hypothetical protein | -none- | D23_1c1565 | NA |
| fig|6666666.60966.peg.1559 | CDS | 1458868 | 1459158 | 1 | + | 291 | hypothetical protein | -none- | D23_1c1566 | NA |
| fig|6666666.60966.peg.1561 | CDS | 1459812 | 1459672 | −3 | − | 141 | hypothetical protein | -none- | D23_1c1567 | NA |
| fig|6666666.60966.peg.1563 | CDS | 1460270 | 1460563 | 2 | + | 294 | Mobile element protein | -none- | D23_1c1568 | Neut_1719 |
| fig|6666666.60966.peg.1564 | CDS | 1460662 | 1461540 | 1 | + | 879 | Mobile element protein | -none- | D23_1c1569 | Neut_1720 |
| fig|6666666.60966.peg.1565 | CDS | 1462142 | 1461954 | −2 | − | 189 | hypothetical protein | -none- | D23_1c1570 | Neut_1489 |
| fig|6666666.60966.peg.1567 | CDS | 1462722 | 1462844 | 3 | + | 123 | hypothetical protein | -none- | D23_1c1571 | NA |
| fig|6666666.60966.peg.1568 | CDS | 1463137 | 1463829 | 1 | + | 693 | putative nuclease | -none- | D23_1c1572 | Neut_1491 |
| fig|6666666.60966.peg.1569 | CDS | 1464806 | 1463826 | −2 | − | 981 | Abortive infection | -none- | D23_1c1573 | NA |
| bacteriophage | ||||||||||
| resistance protein | ||||||||||
| fig|6666666.60966.peg.1570 | CDS | 1466353 | 1465106 | −1 | − | 1248 | Mobile element protein | -none- | D23_1c1574 | Neut_0357 |
| fig|6666666.60966.peg.1573 | CDS | 1466953 | 1467108 | 1 | + | 156 | hypothetical protein | -none- | D23_1c1575 | NA |
| fig|6666666.60966.peg.1574 | CDS | 1467105 | 1467389 | 3 | + | 285 | hypothetical protein | -none- | D23_1c1576 | Neut_1493 |
| fig|6666666.60966.peg.1575 | CDS | 1467386 | 1467868 | 2 | + | 483 | hypothetical protein | -none- | D23_1c1577 | Neut_1494 |
| fig|6666666.60966.peg.1576 | CDS | 1467883 | 1468245 | 1 | + | 363 | hypothetical protein | -none- | D23_1c1578 | Neut_1495 |
| fig|6666666.60966.peg.1577 | CDS | 1468255 | 1468638 | 1 | + | 384 | hypothetical protein | -none- | D23_1c1579 | Neut_1496 |
| fig|6666666.60966.peg.1580 | CDS | 1469337 | 1470362 | 3 | + | 1026 | Integrase | -none- | D23_1c1580 | Neut_1498 |
| fig|6666666.60966.peg.1581 | CDS | 1470687 | 1470989 | 3 | + | 303 | Exodeoxyribonuclease | DNA repair, bacterial; | D23_1c1582 | Neut_1499 |
| VII small subunit (EC | <br>Purine salvage | |||||||||
| 3.1.11.6) | cluster | |||||||||
| fig|6666666.60966.peg.1582 | CDS | 1470979 | 1471872 | 1 | + | 894 | Octaprenyl diphosphate | Isoprenoid Biosynthesis; | D23_1c1583 | Neut_1500 |
| synthase (EC 2.5.1.90)/ | <br>Isoprenoid | |||||||||
| Dimethylallyltransferase | Biosynthesis; | |||||||||
| (EC 2.5.1.1)/(2E,6E)- | <br>Isoprenoid | |||||||||
| farnesyl diphosphate | Biosynthesis: | |||||||||
| synthase (EC 2.5.1.10)/ | Interconversions; | |||||||||
| Geranylgeranyl | <br>Isoprenoinds for | |||||||||
| diphosphate synthase | Quinones; | |||||||||
| (EC 2.5.1.29) | <br>Isoprenoinds for | |||||||||
| Quinones; | ||||||||||
| <br>Isoprenoinds for | ||||||||||
| Quinones; | ||||||||||
| <br>Isoprenoinds for | ||||||||||
| Quinones; | ||||||||||
| <br>Polyprenyl | ||||||||||
| Diphosphate | ||||||||||
| Biosynthesis; | ||||||||||
| <br>Polyprenyl | ||||||||||
| Diphosphate | ||||||||||
| Biosynthesis; | ||||||||||
| <br>Polyprenyl | ||||||||||
| Diphosphate | ||||||||||
| Biosynthesis | ||||||||||
| fig|6666666.60966.peg.1583 | CDS | 1471935 | 1473779 | 3 | + | 1845 | 1-deoxy-D-xylulose 5- | Isoprenoid Biosynthesis; | D23_1c1584 | Neut_1501 |
| phosphate synthase (EC | <br>Nonmevalonate | |||||||||
| 2.2.1.7) | Branch of Isoprenoid | |||||||||
| Biosynthesis; | ||||||||||
| <br>Pyridoxin (Vitamin | ||||||||||
| B6) Biosynthesis; | ||||||||||
| <br>Thiamin | ||||||||||
| biosynthesis | ||||||||||
| fig|6666666.60966.peg.1584 | CDS | 1473895 | 1474698 | 1 | + | 804 | GTP cyclohydrolase I | Folate Biosynthesis; | D23_1c1585 | Neut_1502 |
| (EC 3.5.4.16) type 2 | <br>Queuosine- | |||||||||
| Archaeosine | ||||||||||
| Biosynthesis; <br>Zinc | ||||||||||
| regulated enzymes | ||||||||||
| fig|6666666.60966.peg.1585 | CDS | 1474865 | 1475485 | 2 | + | 621 | InterPro IPR005134 | -none- | D23_1c1586 | Neut_1503 |
| COGs COG2862 | ||||||||||
| fig|6666666.60966.peg.1586 | CDS | 1476254 | 1475514 | −2 | − | 741 | FolM Alternative | Folate Biosynthesis | D23_1c1587 | Neut_1504 |
| dihydrofolate reductase 1 | ||||||||||
| fig|6666666.60966.peg.1587 | CDS | 1476327 | 1477502 | 3 | + | 1176 | COG1565: | -none- | D23_1c1588 | Neut_1505 |
| Uncharacterized | ||||||||||
| conserved protein | ||||||||||
| fig|6666666.60966.peg.1588 | CDS | 1478242 | 1477499 | −1 | − | 744 | 5'- | Adenosyl nucleosidases; | D23_1c1589 | Neut_1506 |
| methylthioadenosine | <br>Adenosyl | |||||||||
| nucleosidase (EC | nucleosidases; | |||||||||
| 3.2.2.16)/S- | <br>CBSS- | |||||||||
| adenosylhomocysteine | 320388.3.peg.3759; | |||||||||
| nucleosidase (EC | <br>CBSS- | |||||||||
| 3.2.2.9) | 320388.3.peg.3759; | |||||||||
| <br>Methionine | ||||||||||
| Biosynthesis; | ||||||||||
| <br>Methionine | ||||||||||
| Degradation; | ||||||||||
| <br>Polyamine | ||||||||||
| Metabolism | ||||||||||
| fig|6666666.60966.peg.1589 | CDS | 1480269 | 1478239 | −3 | − | 2031 | Squalene--hopene | CBSS- | D23_1c1590 | Neut_1507 |
| cyclase (EC 5.4.99.17) | 320388.3.peg.3759; | |||||||||
| <br>Hopanes | ||||||||||
| fig|6666666.60966.peg.1590 | CDS | 1481103 | 1480384 | −3 | − | 720 | Surface lipoprotein | -none- | D23_1c1591 | Neut_1508 |
| fig|6666666.60966.peg.1591 | CDS | 1481997 | 1481389 | −3 | − | 609 | Ferric siderophore | Ton and Tol transport | D23_1c1592 | Neut_1509 |
| transport system, | systems | |||||||||
| biopolymer transport | ||||||||||
| protein ExbB | ||||||||||
| fig|6666666.60966.peg.1592 | CDS | 1482298 | 1483644 | 1 | + | 1347 | Exodeoxyribonuclease | DNA repair, bacterial; | D23_1c1594 | Neut_1510 |
| VII large subunit (EC | <br>Purine salvage | |||||||||
| 3.1.11.6) | cluster | |||||||||
| fig|6666666.60966.peg.1593 | CDS | 1483709 | 1484089 | 2 | + | 381 | COG2363 | -none- | D23_1c1595 | Neut_1511 |
| fig|6666666.60966.peg.1594 | CDS | 1484150 | 1485328 | 2 | + | 1179 | 23S rRNA (guanine-N-2-)- | RNA methylation | D23_1c1596 | Neut_1512 |
| methyltransferase | ||||||||||
| rlmL EC 2.1.1.—) | ||||||||||
| fig|6666666.60966.peg.1595 | CDS | 1485345 | 1485833 | 3 | + | 489 | Periplasmic | Biogenesis of c-type | D23_1c1597 | Neut_1513 |
| thiol:disulfide | cytochromes; | |||||||||
| oxidoreductase DsbB, | <br>Periplasmic disulfide | |||||||||
| required for DsbA | interchange | |||||||||
| reoxidation | ||||||||||
| fig|6666666.60966.peg.1596 | CDS | 1486114 | 1486503 | 1 | + | 390 | Endoribonuclease L-PSP | CBSS- | D23_1c1598 | Neut_1514 |
| 176299.4.peg.1996A | ||||||||||
| fig|6666666.60966.peg.1598 | CDS | 1486998 | 1486651 | −3 | − | 348 | FIG016027: protein of | -none- | D23_1c1599 | Neut_1515 |
| unknown function YeaO | ||||||||||
| fig|6666666.60966.peg.1599 | CDS | 1487053 | 1487727 | 1 | + | 675 | AttE component of | AttEFGH ABC Transport | D23_1c1600 | Neut_1516 |
| AttEFGH ABC transport | System | |||||||||
| system | ||||||||||
| fig|6666666.60966.peg.1600 | CDS | 1487724 | 1490273 | 3 | + | 2550 | AttF component of | AttEFGH ABC Transport | D23_1c1601 | Neut_1517 |
| AttEFGH ABC transport | System; <br>AttEFGH | |||||||||
| system/AttG | ABC Transport System | |||||||||
| component of AttEFGH | ||||||||||
| ABC transport system | ||||||||||
| fig|6666666.60966.peg.1601 | CDS | 1490273 | 1491343 | 2 | + | 1071 | AttH component of | AttEFGH ABC Transport | D23_1c1602 | Neut_1518 |
| AttEFGH ABC transport | System | |||||||||
| system | ||||||||||
| fig|6666666.60966.peg.1602 | CDS | 1491424 | 1491666 | 1 | + | 243 | Molybdopterin | -none- | D23_1c1603 | Neut_1519 |
| biosynthesis protein B | ||||||||||
| fig|6666666.60966.peg.1603 | CDS | 1491738 | 1491619 | −3 | − | 120 | hypothetical protein | -none- | D23_1c1604 | NA |
| fig|6666666.60966.peg.1605 | CDS | 1492158 | 1492982 | 3 | + | 825 | Particulate methane | Particulate methane | D23_1c1605 | Neut_1520 |
| monooxygenase C- | monooxygenase | |||||||||
| subunit (EC 1.14.13.25) | (pMMO) | |||||||||
| fig|6666666.60966.peg.1607 | CDS | 1494238 | 1493309 | −1 | − | 930 | Cytochrome c551 | Protection from Reactive | D23_1c1607 | Neut_1521 |
| peroxidase (EC 1.11.1.5) | Oxygen Species | |||||||||
| fig|6666666.60966.peg.1609 | CDS | 1494804 | 1495091 | 3 | + | 288 | Mobile element protein | -none- | D23_1c1608 | Neut_2502 |
| fig|6666666.60966.peg.1611 | CDS | 1495989 | 1495288 | −3 | − | 702 | 2-C-methyl-D-erythritol | Isoprenoid Biosynthesis; | D23_1c1609 | Neut_1525 |
| 4-phosphate | <br>Nonmevalonate | |||||||||
| cytidylyltransferase (EC | Branch of Isoprenoid | |||||||||
| 2.7.7.60) | Biosynthesis; | |||||||||
| <br>Possible RNA | ||||||||||
| degradation cluster; | ||||||||||
| <br>Stationary phase | ||||||||||
| repair cluster | ||||||||||
| fig|6666666.60966.peg.1612 | CDS | 1496057 | 1496497 | 2 | + | 441 | Inosine-5'- | Purine conversions; | D23_1c1610 | Neut_1526 |
| monophosphate | <br>Purine salvage | |||||||||
| dehydrogenase (EC | cluster | |||||||||
| 1.1.1.205) | ||||||||||
| fig|6666666.60966.peg.1613 | CDS | 1497472 | 1496552 | −1 | − | 921 | Cell division protein | Bacterial Cell Division; | D23_1c1611 | Neut_1527 |
| FtsX | <br>Heat shock Cell | |||||||||
| division Proteases and a | ||||||||||
| Methyltransferase | ||||||||||
| fig|6666666.60966.peg.1614 | CDS | 1498131 | 1497469 | −3 | − | 663 | Cell division | Bacterial Cell Division; | D23_1c1612 | Neut_1528 |
| transporter, ATP- | <br>Heat shock Cell | |||||||||
| binding protein FtsE (TC | division Proteases and a | |||||||||
| 3.A.5.1.1) | Methyltransferase | |||||||||
| fig|6666666.60966.peg.1615 | CDS | 1499195 | 1498158 | −2 | − | 1038 | Signal recognition | Bacterial Cell Division; | D23_1c1613 | Neut_1529 |
| particle receptor | <br>Bacterial signal | |||||||||
| protein FtsY (=alpha | recognition particle | |||||||||
| subunit) (TC 3.A.5.1.1) | (SRP); <br>Heat shock | |||||||||
| Cell division Proteases | ||||||||||
| and a Methyltransferase; | ||||||||||
| <br>Universal GTPases | ||||||||||
| fig|6666666.60966.peg.1616 | CDS | 1499262 | 1500653 | 3 | + | 1392 | FIG015547: peptidase, | -none- | D23_1c1614 | Neut_1530 |
| M16 family | ||||||||||
| fig|6666666.60966.peg.1617 | CDS | 1500780 | 1501865 | 3 | + | 1086 | Alanine racemase (EC | Alanine biosynthesis; | D23_1c1615 | Neut_1531 |
| 5.1.1.1) | <br>Pyruvate Alanine | |||||||||
| Serine Interconversions | ||||||||||
| fig|6666666.60966.peg.1618 | CDS | 1502688 | 1501894 | −3 | − | 795 | Peptidyl-prolyl cis-trans | Queuosine-Archaeosine | D23_1c1616 | Neut_1532 |
| isomerase (EC 5.2.1.8) | Biosynthesis | |||||||||
| fig|6666666.60966.peg.1619 | CDS | 1502854 | 1502738 | −1 | − | 117 | hypothetical protein | -none- | D23_1c1617 | NA |
| fig|6666666.60966.peg.1620 | CDS | 1503164 | 1502862 | −2 | − | 303 | YciL protein | Broadly distributed | D23_1c1618 | Neut_1533 |
| proteins not in | ||||||||||
| subsystems; <br>CBSS- | ||||||||||
| 211586.9.peg.2729 | ||||||||||
| fig|6666666.60966.peg.1621 | CDS | 1504431 | 1503277 | −3 | − | 1155 | Rubredoxin-NAD(+) | Rubrerythrin | D23_1c1619 | Neut_1534 |
| reductase (EC 1.18.1.1) | ||||||||||
| fig|6666666.60966.peg.1622 | CDS | 1504748 | 1505626 | 2 | + | 879 | Probable protease htpX | -none- | D23_1c1620 | Neut_1535 |
| homolog (EC 3.4.24.—) | ||||||||||
| fig|6666666.60966.peg.1623 | CDS | 1505626 | 1505739 | 1 | + | 114 | hypothetical protein | -none- | D23_1c1621 | NA |
| fig|6666666.60966.peg.1624 | CDS | 1506477 | 1505698 | −3 | − | 780 | Surface lipoprotein | -none- | D23_1c1622 | Neut_1536 |
| fig|6666666.60966.peg.1625 | CDS | 1507909 | 1506626 | −1 | − | 1284 | Glutamate-1- | CBSS-196164.1.peg.461; | D23_1c1623 | Neut_1537 |
| semialdehyde | <br>Heme and Siroheme | |||||||||
| aminotransferase (EC | Biosynthesis | |||||||||
| 5.4.3.8) | ||||||||||
| fig|6666666.60966.peg.1626 | CDS | 1508584 | 1507946 | −1 | − | 639 | Thiamin-phosphate | 5-FCL-like protein; | D23_1c1624 | Neut_1538 |
| pyrophosphorylase (EC | <br>Thiamin | |||||||||
| 2.5.1.3) | biosynthesis | |||||||||
| fig|6666666.60966.peg.1627 | CDS | 1509419 | 1508577 | −2 | − | 843 | Phosphomethylpyrimidine | 5-FCL-like protein; | D23_1c1625 | Neut_1539 |
| kinase (EC 2.7.4.7) | <br>Thiamin | |||||||||
| biosynthesis | ||||||||||
| fig|6666666.60966.peg.1628 | CDS | 1509508 | 1509660 | 1 | + | 153 | Rubredoxin | Rubrerythrin | D23_1c1626 | Neut_1540 |
| fig|6666666.60966.peg.1629 | CDS | 1509660 | 1510049 | 3 | + | 390 | Lactoylglutathione lyase | Glutathione: Non-redox | D23_1c1627 | Neut_1541 |
| (EC 4.4.1.5) | reactions; | |||||||||
| <br>Methylglyoxal | ||||||||||
| Metabolism | ||||||||||
| fig|6666666.60966.peg.1630 | CDS | 1510238 | 1510603 | 2 | + | 366 | probable iron binding | -none- | D23_1c1628 | Neut_1542 |
| protein from the | ||||||||||
| HesB_IscA_SufA family | ||||||||||
| fig|6666666.60966.peg.1631 | CDS | 1511703 | 1510612 | −3 | − | 1092 | Anhydro-N- | Recycling of | D23_1c1629 | Neut_1543 |
| acetylmuramic acid | Peptidoglycan Amino | |||||||||
| kinase (EC 2.7.1.—) | Sugars | |||||||||
| fig|6666666.60966.peg.1632 | CDS | 1513070 | 1511739 | −2 | − | 1332 | Peptidase, M23/M37 | -none- | D23_1c1630 | Neut_1544 |
| family | ||||||||||
| fig|6666666.60966.peg.1633 | CDS | 1513163 | 1514383 | 2 | + | 1221 | Tyrosyl-tRNA | tRNA aminoacylation, | D23_1c1631 | Neut_1545 |
| synthetase (EC 6.1.1.1) | Tyr | |||||||||
| fig|6666666.60966.peg.1634 | CDS | 1514577 | 1515674 | 3 | + | 1098 | Myo-inositol 2- | -none- | D23_1c1632 | Neut_1547 |
| dehydrogenase (EC | ||||||||||
| 1.1.1.18) | ||||||||||
| fig|6666666.60966.peg.1635 | CDS | 1515687 | 1516748 | 3 | + | 1062 | N-Acetylneuraminate | CMP-N- | D23_1c1633 | Neut_1548 |
| cytidylyltransferase (EC | acetylneuraminate | |||||||||
| 2.7.7.43) | Biosynthesis; <br>Sialic | |||||||||
| Acid Metabolism | ||||||||||
| fig|6666666.60966.peg.1636 | CDS | 1516926 | 1518425 | 3 | + | 1500 | N-acetylneuraminate | CMP-N- | D23_1c1634 | Neut_1549 |
| synthase (EC 2.5.1.56) | acetylneuraminate | |||||||||
| Biosynthesis; <br>Sialic | ||||||||||
| Acid Metabolism | ||||||||||
| fig|6666666.60966.peg.1637 | CDS | 1518919 | 1518437 | −1 | − | 483 | Ribonucleotide | Ribonucleotide | D23_1c1635 | Neut_1551 |
| reductase | redcution | |||||||||
| transcriptional | ||||||||||
| regulator NrdR | ||||||||||
| fig|6666666.60966.peg.1638 | CDS | 1520246 | 1518996 | −2 | − | 1251 | Serine | 5-FCL-like protein; | D23_1c1636 | Neut_1552 |
| hydroxymethyltransferase | <br>Glycine | |||||||||
| (EC 2.1.2.1) | Biosynthesis; | |||||||||
| <br>Glycine and Serine | ||||||||||
| Utilization; | ||||||||||
| <br>Photorespiration | ||||||||||
| (oxidative C2 cycle); | ||||||||||
| <br>Serine Biosynthesis | ||||||||||
| fig|6666666.60966.peg.1639 | CDS | 1520440 | 1521180 | 1 | + | 741 | PqqC-like protein | Folate Biosynthesis | D23_1c1638 | Neut_1553 |
| fig|6666666.60966.peg.1640 | CDS | 1522218 | 1521283 | −3 | − | 936 | Transcriptional | LysR-family proteins in | D23_1c1639 | Neut_1554 |
| activator MetR | Escherichia coli; | |||||||||
| <br>LysR-family proteins | ||||||||||
| in Salmonella enterica | ||||||||||
| Typhimurium; | ||||||||||
| <br>Methionine | ||||||||||
| Biosynthesis | ||||||||||
| fig|6666666.60966.peg.1641 | CDS | 1522318 | 1524594 | 1 | + | 2277 | 5- | Methionine Biosynthesis | D23_1c1640 | Neut_1555 |
| methyltetrahydropteroyltriglutamate-- | ||||||||||
| homocysteine | ||||||||||
| methyltransferase (EC | ||||||||||
| 2.1.1.14) | ||||||||||
| fig|6666666.60966.peg.1643 | CDS | 1526020 | 1524767 | −1 | − | 1254 | UDP-N- | Peptidoglycan | D23_1c1641 | Neut_1556 |
| acetylglucosamine 1- | Biosynthesis; <br>UDP- | |||||||||
| carboxyvinyltransferase | N-acetylmuramate from | |||||||||
| (EC 2.5.1.7) | Fructose-6-phosphate | |||||||||
| Biosynthesis | ||||||||||
| fig|6666666.60966.peg.1644 | CDS | 1526108 | 1526497 | 2 | + | 390 | Putative translation | -none- | D23_1c1642 | Neut_1557 |
| initiation inhibitor, yjgF | ||||||||||
| family | ||||||||||
| fig|6666666.60966.peg.1645 | CDS | 1526528 | 1528585 | 2 | + | 2058 | ATP-dependent DNA | -none- | D23_1c1643 | Neut_1558 |
| helicase RecG (EC | ||||||||||
| 3.6.1.—) | ||||||||||
| fig|6666666.60966.peg.1646 | CDS | 1529436 | 1528588 | −3 | − | 849 | Hypothetical ATP- | -none- | D23_1c1644 | Neut_1559 |
| binding protein | ||||||||||
| UPF0042, contains P- | ||||||||||
| loop | ||||||||||
| fig|6666666.60966.peg.1647 | CDS | 1529521 | 1530072 | 1 | + | 552 | Transcription | CBSS-243265.1.peg.198; | D23_1c1645 | Neut_1560 |
| elongation factor GreB | <br>Transcription | |||||||||
| factors bacterial | ||||||||||
| fig|6666666.60966.peg.1648 | CDS | 1532787 | 1530136 | −3 | − | 2652 | Malto-oligosyltrehalose | -none- | D23_1c1646 | NA |
| synthase (EC 5.4.99.15) | ||||||||||
| fig|6666666.60966.peg.1649 | CDS | 1533038 | 1532850 | −2 | − | 189 | hypothetical protein | -none- | D23_1c1647 | NA |
| fig|6666666.60966.peg.1650 | CDS | 1534716 | 1533031 | −3 | − | 1686 | Malto-oligosyltrehalose | -none- | D23_1c1648 | Neut_1291 |
| trehalohydrolase (EC | ||||||||||
| 3.2.1.141) | ||||||||||
| fig|6666666.60966.peg.1651 | CDS | 1535327 | 1534896 | −2 | − | 432 | Trehalose synthase, | -none- | D23_1c1649 | NA |
| nucleoside diphosphate | ||||||||||
| glucose dependent | ||||||||||
| fig|6666666.60966.peg.1652 | CDS | 1535502 | 1535386 | −3 | − | 117 | hypothetical protein | -none- | D23_1c1650 | NA |
| fig|6666666.60966.peg.1653 | CDS | 1535501 | 1536028 | 2 | + | 528 | Sensory histidine kinase | -none- | D23_1c1651 | Neut_1565 |
| QseC | ||||||||||
| fig|6666666.60966.peg.1654 | CDS | 1535992 | 1536651 | 1 | + | 660 | Sensory histidine kinase | -none- | D23_1c1652 | Neut_1565 |
| QseC | ||||||||||
| fig|6666666.60966.peg.1655 | CDS | 1537148 | 1537849 | 2 | + | 702 | Protein of unknown | -none- | D23_1c1653 | Neut_1566 |
| function DUF484 | ||||||||||
| fig|6666666.60966.peg.1656 | CDS | 1537833 | 1538798 | 3 | + | 966 | Tyrosine recombinase | -none- | D23_1c1654 | Neut_1567 |
| XerC | ||||||||||
| fig|6666666.60966.peg.1657 | CDS | 1539747 | 1538845 | −3 | − | 903 | Arogenate | Chorismate Synthesis; | D23_1c1655 | Neut_1568 |
| dehydrogenase (EC | <br>Phenylalanine and | |||||||||
| 1.3.1.43) | Tyrosine Branches from | |||||||||
| Chorismate | ||||||||||
| fig|6666666.60966.peg.1658 | CDS | 1540893 | 1539775 | −3 | − | 1119 | Biosynthetic Aromatic | Phenylalanine and | D23_1c1656 | Neut_1569 |
| amino acid | Tyrosine Branches from | |||||||||
| aminotransferase beta | Chorismate | |||||||||
| (EC 2.6.1.57) | ||||||||||
| fig|6666666.60966.peg.1659 | CDS | 1541973 | 1540915 | −3 | − | 1059 | Chorismate mutase I | Chorismate Synthesis; | D23_1c1657 | Neut_1570 |
| (EC 5.4.99.5)/ | <br>Chorismate | |||||||||
| Prephenate | Synthesis; | |||||||||
| dehydratase (EC | <br>Phenylalanine and | |||||||||
| 4.2.1.51) | Tyrosine Branches from | |||||||||
| Chorismate; | ||||||||||
| <br>Phenylalanine and | ||||||||||
| Tyrosine Branches from | ||||||||||
| Chorismate | ||||||||||
| fig|6666666.60966.peg.1660 | CDS | 1543230 | 1542013 | −3 | − | 1218 | D-3-phosphoglycerate | Glycine and Serine | D23_1c1658 | Neut_1571 |
| dehydrogenase (EC | Utilization; | |||||||||
| 1.1.1.95) | <br>Pyridoxin (Vitamin | |||||||||
| B6) Biosynthesis; | ||||||||||
| <br>Serine Biosynthesis | ||||||||||
| fig|6666666.60966.peg.1661 | CDS | 1544329 | 1543223 | −1 | − | 1107 | Phosphoserine | Glycine and Serine | D23_1c1659 | Neut_1572 |
| aminotransferase (EC | Utilization; | |||||||||
| 2.6.1.52) | <br>Pyridoxin (Vitamin | |||||||||
| B6) Biosynthesis; | ||||||||||
| <br>Serine Biosynthesis | ||||||||||
| fig|6666666.60966.peg.1662 | CDS | 1546893 | 1544347 | −3 | − | 2547 | DNA gyrase subunit A | Cell Division Subsystem | D23_1c1660 | Neut_1573 |
| (EC 5.99.1.3) | including YidCD; | |||||||||
| <br>DNA gyrase | ||||||||||
| subunits; <br>DNA | ||||||||||
| replication cluster 1; | ||||||||||
| <br>DNA | ||||||||||
| topoisomerases, Type II, | ||||||||||
| ATP-dependent; | ||||||||||
| <br>Resistance to | ||||||||||
| fluoroquinolones | ||||||||||
| fig|6666666.60966.peg.1663 | CDS | 1547556 | 1546963 | −3 | − | 594 | COGs COG2854 | -none- | D23_1c1661 | Neut_1574 |
| fig|6666666.60966.peg.1664 | CDS | 1548691 | 1547573 | −1 | − | 1119 | Glycosyl transferase, | -none- | D23_1c1662 | Neut_1575 |
| family 2 | ||||||||||
| fig|6666666.60966.peg.1665 | CDS | 1549918 | 1548755 | −1 | − | 1164 | Possible Fe—S | -none- | D23_1c1663 | Neut_1576 |
| oxidoreductase | ||||||||||
| fig|6666666.60966.peg.1666 | CDS | 1550134 | 1550247 | 1 | + | 114 | hypothetical protein | -none- | D23_1c1664 | NA |
| fig|6666666.60966.peg.1668 | CDS | 1550439 | 1552481 | 3 | + | 2043 | Transketolase (EC | Calvin-Benson cycle; | D23_1c1666 | Neut_1577 |
| 2.2.1.1) | <br>Pentose phosphate | |||||||||
| pathway | ||||||||||
| fig|6666666.60966.peg.1669 | CDS | 1552544 | 1553551 | 2 | + | 1008 | NADPH-dependent | Calvin-Benson cycle; | D23_1c1667 | Neut_1578 |
| glyceraldehyde-3- | <br>Calvin-Benson cycle; | |||||||||
| phosphate | <br>Glycolysis and | |||||||||
| dehydrogenase (EC | Gluconeogenesis; | |||||||||
| 1.2.1.13)/NAD- | <br>Glycolysis and | |||||||||
| dependent | Gluconeogenesis; | |||||||||
| glyceraldehyde-3- | <br>Pyridoxin (Vitamin | |||||||||
| phosphate | B6) Biosynthesis | |||||||||
| dehydrogenase (EC | ||||||||||
| 1.2.1.12) | ||||||||||
| fig|6666666.60966.peg.1670 | CDS | 1553775 | 1553659 | −3 | − | 117 | hypothetical protein | -none- | D23_1c1668 | NA |
| fig|6666666.60966.peg.1671 | CDS | 1553870 | 1555048 | 2 | + | 1179 | Phosphoglycerate | Calvin-Benson cycle; | D23_1c1669 | Neut_1579 |
| kinase (EC 2.7.2.3) | <br>Glycolysis and | |||||||||
| Gluconeogenesis | ||||||||||
| fig|6666666.60966.peg.1672 | CDS | 1555083 | 1556573 | 3 | + | 1491 | Pyruvate kinase (EC | Glycerate metabolism; | D23_1c1670 | Neut_1580 |
| 2.7.1.40) | <br>Glycolysis and | |||||||||
| Gluconeogenesis; | ||||||||||
| <br>Pyruvate | ||||||||||
| metabolism I: | ||||||||||
| anaplerotic reactions, | ||||||||||
| PEP | ||||||||||
| fig|6666666.60966.peg.1673 | CDS | 1556682 | 1557746 | 3 | + | 1065 | Fructose-bisphosphate | Calvin-Benson cycle; | D23_1c1671 | Neut_1581 |
| aldolase class II (EC | <br>Glycolysis and | |||||||||
| 4.1.2.13) | Gluconeogenesis | |||||||||
| fig|6666666.60966.peg.1674 | CDS | 1558432 | 1560090 | 1 | + | 1659 | Cytochrome c oxidases | Terminal cytochrome C | D23_1c1672 | Neut_1582 |
| subunit CcoN (EC | oxidases | |||||||||
| 1.9.3.1) | ||||||||||
| fig|6666666.60966.peg.1675 | CDS | 1560080 | 1560688 | 2 | + | 609 | Cytochrome c oxidase | Terminal cytochrome C | D23_1c1673 | Neut_1583 |
| subunit CcoO (EC | oxidases | |||||||||
| 1.9.3.1) | ||||||||||
| fig|6666666.60966.peg.1676 | CDS | 1560753 | 1561364 | 3 | + | 612 | Copper-containing | Denitrification; | D23_1c1674 | Neut_1584 |
| nitrite reductase (EC | <br>Denitrifying | |||||||||
| 1.7.2.1) | reductase gene clusters | |||||||||
| fig|6666666.60966.peg.1677 | CDS | 1561404 | 1562054 | 3 | + | 651 | Cytochrome oxidase | Biogenesis of | D23_1c1675 | Neut_1585 |
| biogenesis protein | cytochrome c oxidases | |||||||||
| Sco1/SenC/PrrC, | ||||||||||
| putative copper | ||||||||||
| metallochaperone | ||||||||||
| fig|6666666.60966.peg.1678 | CDS | 1562150 | 1562635 | 2 | + | 486 | hypothetical | -none- | D23_1c1676 | Neut_1586 |
| cytochrome oxidase | ||||||||||
| associated membrane | ||||||||||
| protein | ||||||||||
| fig|6666666.60966.peg.1679 | CDS | 1563699 | 1562746 | −3 | − | 954 | Rare lipoprotein A | Peptidoglycan | D23_1c1677 | Neut_1587 |
| precursor | Biosynthesis | |||||||||
| fig|6666666.60966.peg.1680 | CDS | 1564813 | 1563704 | −1 | − | 1110 | Rod shape-determining | Bacterial Cytoskeleton; | D23_1c1678 | Neut_1588 |
| protein RodA | <br>Bacterial cell | |||||||||
| division cluster; | ||||||||||
| <br>Peptidoglycan | ||||||||||
| Biosynthesis | ||||||||||
| fig|6666666.60966.peg.1681 | CDS | 1566713 | 1564836 | −2 | − | 1878 | Penicillin-binding | 16S rRNA modification | D23_1c1679 | Neut_1589 |
| protein 2 (PBP-2) | within P site of | |||||||||
| ribosome; <br>Bacterial | ||||||||||
| cell division cluster; | ||||||||||
| <br>CBSS- | ||||||||||
| 83331.1.peg.3039; | ||||||||||
| <br>Peptidoglycan | ||||||||||
| Biosynthesis | ||||||||||
| fig|6666666.60966.peg.1682 | CDS | 1567261 | 1566710 | −1 | − | 552 | Rod shape-determining | Bacterial Cell Division; | D23_1c1680 | Neut_1590 |
| protein MreD | <br>Bacterial | |||||||||
| Cytoskeleton; | ||||||||||
| <br>Bacterial cell | ||||||||||
| division cluster; | ||||||||||
| <br>CBSS- | ||||||||||
| 354.1.peg.2917 | ||||||||||
| fig|6666666.60966.peg.1683 | CDS | 1568123 | 1567233 | −2 | − | 891 | Rod shape-determining | Bacterial Cell Division; | D23_1c1681 | Neut_1591 |
| protein MreC | <br>Bacterial | |||||||||
| Cytoskeleton; | ||||||||||
| <br>Bacterial cell | ||||||||||
| division cluster; | ||||||||||
| <br>CBSS- | ||||||||||
| 354.1.peg.2917 | ||||||||||
| fig|6666666.60966.peg.1684 | CDS | 1569547 | 1568486 | −1 | − | 1062 | Rod shape-determining | Bacterial Cell Division; | D23_1c1682 | Neut_1592 |
| protein MreB | <br>Bacterial | |||||||||
| Cytoskeleton; | ||||||||||
| <br>Bacterial cell | ||||||||||
| division cluster | ||||||||||
| fig|6666666.60966.peg.1685 | CDS | 1569665 | 1569997 | 2 | + | 333 | Aspartyl-tRNA(Asn) | tRNA aminoacylation, | D23_1c1683 | Neut_1593 |
| amidotransferase | Asp and Asn; <br>tRNA | |||||||||
| subunit C (EC 6.3.5.6) @ | aminoacylation, Glu and | |||||||||
| Glutamyl-tRNA(Gln) | Gln | |||||||||
| amidotransferase | ||||||||||
| subunit C (EC 6.3.5.7) | ||||||||||
| fig|6666666.60966.peg.1686 | CDS | 1570062 | 1571522 | 3 | + | 1461 | Aspartyl-tRNA(Asn) | tRNA aminoacylation, | D23_1c1684 | Neut_1594 |
| amidotransferase | Asp and Asn; <br>tRNA | |||||||||
| subunit A (EC 6.3.5.6) @ | aminoacylation, Glu and | |||||||||
| Glutamyl-tRNA(Gln) | Gln | |||||||||
| amidotransferase | ||||||||||
| subunit A (EC 6.3.5.7) | ||||||||||
| fig|6666666.60966.peg.1687 | CDS | 1571587 | 1573023 | 1 | + | 1437 | Aspartyl-tRNA(Asn) | tRNA aminoacylation, | D23_1c1685 | Neut_1595 |
| amidotransferase | Asp and Asn; <br>tRNA | |||||||||
| subunit B (EC 6.3.5.6) @ | aminoacylation, Glu and | |||||||||
| Glutamyl-tRNA(Gln) | Gln | |||||||||
| amidotransferase | ||||||||||
| subunit B (EC 6.3.5.7) | ||||||||||
| fig|6666666.60966.peg.1688 | CDS | 1573150 | 1573001 | −1 | − | 150 | hypothetical protein | -none- | D23_1c1686 | NA |
| fig|6666666.60966.peg.1689 | CDS | 1573320 | 1573129 | −3 | − | 192 | FIG00859257: | -none- | D23_1c1687 | NA |
| hypothetical protein | ||||||||||
| fig|6666666.60966.peg.1691 | CDS | 1574140 | 1573703 | −1 | − | 438 | heat shock protein, | -none- | D23_1c1688 | Neut_1596 |
| Hsp20 family | ||||||||||
| fig|6666666.60966.peg.1692 | CDS | 1574662 | 1574802 | 1 | + | 141 | Integrase | -none- | D23_1c1690 | Neut_1498 |
| fig|6666666.60966.peg.1693 | CDS | 1575055 | 1574942 | −1 | − | 114 | hypothetical protein | -none- | D23_1c1692 | NA |
| fig|6666666.60966.peg.1694 | CDS | 1575572 | 1575369 | −2 | − | 204 | hypothetical protein | -none- | D23_1c1693 | NA |
| fig|6666666.60966.peg.1696 | CDS | 1575911 | 1575753 | −2 | − | 159 | Mobile element protein | -none- | D23_1c1694 | Neut_1094 |
| fig|6666666.60966.peg.1697 | CDS | 1576265 | 1578433 | 2 | + | 2169 | GTP pyrophosphokinase | Stringent Response, | D23_1c1695 | Neut_1601 |
| (EC 2.7.6.5), (p)ppGpp | (p)ppGpp metabolism; | |||||||||
| synthetase II/ | <br>Stringent Response, | |||||||||
| Guanosine- | (p)ppGpp metabolism | |||||||||
| 3',5'- | ||||||||||
| bis(diphosphate) | ||||||||||
| 3'- | ||||||||||
| pyrophosphohydrolase | ||||||||||
| (EC 3.1.7.2) | ||||||||||
| fig|6666666.60966.peg.1698 | CDS | 1578452 | 1579135 | 2 | + | 684 | FIG00858669: | -none- | D23_1c1696 | Neut_1602 |
| hypothetical protein | ||||||||||
| fig|6666666.60966.peg.1699 | CDS | 1579798 | 1579145 | −1 | − | 654 | Periplasmic | Biogenesis of c-type | D23_1c1697 | Neut_1603 |
| thiol:disulfide | cytochromes; | |||||||||
| interchange protein | <br>Periplasmic disulfide | |||||||||
| DsbA | interchange | |||||||||
| fig|6666666.60966.peg.1700 | CDS | 1580580 | 1579915 | −3 | − | 666 | Cell division protein | -none- | D23_1c1698 | Neut_1604 |
| fig|6666666.60966.peg.1701 | CDS | 1582304 | 1580604 | −2 | − | 1701 | Arginyl-tRNA synthetase | tRNA aminoacylation, | D23_1c1699 | Neut_1605 |
| (EC 6.1.1.19) | Arg | |||||||||
| fig|6666666.60966.peg.1702 | CDS | 1582613 | 1583272 | 2 | + | 660 | FIG00859197: | -none- | D23_1c1700 | Neut_1606 |
| hypothetical protein | ||||||||||
| fig|6666666.60966.peg.1703 | CDS | 1583410 | 1584297 | 1 | + | 888 | Methylenetetrahydrofolate | 5-FCL-like protein; | D23_1c1701 | Neut_1607 |
| dehydrogenase | <br>One-carbon | |||||||||
| (NADP+) (EC 1.5.1.5)/ | metabolism by | |||||||||
| Methenyltetrahydrofolate | tetrahydropterines; | |||||||||
| cyclohydrolase (EC | <br>One-carbon | |||||||||
| 3.5.4.9) | metabolism by | |||||||||
| tetrahydropterines | ||||||||||
| fig|6666666.60966.peg.1704 | CDS | 1584339 | 1586999 | 3 | + | 2661 | Pyruvate | 5-FCL-like protein; | D23_1c1702 | Neut_1608 |
| dehydrogenase E1 | <br>Dehydrogenase | |||||||||
| component (EC 1.2.4.1) | complexes; | |||||||||
| <br>Methionine | ||||||||||
| Degradation; | ||||||||||
| <br>Pyruvate | ||||||||||
| metabolism II: acetyl- | ||||||||||
| CoA, acetogenesis from | ||||||||||
| pyruvate | ||||||||||
| fig|6666666.60966.peg.1705 | CDS | 1587072 | 1588421 | 3 | + | 1350 | Dihydrolipoamide | 5-FCL-like protein; | D23_1c1703 | Neut_1609 |
| acetyltransferase | <br>Dehydrogenase | |||||||||
| component of pyruvate | complexes; | |||||||||
| dehydrogenase | <br>Pyruvate | |||||||||
| complex (EC 2.3.1.12) | metabolism II: acetyl- | |||||||||
| CoA, acetogenesis from | ||||||||||
| pyruvate | ||||||||||
| fig|6666666.60966.peg.1706 | CDS | 1588457 | 1589170 | 2 | + | 714 | Nicotinate-nucleotide | NAD and NADP cofactor | D23_1c1704 | Neut_1610 |
| adenylyltransferase (EC | biosynthesis global | |||||||||
| 2.7.7.18) | ||||||||||
| fig|6666666.60966.peg.1707 | CDS | 1589167 | 1589532 | 1 | + | 366 | Iojap protein | -none- | D23_1c1705 | Neut_1611 |
| fig|6666666.60966.peg.1708 | CDS | 1589624 | 1590091 | 2 | + | 468 | LSU m3Psi1915 | RNA methylation; | D23_1c1706 | Neut_1612 |
| methyltransferase RlmH | <br>Ribosome | |||||||||
| biogenesis bacterial; | ||||||||||
| <br>tRNA modification | ||||||||||
| Bacteria | ||||||||||
| fig|6666666.60966.peg.1709 | CDS | 1590169 | 1590792 | 1 | + | 624 | Septum formation | Bacterial Cell Division; | D23_1c1707 | Neut_1613 |
| protein Maf | <br>Bacterial | |||||||||
| Cytoskeleton; | ||||||||||
| <br>Bacterial cell | ||||||||||
| division cluster; | ||||||||||
| <br>CBSS- | ||||||||||
| 354.1.peg.2917 | ||||||||||
| fig|6666666.60966.peg.1710 | CDS | 1590825 | 1592276 | 3 | + | 1452 | Cytoplasmic axial | Bacterial Cell Division; | D23_1c1708 | Neut_1614 |
| filament protein CafA | <br>CBSS- | |||||||||
| and Ribonuclease G (EC | 354.1.peg.2917; | |||||||||
| 3.1.4.—) | <br>RNA processing and | |||||||||
| degradation, bacterial | ||||||||||
| fig|6666666.60966.peg.1711 | CDS | 1592500 | 1593222 | 1 | + | 723 | Ferric siderophore | Ton and Tol transport | D23_1c1709 | Neut_1615 |
| transport system, | systems | |||||||||
| periplasmic binding | ||||||||||
| protein TonB | ||||||||||
| fig|6666666.60966.peg.1712 | CDS | 1593226 | 1594023 | 1 | + | 798 | MotA/TolQ/ExbB | Ton and Tol transport | D23_1c1710 | Neut_1616 |
| proton channel family | systems | |||||||||
| protein | ||||||||||
| fig|6666666.60966.peg.1713 | CDS | 1594023 | 1594448 | 3 | + | 426 | Biopolymer transport | Ton and Tol transport | D23_1c1711 | Neut_1617 |
| protein ExbD/TolR | systems | |||||||||
| fig|6666666.60966.peg.1714 | CDS | 1595300 | 1594518 | −2 | − | 783 | 23S rRNA (guanosine- | RNA methylation | D23_1c1712 | Neut_1618 |
| 2'-O-)- | ||||||||||
| methyltransferase rlmB | ||||||||||
| (EC 2.1.1.—) | ||||||||||
| fig|6666666.60966.peg.1715 | CDS | 1597532 | 1595328 | −2 | − | 2205 | 3'-to-5' | RNA processing and | D23_1c1713 | Neut_1619 |
| exoribonuclease RNase R | degradation, bacterial | |||||||||
| fig|6666666.60966.peg.1717 | CDS | 1598152 | 1599303 | 1 | + | 1152 | DNA polymerase IV (EC | DNA repair, bacterial | D23_1c1715 | Neut_1620 |
| 2.7.7.7) | ||||||||||
| fig|6666666.60966.peg.1718 | CDS | 1599507 | 1599391 | −3 | − | 117 | hypothetical protein | -none- | D23_1c1716 | NA |
| fig|6666666.60966.peg.1719 | CDS | 1599639 | 1601015 | 3 | + | 1377 | Flagellar regulatory | Flagellum | D23_1c1717 | Neut_1621 |
| protein FleQ | ||||||||||
| fig|6666666.60966.peg.1720 | CDS | 1601809 | 1601045 | −1 | − | 765 | hypothetical protein | -none- | D23_1c1718 | Neut_1622 |
| fig|6666666.60966.peg.1721 | CDS | 1604085 | 1601893 | −3 | − | 2193 | hypothetical protein | -none- | D23_1c1719 | Neut_1623 |
| fig|6666666.60966.peg.1722 | CDS | 1605035 | 1604157 | −2 | − | 879 | Mobile element protein | -none- | D23_1c1720 | Neut_1720 |
| fig|6666666.60966.peg.1723 | CDS | 1605427 | 1605134 | −1 | − | 294 | Mobile element protein | -none- | D23_1c1721 | Neut_1719 |
| fig|6666666.60966.peg.1724 | CDS | 1606591 | 1605455 | −1 | − | 1137 | 8-amino-7- | Biotin biosynthesis; | D23_1c1722 | Neut_2137 |
| oxononanoate synthase | <br>Biotin biosynthesis | |||||||||
| (EC 2.3.1.47) | Experimental; <br>Biotin | |||||||||
| synthesis cluster | ||||||||||
| fig|6666666.60966.peg.1725 | CDS | 1608741 | 1606597 | −3 | − | 2145 | hypothetical protein | -none- | D23_1c1723 | NA |
| fig|6666666.60966.peg.1726 | CDS | 1610072 | 1608738 | −2 | − | 1335 | hypothetical protein | -none- | D23_1c1724 | NA |
| fig|6666666.60966.peg.1727 | CDS | 1610798 | 1610106 | −2 | − | 693 | hypothetical protein | -none- | D23_1c1725 | Neut_1626 |
| fig|6666666.60966.peg.1728 | CDS | 1611531 | 1610833 | −3 | − | 699 | hypothetical protein | -none- | D23_1c1726 | Neut_1626 |
| fig|6666666.60966.peg.1729 | CDS | 1611922 | 1612056 | 1 | + | 135 | hypothetical protein | -none- | D23_1c1727 | NA |
| fig|6666666.60966.peg.1731 | CDS | 1612368 | 1612991 | 3 | + | 624 | InterPro IPR000379 | -none- | D23_1c1729 | Neut_1627 |
| COGs COG2945 | ||||||||||
| fig|6666666.60966.peg.1732 | CDS | 1614001 | 1613204 | −1 | − | 798 | Carbonic anhydrase (EC | Zinc regulated enzymes | D23_1c1730 | Neut_1628 |
| 4.2.1.1) | ||||||||||
| fig|6666666.60966.peg.1734 | CDS | 1614522 | 1614355 | −3 | − | 168 | hypothetical protein | -none- | D23_1c1731 | NA |
| fig|6666666.60966.peg.1735 | CDS | 1614827 | 1614699 | −2 | − | 129 | hypothetical protein | -none- | D23_1c1732 | NA |
| fig|6666666.60966.peg.1736 | CDS | 1614794 | 1616134 | 2 | + | 1341 | Probable | -none- | D23_1c1733 | Neut_1630 |
| transmembrane protein | ||||||||||
| fig|6666666.60966.peg.1737 | CDS | 1617043 | 1616225 | −1 | − | 819 | rRNA methylases | -none- | D23_1c1734 | Neut_1631 |
| fig|6666666.60966.peg.1738 | CDS | 1617516 | 1617061 | −3 | − | 456 | Mobile element protein | -none- | D23_1c1735 | Neut_2502 |
| fig|6666666.60966.peg.1739 | CDS | 1617913 | 1617479 | −1 | − | 435 | Mobile element protein | -none- | D23_1c1736 | Neut_0884 |
| fig|6666666.60966.peg.1740 | CDS | 1618427 | 1618293 | −2 | − | 135 | hypothetical protein | -none- | D23_1c1738 | NA |
| fig|6666666.60966.peg.1741 | CDS | 1619838 | 1618420 | −3 | − | 1419 | Dihydrolipoamide | 5-FCL-like protein; | D23_1c1739 | Neut_1632 |
| dehydrogenase (EC | <br>Glycine cleavage | |||||||||
| 1.8.1.4) | system; | |||||||||
| <br>Photorespiration | ||||||||||
| (oxidative C2 cycle); | ||||||||||
| <br>TCA Cycle | ||||||||||
| fig|6666666.60966.peg.1742 | CDS | 1620067 | 1621053 | 1 | + | 987 | Malate dehydrogenase | TCA Cycle | D23_1c1740 | Neut_1633 |
| (EC 1.1.1.37) | ||||||||||
| fig|6666666.60966.peg.1743 | CDS | 1621562 | 1621107 | −2 | − | 456 | Thiol peroxidase, Bcp- | CBSS- | D23_1c1741 | Neut_1634 |
| type (EC 1.11.1.15) | 316057.3.peg.3521; | |||||||||
| <br>Thioredoxin- | ||||||||||
| disulfide reductase | ||||||||||
| fig|6666666.60966.peg.1744 | CDS | 1622938 | 1621595 | −1 | − | 1344 | Cytochrome c heme | Biogenesis of c-type | D23_1c1742 | Neut_1635 |
| lyase subunit CcmH | cytochromes; | |||||||||
| <br>Copper homeostasis | ||||||||||
| fig|6666666.60966.peg.1745 | CDS | 1623399 | 1622935 | −3 | − | 465 | Cytochrome c heme | Biogenesis of c-type | D23_1c1743 | Neut_1636 |
| lyase subunit CcmL | cytochromes | |||||||||
| fig|6666666.60966.peg.1746 | CDS | 1623982 | 1623458 | −1 | − | 525 | Cytochrome c-type | Biogenesis of c-type | D23_1c1744 | Neut_1637 |
| biogenesis protein | cytochromes; | |||||||||
| CcmG/DsbE, | <br>Periplasmic disulfide | |||||||||
| thiol:disulfide | interchange | |||||||||
| oxidoreductase | ||||||||||
| fig|6666666.60966.peg.1747 | CDS | 1626024 | 1623979 | −3 | − | 2046 | Cytochrome c heme | Biogenesis of c-type | D23_1c1745 | Neut_1638 |
| lyase subunit CcmF | cytochromes; | |||||||||
| <br>Copper homeostasis | ||||||||||
| fig|6666666.60966.peg.1748 | CDS | 1626514 | 1626065 | −1 | − | 450 | Cytochrome c-type | Biogenesis of c-type | D23_1c1746 | Neut_1639 |
| biogenesis protein | cytochromes | |||||||||
| CcmE, heme chaperone | ||||||||||
| fig|6666666.60966.peg.1749 | CDS | 1627373 | 1626690 | −2 | − | 684 | Cytochrome c-type | Biogenesis of c-type | D23_1c1747 | Neut_1641 |
| biogenesis protein | cytochromes | |||||||||
| CcmC, putative heme | ||||||||||
| lyase for CcmE | ||||||||||
| fig|6666666.60966.peg.1750 | CDS | 1628195 | 1627536 | −2 | − | 660 | ABC transporter | Biogenesis of c-type | D23_1c1748 | Neut_1642 |
| involved in cytochrome | cytochromes | |||||||||
| c biogenesis, CcmB | ||||||||||
| subunit | ||||||||||
| fig|6666666.60966.peg.1751 | CDS | 1628729 | 1628202 | −2 | − | 528 | ABC transporter | Biogenesis of c-type | D23_1c1749 | Neut_1643 |
| involved in cytochrome | cytochromes | |||||||||
| c biogenesis, ATPase | ||||||||||
| component CcmA | ||||||||||
| fig|6666666.60966.peg.1752 | CDS | 1629793 | 1628927 | −1 | − | 867 | tRNA pseudouridine | CBSS- | D23_1c1750 | Neut_1644 |
| synthase B (EC 4.2.1.70) | 138119.3.peg.2719; | |||||||||
| <br>RNA pseudouridine | ||||||||||
| syntheses; | ||||||||||
| <br>Riboflavin, FMN and | ||||||||||
| FAD metabolism in | ||||||||||
| plants; <br>tRNA | ||||||||||
| modification Bacteria; | ||||||||||
| <br>tRNA processing | ||||||||||
| fig|6666666.60966.peg.1753 | CDS | 1630354 | 1630001 | −1 | − | 354 | Ribosome-binding | CBSS- | D23_1c1751 | Neut_1645 |
| factor A | 138119.3.peg.2719; | |||||||||
| <br>NusA-TFII Cluster; | ||||||||||
| <br>Translation | ||||||||||
| initiation factors | ||||||||||
| bacterial | ||||||||||
| fig|6666666.60966.peg.1754 | CDS | 1633073 | 1630407 | −2 | − | 2667 | Translation initiation | CBSS- | D23_1c1752 | Neut_1646 |
| factor 2 | 138119.3.peg.2719; | |||||||||
| <br>NusA-TFII Cluster; | ||||||||||
| <br>Translation | ||||||||||
| initiation factors | ||||||||||
| bacterial; <br>Universal | ||||||||||
| GTPases | ||||||||||
| fig|6666666.60966.peg.1756 | CDS | 1634664 | 1633192 | −3 | − | 1473 | Transcription | NusA-TFII Cluster; | D23_1c1753 | Neut_1647 |
| termination protein | <br>Transcription | |||||||||
| NusA | factors bacterial | |||||||||
| fig|6666666.60966.peg.1757 | CDS | 1635199 | 1634717 | −1 | − | 483 | COG0779: clustered | -none- | D23_1c1754 | Neut_1648 |
| with transcription | ||||||||||
| termination protein | ||||||||||
| NusA | ||||||||||
| fig|6666666.60966.peg.1760 | CDS | 1636174 | 1636611 | 1 | + | 438 | FIG00859331: | -none- | D23_1c1755 | Neut_1650 |
| hypothetical protein | ||||||||||
| fig|6666666.60966.peg.1761 | CDS | 1637012 | 1636686 | −2 | − | 327 | Cytochrome c4 | Soluble cytochromes | D23_1c1756 | Neut_1651 |
| and functionally related | ||||||||||
| electron carriers | ||||||||||
| fig|6666666.60966.peg.1762 | CDS | 1637371 | 1637045 | −1 | − | 327 | Putative periplasmic | -none- | D23_1c1757 | Neut_1652 |
| cytochrome type-C | ||||||||||
| oxidoreductase signal | ||||||||||
| peptide protein (EC 1.—.—.—) | ||||||||||
| fig|6666666.60966.peg.1763 | CDS | 1639430 | 1637484 | −2 | − | 1947 | COG0488: ATPase | -none- | D23_1c1758 | Neut_1653 |
| components of ABC | ||||||||||
| transporters with | ||||||||||
| duplicated ATPase | ||||||||||
| domains | ||||||||||
| fig|6666666.60966.peg.1765 | CDS | 1639660 | 1640709 | 1 | + | 1050 | Selenide, water dikinase | Selenocysteine | D23_1c1759 | Neut_1654 |
| (EC 2.7.9.3) | metabolism; <br>tRNA | |||||||||
| modification Bacteria | ||||||||||
| fig|6666666.60966.peg.1766 | CDS | 1640702 | 1641868 | 2 | + | 1167 | Selenophosphate- | Selenocysteine | D23_1c1760 | Neut_1655 |
| dependent tRNA 2- | metabolism; <br>tRNA | |||||||||
| selenouridine synthase | modification Bacteria | |||||||||
| fig|6666666.60966.peg.1767 | CDS | 1642217 | 1642050 | −2 | − | 168 | hypothetical protein | -none- | D23_1c1761 | NA |
| fig|6666666.60966.peg.1768 | CDS | 1643785 | 1642217 | −1 | − | 1569 | 4-cresol dehydrogenase | Cresol degradation | D23_1c1762 | Neut_1656 |
| [hydroxylating] | ||||||||||
| flavoprotein subunit (EC | ||||||||||
| 1.17.99.1) | ||||||||||
| fig|6666666.60966.peg.1769 | CDS | 1644507 | 1643782 | −3 | − | 726 | PchX protein | -none- | D23_1c1763 | Neut_1657 |
| fig|6666666.60966.peg.1770 | CDS | 1644874 | 1644518 | −1 | − | 357 | 4-cresol dehydrogenase | Cresol degradation | D23_1c1764 | Neut_1658 |
| [hydroxylating] | ||||||||||
| cytochrome c subunit | ||||||||||
| precursor | ||||||||||
| fig|6666666.60966.peg.1771 | CDS | 1646175 | 1645138 | −3 | − | 1038 | Dihydroorotase (EC | De Novo Pyrimidine | D23_1c1766 | Neut_1659 |
| 3.5.2.3) | Synthesis; <br>Zinc | |||||||||
| regulated enzymes | ||||||||||
| fig|6666666.60966.peg.1772 | CDS | 1647130 | 1646273 | −1 | − | 858 | rRNA small subunit | 16S rRNA modification | D23_1c1767 | Neut_1660 |
| methyltransferase I | within P site of | |||||||||
| ribosome; <br>CBSS- | ||||||||||
| 160492.1.peg.550; | ||||||||||
| <br>Heat shock dnaK | ||||||||||
| gene cluster extended | ||||||||||
| fig|6666666.60966.peg.1773 | CDS | 1647311 | 1649101 | 2 | + | 1791 | ABC transporter, | -none- | D23_1c1769 | Neut_1661 |
| multidrug efflux family | ||||||||||
| fig|6666666.60966.peg.1774 | CDS | 1649206 | 1649556 | 1 | + | 351 | Predicted endonuclease | CBSS-160492.1.peg.550 | D23_1c1770 | Neut_1662 |
| distantly related to | ||||||||||
| archaeal Holliday | ||||||||||
| junction resolvase | ||||||||||
| fig|6666666.60966.peg.1776 | CDS | 1651143 | 1649929 | −3 | − | 1215 | hypothetical protein | -none- | D23_1c1771 | Neut_1663 |
| fig|6666666.60966.peg.1777 | CDS | 1651568 | 1651446 | −2 | − | 123 | hypothetical protein | -none- | D23_1c1772 | NA |
| fig|6666666.60966.peg.1778 | CDS | 1651714 | 1652223 | 1 | + | 510 | Putative lipoprotein | -none- | D23_1c1773 | Neut_1664 |
| fig|6666666.60966.peg.1779 | CDS | 1652740 | 1661706 | 1 | + | 8967 | Cyclic beta-1,2-glucan | Synthesis of | D23_1c1774 | Neut_1665 |
| synthase (EC 2.4.1.—) | osmoregulated | |||||||||
| periplasmic glucans | ||||||||||
| fig|6666666.60966.peg.1780 | CDS | 1662138 | 1661821 | −3 | − | 318 | Mobile element protein | -none- | D23_1c1775 | Neut_1666 |
| fig|6666666.60966.peg.1781 | CDS | 1662168 | 1662344 | 3 | + | 177 | hypothetical protein | -none- | D23_1c1776 | NA |
| fig|6666666.60966.peg.1782 | CDS | 1662546 | 1662406 | −3 | − | 141 | Mobile element protein | -none- | D23_1c1777 | Neut_2190 |
| fig|6666666.60966.peg.1783 | CDS | 1663286 | 1663158 | −2 | − | 129 | hypothetical protein | -none- | D23_1c1778 | NA |
| fig|6666666.60966.peg.1784 | CDS | 1663556 | 1664518 | 2 | + | 963 | Mobile element protein | -none- | D23_1c1779 | Neut_1746 |
| fig|6666666.60966.peg.1785 | CDS | 1666051 | 1664585 | −1 | − | 1467 | ATP-dependent RNA | ATP-dependent RNA | D23_1c1780 | Neut_1668 |
| helicase | helicases, bacterial | |||||||||
| Bcep18194_A5658 | ||||||||||
| fig|6666666.60966.peg.1786 | CDS | 1666377 | 1666147 | −3 | − | 231 | Mobile element protein | -none- | D23_1c1781 | Neut_2088 |
| fig|6666666.60966.peg.1787 | CDS | 1666620 | 1666441 | −3 | − | 180 | Mobile element protein | -none- | D23_1c1782 | Neut_0332 |
| fig|6666666.60966.peg.1788 | CDS | 1667117 | 1666644 | −2 | − | 474 | Mobile element protein | -none- | D23_1c1783 | NA |
| fig|6666666.60966.peg.1789 | CDS | 1668091 | 1667294 | −1 | − | 798 | FIG00861229: | -none- | D23_1c1784 | Neut_1669 |
| hypothetical protein | ||||||||||
| fig|6666666.60966.peg.1790 | CDS | 1668254 | 1668093 | −2 | − | 162 | hypothetical protein | -none- | D23_1c1785 | NA |
| fig|6666666.60966.peg.1791 | CDS | 1669037 | 1668330 | −2 | − | 708 | Cytochrome c family | -none- | D23_1c1786 | Neut_2333 |
| protein | ||||||||||
| fig|6666666.60966.peg.1792 | CDS | 1670220 | 1669099 | −3 | − | 1122 | FIG00859557: | -none- | D23_1c1787 | Neut_1792 |
| hypothetical protein | ||||||||||
| fig|6666666.60966.peg.1793 | CDS | 1671929 | 1670217 | −2 | − | 1713 | Hydroxylamine | -none- | D23_1c1788 | Neut_2335 |
| oxidoreductase | ||||||||||
| precursor (EC 1.7.3.4) | ||||||||||
| fig|6666666.60966.peg.1794 | CDS | 1672280 | 1672017 | −2 | − | 264 | SSU ribosomal protein | -none- | D23_1c1789 | NA |
| S20p | ||||||||||
| fig|6666666.60966.peg.1795 | CDS | 1672473 | 1672634 | 3 | + | 162 | hypothetical protein | -none- | D23_1c1790 | NA |
| fig|6666666.60966.peg.1796 | CDS | 1672870 | 1672601 | −1 | − | 270 | Mobile element protein | -none- | D23_1c1791 | Neut_2450 |
| fig|6666666.60966.peg.1797 | CDS | 1673187 | 1672894 | −3 | − | 294 | hypothetical protein | -none- | D23_1c1792 | Neut_2449 |
| fig|6666666.60966.peg.1798 | CDS | 1673875 | 1673648 | −1 | − | 228 | hypothetical protein | -none- | D23_1c1795 | Neut_1676 |
| fig|6666666.60966.peg.1799 | CDS | 1674438 | 1674052 | −3 | − | 387 | FIG002082: Protein | A Gammaproteobacteria | D23_1c1796 | Neut_1677 |
| SirB2 | Cluster Relating to | |||||||||
| Translation | ||||||||||
| fig|6666666.60966.peg.1800 | CDS | 1674844 | 1674500 | −1 | − | 345 | FIG00858740: | -none- | D23_1c1797 | Neut_1678 |
| hypothetical protein | ||||||||||
| fig|6666666.60966.peg.1801 | CDS | 1675595 | 1674939 | −2 | − | 657 | Probable membrane | -none- | D23_1c1798 | Neut_1679 |
| protein | ||||||||||
| fig|6666666.60966.peg.1802 | CDS | 1675804 | 1675601 | −1 | − | 204 | Probable membrane | -none- | D23_1c1800 | Neut_1679 |
| protein | ||||||||||
| fig|6666666.60966.peg.1803 | CDS | 1676931 | 1675825 | −3 | − | 1107 | GbcA Glycine betaine | -none- | D23_1c1801 | Neut_1680 |
| demethylase subunit A | ||||||||||
| fig|6666666.60966.peg.1804 | CDS | 1677301 | 1678686 | 1 | + | 1386 | FIG00858667: | -none- | D23_1c1802 | Neut_1681 |
| hypothetical protein | ||||||||||
| fig|6666666.60966.peg.1805 | CDS | 1678742 | 1680964 | 2 | + | 2223 | Helicase PriA essential | -none- | D23_1c1803 | Neut_1682 |
| for oriC/DnaA- | ||||||||||
| independent DNA | ||||||||||
| replication | ||||||||||
| fig|6666666.60966.peg.1806 | CDS | 1681478 | 1681032 | −2 | − | 447 | Universal stress protein | -none- | D23_1c1804 | Neut_1683 |
| fig|6666666.60966.peg.1807 | CDS | 1683246 | 1681597 | −3 | − | 1650 | Folate transporter 3 | -none- | D23_1c1805 | Neut_1684 |
| fig|6666666.60966.peg.1808 | CDS | 1684397 | 1683258 | −2 | − | 1140 | Outer membrane stress | Periplasmic Stress | D23_1c1806 | Neut_1685 |
| sensor protease DegS | Response; | |||||||||
| <br>Proteolysis in | ||||||||||
| bacteria, ATP-dependent | ||||||||||
| fig|6666666.60966.peg.1809 | CDS | 1684396 | 1685181 | 1 | + | 786 | FIG137478: | -none- | D23_1c1807 | Neut_1686 |
| Hypothetical protein | ||||||||||
| YbgI | ||||||||||
| fig|6666666.60966.peg.1810 | CDS | 1685374 | 1685249 | −1 | − | 126 | hypothetical protein | -none- | D23_1c1808 | NA |
| fig|6666666.60966.peg.1811 | CDS | 1685328 | 1686644 | 3 | + | 1317 | Membrane-bound lytic | Murein Hydrolases | D23_1c1809 | Neut_1687 |
| murein transglycosylase | ||||||||||
| A precursor (EC 3.2.1.—) | ||||||||||
| fig|6666666.60966.peg.1812 | CDS | 1687397 | 1686684 | −2 | − | 714 | Thiol:disulfide | Periplasmic disulfide | D23_1c1810 | Neut_1688 |
| interchange protein | interchange | |||||||||
| DsbC | ||||||||||
| fig|6666666.60966.peg.1813 | CDS | 1688609 | 1687443 | −2 | − | 1167 | 2-octaprenyl-3-methyl- | CBSS-87626.3.peg.3639; | D23_1c1811 | Neut_1689 |
| 6-methoxy-1,4- | <br>Ubiquinone | |||||||||
| benzoquinol | Biosynthesis; | |||||||||
| hydroxylase (EC | <br>Ubiquinone | |||||||||
| 1.14.13.—) | Biosynthesis-gjo | |||||||||
| fig|6666666.60966.peg.1814 | CDS | 1688840 | 1690807 | 2 | + | 1968 | Acetyl-coenzyme A | Pyruvate metabolism II: | D23_1c1812 | Neut_1690 |
| synthetase (EC 6.2.1.1) | acetyl-CoA, acetogenesis | |||||||||
| from pyruvate | ||||||||||
| fig|6666666.60966.peg.1815 | CDS | 1690825 | 1691799 | 1 | + | 975 | Beta-lactamase related | -none- | D23_1c1813 | Neut_1691 |
| protein | ||||||||||
| fig|6666666.60966.peg.1816 | CDS | 1693183 | 1691903 | −1 | − | 1281 | amidohydrolase | -none- | D23_1c1814 | Neut_1692 |
| fig|6666666.60966.peg.1817 | CDS | 1693463 | 1693633 | 2 | + | 171 | Mobile element protein | -none- | D23_1c1816 | Neut_1693 |
| fig|6666666.60966.peg.1818 | CDS | 1694024 | 1695034 | 2 | + | 1011 | Fatty acid desaturase | -none- | D23_1c1817 | Neut_1694 |
| fig|6666666.60966.peg.1819 | CDS | 1696649 | 1695402 | −2 | − | 1248 | Mobile element protein | -none- | D23_1c1818 | Neut_0357 |
| fig|6666666.60966.peg.1820 | CDS | 1697303 | 1696830 | −2 | − | 474 | Mobile element protein | -none- | D23_1c1820 | Neut_1256 |
| fig|6666666.60966.peg.1821 | CDS | 1697769 | 1697377 | −3 | − | 393 | hypothetical protein | -none- | D23_1c1821 | Neut_2449 |
| fig|6666666.60966.peg.1822 | CDS | 1698235 | 1698032 | −1 | − | 204 | hypothetical protein | -none- | D23_1c1822 | Neut_0363 |
| fig|6666666.60966.peg.1823 | CDS | 1698639 | 1698322 | −3 | − | 318 | hypothetical protein | -none- | D23_1c1823 | Neut_1695 |
| fig|6666666.60966.peg.1824 | CDS | 1698977 | 1698639 | −2 | − | 339 | Mobile element protein | -none- | D23_1c1824 | Neut_1696 |
| fig|6666666.60966.peg.1825 | CDS | 1699393 | 1702311 | 1 | + | 2919 | Na(+) H(+) antiporter | Multi-subunit cation | D23_1c1825 | Neut_1697 |
| subunit A/Na(+) H(+) | antiporter; <br>Multi- | |||||||||
| antiporter subunit B | subunit cation antiporter | |||||||||
| fig|6666666.60966.peg.1826 | CDS | 1702311 | 1702655 | 3 | + | 345 | Na(+) H(+) antiporter | Multi-subunit cation | D23_1c1826 | Neut_1698 |
| subunit C | antiporter | |||||||||
| fig|6666666.60966.peg.1827 | CDS | 1702652 | 1704298 | 2 | + | 1647 | Na(+) H(+) antiporter | Multi-subunit cation | D23_1c1827 | Neut_1699 |
| subunit D | antiporter | |||||||||
| fig|6666666.60966.peg.1828 | CDS | 1704295 | 1704780 | 1 | + | 486 | Na(+) H(+) antiporter | Multi-subunit cation | D23_1c1828 | Neut_1700 |
| subunit E | antiporter | |||||||||
| fig|6666666.60966.peg.1829 | CDS | 1704777 | 1705058 | 3 | + | 282 | Na(+) H(+) antiporter | Multi-subunit cation | D23_1c1829 | Neut_1701 |
| subunit F | antiporter | |||||||||
| fig|6666666.60966.peg.1830 | CDS | 1705055 | 1705480 | 2 | + | 426 | Na(+) H(+) antiporter | Multi-subunit cation | D23_1c1830 | Neut_1702 |
| subunit G | antiporter | |||||||||
| fig|6666666.60966.peg.1831 | CDS | 1708136 | 1705638 | −2 | − | 2499 | FIG00809136: | -none- | D23_1c1831 | Neut_1703 |
| hypothetical protein | ||||||||||
| fig|6666666.60966.peg.1832 | CDS | 1709066 | 1708266 | −2 | − | 801 | ABC transporter ATP- | -none- | D23_1c1832 | Neut_1704 |
| binding protein YvcR | ||||||||||
| fig|6666666.60966.peg.1833 | CDS | 1709065 | 1709676 | 1 | + | 612 | Arylesterase precursor | -none- | D23_1c1833 | Neut_1705 |
| (EC 3.1.1.2) | ||||||||||
| fig|6666666.60966.peg.1834 | CDS | 1710780 | 1709716 | −3 | − | 1065 | Ribosomal large subunit | RNA pseudouridine | D23_1c1834 | Neut_1706 |
| pseudouridine synthase | syntheses; | |||||||||
| C (EC 4.2.1.70) | <br>Ribosome | |||||||||
| biogenesis bacterial | ||||||||||
| fig|6666666.60966.peg.1835 | CDS | 1711189 | 1713738 | 1 | + | 2550 | Ribonuclease E (EC | RNA processing and | D23_1c1835 | Neut_1707 |
| 3.1.26.12) | degradation, bacterial; | |||||||||
| <br>Ribosome | ||||||||||
| biogenesis bacterial | ||||||||||
| fig|6666666.60966.peg.1836 | CDS | 1714787 | 1713870 | −2 | − | 918 | Tyrosine recombinase | -none- | D23_1c1836 | Neut_1708 |
| XerD | ||||||||||
| fig|6666666.60966.peg.1837 | CDS | 1715754 | 1714909 | −3 | − | 846 | CcsA-related protein | -none- | D23_1c1837 | Neut_1709 |
| fig|6666666.60966.peg.1838 | CDS | 1715897 | 1717246 | 2 | + | 1350 | Signal recognition | Bacterial signal | D23_1c1838 | Neut_1710 |
| particle, subunit Ffh | recognition particle | |||||||||
| SRP54 (TC 3.A.5.1.1) | (SRP); <br>Universal | |||||||||
| GTPases | ||||||||||
| fig|6666666.60966.peg.1839 | CDS | 1717562 | 1718059 | 2 | + | 498 | Cytosine/adenosine | -none- | D23_1c1840 | Neut_1711 |
| deaminases | ||||||||||
| fig|6666666.60966.peg.1840 | CDS | 1719089 | 1718079 | −2 | − | 1011 | collagen triple helix | -none- | D23_1c1841 | Neut_1712 |
| repeat domain protein | ||||||||||
| fig|6666666.60966.peg.1841 | CDS | 1719941 | 1719435 | −2 | − | 507 | Mobile element protein | -none- | D23_1c1843 | Neut_1353 |
| fig|6666666.60966.peg.1843 | CDS | 1720927 | 1720256 | −1 | − | 672 | Putative TEGT family | CBSS-326442.4.peg.1852 | D23_1c1844 | Neut_1715 |
| carrier/transport | ||||||||||
| protein | ||||||||||
| fig|6666666.60966.peg.1844 | CDS | 1721245 | 1721081 | −1 | − | 165 | hypothetical protein | -none- | D23_1c1845 | Neut_1716 |
| fig|6666666.60966.peg.1845 | CDS | 1721933 | 1721268 | −2 | − | 666 | Mobile element protein | -none- | D23_1c1846 | Neut_1717 |
| fig|6666666.60966.peg.1846 | CDS | 1722745 | 1722137 | −1 | − | 609 | Aldehyde | Glycerolipid and | D23_1c1847 | Neut_0700 |
| dehydrogenase (EC | Glycerophospholipid | |||||||||
| 1.2.1.3) | Metabolism in Bacteria; | |||||||||
| <br>Methylglyoxal | ||||||||||
| Metabolism; | ||||||||||
| <br>Methylglyoxal | ||||||||||
| Metabolism; | ||||||||||
| <br>Pyruvate | ||||||||||
| metabolism II: acetyl- | ||||||||||
| CoA, acetogenesis from | ||||||||||
| pyruvate | ||||||||||
| fig|6666666.60966.peg.1847 | CDS | 1722896 | 1723189 | 2 | + | 294 | Mobile element protein | -none- | D23_1c1848 | Neut_1719 |
| fig|6666666.60966.peg.1848 | CDS | 1723288 | 1724166 | 1 | + | 879 | Mobile element protein | -none- | D23_1c1849 | Neut_1720 |
| fig|6666666.60966.peg.1849 | CDS | 1724724 | 1724179 | −3 | − | 546 | Aldehyde | Glycerolipid and | D23_1c1850 | Neut_0700 |
| dehydrogenase (EC | Glycerophospholipid | |||||||||
| 1.2.1.3) | Metabolism in Bacteria; | |||||||||
| <br>Methylglyoxal | ||||||||||
| Metabolism; | ||||||||||
| <br>Methylglyoxal | ||||||||||
| Metabolism; | ||||||||||
| <br>Pyruvate | ||||||||||
| metabolism II: acetyl- | ||||||||||
| CoA, acetogenesis from | ||||||||||
| pyruvate | ||||||||||
| fig|6666666.60966.peg.1850 | CDS | 1726242 | 1724995 | −3 | − | 1248 | Mobile element protein | -none- | D23_1c1851 | Neut_0357 |
| fig|6666666.60966.peg.1851 | CDS | 1727368 | 1727126 | −1 | − | 243 | Mobile element protein | -none- | D23_1c1854 | Neut_2190 |
| fig|6666666.60966.peg.1852 | CDS | 1727480 | 1727641 | 2 | + | 162 | hypothetical protein | -none- | D23_1c1855 | NA |
| fig|6666666.60966.peg.1853 | CDS | 1727757 | 1727873 | 3 | + | 117 | hypothetical protein | -none- | D23_1c1856 | NA |
| fig|6666666.60966.peg.1854 | CDS | 1727880 | 1728818 | 3 | + | 939 | Major facilitator family | -none- | D23_1c1857 | NA |
| transporter | ||||||||||
| fig|6666666.60966.peg.1855 | CDS | 1728936 | 1730123 | 3 | + | 1188 | Cytosine deaminase (EC | CBSS- | D23_1c1858 | Neut_1722 |
| 3.5.4.1) | 326442.4.peg.1852; | |||||||||
| <br>Creatine and | ||||||||||
| Creatinine Degradation; | ||||||||||
| <br>pyrimidine | ||||||||||
| conversions | ||||||||||
| fig|6666666.60966.peg.1857 | CDS | 1730427 | 1730624 | 3 | + | 198 | Mobile element protein | -none- | D23_1c1859 | Neut_1748 |
| fig|6666666.60966.peg.1858 | CDS | 1730716 | 1730937 | 1 | + | 222 | Mobile element protein | -none- | D23_1c1860 | Neut_1747 |
| fig|6666666.60966.peg.1859 | CDS | 1731165 | 1733414 | 3 | + | 2250 | Lead, cadmium, zinc | Copper Transport | D23_1c1862 | Neut_1724 |
| and mercury | System; <br>Copper | |||||||||
| transporting ATPase (EC | homeostasis | |||||||||
| 3.6.3.3) (EC 3.6.3.5); | ||||||||||
| Copper-translocating P- | ||||||||||
| type ATPase (EC 3.6.3.4) | ||||||||||
| fig|6666666.60966.peg.1860 | CDS | 1733755 | 1733946 | 1 | + | 192 | hypothetical protein | -none- | D23_1c1863 | Neut_1734 |
| fig|6666666.60966.peg.1861 | CDS | 1734020 | 1735762 | 2 | + | 1743 | Asparagine synthetase | Cyanophycin | D23_1c1864 | Neut_1735 |
| [glutamine-hydrolyzing] | Metabolism; | |||||||||
| (EC 6.3.5.4) | <br>Glutamate and | |||||||||
| Aspartate uptake in | ||||||||||
| Bacteria; <br>Glutamine, | ||||||||||
| Glutamate, Aspartate | ||||||||||
| and Asparagine | ||||||||||
| Biosynthesis | ||||||||||
| fig|6666666.60966.peg.1862 | CDS | 1735929 | 1737425 | 3 | + | 1497 | major facilitator | -none- | D23_1c1865 | Neut_1736 |
| superfamily MFS_1 | ||||||||||
| fig|6666666.60966.peg.1863 | CDS | 1737575 | 1737841 | 2 | + | 267 | Mobile element protein | -none- | D23_1c1866 | NA |
| fig|6666666.60966.peg.1864 | CDS | 1737835 | 1737975 | 1 | + | 141 | Mobile element protein | -none- | D23_1c1867 | NA |
| fig|6666666.60966.peg.1865 | CDS | 1738803 | 1738006 | −3 | − | 798 | Mobile element protein | -none- | D23_1c1868 | Neut_1888 |
| fig|6666666.60966.peg.1866 | CDS | 1739186 | 1738917 | −2 | − | 270 | Mobile element protein | -none- | D23_1c1869 | Neut_2500 |
| fig|6666666.60966.peg.1868 | CDS | 1740582 | 1739374 | −3 | − | 1209 | hypothetical protein | -none- | D23_1c1870 | Neut_1740 |
| fig|6666666.60966.peg.1869 | CDS | 1742717 | 1740588 | −2 | − | 2130 | Ferrichrome-iron | -none- | D23_1c1871 | Neut_1741 |
| receptor | ||||||||||
| fig|6666666.60966.peg.1870 | CDS | 1744008 | 1742806 | −3 | − | 1203 | Vibrioferrin | -none- | D23_1c1872 | Neut_1742 |
| decarboxylase protein | ||||||||||
| PvsE | ||||||||||
| fig|6666666.60966.peg.1871 | CDS | 1745819 | 1744005 | −2 | − | 1815 | Vibrioferrin amide bond | -none- | D23_1c1873 | Neut_1743 |
| forming protein PvsD @ | ||||||||||
| Siderophore synthetase | ||||||||||
| superfamily, group A | ||||||||||
| fig|6666666.60966.peg.1872 | CDS | 1747001 | 1745829 | −2 | − | 1173 | Vibrioferrin membrane- | -none- | D23_1c1874 | Neut_1744 |
| spanning transport | ||||||||||
| protein PvsC | ||||||||||
| fig|6666666.60966.peg.1873 | CDS | 1748855 | 1747044 | −2 | − | 1812 | Anthrachelin | -none- | D23_1c1875 | Neut_1745 |
| biosynthesis protein | ||||||||||
| AsbB @ Siderophore | ||||||||||
| synthetase superfamily, | ||||||||||
| group C @ Siderophore | ||||||||||
| synthetase component, | ||||||||||
| ligase | ||||||||||
| fig|6666666.60966.peg.1874 | CDS | 1749327 | 1749151 | −3 | − | 177 | Mobile element protein | -none- | D23_1c1876 | Neut_1747 |
| fig|6666666.60966.peg.1876 | CDS | 1750647 | 1749685 | −3 | − | 963 | Mobile element protein | -none- | D23_1c1878 | Neut_1278 |
| fig|6666666.60966.peg.1877 | CDS | 1751012 | 1752274 | 2 | + | 1263 | hypothetical protein | -none- | D23_1c1879 | Neut_1749 |
| fig|6666666.60966.peg.1878 | CDS | 1752303 | 1753133 | 3 | + | 831 | Potassium efflux system | Potassium homeostasis | D23_1c1880 | NA |
| KefA protein/Small- | ||||||||||
| conductance | ||||||||||
| mechanosensitive | ||||||||||
| channel | ||||||||||
| fig|6666666.60966.peg.1879 | CDS | 1753722 | 1753153 | −3 | − | 570 | hypothetical protein | -none- | D23_1c1881 | NA |
| fig|6666666.60966.peg.1880 | CDS | 1753823 | 1754629 | 2 | + | 807 | Glutamate racemase | Glutamine, Glutamate, | D23_1c1882 | Neut_1752 |
| (EC 5.1.1.3) | Aspartate and | |||||||||
| Asparagine Biosynthesis; | ||||||||||
| <br>Peptidoglycan | ||||||||||
| Biosynthesis | ||||||||||
| fig|6666666.60966.peg.1881 | CDS | 1754733 | 1755689 | 3 | + | 957 | Universal stress protein | -none- | D23_1c1883 | Neut_1753 |
| fig|6666666.60966.peg.1882 | CDS | 1756978 | 1755725 | −1 | − | 1254 | DNA repair protein | DNA repair, bacterial; | D23_1c1884 | Neut_1754 |
| RadA | <br>Proteolysis in | |||||||||
| bacteria, ATP-dependent | ||||||||||
| fig|6666666.60966.peg.1883 | CDS | 1757073 | 1757201 | 3 | + | 129 | hypothetical protein | -none- | D23_1c1885 | NA |
| fig|6666666.60966.peg.1884 | CDS | 1758757 | 1757372 | −1 | − | 1386 | L-serine dehydratase | Glycine and Serine | D23_1c1887 | Neut_1760 |
| (EC 4.3.1.17) | Utilization; <br>Pyruvate | |||||||||
| Alanine Serine | ||||||||||
| Interconversions | ||||||||||
| fig|6666666.60966.peg.1886 | CDS | 1759312 | 1760013 | 1 | + | 702 | Serine protease | Transcription initiation, | D23_1c1890 | Neut_1761 |
| precursor MucD/AlgY | bacterial sigma factors | |||||||||
| associated with sigma | ||||||||||
| factor RpoE | ||||||||||
| fig|6666666.60966.peg.1887 | CDS | 1760622 | 1761584 | 3 | + | 963 | Mobile element protein | -none- | D23_1c1892 | Neut_1278 |
| fig|6666666.60966.peg.1888 | CDS | 1761643 | 1762524 | 1 | + | 882 | FIG071646: Sugar | Cell wall related cluster | D23_1c1893 | Neut_1762 |
| transferase | ||||||||||
| fig|6666666.60966.peg.1889 | CDS | 1762574 | 1764655 | 2 | + | 2082 | Sensory transduction | -none- | D23_1c1894 | Neut_1763 |
| histidine kinases | ||||||||||
| fig|6666666.60966.peg.1890 | CDS | 1764739 | 1766601 | 1 | + | 1863 | Lipid A export ATP- | -none- | D23_1c1895 | Neut_1764 |
| binding/permease | ||||||||||
| protein MsbA | ||||||||||
| fig|6666666.60966.peg.1891 | CDS | 1769731 | 1766636 | −1 | − | 3096 | Cobalt-zinc-cadmium | Cobalt-zinc-cadmium | D23_1c1896 | Neut_1765 |
| resistance protein CzcA; | resistance; <br>Cobalt- | |||||||||
| Cation efflux system | zinc-cadmium resistance | |||||||||
| protein CusA | ||||||||||
| fig|6666666.60966.peg.1892 | CDS | 1770897 | 1769734 | −3 | − | 1164 | Cobalt/zinc/cadmium | Cobalt-zinc-cadmium | D23_1c1897 | Neut_1766 |
| efflux RND transporter, | resistance | |||||||||
| membrane fusion | ||||||||||
| protein, CzcB family | ||||||||||
| fig|6666666.60966.peg.1893 | CDS | 1772112 | 1770907 | −3 | − | 1206 | Heavy metal RND efflux | Cobalt-zinc-cadmium | D23_1c1898 | Neut_1767 |
| outer membrane | resistance | |||||||||
| protein, CzcC family | ||||||||||
| fig|6666666.60966.peg.1894 | CDS | 1773163 | 1772504 | −1 | − | 660 | FIG00859115: | -none- | D23_1c1899 | Neut_1768 |
| hypothetical protein | ||||||||||
| fig|6666666.60966.peg.1895 | CDS | 1773250 | 1773996 | 1 | + | 747 | Glycerophosphoryl | CBSS- | D23_1c1900 | Neut_1769 |
| diester | 176299.4.peg.1996A; | |||||||||
| phosphodiesterase (EC | <br>Glycerol and | |||||||||
| 3.1.4.46) | Glycerol-3-phosphate | |||||||||
| Uptake and Utilization | ||||||||||
| fig|6666666.60966.peg.1896 | CDS | 1774006 | 1775181 | 1 | + | 1176 | Aerobic glycerol-3- | Glycerol and Glycerol-3- | D23_1c1901 | Neut_1770 |
| phosphate | phosphate Uptake and | |||||||||
| dehydrogenase (EC | Utilization; | |||||||||
| 1.1.5.3) | <br>Glycerolipid and | |||||||||
| Glycerophospholipid | ||||||||||
| Metabolism in Bacteria; | ||||||||||
| <br>Respiratory | ||||||||||
| dehydrogenases 1 | ||||||||||
| fig|6666666.60966.peg.1897 | CDS | 1775543 | 1775211 | −2 | − | 333 | FIG00859262: | -none- | D23_1c1902 | Neut_1771 |
| hypothetical protein | ||||||||||
| fig|6666666.60966.peg.1898 | CDS | 1776076 | 1775636 | −1 | − | 441 | FIG00859309: | -none- | D23_1c1903 | Neut_1772 |
| hypothetical protein | ||||||||||
| fig|6666666.60966.peg.1899 | CDS | 1777538 | 1776078 | −2 | − | 1461 | Dihydrolipoamide | Dehydrogenase | D23_1c1904 | Neut_1773 |
| dehydrogenase of 2- | complexes; <br>TCA | |||||||||
| oxoglutarate | Cycle | |||||||||
| dehydrogenase (EC | ||||||||||
| 1.8.1.4) | ||||||||||
| fig|6666666.60966.peg.1900 | CDS | 1778658 | 1777612 | −3 | − | 1047 | Beta N-acetyl- | Murein Hydrolases; | D23_1c1905 | Neut_1774 |
| glucosaminidase (EC | <br>Recycling of | |||||||||
| 3.2.1.52) | Peptidoglycan Amino | |||||||||
| Sugars | ||||||||||
| fig|6666666.60966.peg.1901 | CDS | 1779038 | 1778661 | −2 | − | 378 | Holo-[acyl-carrier | Fatty Acid Biosynthesis | D23_1c1906 | Neut_1775 |
| protein] synthase (EC | FASII | |||||||||
| 2.7.8.7) | ||||||||||
| fig|6666666.60966.peg.1902 | CDS | 1779760 | 1779035 | −1 | − | 726 | Pyridoxine 5'- | Pyridoxin (Vitamin B6) | D23_1c1907 | Neut_1776 |
| phosphate synthase (EC | Biosynthesis | |||||||||
| 2.6.99.2) | ||||||||||
| fig|6666666.60966.peg.1903 | CDS | 1780768 | 1779878 | −1 | − | 891 | GTP-binding protein Era | Bacterial Cell Division; | D23_1c1908 | Neut_1777 |
| <br>Glycyl-tRNA | ||||||||||
| synthetase containing | ||||||||||
| cluster; <br>Universal | ||||||||||
| GTPases | ||||||||||
| fig|6666666.60966.peg.1904 | CDS | 1781583 | 1780846 | −3 | − | 738 | Ribonuclease III (EC | RNA processing and | D23_1c1909 | Neut_1778 |
| 3.1.26.3) | degradation, bacterial | |||||||||
| fig|6666666.60966.peg.1905 | CDS | 1781963 | 1781580 | −2 | − | 384 | possible | -none- | D23_1c1910 | Neut_1779 |
| transmembrane protein | ||||||||||
| fig|6666666.60966.peg.1906 | CDS | 1782802 | 1781999 | −1 | − | 804 | Signal peptidase I (EC | Signal peptidase | D23_1c1911 | Neut_1780 |
| 3.4.21.89) | ||||||||||
| fig|6666666.60966.peg.1907 | CDS | 1784670 | 1782874 | −3 | − | 1797 | Translation elongation | Heat shock dnaK gene | D23_1c1912 | Neut_1781 |
| factor LepA | cluster extended; | |||||||||
| <br>Translation | ||||||||||
| elongation factors | ||||||||||
| bacterial; <br>Universal | ||||||||||
| GTPases | ||||||||||
| fig|6666666.60966.peg.1908 | CDS | 1784806 | 1784651 | −1 | − | 156 | hypothetical protein | -none- | D23_1c1913 | NA |
| fig|6666666.60966.peg.1909 | CDS | 1785160 | 1784972 | −1 | − | 189 | COGs COG0526 | -none- | D23_1c1914 | Neut_1782 |
| fig|6666666.60966.peg.1910 | CDS | 1786580 | 1785222 | −2 | − | 1359 | Serine protease | Transcription initiation, | D23_1c1915 | Neut_1783 |
| precursor MucD/AlgY | bacterial sigma factors | |||||||||
| associated with sigma | ||||||||||
| factor RpoE | ||||||||||
| fig|6666666.60966.peg.1911 | CDS | 1787446 | 1786871 | −1 | − | 576 | InterPro IPR001687 | -none- | D23_1c1916 | Neut_1784 |
| COGs COG3073 | ||||||||||
| fig|6666666.60966.peg.1912 | CDS | 1788062 | 1787460 | −2 | − | 603 | RNA polymerase sigma | Transcription initiation, | D23_1c1917 | Neut_1785 |
| factor RpoE | bacterial sigma factors | |||||||||
| fig|6666666.60966.peg.1913 | CDS | 1789111 | 1788260 | −1 | − | 852 | Magnesium and cobalt | CBSS- | D23_1c1919 | Neut_1786 |
| efflux protein CorC | 56780.10.peg.1536; | |||||||||
| <br>Copper | ||||||||||
| homeostasis: copper | ||||||||||
| tolerance; <br>Glycyl- | ||||||||||
| tRNA synthetase | ||||||||||
| containing cluster; | ||||||||||
| <br>Magnesium | ||||||||||
| transport; <br>tRNA- | ||||||||||
| methylthiotransferase | ||||||||||
| containing cluster | ||||||||||
| fig|6666666.60966.peg.1914 | CDS | 1789590 | 1789165 | −3 | − | 426 | Metal-dependent | CBSS- | D23_1c1920 | Neut_1787 |
| hydrolase YbeY, | 56780.10.peg.1536; | |||||||||
| involved in rRNA and/or | <br>Glycyl-tRNA | |||||||||
| ribosome maturation | synthetase containing | |||||||||
| and assembly | cluster; <br>tRNA- | |||||||||
| methylthiotransferase | ||||||||||
| containing cluster | ||||||||||
| fig|6666666.60966.peg.1915 | CDS | 1790629 | 1789619 | −1 | − | 1011 | Phosphate starvation- | -none- | D23_1c1921 | Neut_1788 |
| inducible ATPase PhoH | ||||||||||
| with RNA binding motif | ||||||||||
| fig|6666666.60966.peg.1916 | CDS | 1792022 | 1790691 | −2 | − | 1332 | tRNA-i(6)A37 | Methylthiotransferases; | D23_1c1922 | Neut_1789 |
| methylthiotransferase | <br>tRNA- | |||||||||
| methylthiotransferase | ||||||||||
| containing cluster; | ||||||||||
| <br>tRNA modification | ||||||||||
| Bacteria; <br>tRNA | ||||||||||
| processing | ||||||||||
| fig|6666666.60966.peg.1917 | CDS | 1793040 | 1792321 | −3 | − | 720 | Cytochrome c-type | -none- | D23_1c1923 | Neut_1790 |
| protein TorY | ||||||||||
| fig|6666666.60966.peg.1918 | CDS | 1793750 | 1793043 | −2 | − | 708 | Cytochrome c family | -none- | D23_1c1924 | Neut_2333 |
| protein | ||||||||||
| fig|6666666.60966.peg.1919 | CDS | 1794933 | 1793812 | −3 | − | 1122 | FIG00859557: | -none- | D23_1c1925 | Neut_1792 |
| hypothetical protein | ||||||||||
| fig|6666666.60966.peg.1920 | CDS | 1796642 | 1794930 | −2 | − | 1713 | Hydroxylamine | -none- | D23_1c1926 | Neut_2335 |
| oxidoreductase | ||||||||||
| precursor (EC 1.7.3.4) | ||||||||||
| fig|6666666.60966.peg.1921 | CDS | 1801076 | 1796862 | −2 | − | 4215 | DNA-directed RNA | Mycobacterium | D23_1c1927 | Neut_1794 |
| polymerase beta' | virulence operon | |||||||||
| subunit (EC 2.7.7.6) | involved in DNA | |||||||||
| transcription; <br>RNA | ||||||||||
| polymerase bacterial | ||||||||||
| fig|6666666.60966.peg.1922 | CDS | 1805314 | 1801235 | −1 | − | 4080 | DNA-directed RNA | Mycobacterium | D23_1c1928 | Neut_1795 |
| polymerase beta | virulence operon | |||||||||
| subunit (EC 2.7.7.6) | involved in DNA | |||||||||
| transcription; <br>RNA | ||||||||||
| polymerase bacterial | ||||||||||
| fig|6666666.60966.peg.1923 | CDS | 1806051 | 1805680 | −3 | − | 372 | LSU ribosomal protein | LSU ribosomal proteins | D23_1c1929 | Neut_1796 |
| L7/L12 (P1/P2) | cluster | |||||||||
| fig|6666666.60966.peg.1924 | CDS | 1806648 | 1806133 | −3 | − | 516 | LSU ribosomal protein | LSU ribosomal proteins | D23_1c1930 | Neut_1797 |
| L10p (P0) | cluster | |||||||||
| fig|6666666.60966.peg.1925 | CDS | 1807793 | 1807098 | −2 | − | 696 | LSU ribosomal protein | LSU ribosomal proteins | D23_1c1931 | Neut_1798 |
| Lip (L10Ae) | cluster | |||||||||
| fig|6666666.60966.peg.1926 | CDS | 1808121 | 1807795 | −3 | − | 327 | LSU ribosomal protein | LSU ribosomal proteins | D23_1c1932 | Neut_1799 |
| L11p (L12e) | cluster | |||||||||
| fig|6666666.60966.peg.1927 | CDS | 1808877 | 1808344 | −3 | − | 534 | Transcription | LSU ribosomal proteins | D23_1c1934 | Neut_1800 |
| antitermination protein | cluster; | |||||||||
| NusG | <br>Transcription | |||||||||
| factors bacterial | ||||||||||
| fig|6666666.60966.peg.1928 | CDS | 1809240 | 1808896 | −3 | − | 345 | Preprotein translocase | LSU ribosomal proteins | D23_1c1935 | Neut_1801 |
| subunit SecE (TC | cluster | |||||||||
| 3.A.5.1.1) | ||||||||||
| fig|6666666.60966.peg.1929 | CDS | 1810674 | 1809484 | −3 | − | 1191 | Translation elongation | Mycobacterium | D23_1c1937 | Neut_1802 |
| factor Tu | virulence operon | |||||||||
| involved in protein | ||||||||||
| synthesis (SSU ribosomal | ||||||||||
| proteins); | ||||||||||
| <br>Translation | ||||||||||
| elongation factors | ||||||||||
| bacterial; <br>Universal | ||||||||||
| GTPases | ||||||||||
| fig|6666666.60966.peg.1930 | CDS | 1813382 | 1811220 | −2 | − | 2163 | Type IV pilus biogenesis | -none- | D23_1c1941 | Neut_1803 |
| fig|6666666.60966.peg.1931 | CDS | 1813906 | 1813379 | −1 | − | 528 | Type IV pilus biogenesis | -none- | D23_1c1942 | Neut_1804 |
| protein PilP | ||||||||||
| fig|6666666.60966.peg.1932 | CDS | 1814553 | 1813903 | −3 | − | 651 | Type IV pilus biogenesis | -none- | D23_1c1943 | Neut_1805 |
| protein PilO | ||||||||||
| fig|6666666.60966.peg.1933 | CDS | 1815161 | 1814550 | −2 | − | 612 | Type IV pilus biogenesis | -none- | D23_1c1944 | Neut_1806 |
| protein PilN | ||||||||||
| fig|6666666.60966.peg.1934 | CDS | 1816207 | 1815158 | −1 | − | 1050 | Type IV pilus biogenesis | -none- | D23_1c1945 | Neut_1807 |
| protein PilM | ||||||||||
| fig|6666666.60966.peg.1936 | CDS | 1816441 | 1818753 | 1 | + | 2313 | Multimodular | Peptidoglycan | D23_1c1947 | Neut_1808 |
| transpeptidase- | Biosynthesis | |||||||||
| transglycosylase (EC | ||||||||||
| 2.4.1.129) (EC 3.4.—.—) | ||||||||||
| fig|6666666.60966.peg.1937 | CDS | 1819961 | 1819041 | −2 | − | 921 | Deacetylases, including | -none- | D23_1c1948 | Neut_1809 |
| yeast histone | ||||||||||
| deacetylase and acetoin | ||||||||||
| utilization protein | ||||||||||
| fig|6666666.60966.peg.1939 | CDS | 1820319 | 1820170 | −3 | − | 150 | hypothetical protein | -none- | D23_1c1949 | Neut_1810 |
| fig|6666666.60966.peg.1941 | CDS | 1820799 | 1820638 | −3 | − | 162 | Addiction module | -none- | D23_1c1950 | Neut_1811 |
| antidote protein | ||||||||||
| fig|6666666.60966.peg.1942 | CDS | 1821096 | 1820914 | −3 | − | 183 | hypothetical protein | -none- | D23_1c1951 | Neut_1812 |
| fig|6666666.60966.peg.1943 | CDS | 1821848 | 1821985 | 2 | + | 138 | Prevent host death | Phd-Doc, YdcE-YdcD | D23_1c1953 | NA |
| protein, Phd antitoxin | toxin-antitoxin | |||||||||
| (programmed cell death) | ||||||||||
| systems | ||||||||||
| fig|6666666.60966.peg.1944 | CDS | 1821982 | 1822278 | 1 | + | 297 | Death on curing | Phd-Doc, YdcE-YdcD | D23_1c1954 | NA |
| protein, Doc toxin | toxin-antitoxin | |||||||||
| (programmed cell death) | ||||||||||
| systems | ||||||||||
| fig|6666666.60966.peg.1945 | CDS | 1822608 | 1822423 | −3 | − | 186 | hypothetical protein | -none- | D23_1c1955 | Neut_1816 |
| fig|6666666.60966.peg.1946 | CDS | 1822933 | 1822688 | −1 | − | 246 | hypothetical protein | -none- | D23_1c1956 | Neut_1817 |
| fig|6666666.60966.peg.1947 | CDS | 1823491 | 1823150 | −1 | − | 342 | Predicted | -none- | D23_1c1957 | NA |
| transcriptional | ||||||||||
| regulator | ||||||||||
| fig|6666666.60966.peg.1948 | CDS | 1823708 | 1823484 | −2 | − | 225 | Phage-related protein | -none- | D23_1c1958 | NA |
| fig|6666666.60966.peg.1952 | CDS | 1824892 | 1824704 | −1 | − | 189 | hypothetical protein | -none- | D23_1c1959 | NA |
| fig|6666666.60966.peg.1953 | CDS | 1825371 | 1825036 | −3 | − | 336 | Mobile element protein | -none- | D23_1c1960 | Neut_1624 |
| fig|6666666.60966.peg.1954 | CDS | 1825828 | 1825352 | −1 | − | 477 | Mobile element protein | -none- | D23_1c1961 | Neut_1888 |
| fig|6666666.60966.peg.1955 | CDS | 1826127 | 1825942 | −3 | − | 186 | Mobile element protein | -none- | D23_1c1962 | Neut_2500 |
| fig|6666666.60966.peg.1956 | CDS | 1826660 | 1826472 | −2 | − | 189 | Mobile element protein | -none- | D23_1c1963 | Neut_1821 |
| fig|6666666.60966.peg.1958 | CDS | 1827279 | 1826920 | −3 | − | 360 | Flagellin protein FlaG | Flagellum | D23_1c1964 | Neut_1822 |
| fig|6666666.60966.peg.1959 | CDS | 1827931 | 1827644 | −1 | − | 288 | Excinuclease ABC, C | -none- | D23_1c1965 | Neut_1823 |
| subunit-like | ||||||||||
| fig|6666666.60966.peg.1960 | CDS | 1829557 | 1828115 | −1 | − | 1443 | Flagellin protein FlaB | Flagellum; <br>Flagellum | D23_1c1967 | Neut_1824 |
| in Campylobacter | ||||||||||
| fig|6666666.60966.peg.1961 | CDS | 1830108 | 1830230 | 3 | + | 123 | hypothetical protein | -none- | D23_1c1968 | NA |
| fig|6666666.60966.peg.1962 | CDS | 1831067 | 1830276 | −2 | − | 792 | Mobile element protein | -none- | D23_1c1969 | Neut_1888 |
| fig|6666666.60966.peg.1963 | CDS | 1831366 | 1831181 | −1 | − | 186 | Mobile element protein | -none- | D23_1c1970 | Neut_2500 |
| fig|6666666.60966.peg.1964 | CDS | 1831759 | 1831616 | −1 | − | 144 | hypothetical protein | -none- | D23_1c1971 | NA |
| fig|6666666.60966.peg.1965 | CDS | 1832465 | 1831749 | −2 | − | 717 | hypothetical protein | -none- | D23_1c1972 | Neut_1827 |
| fig|6666666.60966.peg.1967 | CDS | 1835117 | 1833291 | −2 | − | 1827 | DNA mismatch repair | DNA repair, bacterial | D23_1c1973 | Neut_1828 |
| protein MutL | MutL-MutS system | |||||||||
| fig|6666666.60966.peg.1968 | CDS | 1835287 | 1835946 | 1 | + | 660 | Ribose 5-phosphate | Calvin-Benson cycle; | D23_1c1974 | Neut_1829 |
| isomerase A (EC 5.3.1.6) | <br>D-ribose utilization; | |||||||||
| <br>Pentose phosphate | ||||||||||
| pathway | ||||||||||
| fig|6666666.60966.peg.1969 | CDS | 1836022 | 1836150 | 1 | + | 129 | hypothetical protein | -none- | D23_1c1975 | NA |
| fig|6666666.60966.peg.1970 | CDS | 1836140 | 1836859 | 2 | + | 720 | Phosphate transport | High affinity phosphate | D23_1c1976 | Neut_1830 |
| system regulatory | transporter and control | |||||||||
| protein PhoU | of PHO regulon; | |||||||||
| <br>Phosphate | ||||||||||
| metabolism | ||||||||||
| fig|6666666.60966.peg.1971 | CDS | 1836819 | 1838420 | 3 | + | 1602 | Exopolyphosphatase | Phosphate metabolism; | D23_1c1977 | Neut_1831 |
| (EC 3.6.1.11) | <br>Polyphosphate | |||||||||
| fig|6666666.60966.peg.1972 | CDS | 1838878 | 1838429 | −1 | − | 450 | Type IV pilus biogenesis | -none- | D23_1c1978 | Neut_1832 |
| protein PilE | ||||||||||
| fig|6666666.60966.peg.1973 | CDS | 1842290 | 1838922 | −2 | − | 3369 | Type IV fimbrial | -none- | D23_1c1979 | Neut_1833 |
| biogenesis protein PilY1 | ||||||||||
| fig|6666666.60966.peg.1974 | CDS | 1843213 | 1842362 | −1 | − | 852 | Type IV fimbrial | -none- | D23_1c1980 | Neut_1834 |
| biogenesis protein PilX | ||||||||||
| fig|6666666.60966.peg.1975 | CDS | 1844303 | 1843239 | −2 | − | 1065 | Type IV fimbrial | -none- | D23_1c1981 | Neut_1835 |
| biogenesis protein PilW | ||||||||||
| fig|6666666.60966.peg.1976 | CDS | 1844806 | 1844321 | −1 | − | 486 | Type IV fimbrial | -none- | D23_1c1982 | Neut_1836 |
| biogenesis protein PilV | ||||||||||
| fig|6666666.60966.peg.1977 | CDS | 1845339 | 1844830 | −3 | − | 510 | Type IV fimbrial | -none- | D23_1c1983 | Neut_1837 |
| biogenesis protein FimT | ||||||||||
| fig|6666666.60966.peg.1978 | CDS | 1845616 | 1845783 | 1 | + | 168 | hypothetical protein | -none- | D23_1c1984 | NA |
| fig|6666666.60966.peg.1979 | CDS | 1846400 | 1845768 | −2 | − | 633 | DNA-binding response | -none- | D23_1c1985 | Neut_1839 |
| regulator, LuxR family | ||||||||||
| fig|6666666.60966.peg.1980 | CDS | 1847948 | 1846452 | −2 | − | 1497 | Sensory box histidine | -none- | D23_1c1986 | Neut_1840 |
| kinase/response | ||||||||||
| regulator | ||||||||||
| fig|6666666.60966.peg.1981 | CDS | 1848084 | 1848206 | 3 | + | 123 | hypothetical protein | -none- | D23_1c1987 | NA |
| fig|6666666.60966.peg.1982 | CDS | 1850161 | 1848614 | −1 | − | 1548 | pilin glycosylation | -none- | D23_1c1988 | Neut_1841 |
| enzyme, putative | ||||||||||
| fig|6666666.60966.peg.1985 | CDS | 1852587 | 1850815 | −3 | − | 1773 | Gamma- | Glutathione: | D23_1c1989 | Neut_1843 |
| glutamyltranspeptidase | Biosynthesis and | |||||||||
| (EC 2.3.2.2) | gamma-glutamyl cycle | |||||||||
| fig|6666666.60966.peg.1986 | CDS | 1853865 | 1852903 | −3 | − | 963 | Mobile element protein | -none- | D23_1c1990 | Neut_1746 |
| fig|6666666.60966.peg.1987 | CDS | 1854432 | 1853923 | −3 | − | 510 | putative | -none- | D23_1c1991 | Neut_1845 |
| transmembrane protein | ||||||||||
| fig|6666666.60966.peg.1988 | CDS | 1855175 | 1854606 | −2 | − | 570 | hypothetical protein | -none- | D23_1c1992 | Neut_1849 |
| fig|6666666.60966.peg.1989 | CDS | 1855822 | 1855421 | −1 | − | 402 | Glyoxalase family protein | -none- | D23_1c1993 | Neut_1850 |
| fig|6666666.60966.peg.1990 | CDS | 1855948 | 1855835 | −1 | − | 114 | hypothetical protein | -none- | D23_1c1994 | NA |
| fig|6666666.60966.peg.1991 | CDS | 1856595 | 1856026 | −3 | − | 570 | hypothetical protein | -none- | D23_1c1995 | Neut_1851 |
| fig|6666666.60966.peg.1992 | CDS | 1856572 | 1856703 | 1 | + | 132 | hypothetical protein | -none- | D23_1c1996 | NA |
| fig|6666666.60966.peg.1993 | CDS | 1858627 | 1856756 | −1 | − | 1872 | hypothetical protein | -none- | D23_1c1997 | Neut_1853 |
| fig|6666666.60966.peg.1994 | CDS | 1860549 | 1858642 | −3 | − | 1908 | hypothetical protein | -none- | D23_1c1998 | Neut_1854 |
| fig|6666666.60966.peg.1995 | CDS | 1860536 | 1860667 | 2 | + | 132 | hypothetical protein | -none- | D23_1c1999 | NA |
| fig|6666666.60966.peg.1996 | CDS | 1861687 | 1860761 | −1 | − | 927 | Expressed protein | -none- | D23_1c2000 | Neut_1857 |
| precursor | ||||||||||
| fig|6666666.60966.peg.1997 | CDS | 1862145 | 1861684 | −3 | − | 462 | hypothetical protein | -none- | D23_1c2001 | Neut_1858 |
| fig|6666666.60966.peg.1998 | CDS | 1865471 | 1862334 | −2 | − | 3138 | Proline dehydrogenase | Proline, 4- | D23_1c2002 | Neut_1859 |
| (EC 1.5.99.8) (Proline | hydroxyproline uptake | |||||||||
| oxidase)/Delta-1- | and utilization; | |||||||||
| pyrroline-5-carboxylate | <br>Respiratory | |||||||||
| dehydrogenase (EC | dehydrogenases 1 | |||||||||
| 1.5.1.12) | ||||||||||
| fig|6666666.60966.peg.2000 | CDS | 1865859 | 1865701 | −3 | − | 159 | hypothetical protein | -none- | D23_1c2003 | Neut_1860 |
| fig|6666666.60966.peg.2001 | CDS | 1866618 | 1866328 | −3 | − | 291 | hypothetical protein | -none- | D23_1c2004 | NA |
| fig|6666666.60966.peg.2002 | CDS | 1866574 | 1866861 | 1 | + | 288 | Probable | -none- | D23_1c2005 | Neut_1861 |
| transmembrane protein | ||||||||||
| fig|6666666.60966.peg.2004 | CDS | 1867176 | 1867955 | 3 | + | 780 | hypothetical protein | -none- | D23_1c2006 | Neut_1863 |
| fig|6666666.60966.peg.2005 | CDS | 1870128 | 1868077 | −3 | − | 2052 | Serine peptidase | -none- | D23_1c2007 | Neut_1864 |
| fig|6666666.60966.peg.2006 | CDS | 1870373 | 1870546 | 2 | + | 174 | hypothetical protein | -none- | D23_1c2008 | NA |
| fig|6666666.60966.peg.2007 | CDS | 1871555 | 1870827 | −2 | − | 729 | 1-acyl-sn-glycerol-3- | Glycerolipid and | D23_1c2009 | Neut_1866 |
| phosphate | Glycerophospholipid | |||||||||
| acyltransferase (EC | Metabolism in Bacteria | |||||||||
| 2.3.1.51) | ||||||||||
| fig|6666666.60966.peg.2008 | CDS | 1872097 | 1871555 | −1 | − | 543 | Histidinol-phosphatase | Histidine Biosynthesis | D23_1c2010 | Neut_1867 |
| (EC 3.1.3.15) | ||||||||||
| fig|6666666.60966.peg.2009 | CDS | 1874271 | 1872124 | −3 | − | 2148 | Glycyl-tRNA synthetase | Glycyl-tRNA synthetase; | D23_1c2011 | Neut_1868 |
| beta chain (EC 6.1.1.14) | <br>Glycyl-tRNA | |||||||||
| synthetase containing | ||||||||||
| cluster; <br>tRNA | ||||||||||
| aminoacylation, Gly | ||||||||||
| fig|6666666.60966.peg.2010 | CDS | 1875191 | 1874268 | −2 | − | 924 | Glycyl-tRNA synthetase | Glycyl-tRNA synthetase; | D23_1c2012 | Neut_1869 |
| alpha chain (EC | <br>Glycyl-tRNA | |||||||||
| 6.1.1.14) | synthetase containing | |||||||||
| cluster; <br>tRNA | ||||||||||
| aminoacylation, Gly | ||||||||||
| fig|6666666.60966.peg.2011 | CDS | 1876717 | 1875224 | −1 | − | 1494 | Apolipoprotein N- | Copper homeostasis: | D23_1c2013 | Neut_1870 |
| acyltransferase (EC | copper tolerance; | |||||||||
| 2.3.1.—)/Copper | <br>Lipoprotein | |||||||||
| homeostasis protein | Biosynthesis; <br>tRNA- | |||||||||
| CutE | methylthiotransferase | |||||||||
| containing cluster; | ||||||||||
| <br>tRNA- | ||||||||||
| methylthiotransferase | ||||||||||
| containing cluster | ||||||||||
| fig|6666666.60966.peg.2012 | CDS | 1877111 | 1876773 | −2 | − | 339 | FIG00859587: | -none- | D23_1c2014 | Neut_1871 |
| hypothetical protein | ||||||||||
| fig|6666666.60966.peg.2013 | CDS | 1877265 | 1877122 | −3 | − | 144 | hypothetical protein | -none- | D23_1c2015 | NA |
| fig|6666666.60966.peg.2014 | CDS | 1877596 | 1879305 | 1 | + | 1710 | Multicopper oxidase | Copper homeostasis | D23_1c2016 | Neut_1872 |
| fig|6666666.60966.peg.2015 | CDS | 1879305 | 1880399 | 3 | + | 1095 | Zinc ABC transporter, | -none- | D23_1c2017 | Neut_1873 |
| periplasmic-binding | ||||||||||
| protein ZnuA | ||||||||||
| fig|6666666.60966.peg.2016 | CDS | 1881044 | 1880847 | −2 | − | 198 | hypothetical protein | -none- | D23_1c2018 | NA |
| fig|6666666.60966.peg.2017 | CDS | 1881486 | 1881962 | 3 | + | 477 | Cytochrome c oxidase | Terminal cytochrome C | D23_1c2020 | Neut_1874 |
| (B(O/a)3-type) chain II | oxidases | |||||||||
| (EC 1.9.3.1) | ||||||||||
| fig|6666666.60966.peg.2018 | CDS | 1882000 | 1883478 | 1 | + | 1479 | Cytochrome c oxidase | Terminal cytochrome C | D23_1c2021 | Neut_1875 |
| (B(O/a)3-type) chain I | oxidases | |||||||||
| (EC 1.9.3.1) | ||||||||||
| fig|6666666.60966.peg.2019 | CDS | 1883574 | 1884203 | 3 | + | 630 | Cytochrome oxidase | Biogenesis of | D23_1c2022 | Neut_1876 |
| biogenesis protein | cytochrome c oxidases | |||||||||
| Sco1/SenC/PrrC, | ||||||||||
| putative copper | ||||||||||
| metallochaperone | ||||||||||
| fig|6666666.60966.peg.2020 | CDS | 1884187 | 1884756 | 1 | + | 570 | hypothetical | -none- | D23_1c2023 | Neut_1877 |
| cytochrome oxidase | ||||||||||
| associated membrane | ||||||||||
| protein | ||||||||||
| fig|6666666.60966.peg.2021 | CDS | 1885726 | 1884809 | −1 | − | 918 | Nitrite transporter from | -none- | D23_1c2024 | Neut_1878 |
| formate/nitrite family | ||||||||||
| fig|6666666.60966.peg.2022 | CDS | 1887084 | 1886077 | −3 | − | 1008 | UDP-glucose 4- | CBSS- | D23_1c2026 | Neut_1879 |
| epimerase (EC 5.1.3.2) | 296591.1.peg.2330; | |||||||||
| <br>N-linked | ||||||||||
| Glycosylation in | ||||||||||
| Bacteria; <br>Rhamnose | ||||||||||
| containing glycans | ||||||||||
| fig|6666666.60966.peg.2023 | CDS | 1888047 | 1887160 | −3 | − | 888 | Glucose-1-phosphate | Rhamnose containing | D23_1c2027 | Neut_1880 |
| thymidylyltransferase | glycans; <br>dTDP- | |||||||||
| (EC 2.7.7.24) | rhamnose synthesis | |||||||||
| fig|6666666.60966.peg.2024 | CDS | 1888279 | 1888148 | −1 | − | 132 | hypothetical protein | -none- | D23_1c2028 | NA |
| fig|6666666.60966.peg.2025 | CDS | 1888278 | 1889198 | 3 | + | 921 | 2-hydroxy-3- | Glycerate metabolism; | D23_1c2029 | Neut_1881 |
| oxopropionate | <br>Photorespiration | |||||||||
| reductase (EC 1.1.1.60) | (oxidative C2 cycle) | |||||||||
| fig|6666666.60966.peg.2026 | CDS | 1889188 | 1890642 | 1 | + | 1455 | Glycolate | Glycolate, glyoxylate | D23_1c2030 | Neut_1882 |
| dehydrogenase (EC | interconversions; | |||||||||
| 1.1.99.14), subunit GlcD | <br>Photorespiration | |||||||||
| (oxidative C2 cycle) | ||||||||||
| fig|6666666.60966.peg.2027 | CDS | 1890667 | 1891767 | 1 | + | 1101 | Glycolate | Glycolate, glyoxylate | D23_1c2031 | Neut_1883 |
| dehydrogenase (EC | interconversions; | |||||||||
| 1.1.99.14), FAD-binding | <br>Photorespiration | |||||||||
| subunit GlcE | (oxidative C2 cycle) | |||||||||
| fig|6666666.60966.peg.2028 | CDS | 1891771 | 1893039 | 1 | + | 1269 | Glycolate | Glycolate, glyoxylate | D23_1c2032 | Neut_1884 |
| dehydrogenase (EC | interconversions; | |||||||||
| 1.1.99.14), iron-sulfur | <br>Photorespiration | |||||||||
| subunit GlcF | (oxidative C2 cycle) | |||||||||
| fig|6666666.60966.peg.2029 | CDS | 1893781 | 1893065 | −1 | − | 717 | Putative predicted | Restriction-Modification | D23_1c2033 | Neut_1885 |
| metal-dependent | System | |||||||||
| hydrolase | ||||||||||
| fig|6666666.60966.peg.2030 | CDS | 1894582 | 1893806 | −1 | − | 777 | 5'- | Adenosyl nucleosidases; | D23_1c2034 | Neut_1886 |
| methylthioadenosine | <br>Adenosyl | |||||||||
| nucleosidase (EC | nucleosidases; | |||||||||
| 3.2.2.16)/S- | <br>CBSS- | |||||||||
| adenosylhomocysteine | 320388.3.peg.3759; | |||||||||
| nucleosidase (EC | <br>CBSS- | |||||||||
| 3.2.2.9) | 320388.3.peg.3759; | |||||||||
| <br>Methionine | ||||||||||
| Biosynthesis; | ||||||||||
| <br>Methionine | ||||||||||
| Degradation; | ||||||||||
| <br>Polyamine | ||||||||||
| Metabolism | ||||||||||
| fig|6666666.60966.peg.2031 | CDS | 1896116 | 1894656 | −2 | − | 1461 | Exodeoxyribonuclease I | DNA Repair Base | D23_1c2035 | Neut_1887 |
| (EC 3.1.11.1) | Excision | |||||||||
| fig|6666666.60966.peg.2032 | CDS | 1896438 | 1897133 | 3 | + | 696 | FIG00657740: | -none- | D23_1c2036 | Neut_1890 |
| hypothetical protein | ||||||||||
| fig|6666666.60966.peg.2033 | CDS | 1898282 | 1897428 | −2 | − | 855 | 5,10- | 5-FCL-like protein; | D23_1c2038 | Neut_1891 |
| methylenetetrahydrofolate | <br>Methionine | |||||||||
| reductase (EC | Biosynthesis; <br>One- | |||||||||
| 1.5.1.20) | carbon metabolism by | |||||||||
| tetrahydropterines | ||||||||||
| fig|6666666.60966.peg.2034 | CDS | 1898327 | 1898494 | 2 | + | 168 | hypothetical protein | -none- | D23_1c2039 | NA |
| fig|6666666.60966.peg.2035 | CDS | 1899999 | 1898563 | −3 | − | 1437 | Adenosylhomocysteinase | Methionine | D23_1c2041 | Neut_1892 |
| (EC 3.3.1.1) | Biosynthesis; | |||||||||
| <br>Methionine | ||||||||||
| Degradation | ||||||||||
| fig|6666666.60966.peg.2036 | CDS | 1901244 | 1900135 | −3 | − | 1110 | S-adenosylmethionine | Methionine | D23_1c2042 | Neut_1893 |
| synthetase (EC 2.5.1.6) | Biosynthesis; | |||||||||
| <br>Methionine | ||||||||||
| Degradation | ||||||||||
| fig|6666666.60966.peg.2037 | CDS | 1901543 | 1902289 | 2 | + | 747 | Short chain | -none- | D23_1c2043 | Neut_1894 |
| dehydrogenase | ||||||||||
| fig|6666666.60966.peg.2038 | CDS | 1902336 | 1902812 | 3 | + | 477 | ATPase YjeE, predicted | -none- | D23_1c2044 | Neut_1895 |
| to have essential role in | ||||||||||
| cell wall biosynthesis | ||||||||||
| fig|6666666.60966.peg.2039 | CDS | 1903046 | 1904116 | 2 | + | 1071 | N-acetylmuramoyl-L- | Murein Hydrolases; | D23_1c2045 | Neut_1896 |
| alanine amidase (EC | <br>Recycling of | |||||||||
| 3.5.1.28) | Peptidoglycan Amino | |||||||||
| Acids; <br>Zinc | ||||||||||
| regulated enzymes | ||||||||||
| fig|6666666.60966.peg.2040 | CDS | 1904922 | 1904170 | −3 | − | 753 | FIG00859340: | -none- | D23_1c2046 | Neut_1897 |
| hypothetical protein | ||||||||||
| fig|6666666.60966.peg.2041 | CDS | 1905860 | 1904919 | −2 | − | 942 | Ribosomal protein L11 | Heat shock dnaK gene | D23_1c2047 | Neut_1898 |
| methyltransferase (EC | cluster extended; | |||||||||
| 2.1.1.—) | <br>Ribosome | |||||||||
| biogenesis bacterial | ||||||||||
| fig|6666666.60966.peg.2042 | CDS | 1907254 | 1905896 | −1 | − | 1359 | Biotin carboxylase of | Fatty Acid Biosynthesis | D23_1c2048 | Neut_1899 |
| acetyl-CoA carboxylase | FASII | |||||||||
| (EC 6.3.4.14) | ||||||||||
| fig|6666666.60966.peg.2043 | CDS | 1907784 | 1907326 | −3 | − | 459 | Biotin carboxyl carrier | Fatty Acid Biosynthesis | D23_1c2049 | Neut_1900 |
| protein of acetyl-CoA | FASII | |||||||||
| carboxylase | ||||||||||
| fig|6666666.60966.peg.2045 | CDS | 1908294 | 1907989 | −3 | − | 306 | 3-dehydroquinate | Chorismate Synthesis; | D23_1c2050 | Neut_1901 |
| dehydratase II (EC | <br>Common Pathway | |||||||||
| 4.2.1.10) | For Synthesis of | |||||||||
| Aromatic Compounds | ||||||||||
| (DAHP synthase to | ||||||||||
| chorismate); | ||||||||||
| <br>Quinate | ||||||||||
| degradation | ||||||||||
| fig|6666666.60966.peg.2047 | CDS | 1908606 | 1909715 | 3 | + | 1110 | Glycine oxidase ThiO | Thiamin biosynthesis | D23_1c2051 | Neut_1902 |
| (EC 1.4.3.19) | ||||||||||
| fig|6666666.60966.peg.2048 | CDS | 1910693 | 1909722 | −2 | − | 972 | 4-hydroxy-3-methylbut- | Isoprenoid Biosynthesis; | D23_1c2052 | Neut_1903 |
| 2-enyl diphosphate | <br>Nonmevalonate | |||||||||
| reductase (EC 1.17.1.2) | Branch of Isoprenoid | |||||||||
| Biosynthesis | ||||||||||
| fig|6666666.60966.peg.2049 | CDS | 1910983 | 1911267 | 1 | + | 285 | FIG00858797: | -none- | D23_1c2053 | Neut_1904 |
| hypothetical protein | ||||||||||
| fig|6666666.60966.peg.2050 | CDS | 1911307 | 1912386 | 1 | + | 1080 | Histidinol-phosphate | Histidine Biosynthesis | D23_1c2054 | Neut_1905 |
| aminotransferase (EC | ||||||||||
| 2.6.1.9) | ||||||||||
| fig|6666666.60966.peg.2051 | CDS | 1912429 | 1913016 | 1 | + | 588 | Imidazoleglycerol- | Histidine Biosynthesis | D23_1c2055 | Neut_1906 |
| phosphate dehydratase | ||||||||||
| (EC 4.2.1.19) | ||||||||||
| fig|6666666.60966.peg.2052 | CDS | 1913079 | 1913687 | 3 | + | 609 | Imidazole glycerol | Histidine Biosynthesis | D23_1c2056 | Neut_1907 |
| phosphate synthase | ||||||||||
| amidotransferase | ||||||||||
| subunit (EC 2.4.2.—) | ||||||||||
| fig|6666666.60966.peg.2053 | CDS | 1913772 | 1914518 | 3 | + | 747 | Phosphoribosylformimino- | Chorismate: | D23_1c2057 | Neut_1908 |
| 5-aminoimidazole | Intermediate for | |||||||||
| carboxamide ribotide | synthesis of Tryptophan, | |||||||||
| isomerase (EC 5.3.1.16) | PAPA antibiotics, PABA, | |||||||||
| 3-hydroxyanthranilate | ||||||||||
| and more.; <br>Histidine | ||||||||||
| Biosynthesis | ||||||||||
| fig|6666666.60966.peg.2054 | CDS | 1914604 | 1915380 | 1 | + | 777 | Imidazole glycerol | Histidine Biosynthesis | D23_1c2058 | Neut_1909 |
| phosphate synthase | ||||||||||
| cyclase subunit (EC | ||||||||||
| 4.1.3.—) | ||||||||||
| fig|6666666.60966.peg.2055 | CDS | 1915424 | 1915909 | 2 | + | 486 | Phosphoribosyl-AMP | Histidine Biosynthesis; | D23_1c2059 | Neut_1910 |
| cyclohydrolase (EC | <br>Zinc regulated | |||||||||
| 3.5.4.19) | enzymes | |||||||||
| fig|6666666.60966.peg.2056 | CDS | 1915906 | 1916259 | 1 | + | 354 | Phosphoribosyl-ATP | Histidine Biosynthesis; | D23_1c2060 | Neut_1911 |
| pyrophosphatase (EC | <br>Riboflavin synthesis | |||||||||
| 3.6.1.31) | cluster | |||||||||
| fig|6666666.60966.peg.2057 | CDS | 1916261 | 1916611 | 2 | + | 351 | FIG146285: | -none- | D23_1c2061 | Neut_1912 |
| Diadenosine | ||||||||||
| tetraphosphate (Ap4A) | ||||||||||
| hydrolase and other HIT | ||||||||||
| family hydrolases | ||||||||||
| fig|6666666.60966.peg.2058 | CDS | 1916631 | 1916864 | 3 | + | 234 | Twin-arginine | Cluster-based Subsystem | D23_1c2062 | Neut_1913 |
| translocation protein | Grouping Hypotheticals- | |||||||||
| TatA | perhaps Proteosome | |||||||||
| Related; <br>Twin- | ||||||||||
| arginine translocation | ||||||||||
| system | ||||||||||
| fig|6666666.60966.peg.2060 | CDS | 1916950 | 1917342 | 1 | + | 393 | Twin-arginine | Twin-arginine | D23_1c2063 | Neut_1914 |
| translocation protein | translocation system | |||||||||
| TatB | ||||||||||
| fig|6666666.60966.peg.2061 | CDS | 1917433 | 1918209 | 1 | + | 777 | Twin-arginine | Cluster-based Subsystem | D23_1c2064 | Neut_1915 |
| translocation protein | Grouping Hypotheticals- | |||||||||
| TatC | perhaps Proteosome | |||||||||
| Related; <br>Twin- | ||||||||||
| arginine translocation | ||||||||||
| system | ||||||||||
| fig|6666666.60966.peg.2062 | CDS | 1918395 | 1920518 | 3 | + | 2124 | Outer membrane | -none- | D23_1c2065 | Neut_1916 |
| vitamin B12 receptor | ||||||||||
| BtuB | ||||||||||
| fig|6666666.60966.peg.2063 | CDS | 1920528 | 1921118 | 3 | + | 591 | Optional hypothetical | -none- | D23_1c2066 | Neut_1917 |
| component of the B12 | ||||||||||
| transporter BtuM | ||||||||||
| fig|6666666.60966.peg.2064 | CDS | 1921118 | 1921726 | 2 | + | 609 | Cob(I)alamin | -none- | D23_1c2067 | Neut_1918 |
| adenosyltransferase (EC | ||||||||||
| 2.5.1.17) | ||||||||||
| fig|6666666.60966.peg.2065 | CDS | 1922713 | 1922826 | 1 | + | 114 | hypothetical protein | -none- | D23_1c2069 | NA |
| fig|6666666.60966.peg.2067 | CDS | 1923447 | 1924253 | 3 | + | 807 | Cytochrome bd-type | -none- | D23_1c2070 | Neut_1920 |
| quinol oxidase, subunit 1 | ||||||||||
| fig|6666666.60966.peg.2068 | CDS | 1926393 | 1924288 | −3 | − | 2106 | Methionyl-tRNA | Scaffold proteins for | D23_1c2071 | Neut_1921 |
| synthetase (EC 6.1.1.10) | [4Fe—4S] cluster | |||||||||
| assembly (MRP family); | ||||||||||
| <br>tRNA | ||||||||||
| aminoacylation, Met | ||||||||||
| fig|6666666.60966.peg.2069 | CDS | 1926506 | 1926390 | −2 | − | 117 | hypothetical protein | -none- | D23_1c2072 | NA |
| fig|6666666.60966.peg.2070 | CDS | 1926499 | 1927584 | 1 | + | 1086 | Scaffold protein for | Scaffold proteins for | D23_1c2073 | Neut_1922 |
| [4Fe—4S] cluster | [4Fe—4S] cluster | |||||||||
| assembly ApbC, MRP- | assembly (MRP family) | |||||||||
| like | ||||||||||
| fig|6666666.60966.peg.2071 | CDS | 1927630 | 1928163 | 1 | + | 534 | Deoxycytidine | pyrimidine conversions | D23_1c2074 | Neut_1923 |
| triphosphate deaminase | ||||||||||
| (EC 3.5.4.13) | ||||||||||
| fig|6666666.60966.peg.2072 | CDS | 1928619 | 1928251 | −3 | − | 369 | COGs COG1917 | -none- | D23_1c2075 | Neut_1924 |
| fig|6666666.60966.peg.2073 | CDS | 1929401 | 1928631 | −2 | − | 771 | Inner membrane | -none- | D23_1c2076 | Neut_1925 |
| protein | ||||||||||
| fig|6666666.60966.peg.2074 | CDS | 1929596 | 1929889 | 2 | + | 294 | Mobile element protein | -none- | D23_1c2077 | Neut_1719 |
| fig|6666666.60966.peg.2075 | CDS | 1929988 | 1930866 | 1 | + | 879 | Mobile element protein | -none- | D23_1c2078 | Neut_1720 |
| fig|6666666.60966.peg.2076 | CDS | 1930961 | 1933699 | 2 | + | 2739 | Ca ion P-type ATPase | -none- | D23_1c2079 | Neut_1926 |
| fig|6666666.60966.peg.2078 | CDS | 1934003 | 1934323 | 2 | + | 321 | hypothetical protein | -none- | D23_1c2080 | Neut_1927 |
| fig|6666666.60966.peg.2079 | CDS | 1935608 | 1934517 | −2 | − | 1092 | Prophage Lp2 protein 6 | -none- | D23_1c2081 | Neut_1928 |
| fig|6666666.60966.peg.2081 | CDS | 1935893 | 1936396 | 2 | + | 504 | ABC transporter ATP- | -none- | D23_1c2083 | Neut_1936 |
| binding protein YvcR | ||||||||||
| fig|6666666.60966.peg.2083 | CDS | 1936587 | 1936880 | 3 | + | 294 | Mobile element protein | -none- | D23_1c2085 | Neut_1719 |
| fig|6666666.60966.peg.2084 | CDS | 1936979 | 1937857 | 2 | + | 879 | Mobile element protein | -none- | D23_1c2086 | Neut_1720 |
| fig|6666666.60966.peg.2085 | CDS | 1938082 | 1937936 | −1 | − | 147 | hypothetical protein | -none- | D23_1c2087 | Neut_1937 |
| fig|6666666.60966.peg.2086 | CDS | 1938637 | 1938188 | −1 | − | 450 | Ferric uptake regulation | Bacterial RNA- | D23_1c2088 | Neut_1938 |
| protein FUR | metabolizing Zn- | |||||||||
| dependent hydrolases; | ||||||||||
| <br>Oxidative stress | ||||||||||
| fig|6666666.60966.peg.2087 | CDS | 1938848 | 1939330 | 2 | + | 483 | Outer membrane | Lipopolysaccharide | D23_1c2089 | Neut_1939 |
| lipoprotein SmpA, a | assembly | |||||||||
| component of the | ||||||||||
| essential YaeT outer- | ||||||||||
| membrane protein | ||||||||||
| assembly complex | ||||||||||
| fig|6666666.60966.peg.2088 | CDS | 1939327 | 1940133 | 1 | + | 807 | Dihydrodipicolinate | -none- | D23_1c2090 | Neut_1940 |
| reductase (EC 1.3.1.26) | ||||||||||
| fig|6666666.60966.peg.2089 | CDS | 1941855 | 1940347 | −3 | − | 1509 | ATPase | -none- | D23_1c2091 | Neut_1941 |
| fig|6666666.60966.peg.2090 | CDS | 1942209 | 1942087 | −3 | − | 123 | hypothetical protein | -none- | D23_1c2092 | NA |
| fig|6666666.60966.peg.2091 | CDS | 1942220 | 1942459 | 2 | + | 240 | Type I restriction- | Restriction-Modification | D23_1c2093 | Neut_1942 |
| modification system, | System; <br>Type I | |||||||||
| DNA-methyltransferase | Restriction-Modification | |||||||||
| subunit M (EC 2.1.1.72) | ||||||||||
| fig|6666666.60966.peg.2092 | CDS | 1942456 | 1942860 | 1 | + | 405 | Cell filamentation | -none- | D23_1c2094 | Neut_1943 |
| protein fic | ||||||||||
| fig|6666666.60966.peg.2093 | CDS | 1942823 | 1943278 | 2 | + | 456 | Mobile element protein | -none- | D23_1c2095 | Neut_2502 |
| fig|6666666.60966.peg.2094 | CDS | 1943305 | 1944786 | 1 | + | 1482 | Outer membrane | -none- | D23_1c2096 | Neut_1945 |
| component of tripartite | ||||||||||
| multidrug resistance | ||||||||||
| system | ||||||||||
| fig|6666666.60966.peg.2095 | CDS | 1944830 | 1946014 | 2 | + | 1185 | Membrane fusion | Multidrug Resistance | D23_1c2097 | Neut_1946 |
| protein of RND family | Efflux Pumps | |||||||||
| multidrug efflux pump | ||||||||||
| fig|6666666.60966.peg.2096 | CDS | 1946018 | 1949131 | 2 | + | 3114 | RND efflux system, | Multidrug Resistance | D23_1c2098 | Neut_1947 |
| inner membrane | Efflux Pumps | |||||||||
| transporter CmeB | ||||||||||
| fig|6666666.60966.peg.2097 | CDS | 1949252 | 1949386 | 2 | + | 135 | Type I restriction- | Restriction-Modification | D23_1c2099 | NA |
| modification system, | System; <br>Type I | |||||||||
| restriction subunit R (EC | Restriction-Modification | |||||||||
| 3.1.21.3) | ||||||||||
| fig|6666666.60966.peg.2098 | CDS | 1949446 | 1950246 | 1 | + | 801 | Bis(5'-nucleosyl)- | EC49-61 | D23_1c2100 | Neut_1949 |
| tetraphosphatase, | ||||||||||
| symmetrical (EC | ||||||||||
| 3.6.1.41) | ||||||||||
| fig|6666666.60966.peg.2099 | CDS | 1951009 | 1950200 | −1 | − | 810 | 1-acyl-sn-glycerol-3- | Glycerolipid and | D23_1c2101 | Neut_1950 |
| phosphate | Glycerophospholipid | |||||||||
| acyltransferase (EC | Metabolism in Bacteria | |||||||||
| 2.3.1.51) | ||||||||||
| fig|6666666.60966.peg.2100 | CDS | 1952008 | 1951073 | −1 | − | 936 | InterPro IPR002173 | -none- | D23_1c2103 | Neut_1951 |
| COGs COG0524 | ||||||||||
| fig|6666666.60966.peg.2101 | CDS | 1953491 | 1952040 | −2 | − | 1452 | Glycine dehydrogenase | Glycine and Serine | D23_1c2104 | Neut_1952 |
| [decarboxylating] | Utilization; <br>Glycine | |||||||||
| (glycine cleavage | cleavage system; | |||||||||
| system P2 protein) (EC | <br>Photorespiration | |||||||||
| 1.4.4.2) | (oxidative C2 cycle) | |||||||||
| fig|6666666.60966.peg.2102 | CDS | 1954921 | 1953566 | −1 | − | 1356 | Glycine dehydrogenase | Glycine and Serine | D23_1c2105 | Neut_1953 |
| [decarboxylating] | Utilization; <br>Glycine | |||||||||
| (glycine cleavage | cleavage system; | |||||||||
| system P1 protein) (EC | <br>Photorespiration | |||||||||
| 1.4.4.2) | (oxidative C2 cycle) | |||||||||
| fig|6666666.60966.peg.2103 | CDS | 1955520 | 1955131 | −3 | − | 390 | Glycine cleavage system | Glycine and Serine | D23_1c2106 | Neut_1954 |
| H protein | Utilization; <br>Glycine | |||||||||
| cleavage system; | ||||||||||
| <br>Photorespiration | ||||||||||
| (oxidative C2 cycle) | ||||||||||
| fig|6666666.60966.peg.2104 | CDS | 1956682 | 1955591 | −1 | − | 1092 | Aminomethyltransferase | CBSS-87626.3.peg.3639; | D23_1c2107 | Neut_1955 |
| (glycine cleavage | <br>Glycine and Serine | |||||||||
| system T protein) (EC | Utilization; <br>Glycine | |||||||||
| 2.1.2.10) | cleavage system; | |||||||||
| <br>Photorespiration | ||||||||||
| (oxidative C2 cycle) | ||||||||||
| fig|6666666.60966.peg.2106 | CDS | 1957270 | 1957133 | −1 | − | 138 | hypothetical protein | -none- | D23_1c2108 | NA |
| fig|6666666.60966.peg.2107 | CDS | 1958337 | 1957420 | −3 | − | 918 | Coproporphyrinogen III | Heme and Siroheme | D23_1c2109 | Neut_1956 |
| oxidase, aerobic (EC | Biosynthesis | |||||||||
| 1.3.3.3) | ||||||||||
| fig|6666666.60966.peg.2108 | CDS | 1958499 | 1959671 | 3 | + | 1173 | Chorismate synthase | Chorismate Synthesis; | D23_1c2110 | Neut_1957 |
| (EC 4.2.3.5) | <br>Common Pathway | |||||||||
| For Synthesis of | ||||||||||
| Aromatic Compounds | ||||||||||
| (DAHP synthase to | ||||||||||
| chorismate) | ||||||||||
| fig|6666666.60966.peg.2110 | CDS | 1960360 | 1961133 | 1 | + | 774 | IncF plasmid | -none- | D23_1c2111 | Neut_1959 |
| conjugative transfer | ||||||||||
| surface exclusion | ||||||||||
| protein TraT | ||||||||||
| fig|6666666.60966.peg.2111 | CDS | 1961191 | 1961517 | 1 | + | 327 | hypothetical protein | -none- | D23_1c2112 | NA |
| fig|6666666.60966.peg.2112 | CDS | 1961582 | 1962544 | 2 | + | 963 | Mobile element protein | -none- | D23_1c2114 | Neut_1862 |
| fig|6666666.60966.peg.2113 | CDS | 1962848 | 1962729 | −2 | − | 120 | hypothetical protein | -none- | D23_1c2115 | NA |
| fig|6666666.60966.peg.2115 | CDS | 1965546 | 1963441 | −3 | − | 2106 | Ferrichrome-iron | -none- | D23_1c2116 | Neut_1962 |
| receptor | ||||||||||
| fig|6666666.60966.peg.2118 | CDS | 1967221 | 1966565 | −1 | − | 657 | Protein of unknown | -none- | D23_1c2119 | Neut_1964 |
| function DUF208 | ||||||||||
| fig|6666666.60966.peg.2119 | CDS | 1967389 | 1968672 | 1 | + | 1284 | FIG00858634: | -none- | D23_1c2120 | Neut_1965 |
| hypothetical protein | ||||||||||
| fig|6666666.60966.peg.2120 | CDS | 1968691 | 1969206 | 1 | + | 516 | FIG00859317: | -none- | D23_1c2121 | Neut_1966 |
| hypothetical protein | ||||||||||
| fig|6666666.60966.peg.2121 | CDS | 1969209 | 1969910 | 3 | + | 702 | InterPro IPR000179 | -none- | D23_1c2122 | Neut_1967 |
| COGs COG1423 | ||||||||||
| fig|6666666.60966.peg.2122 | CDS | 1969960 | 1970334 | 1 | + | 375 | InterPro IPR003807 | -none- | D23_1c2123 | Neut_1968 |
| COGs COG2149 | ||||||||||
| fig|6666666.60966.peg.2123 | CDS | 1971838 | 1970381 | −1 | − | 1458 | Catalase (EC 1.11.1.6) | Oxidative stress; | D23_1c2124 | Neut_1969 |
| <br>Photorespiration | ||||||||||
| (oxidative C2 cycle); | ||||||||||
| <br>Protection from | ||||||||||
| Reactive Oxygen Species | ||||||||||
| fig|6666666.60966.peg.2124 | CDS | 1973211 | 1971865 | −3 | − | 1347 | FIG00858984: | -none- | D23_1c2125 | Neut_1970 |
| hypothetical protein | ||||||||||
| fig|6666666.60966.peg.2125 | CDS | 1974046 | 1973246 | −1 | − | 801 | Protein of unknown | -none- | D23_1c2126 | Neut_1971 |
| function DUF81 | ||||||||||
| fig|6666666.60966.peg.2126 | CDS | 1974579 | 1974124 | −3 | − | 456 | Protein of unknown | -none- | D23_1c2127 | Neut_1972 |
| function DUF55 | ||||||||||
| fig|6666666.60966.peg.2127 | CDS | 1976514 | 1974985 | −3 | − | 1530 | Capsular polysaccharide | Capsular Polysaccharides | D23_1c2128 | NA |
| biosynthesis protein | Biosynthesis and | |||||||||
| WcbQ | Assembly | |||||||||
| fig|6666666.60966.peg.2128 | CDS | 1977322 | 1976504 | −1 | − | 819 | Oxidoreductase, short- | Capsular Polysaccharides | D23_1c2129 | Neut_1974 |
| chain | Biosynthesis and | |||||||||
| dehydrogenase/reductase | Assembly | |||||||||
| family (EC 1.1.1.—) | ||||||||||
| fig|6666666.60966.peg.2129 | CDS | 1978801 | 1977323 | −1 | − | 1479 | Glycosyltransferase | -none- | D23_1c2130 | Neut_1975 |
| fig|6666666.60966.peg.2130 | CDS | 1979888 | 1978803 | −2 | − | 1086 | possible spore protein | -none- | D23_1c2131 | Neut_1976 |
| [UI:20467420] | ||||||||||
| fig|6666666.60966.peg.2131 | CDS | 1981090 | 1979921 | −1 | − | 1170 | FIG00858788: | -none- | D23_1c2132 | Neut_1977 |
| hypothetical protein | ||||||||||
| fig|6666666.60966.peg.2132 | CDS | 1982214 | 1981231 | −3 | − | 984 | hypothetical protein | -none- | D23_1c2133 | NA |
| fig|6666666.60966.peg.2133 | CDS | 1982778 | 1982218 | −3 | − | 561 | hypothetical protein | -none- | D23_1c2134 | NA |
| fig|6666666.60966.peg.2134 | CDS | 1983862 | 1982783 | −1 | − | 1080 | Glycosyltransferase (EC | -none- | D23_1c2135 | Neut_1982 |
| 2.4.1.—) | ||||||||||
| fig|6666666.60966.peg.2135 | CDS | 1984198 | 1983896 | −1 | − | 303 | hypothetical protein | -none- | D23_1c2136 | Neut_1983 |
| fig|6666666.60966.peg.2136 | CDS | 1984883 | 1984704 | −2 | − | 180 | Mobile element protein | -none- | D23_1c2137 | Neut_1984 |
| fig|6666666.60966.peg.2137 | CDS | 1985076 | 1984852 | −3 | − | 225 | hypothetical protein | -none- | D23_1c2138 | NA |
| fig|6666666.60966.peg.2139 | CDS | 1985629 | 1986384 | 1 | + | 756 | hypothetical protein | -none- | D23_1c2139 | Neut_1985 |
| fig|6666666.60966.peg.2140 | CDS | 1987287 | 1988645 | 3 | + | 1359 | FIG00860556: | -none- | D23_1c2140 | Neut_1986 |
| hypothetical protein | ||||||||||
| fig|6666666.60966.peg.2141 | CDS | 1988761 | 1989375 | 1 | + | 615 | Cytochrome oxidase | Biogenesis of | D23_1c2141 | Neut_1987 |
| biogenesis protein | cytochrome c oxidases | |||||||||
| Sco1/SenC/PrrC, | ||||||||||
| putative copper | ||||||||||
| metallochaperone | ||||||||||
| fig|6666666.60966.peg.2142 | CDS | 1989381 | 1990007 | 3 | + | 627 | FIG00859788: | -none- | D23_1c2142 | Neut_1988 |
| hypothetical protein | ||||||||||
| fig|6666666.60966.peg.2145 | CDS | 1990866 | 1990588 | −3 | − | 279 | hypothetical membrane | -none- | D23_1c2144 | Neut_1990 |
| protein | ||||||||||
| fig|6666666.60966.peg.2146 | CDS | 1991501 | 1991046 | −2 | − | 456 | InterPro IPR000485 | -none- | D23_1c2145 | Neut_1991 |
| fig|6666666.60966.peg.2147 | CDS | 1993914 | 1991785 | −3 | − | 2130 | Phosphate | Fermentations: Lactate; | D23_1c2146 | Neut_1995 |
| acetyltransferase (EC | <br>Pyruvate | |||||||||
| 2.3.1.8) | metabolism II: acetyl- | |||||||||
| CoA, acetogenesis from | ||||||||||
| pyruvate | ||||||||||
| fig|6666666.60966.peg.2148 | CDS | 1995278 | 1994253 | −2 | − | 1026 | Fructose-bisphosphate | Calvin-Benson cycle; | D23_1c2147 | Neut_1996 |
| aldolase class I (EC | <br>Glycolysis and | |||||||||
| 4.1.2.13) | Gluconeogenesis | |||||||||
| fig|6666666.60966.peg.2150 | CDS | 1995705 | 1995851 | 3 | + | 147 | hypothetical protein | -none- | D23_1c2148 | NA |
| fig|6666666.60966.peg.2152 | CDS | 1995966 | 1996298 | 3 | + | 333 | DNA-binding protein | -none- | D23_1c2150 | Neut_1998 |
| fig|6666666.60966.peg.2154 | CDS | 1996639 | 1996932 | 1 | + | 294 | protein of unknown | -none- | D23_1c2151 | Neut_1999 |
| function DUF497 | ||||||||||
| fig|6666666.60966.peg.2155 | CDS | 1996922 | 1997203 | 2 | + | 282 | hypothetical protein | -none- | D23_1c2152 | Neut_2000 |
| fig|6666666.60966.peg.2156 | CDS | 1997890 | 1998093 | 1 | + | 204 | Mobile element protein | -none- | D23_1c2154 | NA |
| fig|6666666.60966.peg.2157 | CDS | 1998565 | 1998266 | −1 | − | 300 | VapC toxin protein | Toxin-antitoxin replicon | D23_1c2155 | NA |
| stabilization systems | ||||||||||
| fig|6666666.60966.peg.2158 | CDS | 1998899 | 1998666 | −2 | − | 234 | VapB protein (antitoxin | Toxin-antitoxin replicon | D23_1c2156 | NA |
| to VapC) | stabilization systems | |||||||||
| fig|6666666.60966.peg.2159 | CDS | 1999186 | 1999344 | 1 | + | 159 | hypothetical protein | -none- | D23_1c2157 | NA |
| fig|6666666.60966.peg.2160 | CDS | 1999629 | 1999339 | −3 | − | 291 | transcriptional | -none- | D23_1c2158 | NA |
| regulator, XRE family | ||||||||||
| fig|6666666.60966.peg.2161 | CDS | 1999997 | 1999692 | −2 | − | 306 | Phage-related protein | -none- | D23_1c2159 | NA |
| fig|6666666.60966.peg.2162 | CDS | 2000147 | 2000022 | −2 | − | 126 | hypothetical protein | -none- | D23_1c2160 | NA |
| fig|6666666.60966.peg.2163 | CDS | 2000220 | 2000486 | 3 | + | 267 | Mobile element protein | -none- | D23_1c2161 | NA |
| fig|6666666.60966.peg.2164 | CDS | 2000507 | 2000995 | 2 | + | 489 | Mobile element protein | -none- | D23_1c2162 | NA |
| fig|6666666.60966.peg.2165 | CDS | 2001470 | 2000997 | −2 | − | 474 | Mobile element protein | -none- | D23_1c2163 | Neut_1256 |
| fig|6666666.60966.peg.2166 | CDS | 2001936 | 2001544 | −3 | − | 393 | hypothetical protein | -none- | D23_1c2164 | Neut_2449 |
| fig|6666666.60966.peg.2167 | CDS | 2002011 | 2002328 | 3 | + | 318 | Mobile element protein | -none- | D23_1c2165 | NA |
| fig|6666666.60966.peg.2168 | CDS | 2003529 | 2002369 | −3 | − | 1161 | CDP-4-dehydro-6- | -none- | D23_1c2166 | NA |
| deoxy-D-glucose 3- | ||||||||||
| dehydratase (EC 4.2.1.—) | ||||||||||
| fig|6666666.60966.peg.2169 | CDS | 2004426 | 2003539 | −3 | − | 888 | NAD-dependent | CBSS-296591.1.peg.2330 | D23_1c2167 | NA |
| epimerase/dehydratase | ||||||||||
| family protein | ||||||||||
| fig|6666666.60966.peg.2170 | CDS | 2005586 | 2004468 | −2 | − | 1119 | GDP-mannose 4,6- | -none- | D23_1c2168 | Neut_0156 |
| dehydratase (EC | ||||||||||
| 4.2.1.47) | ||||||||||
| fig|6666666.60966.peg.2171 | CDS | 2007467 | 2005632 | −2 | − | 1836 | hypothetical protein | -none- | D23_1c2169 | NA |
| fig|6666666.60966.peg.2172 | CDS | 2010568 | 2007473 | −1 | − | 3096 | Minor teichoic acid | -none- | D23_1c2170 | NA |
| biosynthesis protein | ||||||||||
| GgaB | ||||||||||
| fig|6666666.60966.peg.2173 | CDS | 2012163 | 2010694 | −3 | − | 1470 | InterPro IPR001173 | -none- | D23_1c2171 | NA |
| COGs COG0463 | ||||||||||
| fig|6666666.60966.peg.2174 | CDS | 2015828 | 2012172 | −2 | − | 3657 | Beta-1,3- | -none- | D23_1c2172 | NA |
| glucosyltransferase | ||||||||||
| fig|6666666.60966.peg.2175 | CDS | 2017307 | 2016147 | −2 | − | 1161 | Capsular polysaccharide | Capsular Polysaccharides | D23_1c2173 | NA |
| export system inner | Biosynthesis and | |||||||||
| membrane protein KpsE | Assembly | |||||||||
| fig|6666666.60966.peg.2176 | CDS | 2017966 | 2017304 | −1 | − | 663 | Capsular polysaccharide | Capsular Polysaccharides | D23_1c2174 | Neut_0152 |
| ABC transporter, ATP- | Biosynthesis and | |||||||||
| binding protein KpsT | Assembly | |||||||||
| fig|6666666.60966.peg.2177 | CDS | 2018757 | 2017963 | −3 | − | 795 | Capsular polysaccharide | Capsular Polysaccharides | D23_1c2175 | NA |
| ABC transporter, | Biosynthesis and | |||||||||
| permease protein KpsM | Assembly; | |||||||||
| <br>Rhamnose | ||||||||||
| containing glycans | ||||||||||
| fig|6666666.60966.peg.2178 | CDS | 2019947 | 2018757 | −2 | − | 1191 | Capsular polysaccharide | Capsular Polysaccharides | D23_1c2176 | Neut_2119 |
| biosynthesis/export | Biosynthesis and | |||||||||
| periplasmic protein | Assembly | |||||||||
| WcbC | ||||||||||
| fig|6666666.60966.peg.2179 | CDS | 2021279 | 2019957 | −2 | − | 1323 | 8-amino-7- | Biotin biosynthesis; | D23_1c2177 | Neut_0461 |
| oxononanoate synthase | <br>Biotin biosynthesis | |||||||||
| (EC 2.3.1.47) | Experimental; <br>Biotin | |||||||||
| synthesis cluster | ||||||||||
| fig|6666666.60966.peg.2180 | CDS | 2025121 | 2021276 | −1 | − | 3846 | Capsular polysaccharide | -none- | D23_1c2178 | NA |
| biosynthesis fatty acid | ||||||||||
| synthase WcbR | ||||||||||
| fig|6666666.60966.peg.2181 | CDS | 2028811 | 2025266 | −1 | − | 3546 | Capsular polysaccharide | -none- | D23_1c2179 | Neut_2003 |
| biosynthesis fatty acid | ||||||||||
| synthase WcbR | ||||||||||
| fig|6666666.60966.peg.2182 | CDS | 2029053 | 2029166 | 3 | + | 114 | hypothetical protein | -none- | D23_1c2180 | NA |
| fig|6666666.60966.peg.2183 | CDS | 2029212 | 2029352 | 3 | + | 141 | hypothetical protein | -none- | D23_1c2181 | NA |
| fig|6666666.60966.peg.2184 | CDS | 2031017 | 2029434 | −2 | − | 1584 | L-aspartate oxidase (EC | Mycobacterium | D23_1c2182 | Neut_2004 |
| 1.4.3.16) | virulence operon | |||||||||
| possibly involved in | ||||||||||
| quinolinate biosynthesis; | ||||||||||
| <br>NAD and NADP | ||||||||||
| cofactor biosynthesis | ||||||||||
| global | ||||||||||
| fig|6666666.60966.peg.2185 | CDS | 2031267 | 2032187 | 3 | + | 921 | Branched-chain amino | Alanine biosynthesis; | D23_1c2184 | Neut_2005 |
| acid aminotransferase | <br>Branched-Chain | |||||||||
| (EC 2.6.1.42) | Amino Acid Biosynthesis; | |||||||||
| <br>Leucine | ||||||||||
| Biosynthesis; | ||||||||||
| <br>Pyruvate Alanine | ||||||||||
| Serine Interconversions | ||||||||||
| fig|6666666.60966.peg.2186 | CDS | 2032212 | 2032421 | 3 | + | 210 | FIG00858455: | -none- | D23_1c2185 | Neut_2006 |
| hypothetical protein | ||||||||||
| fig|6666666.60966.peg.2187 | CDS | 2032485 | 2033864 | 3 | + | 1380 | Phosphomannomutase | Mannose Metabolism | D23_1c2186 | Neut_2007 |
| (EC 5.4.2.8)/ | ||||||||||
| Phosphoglucomutase | ||||||||||
| (EC 5.4.2.2) | ||||||||||
| fig|6666666.60966.peg.2188 | CDS | 2033901 | 2035508 | 3 | + | 1608 | NAD synthetase (EC | NAD and NADP cofactor | D23_1c2187 | Neut_2008 |
| 6.3.1.5)/Glutamine | biosynthesis global; | |||||||||
| amidotransferase chain | <br>NAD and NADP | |||||||||
| of NAD synthetase | cofactor biosynthesis | |||||||||
| global | ||||||||||
| fig|6666666.60966.peg.2189 | CDS | 2035472 | 2037178 | 2 | + | 1707 | Exported zinc | -none- | D23_1c2188 | Neut_2009 |
| metalloprotease YfgC | ||||||||||
| precursor | ||||||||||
| fig|6666666.60966.peg.2190 | CDS | 2037257 | 2038402 | 2 | + | 1146 | Macrolide-specific | Multidrug Resistance | D23_1c2189 | Neut_2010 |
| efflux protein MacA | Efflux Pumps | |||||||||
| fig|6666666.60966.peg.2191 | CDS | 2038413 | 2039180 | 3 | + | 768 | Macrolide export ATP- | Multidrug Resistance | D23_1c2190 | Neut_2011 |
| binding/permease | Efflux Pumps | |||||||||
| protein MacB (EC 3.6.3.—) | ||||||||||
| fig|6666666.60966.peg.2192 | CDS | 2039177 | 2040400 | 2 | + | 1224 | Macrolide export ATP- | Multidrug Resistance | D23_1c2191 | Neut_2012 |
| binding/permease | Efflux Pumps | |||||||||
| protein MacB (EC 3.6.3.—) | ||||||||||
| fig|6666666.60966.peg.2193 | CDS | 2040442 | 2040612 | 1 | + | 171 | hypothetical protein | -none- | D23_1c2192 | NA |
| fig|6666666.60966.peg.2195 | CDS | 2040690 | 2040875 | 3 | + | 186 | hypothetical protein | -none- | D23_1c2193 | NA |
| fig|6666666.60966.peg.2196 | CDS | 2040926 | 2042374 | 2 | + | 1449 | ATP synthase beta chain | -none- | D23_1c2194 | Neut_2013 |
| (EC 3.6.3.14) | ||||||||||
| fig|6666666.60966.peg.2197 | CDS | 2042371 | 2042781 | 1 | + | 411 | ATP synthase epsilon | -none- | D23_1c2195 | Neut_2014 |
| chain (EC 3.6.3.14) | ||||||||||
| fig|6666666.60966.peg.2198 | CDS | 2042778 | 2043059 | 3 | + | 282 | ATP synthase protein I | -none- | D23_1c2196 | Neut_2015 |
| fig|6666666.60966.peg.2199 | CDS | 2043105 | 2043398 | 3 | + | 294 | FIG048548: ATP | -none- | D23_1c2197 | Neut_2016 |
| synthase protein I2 | ||||||||||
| fig|6666666.60966.peg.2200 | CDS | 2043420 | 2044112 | 3 | + | 693 | ATP synthase A chain | -none- | D23_1c2198 | Neut_2017 |
| (EC 3.6.3.14) | ||||||||||
| fig|6666666.60966.peg.2201 | CDS | 2044115 | 2044393 | 2 | + | 279 | ATP synthase C chain | -none- | D23_1c2199 | Neut_2018 |
| (EC 3.6.3.14) | ||||||||||
| fig|6666666.60966.peg.2202 | CDS | 2044400 | 2045170 | 2 | + | 771 | ATP synthase B chain | -none- | D23_1c2200 | Neut_2019 |
| (EC 3.6.3.14) | ||||||||||
| fig|6666666.60966.peg.2203 | CDS | 2045183 | 2046733 | 2 | + | 1551 | ATP synthase alpha | -none- | D23_1c2201 | Neut_2020 |
| chain (EC 3.6.3.14) | ||||||||||
| fig|6666666.60966.peg.2204 | CDS | 2046810 | 2047607 | 3 | + | 798 | ATP synthase gamma | -none- | D23_1c2202 | Neut_2021 |
| chain (EC 3.6.3.14) | ||||||||||
| fig|6666666.60966.peg.2206 | CDS | 2048344 | 2050986 | 1 | + | 2643 | DNA mismatch repair | DNA repair, bacterial | D23_1c2204 | Neut_2022 |
| protein MutS | MutL-MutS system; | |||||||||
| <br>DNA repair system | ||||||||||
| including RecA, MutS | ||||||||||
| and a hypothetical | ||||||||||
| protein | ||||||||||
| fig|6666666.60966.peg.2207 | CDS | 2051500 | 2051021 | −1 | − | 480 | FKBP-type peptidyl- | G3E family of P-loop | D23_1c2205 | Neut_2023 |
| prolyl cis-trans | GTPases (metallocenter | |||||||||
| isomerase SlyD (EC | biosynthesis); | |||||||||
| 5.2.1.8) | <br>Peptidyl-prolyl cis- | |||||||||
| trans isomerase; | ||||||||||
| <br>Potassium | ||||||||||
| homeostasis | ||||||||||
| fig|6666666.60966.peg.2208 | CDS | 2052207 | 2051656 | −3 | − | 552 | Ribonuclease HII (EC | Ribonuclease H; | D23_1c2206 | Neut_2024 |
| 3.1.26.4) | <br>Ribonucleases in | |||||||||
| Bacillus | ||||||||||
| fig|6666666.60966.peg.2209 | CDS | 2052737 | 2052294 | −2 | − | 444 | (3R)-hydroxymyristoyl- | -none- | D23_1c2207 | Neut_2025 |
| [acyl carrier protein] | ||||||||||
| dehydratase (EC 4.2.1.—) | ||||||||||
| fig|6666666.60966.peg.2210 | CDS | 2053333 | 2052770 | −1 | − | 564 | Outer membrane | Lipopolysaccharide | D23_1c2208 | Neut_2026 |
| protein H precursor | assembly; | |||||||||
| <br>Periplasmic Stress | ||||||||||
| Response | ||||||||||
| fig|6666666.60966.peg.2211 | CDS | 2055635 | 2053359 | −2 | − | 2277 | Outer membrane | Lipopolysaccharide | D23_1c2209 | Neut_2027 |
| protein assembly factor | assembly | |||||||||
| YaeT precursor | ||||||||||
| fig|6666666.60966.peg.2212 | CDS | 2057020 | 2055638 | −1 | − | 1383 | Membrane-associated | -none- | D23_1c2210 | Neut_2028 |
| zinc metalloprotease | ||||||||||
| fig|6666666.60966.peg.2213 | CDS | 2058265 | 2057024 | −1 | − | 1242 | 1-deoxy-D-xylulose 5- | CBSS-83331.1.peg.3039; | D23_1c2211 | Neut_2029 |
| phosphate | <br>Isoprenoid | |||||||||
| reductoisomerase (EC | Biosynthesis; | |||||||||
| 1.1.1.267) | <br>Nonmevalonate | |||||||||
| Branch of Isoprenoid | ||||||||||
| Biosynthesis | ||||||||||
| fig|6666666.60966.peg.2214 | CDS | 2059089 | 2058262 | −3 | − | 828 | Phosphatidate | Glycerolipid and | D23_1c2212 | Neut_2030 |
| cytidylyltransferase (EC | Glycerophospholipid | |||||||||
| 2.7.7.41) | Metabolism in Bacteria | |||||||||
| fig|6666666.60966.peg.2215 | CDS | 2059870 | 2059124 | −1 | − | 747 | Undecaprenyl | CBSS-83331.1.peg.3039; | D23_1c2213 | Neut_2031 |
| diphosphate synthase | <br>Isoprenoid | |||||||||
| (EC 2.5.1.31) | Biosynthesis; | |||||||||
| <br>Isoprenoinds for | ||||||||||
| Quinones; | ||||||||||
| <br>Polyprenyl | ||||||||||
| Diphosphate | ||||||||||
| Biosynthesis | ||||||||||
| fig|6666666.60966.peg.2216 | CDS | 2060476 | 2059919 | −1 | − | 558 | Ribosome recycling | Ribosome recycling | D23_1c2214 | Neut_2032 |
| factor | related cluster; | |||||||||
| <br>Translation | ||||||||||
| termination factors | ||||||||||
| bacterial | ||||||||||
| fig|6666666.60966.peg.2217 | CDS | 2061239 | 2060577 | −2 | − | 663 | Uridylate kinase (EC | -none- | D23_1c2215 | Neut_2033 |
| 2.7.4.—) | ||||||||||
| fig|6666666.60966.peg.2218 | CDS | 2061489 | 2061361 | −3 | − | 129 | hypothetical protein | -none- | D23_1c2216 | NA |
| fig|6666666.60966.peg.2219 | CDS | 2062729 | 2061845 | −1 | − | 885 | Translation elongation | CBSS- | D23_1c2217 | Neut_2034 |
| factor Ts | 312309.3.peg.1965; | |||||||||
| <br>Ribosome recycling | ||||||||||
| related cluster; | ||||||||||
| <br>Translation | ||||||||||
| elongation factors | ||||||||||
| bacterial | ||||||||||
| fig|6666666.60966.peg.2220 | CDS | 2063557 | 2062802 | −1 | − | 756 | SSU ribosomal protein | CBSS- | D23_1c2218 | Neut_2035 |
| S2p (SAe) | 312309.3.peg.1965; | |||||||||
| <br>Ribosome recycling | ||||||||||
| related cluster | ||||||||||
| fig|6666666.60966.peg.2221 | CDS | 2064515 | 2063772 | −2 | − | 744 | transcriptional | Oxidative stress | D23_1c2219 | Neut_2036 |
| regulator, Crp/Fnr | ||||||||||
| family | ||||||||||
| fig|6666666.60966.peg.2222 | CDS | 2064873 | 2064562 | −3 | − | 312 | Cytochrome c, class I | -none- | D23_1c2220 | Neut_2037 |
| fig|6666666.60966.peg.2223 | CDS | 2067162 | 2065111 | −3 | − | 2052 | Zinc-regulated outer | -none- | D23_1c2221 | Neut_2038 |
| membrane receptor | ||||||||||
| fig|6666666.60966.peg.2225 | CDS | 2067907 | 2068395 | 1 | + | 489 | Zinc uptake regulation | Glycyl-tRNA synthetase | D23_1c2222 | NA |
| protein ZUR | containing cluster; | |||||||||
| <br>Oxidative stress; | ||||||||||
| <br>Zinc regulated | ||||||||||
| enzymes | ||||||||||
| fig|6666666.60966.peg.2226 | CDS | 2068438 | 2068560 | 1 | + | 123 | Mobile element protein | -none- | D23_1c2223 | Neut_0884 |
| fig|6666666.60966.peg.2228 | CDS | 2068811 | 2069020 | 2 | + | 210 | hypothetical protein | -none- | D23_1c2224 | NA |
| fig|6666666.60966.peg.2231 | CDS | 2069466 | 2069332 | −3 | − | 135 | hypothetical protein | -none- | D23_1c2225 | NA |
| fig|6666666.60966.peg.2232 | CDS | 2069455 | 2070327 | 1 | + | 873 | COG0613, Predicted | A cluster relating to | D23_1c2226 | Neut_2039 |
| metal-dependent | Tryptophanyl-tRNA | |||||||||
| phosphoesterases (PHP | synthetase; <br>tRNA | |||||||||
| family) | modification Bacteria | |||||||||
| fig|6666666.60966.peg.2233 | CDS | 2070450 | 2071082 | 3 | + | 633 | YciO family | -none- | D23_1c2227 | Neut_2040 |
| fig|6666666.60966.peg.2234 | CDS | 2071075 | 2071740 | 1 | + | 666 | FIG004556: membrane | A cluster relating to | D23_1c2228 | Neut_2041 |
| metalloprotease | Tryptophanyl-tRNA | |||||||||
| synthetase | ||||||||||
| fig|6666666.60966.peg.2235 | CDS | 2071817 | 2073019 | 2 | + | 1203 | Tryptophanyl-tRNA | A cluster relating to | D23_1c2229 | Neut_2042 |
| synthetase (EC 6.1.1.2) | Tryptophanyl-tRNA | |||||||||
| synthetase; <br>tRNA | ||||||||||
| aminoacylation, Trp | ||||||||||
| fig|6666666.60966.peg.2236 | CDS | 2073064 | 2073864 | 1 | + | 801 | Segregation and | -none- | D23_1c2230 | Neut_2043 |
| condensation protein A | ||||||||||
| fig|6666666.60966.peg.2237 | CDS | 2073830 | 2074480 | 2 | + | 651 | Segregation and | -none- | D23_1c2231 | Neut_2044 |
| condensation protein B | ||||||||||
| fig|6666666.60966.peg.2238 | CDS | 2074504 | 2075751 | 1 | + | 1248 | Isocitrate | 5-FCL-like protein; | D23_1c2232 | Neut_2045 |
| dehydrogenase [NADP] | <br>TCA Cycle | |||||||||
| (EC 1.1.1.42) | ||||||||||
| fig|6666666.60966.peg.2239 | CDS | 2076095 | 2075892 | −2 | − | 204 | Cold shock protein CspD | Cold shock, CspA family | D23_1c2233 | Neut_2046 |
| of proteins | ||||||||||
| fig|6666666.60966.peg.2240 | CDS | 2076577 | 2076407 | −1 | − | 171 | hypothetical protein | -none- | D23_1c2234 | NA |
| fig|6666666.60966.peg.2241 | CDS | 2076576 | 2076779 | 3 | + | 204 | ATP-dependent Clp | ClpAS cluster; | D23_1c2235 | Neut_2047 |
| protease adaptor | <br>Proteolysis in | |||||||||
| protein ClpS | bacteria, ATP-dependent | |||||||||
| fig|6666666.60966.peg.2242 | CDS | 2076781 | 2079051 | 1 | + | 2271 | ATP-dependent Clp | ClpAS cluster; | D23_1c2236 | Neut_2048 |
| protease ATP-binding | <br>Proteolysis in | |||||||||
| subunit ClpA | bacteria, ATP- | |||||||||
| dependent; | ||||||||||
| <br>Ribosome recycling | ||||||||||
| related cluster | ||||||||||
| fig|6666666.60966.peg.2243 | CDS | 2079170 | 2080129 | 2 | + | 960 | TRAP transporter solute | TRAP Transporter | D23_1c2237 | Neut_2049 |
| receptor, unknown | unknown substrate 6 | |||||||||
| substrate 6 | ||||||||||
| fig|6666666.60966.peg.2244 | CDS | 2080157 | 2080885 | 2 | + | 729 | Orotate | De Novo Pyrimidine | D23_1c2238 | Neut_2050 |
| phosphoribosyltransferase | Synthesis | |||||||||
| (EC 2.4.2.10) | ||||||||||
| fig|6666666.60966.peg.2245 | CDS | 2081203 | 2082156 | 1 | + | 954 | COGs COG0715 | -none- | D23_1c2239 | Neut_2051 |
| fig|6666666.60966.peg.2246 | CDS | 2082161 | 2082997 | 2 | + | 837 | Alkanesulfonates | Alkanesulfonate | D23_1c2240 | Neut_2052 |
| transport system | assimilation | |||||||||
| permease protein | ||||||||||
| fig|6666666.60966.peg.2247 | CDS | 2083232 | 2083038 | −2 | − | 195 | hypothetical protein | -none- | D23_1c2241 | NA |
| fig|6666666.60966.peg.2248 | CDS | 2083287 | 2083823 | 3 | + | 537 | ABC-type | Alkanesulfonate | D23_1c2242 | Neut_2053 |
| nitrate/sulfonate/bicarbonate | assimilation | |||||||||
| transport system, | ||||||||||
| ATPase component | ||||||||||
| fig|6666666.60966.peg.2249 | CDS | 2083938 | 2086493 | 3 | + | 2556 | Glycogen | Glycogen metabolism | D23_1c2243 | Neut_2054 |
| phosphorylase (EC | ||||||||||
| 2.4.1.1) | ||||||||||
| fig|6666666.60966.peg.2251 | CDS | 2086807 | 2086661 | −1 | − | 147 | hypothetical protein | -none- | D23_1c2244 | NA |
| fig|6666666.60966.peg.2252 | CDS | 2086806 | 2087288 | 3 | + | 483 | Flagellar biosynthesis | Flagellum | D23_1c2245 | Neut_2055 |
| protein FliL | ||||||||||
| fig|6666666.60966.peg.2253 | CDS | 2087301 | 2088293 | 3 | + | 993 | Flagellar motor switch | Flagellar motility; | D23_1c2246 | Neut_2056 |
| protein FliM | <br>Flagellum | |||||||||
| fig|6666666.60966.peg.2254 | CDS | 2088322 | 2088795 | 1 | + | 474 | Flagellar motor switch | Flagellar motility; | D23_1c2247 | Neut_2057 |
| protein FliN | <br>Flagellum | |||||||||
| fig|6666666.60966.peg.2255 | CDS | 2088822 | 2089265 | 3 | + | 444 | Flagellar biosynthesis | Flagellum | D23_1c2248 | Neut_2058 |
| protein FliQ | ||||||||||
| fig|6666666.60966.peg.2256 | CDS | 2089255 | 2090040 | 1 | + | 786 | Flagellar biosynthesis | Flagellum | D23_1c2249 | Neut_2059 |
| protein FliP | ||||||||||
| fig|6666666.60966.peg.2257 | CDS | 2090056 | 2090331 | 1 | + | 276 | Flagellar biosynthesis | Flagellum | D23_1c2250 | Neut_2060 |
| protein FliQ | ||||||||||
| fig|6666666.60966.peg.2258 | CDS | 2090429 | 2091229 | 2 | + | 801 | Flagellar biosynthesis | Flagellar motility; | D23_1c2251 | Neut_2061 |
| protein FliR | <br>Flagellum | |||||||||
| fig|6666666.60966.peg.2259 | CDS | 2091389 | 2093485 | 2 | + | 2097 | FIG00858519: | -none- | D23_1c2252 | Neut_2062 |
| hypothetical protein | ||||||||||
| fig|6666666.60966.peg.2260 | CDS | 2093591 | 2095027 | 2 | + | 1437 | FIG00858578: | -none- | D23_1c2253 | Neut_2063 |
| hypothetical protein | ||||||||||
| fig|6666666.60966.peg.2261 | CDS | 2096049 | 2095090 | −3 | − | 960 | alpha/beta hydrolase | -none- | D23_1c2254 | Neut_2064 |
| fold | ||||||||||
| fig|6666666.60966.peg.2262 | CDS | 2096035 | 2096187 | 1 | + | 153 | hypothetical protein | -none- | D23_1c2255 | NA |
| fig|6666666.60966.peg.2263 | CDS | 2097510 | 2096296 | −3 | − | 1215 | Argininosuccinate | Arginine Biosynthesis-- | D23_1c2256 | Neut_2065 |
| synthase (EC 6.3.4.5) | gjo; <br>Arginine | |||||||||
| Biosynthesis extended | ||||||||||
| fig|6666666.60966.peg.2264 | CDS | 2098473 | 2097550 | −3 | − | 924 | Ornithine | Arginine Biosynthesis-- | D23_1c2257 | Neut_2066 |
| carbamoyltransferase | gjo; <br>Arginine | |||||||||
| (EC 2.1.3.3) | Biosynthesis extended; | |||||||||
| <br>Arginine and | ||||||||||
| Ornithine Degradation | ||||||||||
| fig|6666666.60966.peg.2266 | CDS | 2099808 | 2099680 | −3 | − | 129 | hypothetical protein | -none- | D23_1c2259 | Neut_2067 |
| fig|6666666.60966.peg.2265 | CDS | 2099605 | 2098649 | −1 | − | 957 | Acetylornithine | Arginine Biosynthesis-- | D23_1c2259 | Neut_2067 |
| aminotransferase (EC | gjo; <br>Arginine | |||||||||
| 2.6.1.11) | Biosynthesis extended | |||||||||
| fig|6666666.60966.peg.2267 | CDS | 2100416 | 2100066 | −2 | − | 351 | FIG00858925: | -none- | D23_1c2260 | Neut_2068 |
| hypothetical protein | ||||||||||
| fig|6666666.60966.peg.2268 | CDS | 2100762 | 2100517 | −3 | − | 246 | FIG00859242: | -none- | D23_1c2261 | Neut_2069 |
| hypothetical protein | ||||||||||
| fig|6666666.60966.peg.2269 | CDS | 2102838 | 2100763 | −3 | − | 2076 | FIG00858999: | -none- | D23_1c2262 | Neut_2070 |
| hypothetical protein | ||||||||||
| fig|6666666.60966.peg.2270 | CDS | 2103683 | 2102844 | −2 | − | 840 | Cysteine synthase B (EC | Cysteine Biosynthesis | D23_1c2263 | Neut_2071 |
| 2.5.1.47) | ||||||||||
| fig|6666666.60966.peg.2272 | CDS | 2106646 | 2103854 | −1 | − | 2793 | FIG00860005: | -none- | D23_1c2264 | Neut_2072 |
| hypothetical protein | ||||||||||
| fig|6666666.60966.peg.2274 | CDS | 2109519 | 2108932 | −3 | − | 588 | hypothetical protein | -none- | D23_1c2268 | Neut_2074 |
| fig|6666666.60966.peg.2275 | CDS | 2110331 | 2109591 | −2 | − | 741 | putative (U92432) ORF4 | -none- | D23_1c2269 | Neut_2316 |
| (Nitrosospira sp. NpAV) | ||||||||||
| fig|6666666.60966.peg.2276 | CDS | 2111663 | 2110398 | −2 | − | 1266 | Particulate methane | Particulate methane | D23_1c2270 | Neut_2317 |
| monooxygenase B- | monooxygenase | |||||||||
| subunit (EC 1.14.13.25) | (pMMO) | |||||||||
| fig|6666666.60966.peg.2277 | CDS | 2112493 | 2111663 | −1 | − | 831 | Particulate methane | Particulate methane | D23_1c2271 | Neut_2318 |
| monooxygenase A- | monooxygenase | |||||||||
| subunit (EC 1.14.13.25) | (pMMO) | |||||||||
| fig|6666666.60966.peg.2278 | CDS | 2113482 | 2112667 | −3 | − | 816 | Particulate methane | Particulate methane | D23_1c2272 | Neut_2319 |
| monooxygenase C- | monooxygenase | |||||||||
| subunit (EC 1.14.13.25) | (pMMO) | |||||||||
| fig|6666666.60966.peg.2279 | CDS | 2114624 | 2114052 | −2 | − | 573 | CDP-diacylglycerol-- | Glycerolipid and | D23_1c2273 | Neut_2079 |
| glycerol-3-phosphate 3- | Glycerophospholipid | |||||||||
| phosphatidyltransferase | Metabolism in Bacteria | |||||||||
| (EC 2.7.8.5) | ||||||||||
| fig|6666666.60966.peg.2280 | CDS | 2116254 | 2114755 | −3 | − | 1500 | Glycerol kinase (EC | Glycerol and Glycerol-3- | D23_1c2274 | Neut_2080 |
| 2.7.1.30) | phosphate Uptake and | |||||||||
| Utilization; | ||||||||||
| <br>Glycerolipid and | ||||||||||
| Glycerophospholipid | ||||||||||
| Metabolism in Bacteria | ||||||||||
| fig|6666666.60966.peg.2281 | CDS | 2116718 | 2116305 | −2 | − | 414 | Regulator of nucleoside | Transcription factors | D23_1c2275 | Neut_2081 |
| diphosphate kinase | bacterial | |||||||||
| fig|6666666.60966.peg.2282 | CDS | 2116748 | 2116897 | 2 | + | 150 | hypothetical protein | -none- | D23_1c2276 | NA |
| fig|6666666.60966.peg.2283 | CDS | 2117727 | 2117005 | −3 | − | 723 | Phosphate regulon | High affinity phosphate | D23_1c2277 | Neut_2082 |
| transcriptional | transporter and control | |||||||||
| regulatory protein PhoB | of PHO regulon; | |||||||||
| (SphR) | <br>PhoR-PhoB two- | |||||||||
| component regulatory | ||||||||||
| system; <br>Phosphate | ||||||||||
| metabolism | ||||||||||
| fig|6666666.60966.peg.2284 | CDS | 2119187 | 2118225 | −2 | − | 963 | Mobile element protein | -none- | D23_1c2278 | Neut_1746 |
| fig|6666666.60966.peg.2287 | CDS | 2121603 | 2120356 | −3 | − | 1248 | Aspartokinase (EC | CBSS-216591.1.peg.168; | D23_1c2282 | Neut_2084 |
| 2.7.2.4) | <br>Lysine Biosynthesis | |||||||||
| DAP Pathway, GJO | ||||||||||
| scratch; <br>Threonine | ||||||||||
| and Homoserine | ||||||||||
| Biosynthesis | ||||||||||
| fig|6666666.60966.peg.2288 | CDS | 2122439 | 2121855 | −2 | − | 585 | Putative peptidoglycan | -none- | D23_1c2283 | Neut_2085 |
| binding domain 1 | ||||||||||
| fig|6666666.60966.peg.2289 | CDS | 2122914 | 2124089 | 3 | + | 1176 | Acetate kinase (EC | Fermentations: Lactate; | D23_1c2284 | Neut_2086 |
| 2.7.2.1) | <br>Pyruvate | |||||||||
| metabolism II: acetyl- | ||||||||||
| CoA, acetogenesis from | ||||||||||
| pyruvate | ||||||||||
| fig|6666666.60966.peg.2290 | CDS | 2124134 | 2126509 | 2 | + | 2376 | Xylulose-5-phosphate | Fermentations: Lactate; | D23_1c2285 | Neut_2087 |
| phosphoketolase (EC | <br>Fermentations: | |||||||||
| 4.1.2.9); Fructose-6- | Lactate; <br>Pentose | |||||||||
| phosphate | phosphate pathway; | |||||||||
| phosphoketolase (EC | <br>Pentose phosphate | |||||||||
| 4.1.2.22) | pathway | |||||||||
| fig|6666666.60966.peg.2291 | CDS | 2126813 | 2126977 | 2 | + | 165 | hypothetical protein | -none- | D23_1c2287 | NA |
| fig|6666666.60966.peg.2292 | CDS | 2128152 | 2127058 | −3 | − | 1095 | Transaldolase (EC | Pentose phosphate | D23_1c2288 | Neut_2089 |
| 2.2.1.2) | pathway | |||||||||
| fig|6666666.60966.peg.2293 | CDS | 2128367 | 2128218 | −2 | − | 150 | hypothetical protein | -none- | D23_1c2289 | NA |
| fig|6666666.60966.peg.2294 | CDS | 2128351 | 2128908 | 1 | + | 558 | FIG006045: Sigma | Iron siderophore sensor | D23_1c2290 | Neut_2090 |
| factor, ECF subfamily | & receptor system | |||||||||
| fig|6666666.60966.peg.2295 | CDS | 2128915 | 2129877 | 1 | + | 963 | Iron siderophore sensor | Iron siderophore sensor | D23_1c2291 | Neut_2091 |
| protein | & receptor system | |||||||||
| fig|6666666.60966.peg.2296 | CDS | 2129956 | 2132253 | 1 | + | 2298 | TonB-dependent | Ton and Tol transport | D23_1c2292 | Neut_2092 |
| receptor | systems | |||||||||
| fig|6666666.60966.peg.2297 | CDS | 2132801 | 2132271 | −2 | − | 531 | FIG00858714: | -none- | D23_1c2293 | Neut_2093 |
| hypothetical protein | ||||||||||
| fig|6666666.60966.peg.2298 | CDS | 2133157 | 2132813 | −1 | − | 345 | FIG00858447: | -none- | D23_1c2294 | Neut_2094 |
| hypothetical protein | ||||||||||
| fig|6666666.60966.peg.2299 | CDS | 2134515 | 2133133 | −3 | − | 1383 | Xaa-Pro | Aminopeptidases (EC | D23_1c2295 | Neut_2095 |
| aminopeptidase (EC | 3.4.11.—); <br>CBSS- | |||||||||
| 3.4.11.9) | 87626.3.peg.3639 | |||||||||
| fig|6666666.60966.peg.2301 | CDS | 2134633 | 2135313 | 1 | + | 681 | Ribulose-phosphate 3- | Calvin-Benson cycle; | D23_1c2296 | Neut_2096 |
| epimerase (EC 5.1.3.1) | <br>Pentose phosphate | |||||||||
| pathway; <br>Riboflavin | ||||||||||
| synthesis cluster | ||||||||||
| fig|6666666.60966.peg.2302 | CDS | 2135328 | 2136050 | 3 | + | 723 | Phosphoglycolate | 2-phosphoglycolate | D23_1c2297 | Neut_2097 |
| phosphatase (EC | salvage; <br>Glycolate, | |||||||||
| 3.1.3.18) | glyoxylate | |||||||||
| interconversions; | ||||||||||
| <br>Photorespiration | ||||||||||
| (oxidative C2 cycle) | ||||||||||
| fig|6666666.60966.peg.2303 | CDS | 2136160 | 2137647 | 1 | + | 1488 | Anthranilate synthase, | Chorismate: | D23_1c2298 | Neut_2098 |
| aminase component (EC | Intermediate for | |||||||||
| 4.1.3.27) | synthesis of Tryptophan, | |||||||||
| PAPA antibiotics, PABA, | ||||||||||
| 3-hydroxyanthranilate | ||||||||||
| and more.; | ||||||||||
| <br>Tryptophan | ||||||||||
| synthesis | ||||||||||
| fig|6666666.60966.peg.2304 | CDS | 2138110 | 2137682 | −1 | − | 429 | Ferredoxin reductase | Anaerobic respiratory | D23_1c2299 | Neut_2099 |
| reductases | ||||||||||
| fig|6666666.60966.peg.2305 | CDS | 2138482 | 2138138 | −1 | − | 345 | FIG00858997: | -none- | D23_1c2300 | Neut_2100 |
| hypothetical protein | ||||||||||
| fig|6666666.60966.peg.2306 | CDS | 2138586 | 2139236 | 3 | + | 651 | Iron-sulfur cluster | CBSS-196164.1.peg.1690 | D23_1c2301 | Neut_2101 |
| regulator SufR | ||||||||||
| fig|6666666.60966.peg.2307 | CDS | 2139353 | 2140534 | 2 | + | 1182 | FIG00859085: | -none- | D23_1c2302 | Neut_2102 |
| hypothetical protein | ||||||||||
| fig|6666666.60966.peg.2308 | CDS | 2142375 | 2140606 | −3 | − | 1770 | Dihydrolipoamide | Pyruvate metabolism II: | D23_1c2304 | Neut_2103 |
| dehydrogenase of | acetyl-CoA, acetogenesis | |||||||||
| pyruvate | from pyruvate; <br>TCA | |||||||||
| dehydrogenase | Cycle | |||||||||
| complex (EC 1.8.1.4) | ||||||||||
| fig|6666666.60966.peg.2309 | CDS | 2143648 | 2142380 | −1 | − | 1269 | Gamma-glutamyl | Proline Synthesis | D23_1c2305 | Neut_2104 |
| phosphate reductase | ||||||||||
| (EC 1.2.1.41) | ||||||||||
| fig|6666666.60966.peg.2310 | CDS | 2144399 | 2143713 | −2 | − | 687 | InterPro IPR001440 | -none- | D23_1c2306 | Neut_2105 |
| COGs COG0457 | ||||||||||
| fig|6666666.60966.peg.2311 | CDS | 2145656 | 2144412 | −2 | − | 1245 | TPR/glycosyl | -none- | D23_1c2307 | Neut_2106 |
| transferase domain | ||||||||||
| protein | ||||||||||
| fig|6666666.60966.peg.2312 | CDS | 2146522 | 2145650 | −1 | − | 873 | Esterase/lipase/thioesterase | -none- | D23_1c2308 | Neut_2107 |
| family active site | ||||||||||
| fig|6666666.60966.peg.2313 | CDS | 2147373 | 2146519 | −3 | − | 855 | Esterase/lipase/thioesterase | -none- | D23_1c2309 | Neut_2108 |
| family active site | ||||||||||
| fig|6666666.60966.peg.2314 | CDS | 2147631 | 2147380 | −3 | − | 252 | FIG00858580: | -none- | D23_1c2310 | Neut_2109 |
| hypothetical protein | ||||||||||
| fig|6666666.60966.peg.2315 | CDS | 2147817 | 2149007 | 3 | + | 1191 | Tetraacyldisaccharide | Broadly distributed | D23_1c2311 | Neut_2110 |
| 4'-kinase (EC | proteins not in | |||||||||
| 2.7.1.130)/FIG002473: | subsystems; <br>KDO2- | |||||||||
| Protein YcaR in KDO2- | Lipid A biosynthesis | |||||||||
| Lipid A biosynthesis | cluster 2; <br>KDO2- | |||||||||
| cluster | Lipid A biosynthesis | |||||||||
| cluster 2 | ||||||||||
| fig|6666666.60966.peg.2316 | CDS | 2149225 | 2149353 | 1 | + | 129 | hypothetical protein | -none- | D23_1c2312 | NA |
| fig|6666666.60966.peg.2318 | CDS | 2150705 | 2149527 | −2 | − | 1179 | Lipid carrier: UDP-N- | CBSS- | D23_1c2313 | Neut_2112 |
| acetylgalactosaminyltransferase | 296591.1.peg.2330; | |||||||||
| (EC 2.4.1.—)/ | <br>CBSS- | |||||||||
| Alpha-1,3-N- | 296591.1.peg.2330; | |||||||||
| acetylgalactosamine | <br>CBSS- | |||||||||
| transferase PglA (EC | 296591.1.peg.2330; | |||||||||
| 2.4.1.—); Putative | <br>N-linked | |||||||||
| glycosyltransferase | Glycosylation in | |||||||||
| Bacteria; <br>N-linked | ||||||||||
| Glycosylation in Bacteria | ||||||||||
| fig|6666666.60966.peg.2319 | CDS | 2151819 | 2150689 | −3 | − | 1131 | Glycosyl transferase, | -none- | D23_1c2314 | Neut_2113 |
| group 1 family protein | ||||||||||
| fig|6666666.60966.peg.2320 | CDS | 2153132 | 2151816 | −2 | − | 1317 | hypothetical protein | -none- | D23_1c2315 | NA |
| fig|6666666.60966.peg.2321 | CDS | 2154290 | 2153199 | −2 | − | 1092 | Alpha-1,4-N- | N-linked Glycosylation in | D23_1c2316 | Neut_2115 |
| acetylgalactosamine | Bacteria | |||||||||
| transferase PglJ (EC | ||||||||||
| 2.4.1.—) | ||||||||||
| fig|6666666.60966.peg.2322 | CDS | 2155270 | 2154290 | −1 | − | 981 | COGs COG0439 | -none- | D23_1c2317 | Neut_2116 |
| fig|6666666.60966.peg.2323 | CDS | 2156578 | 2155337 | −1 | − | 1242 | Membrane protein | -none- | D23_1c2318 | Neut_2117 |
| involved in the export | ||||||||||
| of O-antigen, teichoic | ||||||||||
| acid lipoteichoic acids | ||||||||||
| fig|6666666.60966.peg.2324 | CDS | 2156818 | 2157207 | 1 | + | 390 | Low molecular weight | Capsular Polysaccharides | D23_1c2319 | Neut_2118 |
| protein-tyrosine- | Biosynthesis and | |||||||||
| phosphatase Wzb (EC | Assembly | |||||||||
| 3.1.3.48) | ||||||||||
| fig|6666666.60966.peg.2325 | CDS | 2157230 | 2158477 | 2 | + | 1248 | Capsule polysaccharide | -none- | D23_1c2320 | Neut_2119 |
| export protein | ||||||||||
| fig|6666666.60966.peg.2326 | CDS | 2158531 | 2160774 | 1 | + | 2244 | Tyrosine-protein kinase | Capsular Polysaccharides | D23_1c2321 | Neut_2120 |
| Wzc (EC 2.7.10.2) | Biosynthesis and | |||||||||
| Assembly | ||||||||||
| fig|6666666.60966.peg.2327 | CDS | 2160771 | 2162330 | 3 | + | 1560 | Undecaprenyl- | -none- | D23_1c2322 | Neut_2121 |
| phosphate N- | ||||||||||
| acetylglucosaminyl 1- | ||||||||||
| phosphate transferase | ||||||||||
| (EC 2.7.8.—) | ||||||||||
| fig|6666666.60966.peg.2329 | CDS | 2165972 | 2162400 | −2 | − | 3573 | Chromosome partition | DNA structural proteins, | D23_1c2323 | Neut_2122 |
| protein smc | bacterial | |||||||||
| fig|6666666.60966.peg.2330 | CDS | 2166059 | 2166478 | 2 | + | 420 | NADPH-dependent 7- | -none- | D23_1c2324 | Neut_2123 |
| cyano-7-deazaguanine | ||||||||||
| reductase (EC 1.7.1.13) | ||||||||||
| fig|6666666.60966.peg.2331 | CDS | 2166527 | 2167927 | 2 | + | 1401 | Fumarate hydratase | TCA Cycle | D23_1c2325 | Neut_2124 |
| class II (EC 4.2.1.2) | ||||||||||
| fig|6666666.60966.peg.2332 | CDS | 2168192 | 2168052 | −2 | − | 141 | hypothetical protein | -none- | D23_1c2326 | NA |
| fig|6666666.60966.peg.2333 | CDS | 2168473 | 2168640 | 1 | + | 168 | hypothetical protein | -none- | D23_1c2327 | NA |
| fig|6666666.60966.peg.2334 | CDS | 2168888 | 2169181 | 2 | + | 294 | Mobile element protein | -none- | D23_1c2328 | Neut_1719 |
| fig|6666666.60966.peg.2335 | CDS | 2169280 | 2170158 | 1 | + | 879 | Mobile element protein | -none- | D23_1c2329 | Neut_1720 |
| fig|6666666.60966.peg.2337 | CDS | 2171884 | 2170655 | −1 | − | 1230 | diguanylate | -none- | D23_1c2332 | Neut_2126 |
| phosphodiesterase | ||||||||||
| fig|6666666.60966.peg.2338 | CDS | 2172707 | 2171898 | −2 | − | 810 | Putative diheme | Soluble cytochromes | D23_1c2333 | Neut_2127 |
| cytochrome c-553 | and functionally related | |||||||||
| electron carriers | ||||||||||
| fig|6666666.60966.peg.2339 | CDS | 2172852 | 2172977 | 3 | + | 126 | hypothetical protein | -none- | D23_1c2334 | NA |
| fig|6666666.60966.peg.2340 | CDS | 2175331 | 2172950 | −1 | − | 2382 | Type II secretory | -none- | D23_1c2335 | Neut_2128 |
| pathway, ATPase | ||||||||||
| PulE/Tfp pilus assembly | ||||||||||
| pathway, ATPase PilB | ||||||||||
| fig|6666666.60966.peg.2341 | CDS | 2176108 | 2175344 | −1 | − | 765 | CAMP | cAMP signaling in | D23_1c2336 | Neut_2129 |
| phosphodiesterases | bacteria | |||||||||
| class-II:Metallo-beta- | ||||||||||
| lactamase superfamily | ||||||||||
| fig|6666666.60966.peg.2342 | CDS | 2176622 | 2176197 | −2 | − | 426 | Universal stress protein | -none- | D23_1c2337 | Neut_2130 |
| (Usp) | ||||||||||
| fig|6666666.60966.peg.2343 | CDS | 2177459 | 2176734 | −2 | − | 726 | Membrane protein | -none- | D23_1c2338 | Neut_2131 |
| TerC, possibly involved | ||||||||||
| in tellurium resistance | ||||||||||
| fig|6666666.60966.peg.2344 | CDS | 2178586 | 2177462 | −1 | − | 1125 | Patatin | -none- | D23_1c2339 | Neut_2132 |
| fig|6666666.60966.peg.2345 | CDS | 2178900 | 2179850 | 3 | + | 951 | Proline iminopeptidase | Proline, 4- | D23_1c2340 | Neut_2133 |
| (EC 3.4.11.5) | hydroxyproline uptake | |||||||||
| and utilization | ||||||||||
| fig|6666666.60966.peg.2346 | CDS | 2180553 | 2179870 | −3 | − | 684 | Dethiobiotin synthetase | Biotin biosynthesis; | D23_1c2341 | Neut_2134 |
| (EC 6.3.3.3) | <br>Biotin biosynthesis | |||||||||
| Experimental; <br>Biotin | ||||||||||
| synthesis cluster | ||||||||||
| fig|6666666.60966.peg.2347 | CDS | 2181452 | 2180556 | −2 | − | 897 | Biotin synthesis protein | Biotin biosynthesis; | D23_1c2342 | Neut_2135 |
| BioC | <br>Biotin biosynthesis | |||||||||
| Experimental; <br>Biotin | ||||||||||
| synthesis cluster | ||||||||||
| fig|6666666.60966.peg.2348 | CDS | 2182200 | 2181442 | −3 | − | 759 | Biotin synthesis protein | Biotin biosynthesis; | D23_1c2343 | Neut_2136 |
| BioH | <br>Biotin biosynthesis | |||||||||
| Experimental; <br>Biotin | ||||||||||
| synthesis cluster | ||||||||||
| fig|6666666.60966.peg.2349 | CDS | 2183365 | 2182202 | −1 | − | 1164 | 8-amino-7- | Biotin biosynthesis; | D23_1c2344 | Neut_2137 |
| oxononanoate synthase | <br>Biotin biosynthesis | |||||||||
| (EC 2.3.1.47) | Experimental; <br>Biotin | |||||||||
| synthesis cluster | ||||||||||
| fig|6666666.60966.peg.2350 | CDS | 2184393 | 2183371 | −3 | − | 1023 | Biotin synthase (EC | Biotin biosynthesis; | D23_1c2345 | Neut_2138 |
| 2.8.1.6) | <br>Biotin biosynthesis | |||||||||
| Experimental; <br>Biotin | ||||||||||
| synthesis cluster | ||||||||||
| fig|6666666.60966.peg.2351 | CDS | 2184641 | 2184453 | −2 | − | 189 | hypothetical protein | -none- | D23_1c2346 | NA |
| fig|6666666.60966.peg.2352 | CDS | 2184698 | 2185168 | 2 | + | 471 | Competence protein F | Biotin biosynthesis | D23_1c2347 | Neut_2139 |
| homolog, | Experimental; <br>Biotin | |||||||||
| phosphoribosyltransferase | synthesis cluster; | |||||||||
| domain; protein | <br>CBSS- | |||||||||
| YhgH required for | 216591.1.peg.168 | |||||||||
| utilization of DNA as | ||||||||||
| sole source of carbon | ||||||||||
| and energy | ||||||||||
| fig|6666666.60966.peg.2353 | CDS | 2185222 | 2185686 | 1 | + | 465 | tRNA (cytidine(34)- | Biotin synthesis cluster; | D23_1c2348 | Neut_2140 |
| 2'-O)- | <br>RNA methylation | |||||||||
| methyltransferase (EC | ||||||||||
| 2.1.1.207) ## TrmL | ||||||||||
| fig|6666666.60966.peg.2354 | CDS | 2185773 | 2186303 | 3 | + | 531 | protein of unknown | -none- | D23_1c2349 | Neut_2141 |
| function DUF1130 | ||||||||||
| fig|6666666.60966.peg.2355 | CDS | 2186489 | 2187325 | 2 | + | 837 | SAM-dependent | -none- | D23_1c2350 | Neut_2142 |
| methyltransferase (EC | ||||||||||
| 2.1.1.—) | ||||||||||
| fig|6666666.60966.peg.2356 | CDS | 2189013 | 2187523 | −3 | − | 1491 | Glucose-6-phosphate 1- | Pentose phosphate | D23_1c2351 | Neut_2143 |
| dehydrogenase (EC | pathway | |||||||||
| 1.1.1.49) | ||||||||||
| fig|6666666.60966.peg.2357 | CDS | 2189925 | 2189017 | −3 | − | 909 | 6-phosphogluconate | D-gluconate and | D23_1c2352 | Neut_2144 |
| dehydrogenase, | ketogluconates | |||||||||
| decarboxylating (EC | metabolism; | |||||||||
| 1.1.1.44) | <br>Pentose phosphate | |||||||||
| pathway | ||||||||||
| fig|6666666.60966.peg.2358 | CDS | 2191152 | 2189995 | −3 | − | 1158 | COGs COG1397 | -none- | D23_1c2353 | Neut_2145 |
| fig|6666666.60966.peg.2359 | CDS | 2191494 | 2191195 | −3 | − | 300 | UPF0235 protein | CBSS-630.2.peg.3360 | D23_1c2354 | Neut_2146 |
| VC0458 | ||||||||||
| fig|6666666.60966.peg.2360 | CDS | 2192054 | 2191494 | −2 | − | 561 | Integral membrane | CBSS-630.2.peg.3360 | D23_1c2355 | Neut_2147 |
| protein YggT, involved | ||||||||||
| in response to | ||||||||||
| extracytoplasmic stress | ||||||||||
| (osmotic shock) | ||||||||||
| fig|6666666.60966.peg.2361 | CDS | 2192939 | 2192127 | −2 | − | 813 | Pyrroline-5-carboxylate | A Hypothetical Protein | D23_1c2356 | Neut_2148 |
| reductase (EC 1.5.1.2) | Related to Proline | |||||||||
| Metabolism; <br>CBSS- | ||||||||||
| 630.2.peg.3360; | ||||||||||
| <br>Proline Synthesis | ||||||||||
| fig|6666666.60966.peg.2362 | CDS | 2193210 | 2193019 | −3 | − | 192 | FIG00859708: | -none- | D23_1c2357 | Neut_2149 |
| hypothetical protein | ||||||||||
| fig|6666666.60966.peg.2364 | CDS | 2194302 | 2194580 | 3 | + | 279 | Ribonuclease P protein | Cell Division Subsystem | D23_1c2359 | Neut_2152 |
| component (EC | including YidCD; | |||||||||
| 3.1.26.5) | <br>RNA modification | |||||||||
| cluster; <br>tRNA | ||||||||||
| processing | ||||||||||
| fig|6666666.60966.peg.2365 | CDS | 2194877 | 2196745 | 2 | + | 1869 | Inner membrane | CTP synthase (EC | D23_1c2360 | Neut_2154 |
| protein translocase | 6.3.4.2) cluster; <br>Cell | |||||||||
| component YidC, long | Division Subsystem | |||||||||
| form | including YidCD; | |||||||||
| <br>RNA modification | ||||||||||
| cluster | ||||||||||
| fig|6666666.60966.peg.2366 | CDS | 2196792 | 2198171 | 3 | + | 1380 | GTPase and tRNA-U34 | Cell Division Subsystem | D23_1c2361 | Neut_2155 |
| 5-formylation enzyme | including YidCD; | |||||||||
| TrmE | <br>RNA modification | |||||||||
| and chromosome | ||||||||||
| partitioning cluster; | ||||||||||
| <br>RNA modification | ||||||||||
| cluster; <br>Universal | ||||||||||
| GTPases; <br>mnm5U34 | ||||||||||
| biosynthesis bacteria; | ||||||||||
| <br>tRNA modification | ||||||||||
| Bacteria | ||||||||||
| fig|6666666.60966.peg.2367 | CDS | 2198398 | 2198667 | 1 | + | 270 | SSU ribosomal protein | -none- | D23_1c2363 | Neut_2156 |
| S15p (S13e) | ||||||||||
| fig|6666666.60966.peg.2368 | CDS | 2198846 | 2200963 | 2 | + | 2118 | Polyribonucleotide | Bacterial RNA- | D23_1c2364 | Neut_2157 |
| nucleotidyltransferase | metabolizing Zn- | |||||||||
| (EC 2.7.7.8) | dependent hydrolases; | |||||||||
| <br>Polyadenylation | ||||||||||
| bacterial | ||||||||||
| fig|6666666.60966.peg.2369 | CDS | 2201167 | 2201039 | −1 | − | 129 | hypothetical protein | -none- | D23_1c2365 | NA |
| fig|6666666.60966.peg.2371 | CDS | 2201553 | 2202926 | 3 | + | 1374 | RND efflux system, | Multidrug Resistance | D23_1c2367 | Neut_2158 |
| outer membrane | Efflux Pumps | |||||||||
| lipoprotein CmeC | ||||||||||
| fig|6666666.60966.peg.2372 | CDS | 2203015 | 2204220 | 1 | + | 1206 | Membrane fusion | Multidrug Resistance | D23_1c2368 | Neut_2159 |
| protein of RND family | Efflux Pumps | |||||||||
| multidrug efflux pump | ||||||||||
| fig|6666666.60966.peg.2373 | CDS | 2204238 | 2207432 | 3 | + | 3195 | RND efflux system, | Multidrug Resistance | D23_1c2369 | Neut_2160 |
| inner membrane | Efflux Pumps | |||||||||
| transporter CmeB | ||||||||||
| fig|6666666.60966.peg.2375 | CDS | 2208043 | 2207702 | −1 | − | 342 | hypothetical protein | -none- | D23_1c2370 | Neut_2161 |
| fig|6666666.60966.peg.2376 | CDS | 2208812 | 2208072 | −2 | − | 741 | conserved hypothetical | -none- | D23_1c2371 | Neut_2162 |
| protein [Pyrococcus | ||||||||||
| horikoshii]; COG2102: | ||||||||||
| Predicted ATPases of | ||||||||||
| PP-loop superfamily; | ||||||||||
| IPR002761: Domain of | ||||||||||
| unknown function | ||||||||||
| DUF71 | ||||||||||
| fig|6666666.60966.peg.2377 | CDS | 2209043 | 2208924 | −2 | − | 120 | FIG00859479: | -none- | D23_1c2372 | Neut_2163 |
| hypothetical protein | ||||||||||
| fig|6666666.60966.peg.2379 | CDS | 2210878 | 2209472 | −1 | − | 1407 | GTP-binding protein | CBSS- | D23_1c2374 | Neut_2164 |
| EngA | 290633.1.peg.1906; | |||||||||
| <br>CBSS- | ||||||||||
| 498211.3.peg.1415; | ||||||||||
| <br>Universal GTPases | ||||||||||
| fig|6666666.60966.peg.2380 | CDS | 2212159 | 2210930 | −1 | − | 1230 | Outer membrane | CBSS- | D23_1c2375 | Neut_2165 |
| protein YfgL, lipoprotein | 290633.1.peg.1906; | |||||||||
| component of the | <br>CBSS- | |||||||||
| protein assembly | 498211.3.peg.1415; | |||||||||
| complex (forms a | <br>Lipopolysaccharide | |||||||||
| complex with YaeT, | assembly | |||||||||
| YfiO, and NlpB) | ||||||||||
| fig|6666666.60966.peg.2381 | CDS | 2212800 | 2212162 | −3 | − | 639 | Mlr7403 protein | CBSS- | D23_1c2376 | Neut_2166 |
| 290633.1.peg.1906; | ||||||||||
| <br>CBSS- | ||||||||||
| 498211.3.peg.1415 | ||||||||||
| fig|6666666.60966.peg.2382 | CDS | 2214088 | 2212823 | −1 | − | 1266 | Histidyl-tRNA | CBSS- | D23_1c2377 | Neut_2167 |
| synthetase (EC 6.1.1.21) | 498211.3.peg.1415; | |||||||||
| <br>tRNA | ||||||||||
| aminoacylation, His | ||||||||||
| fig|6666666.60966.peg.2383 | CDS | 2215286 | 2214081 | −2 | − | 1206 | 1-hydroxy-2-methyl-2- | CBSS- | D23_1c2378 | Neut_2168 |
| (E)-butenyl 4- | 498211.3.peg.1415; | |||||||||
| diphosphate synthase | <br>CBSS- | |||||||||
| (EC 1.17.7.1) | 83331.1.peg.3039; | |||||||||
| <br>Isoprenoid | ||||||||||
| Biosynthesis; | ||||||||||
| <br>Nonmevalonate | ||||||||||
| Branch of Isoprenoid | ||||||||||
| Biosynthesis | ||||||||||
| fig|6666666.60966.peg.2384 | CDS | 2216438 | 2215359 | −2 | − | 1080 | FIG021952: putative | CBSS-498211.3.peg.1415 | D23_1c2379 | Neut_2169 |
| membrane protein | ||||||||||
| fig|6666666.60966.peg.2385 | CDS | 2217306 | 2216428 | −3 | − | 879 | Type IV pilus biogenesis | CBSS-498211.3.peg.1415 | D23_1c2380 | Neut_2170 |
| protein PilF | ||||||||||
| fig|6666666.60966.peg.2386 | CDS | 2218414 | 2217275 | −1 | − | 1140 | Ribosomal RNA large | CBSS- | D23_1c2381 | Neut_2171 |
| subunit | 498211.3.peg.1415; | |||||||||
| methyltransferase N (EC | <br>RNA methylation | |||||||||
| 2.1.1.—) | ||||||||||
| fig|6666666.60966.peg.2387 | CDS | 2218877 | 2218452 | −2 | − | 426 | Nucleoside diphosphate | CBSS- | D23_1c2382 | Neut_2172 |
| kinase (EC 2.7.4.6) | 498211.3.peg.1415; | |||||||||
| <br>Purine conversions; | ||||||||||
| <br>pyrimidine | ||||||||||
| conversions | ||||||||||
| fig|6666666.60966.peg.2389 | CDS | 2219591 | 2219175 | −2 | − | 417 | Chain A, Red Copper | -none- | D23_1c2383 | Neut_2173 |
| Protein Nitrosocyanin | ||||||||||
| fig|6666666.60966.peg.2390 | CDS | 2220042 | 2221430 | 3 | + | 1389 | Aminotransferase | Hopanes | D23_1c2384 | Neut_2174 |
| HpnO, required for | ||||||||||
| aminobacteriohopanetriol | ||||||||||
| fig|6666666.60966.peg.2391 | CDS | 2222146 | 2221442 | −1 | − | 705 | DNA polymerase III | CBSS-228410.1.peg.134; | D23_1c2385 | Neut_2175 |
| epsilon subunit (EC | <br>CBSS- | |||||||||
| 2.7.7.7) | 342610.3.peg.1536 | |||||||||
| fig|6666666.60966.peg.2392 | CDS | 2222646 | 2222158 | −3 | − | 489 | Ribonuclease HI (EC | CBSS-228410.1.peg.134; | D23_1c2386 | Neut_2176 |
| 3.1.26.4) | <br>CBSS- | |||||||||
| 342610.3.peg.1536; | ||||||||||
| <br>Ribonuclease H | ||||||||||
| fig|6666666.60966.peg.2393 | CDS | 2223440 | 2222706 | −2 | − | 735 | FIG005121: SAM- | CBSS-228410.1.peg.134; | D23_1c2387 | Neut_2177 |
| dependent | <br>CBSS- | |||||||||
| methyltransferase (EC | 342610.3.peg.1536; | |||||||||
| 2.1.1.—) | <br>Glutathione: Non- | |||||||||
| redox reactions | ||||||||||
| fig|6666666.60966.peg.2394 | CDS | 2223500 | 2224267 | 2 | + | 768 | Hydroxyacylglutathione | CBSS-228410.1.peg.134; | D23_1c2388 | Neut_2178 |
| hydrolase (EC 3.1.2.6) | <br>CBSS- | |||||||||
| 342610.3.peg.1536; | ||||||||||
| <br>Glutathione: Non- | ||||||||||
| redox reactions; | ||||||||||
| <br>Methylglyoxal | ||||||||||
| Metabolism | ||||||||||
| fig|6666666.60966.peg.2396 | CDS | 2225143 | 2224571 | −1 | − | 573 | hypothetical protein | -none- | D23_1c2389 | Neut_2179 |
| fig|6666666.60966.peg.2397 | CDS | 2225287 | 2225162 | −1 | − | 126 | hypothetical protein | -none- | D23_1c2390 | NA |
| fig|6666666.60966.peg.2398 | CDS | 2226167 | 2225250 | −2 | − | 918 | hypothetical protein | -none- | D23_1c2391 | Neut_2180 |
| fig|6666666.60966.peg.2399 | CDS | 2228864 | 2226171 | −2 | − | 2694 | Helicase, SNF2/RAD54 | -none- | D23_1c2392 | Neut_2181 |
| family | ||||||||||
| fig|6666666.60966.peg.2401 | CDS | 2229650 | 2229480 | −2 | − | 171 | hypothetical protein | -none- | D23_1c2393 | NA |
| fig|6666666.60966.peg.2402 | CDS | 2229693 | 2230814 | 3 | + | 1122 | Oxidoreductase, FMN- | -none- | D23_1c2394 | Neut_2182 |
| binding | ||||||||||
| fig|6666666.60966.peg.2403 | CDS | 2230925 | 2231368 | 2 | + | 444 | Ornithine | Arginine and Ornithine | D23_1c2395 | Neut_2183 |
| cyclodeaminase (EC | Degradation | |||||||||
| 4.3.1.12) | ||||||||||
| fig|6666666.60966.peg.2404 | CDS | 2231434 | 2233005 | 1 | + | 1572 | Phosphoglucomutase | -none- | D23_1c2396 | Neut_2184 |
| (EC 5.4.2.2) | ||||||||||
| fig|6666666.60966.peg.2405 | CDS | 2233192 | 2233344 | 1 | + | 153 | hypothetical protein | -none- | D23_1c2397 | NA |
| fig|6666666.60966.peg.2406 | CDS | 2234195 | 2233347 | −2 | − | 849 | Mobile element protein | -none- | D23_1c2398 | Neut_1888 |
| fig|6666666.60966.peg.2407 | CDS | 2234437 | 2234252 | −1 | − | 186 | Mobile element protein | -none- | D23_1c2399 | Neut_2500 |
| fig|6666666.60966.peg.2408 | CDS | 2234636 | 2235049 | 2 | + | 414 | Cobalt-zinc-cadmium | Cobalt-zinc-cadmium | D23_1c2400 | Neut_2185 |
| resistance protein | resistance | |||||||||
| fig|6666666.60966.peg.2409 | CDS | 2235949 | 2235359 | −1 | − | 591 | Hydroxyacylglutathione | CBSS-228410.1.peg.134; | D23_1c2401 | Neut_2178 |
| hydrolase (EC 3.1.2.6) | <br>CBSS- | |||||||||
| 342610.3.peg.1536; | ||||||||||
| <br>Glutathione: Non- | ||||||||||
| redox reactions; | ||||||||||
| <br>Methylglyoxal | ||||||||||
| Metabolism | ||||||||||
| fig|6666666.60966.peg.2410 | CDS | 2236135 | 2236287 | 1 | + | 153 | hypothetical protein | -none- | D23_1c2403 | Neut_1255 |
| fig|6666666.60966.peg.2411 | CDS | 2236295 | 2236462 | 2 | + | 168 | hypothetical protein | -none- | D23_1c2404 | Neut_2449 |
| fig|6666666.60966.peg.2412 | CDS | 2236616 | 2236419 | −2 | − | 198 | Mobile element protein | -none- | D23_1c2405 | Neut_2268 |
| fig|6666666.60966.peg.2414 | CDS | 2236758 | 2237006 | 3 | + | 249 | Mobile element protein | -none- | D23_1c2406 | Neut_1756 |
| fig|6666666.60966.peg.2417 | CDS | 2240037 | 2237515 | −3 | − | 2523 | Aconitate hydratase (EC | TCA Cycle | D23_1c2409 | Neut_2457 |
| 4.2.1.3) | ||||||||||
| fig|6666666.60966.peg.2418 | CDS | 2240239 | 2240093 | −1 | − | 147 | Aconitate hydratase (EC | TCA Cycle | D23_1c2410 | NA |
| 4.2.1.3) | ||||||||||
| fig|6666666.60966.peg.2419 | CDS | 2240661 | 2241623 | 3 | + | 963 | Mobile element protein | -none- | D23_1c2411 | Neut_1278 |
| fig|6666666.60966.peg.2421 | CDS | 2241835 | 2241987 | 1 | + | 153 | Mobile element protein | -none- | D23_1c2413 | NA |
| fig|6666666.60966.peg.2422 | CDS | 2242232 | 2242522 | 2 | + | 291 | hypothetical protein | -none- | D23_1c2414 | NA |
| fig|6666666.60966.peg.2423 | CDS | 2242506 | 2243450 | 3 | + | 945 | Agmatinase (EC | Arginine and Ornithine | D23_1c2415 | Neut_2187 |
| 3.5.3.11) | Degradation; | |||||||||
| <br>Polyamine | ||||||||||
| Metabolism | ||||||||||
| fig|6666666.60966.peg.2424 | CDS | 2243462 | 2245420 | 2 | + | 1959 | Biosynthetic arginine | Arginine and Ornithine | D23_1c2416 | Neut_2188 |
| decarboxylase (EC | Degradation; | |||||||||
| 4.1.1.19) | <br>Polyamine | |||||||||
| Metabolism | ||||||||||
| fig|6666666.60966.peg.2425 | CDS | 2246086 | 2245436 | −1 | − | 651 | Mobile element protein | -none- | D23_1c2417 | Neut_2189 |
| fig|6666666.60966.peg.2426 | CDS | 2247251 | 2246148 | −2 | − | 1104 | hypothetical protein | -none- | D23_1c2418 | Neut_2191 |
| fig|6666666.60966.peg.2427 | CDS | 2247251 | 2247436 | 2 | + | 186 | Mobile element protein | -none- | D23_1c2419 | Neut_2500 |
| fig|6666666.60966.peg.2428 | CDS | 2247493 | 2248341 | 1 | + | 849 | Mobile element protein | -none- | D23_1c2420 | Neut_1375 |
| fig|6666666.60966.peg.2430 | CDS | 2249188 | 2249352 | 1 | + | 165 | Mobile element protein | -none- | D23_1c2422 | Neut_2186 |
| fig|6666666.60966.peg.2431 | CDS | 2249749 | 2251734 | 1 | + | 1986 | Protein-L-isoaspartate | Protein-L-isoaspartate O- | D23_1c2423 | Neut_2323 |
| O-methyltransferase | methyltransferase; | |||||||||
| (EC 2.1.1.77) | <br>Stationary phase | |||||||||
| repair cluster; <br>Ton | ||||||||||
| and Tol transport | ||||||||||
| systems | ||||||||||
| fig|6666666.60966.peg.2432 | CDS | 2252354 | 2253127 | 2 | + | 774 | hypothetical protein | -none- | D23_1c2424 | Neut_2196 |
| fig|6666666.60966.peg.2433 | CDS | 2253955 | 2253515 | −1 | − | 441 | tRNA pseudouridine | Colicin V and Bacteriocin | D23_1c2425 | Neut_2203 |
| synthase A (EC 4.2.1.70) | Production Cluster; | |||||||||
| <br>RNA pseudouridine | ||||||||||
| syntheses; <br>tRNA | ||||||||||
| modification Bacteria; | ||||||||||
| <br>tRNA processing | ||||||||||
| fig|6666666.60966.peg.2434 | CDS | 2254408 | 2254247 | −1 | − | 162 | hypothetical protein | -none- | D23_1c2426 | NA |
| fig|6666666.60966.peg.2435 | CDS | 2256251 | 2254536 | −2 | − | 1716 | Selenoprotein O and | Selenoprotein O | D23_1c2427 | Neut_2204 |
| cysteine-containing | ||||||||||
| homologs | ||||||||||
| fig|6666666.60966.peg.2436 | CDS | 2256898 | 2257503 | 1 | + | 606 | GCN5-related N- | -none- | D23_1c2429 | Neut_2208 |
| acetyltransferase | ||||||||||
| fig|6666666.60966.peg.2437 | CDS | 2258004 | 2257552 | −3 | − | 453 | probable multiple | -none- | D23_1c2430 | Neut_2211 |
| antibiotic resistance | ||||||||||
| protein marC | ||||||||||
| fig|6666666.60966.peg.2438 | CDS | 2258357 | 2258229 | −2 | − | 129 | hypothetical protein | -none- | D23_1c2431 | Neut_2212 |
| fig|6666666.60966.peg.2440 | CDS | 2259106 | 2259264 | 1 | + | 159 | hypothetical protein | -none- | D23_1c2432 | NA |
| fig|6666666.60966.peg.2441 | CDS | 2259280 | 2260221 | 1 | + | 942 | Ornithine | Arginine and Ornithine | D23_1c2433 | Neut_2213 |
| cyclodeaminase (EC | Degradation | |||||||||
| 4.3.1.12) | ||||||||||
| fig|6666666.60966.peg.2442 | CDS | 2260562 | 2261791 | 2 | + | 1230 | hypothetical protein | -none- | D23_1c2434 | Neut_2214 |
| fig|6666666.60966.peg.2443 | CDS | 2262110 | 2262748 | 2 | + | 639 | hypothetical protein | -none- | D23_1c2435 | Neut_2232 |
| fig|6666666.60966.peg.2444 | CDS | 2262936 | 2263406 | 3 | + | 471 | FIG00858867: | -none- | D23_1c2436 | Neut_2233 |
| hypothetical protein | ||||||||||
| fig|6666666.60966.peg.2446 | CDS | 2264766 | 2263630 | −3 | − | 1137 | N-succinyl-L,L- | Arginine Biosynthesis-- | D23_1c2437 | Neut_2234 |
| diaminopimelate | gjo; <br>Arginine | |||||||||
| desuccinylase (EC | Biosynthesis extended; | |||||||||
| 3.5.1.18) | <br>Lysine Biosynthesis | |||||||||
| DAP Pathway, GJO | ||||||||||
| scratch | ||||||||||
| fig|6666666.60966.peg.2447 | CDS | 2265597 | 2264815 | −3 | − | 783 | Methionine ABC | Methionine | D23_1c2438 | Neut_2235 |
| transporter ATP-binding | Biosynthesis; | |||||||||
| protein | <br>Methionine | |||||||||
| Degradation | ||||||||||
| fig|6666666.60966.peg.2448 | CDS | 2266742 | 2265597 | −2 | − | 1146 | ABC-type transport | -none- | D23_1c2439 | Neut_2236 |
| system involved in | ||||||||||
| resistance to organic | ||||||||||
| solvents, permease | ||||||||||
| component USSDB6A | ||||||||||
| fig|6666666.60966.peg.2449 | CDS | 2267603 | 2266767 | −2 | − | 837 | Prolipoprotein | Lipoprotein Biosynthesis | D23_1c2440 | Neut_2237 |
| diacylglyceryl | ||||||||||
| transferase (EC 2.4.99.—) | ||||||||||
| fig|6666666.60966.peg.2450 | CDS | 2267740 | 2269413 | 1 | + | 1674 | Dihydroxy-acid | Branched-Chain Amino | D23_1c2441 | Neut_2238 |
| dehydratase (EC | Acid Biosynthesis | |||||||||
| 4.2.1.9) | ||||||||||
| fig|6666666.60966.peg.2451 | CDS | 2269430 | 2271499 | 2 | + | 2070 | Thymidylate kinase (EC | pyrimidine conversions | D23_1c2442 | Neut_2241 |
| 2.7.4.9) | ||||||||||
| fig|6666666.60966.peg.2452 | CDS | 2271523 | 2271834 | 1 | + | 312 | Cytochrome c551/c552 | Soluble cytochromes | D23_1c2443 | Neut_2242 |
| and functionally related | ||||||||||
| electron carriers | ||||||||||
| fig|6666666.60966.peg.2454 | CDS | 2272004 | 2272972 | 2 | + | 969 | D-3-phosphoglycerate | Glycine and Serine | D23_1c2444 | Neut_2243 |
| dehydrogenase (EC | Utilization; | |||||||||
| 1.1.1.95) | <br>Pyridoxin (Vitamin | |||||||||
| B6) Biosynthesis; | ||||||||||
| <br>Serine Biosynthesis | ||||||||||
| fig|6666666.60966.peg.2455 | CDS | 2273050 | 2273595 | 1 | + | 546 | dTDP-4- | Rhamnose containing | D23_1c2445 | Neut_2244 |
| dehydrorhamnose 3,5- | glycans; <br>dTDP- | |||||||||
| epimerase (EC 5.1.3.13) | rhamnose synthesis | |||||||||
| fig|6666666.60966.peg.2456 | CDS | 2273700 | 2274983 | 3 | + | 1284 | Permeases of the major | -none- | D23_1c2446 | Neut_2245 |
| facilitator superfamily | ||||||||||
| fig|6666666.60966.peg.2457 | CDS | 2275758 | 2274997 | −3 | − | 762 | hypothetical protein | -none- | D23_1c2447 | NA |
| fig|6666666.60966.peg.2458 | CDS | 2275968 | 2276633 | 3 | + | 666 | Chromosomal | Cell Division Subsystem | D23_1c2449 | Neut_2247 |
| replication initiator | including YidCD; | |||||||||
| protein DnaA | <br>DNA replication | |||||||||
| cluster 1 | ||||||||||
| fig|6666666.60966.peg.2459 | CDS | 2276770 | 2277435 | 1 | + | 666 | Phosphoserine | Glycine and Serine | D23_1c2450 | Neut_2248 |
| phosphatase (EC | Utilization; <br>Serine | |||||||||
| 3.1.3.3) | Biosynthesis; <br>Serine | |||||||||
| Biosynthesis | ||||||||||
| fig|6666666.60966.peg.2460 | CDS | 2277481 | 2277846 | 1 | + | 366 | FIG00859424: | -none- | D23_1c2451 | Neut_2249 |
| hypothetical protein | ||||||||||
| fig|6666666.60966.peg.2461 | CDS | 2277800 | 2277958 | 2 | + | 159 | hypothetical protein | -none- | D23_1c2452 | NA |
| fig|6666666.60966.peg.2462 | CDS | 2277971 | 2279434 | 2 | + | 1464 | Inosine-5'- | Purine conversions; | D23_1c2453 | Neut_2250 |
| monophosphate | <br>Purine salvage | |||||||||
| dehydrogenase (EC | cluster | |||||||||
| 1.1.1.205) | ||||||||||
| fig|6666666.60966.peg.2463 | CDS | 2279447 | 2281006 | 2 | + | 1560 | GMP synthase | GMP synthase; <br>GMP | D23_1c2454 | Neut_2251 |
| [glutamine- | synthase; <br>Purine | |||||||||
| hydrolyzing], | conversions; <br>Purine | |||||||||
| amidotransferase | conversions; <br>Purine | |||||||||
| subunit (EC 6.3.5.2)/ | salvage cluster; | |||||||||
| GMP synthase | <br>Purine salvage | |||||||||
| [glutamine- | cluster | |||||||||
| hydrolyzing], ATP | ||||||||||
| pyrophosphatase | ||||||||||
| subunit (EC 6.3.5.2) | ||||||||||
| fig|6666666.60966.peg.2465 | CDS | 2282716 | 2281352 | −1 | − | 1365 | hypothetical protein | -none- | D23_1c2455 | NA |
| fig|6666666.60966.peg.2466 | CDS | 2282899 | 2282762 | −1 | − | 138 | Mobile element protein | -none- | D23_1c2456 | Neut_2501 |
| fig|6666666.60966.peg.2467 | CDS | 2283609 | 2282872 | −3 | − | 738 | Mobile element protein | -none- | D23_1c2457 | Neut_1888 |
| fig|6666666.60966.peg.2468 | CDS | 2283851 | 2283666 | −2 | − | 186 | Mobile element protein | -none- | D23_1c2458 | Neut_2500 |
| fig|6666666.60966.peg.2469 | CDS | 2285015 | 2284020 | −2 | − | 996 | hypothetical protein | -none- | D23_1c2459 | NA |
| fig|6666666.60966.peg.2470 | CDS | 2285305 | 2285048 | −1 | − | 258 | hypothetical protein | -none- | D23_1c2460 | NA |
| fig|6666666.60966.peg.2471 | CDS | 2285448 | 2285573 | 3 | + | 126 | hypothetical protein | -none- | D23_1c2461 | NA |
| fig|6666666.60966.peg.2472 | CDS | 2285631 | 2286293 | 3 | + | 663 | Thiopurine S- | -none- | D23_1c2462 | Neut_2272 |
| methyltransferase (EC | ||||||||||
| 2.1.1.67) | ||||||||||
| fig|6666666.60966.peg.2473 | CDS | 2286615 | 2288795 | 3 | + | 2181 | hypothetical protein | -none- | D23_1c2463 | Neut_2273 |
| fig|6666666.60966.peg.2474 | CDS | 2289016 | 2291046 | 1 | + | 2031 | oligopeptide | -none- | D23_1c2464 | Neut_2274 |
| transporter | ||||||||||
| fig|6666666.60966.peg.2475 | CDS | 2291342 | 2291145 | −2 | − | 198 | FIG00859558: | -none- | D23_1c2465 | Neut_2275 |
| hypothetical protein | ||||||||||
| fig|6666666.60966.peg.2476 | CDS | 2291757 | 2291362 | −3 | − | 396 | FIG00859558: | -none- | D23_1c2466 | Neut_2275 |
| hypothetical protein | ||||||||||
| fig|6666666.60966.peg.2477 | CDS | 2292959 | 2291901 | −2 | − | 1059 | Putative permease | -none- | D23_1c2467 | Neut_2276 |
| often clustered with de | ||||||||||
| novo purine synthesis | ||||||||||
| fig|6666666.60966.peg.2478 | CDS | 2293039 | 2294097 | 1 | + | 1059 | Phosphoribosylformylglycinamidine | De Novo Purine | D23_1c2468 | Neut_2277 |
| cyclo-ligase | Biosynthesis | |||||||||
| (EC 6.3.3.1) | ||||||||||
| fig|6666666.60966.peg.2479 | CDS | 2294109 | 2294741 | 3 | + | 633 | Phosphoribosylglycinamide | 5-FCL-like protein; | D23_1c2469 | Neut_2278 |
| formyltransferase | <br>De Novo Purine | |||||||||
| (EC 2.1.2.2) | Biosynthesis | |||||||||
| fig|6666666.60966.peg.2480 | CDS | 2294738 | 2295460 | 2 | + | 723 | FIG00859545: | -none- | D23_1c2470 | Neut_2279 |
| hypothetical protein | ||||||||||
| fig|6666666.60966.peg.2481 | CDS | 2295477 | 2296751 | 3 | + | 1275 | Fmu (Sun)/eukaryotic | -none- | D23_1c2471 | Neut_2280 |
| nucleolar NOL1/Nop2p; | ||||||||||
| tRNAand rRNA | ||||||||||
| cytosine-C5-methylases | ||||||||||
| fig|6666666.60966.peg.2482 | CDS | 2297068 | 2296832 | −1 | − | 237 | hypothetical protein | -none- | D23_1c2472 | Neut_2281 |
| PA0941 | ||||||||||
| fig|6666666.60966.peg.2483 | CDS | 2297785 | 2297237 | −1 | − | 549 | InterPro | -none- | D23_1c2473 | Neut_2282 |
| IPR000694:IPR001734 | ||||||||||
| fig|6666666.60966.peg.2484 | CDS | 2297997 | 2297800 | −3 | − | 198 | hypothetical protein | -none- | D23_1c2474 | Neut_2283 |
| fig|6666666.60966.peg.2485 | CDS | 2298574 | 2299293 | 1 | + | 720 | possible | -none- | D23_1c2475 | Neut_2284 |
| transmembrane protein | ||||||||||
| fig|6666666.60966.peg.2486 | CDS | 2299389 | 2301113 | 3 | + | 1725 | Diguanylate | -none- | D23_1c2476 | Neut_2285 |
| cyclase/phosphodiesterase | ||||||||||
| domain 2 (EAL) | ||||||||||
| fig|6666666.60966.peg.2488 | CDS | 2301326 | 2301784 | 2 | + | 459 | FKBP-type peptidyl- | -none- | D23_1c2477 | Neut_2286 |
| prolyl cis-trans | ||||||||||
| isomerase | ||||||||||
| fig|6666666.60966.peg.2489 | CDS | 2302743 | 2301856 | −3 | − | 888 | Ribosome small | Universal GTPases | D23_1c2478 | Neut_2287 |
| subunit-stimulated | ||||||||||
| GTPase EngC | ||||||||||
| fig|6666666.60966.peg.2490 | CDS | 2303060 | 2302782 | −2 | − | 279 | Pterin-4-alpha- | Pterin carbinolamine | D23_1c2479 | Neut_2288 |
| carbinolamine | dehydratase | |||||||||
| dehydratase (EC | ||||||||||
| 4.2.1.96) | ||||||||||
| fig|6666666.60966.peg.2491 | CDS | 2304388 | 2303120 | −1 | − | 1269 | macromolecule | -none- | D23_1c2480 | Neut_2289 |
| metabolism; | ||||||||||
| macromolecule | ||||||||||
| degradation; | ||||||||||
| degradation of proteins, | ||||||||||
| peptides, glycopeptides | ||||||||||
| fig|6666666.60966.peg.2492 | CDS | 2304540 | 2305085 | 3 | + | 546 | 3'-to-5' | RNA processing and | D23_1c2481 | Neut_2290 |
| oligoribonuclease (orn) | degradation, bacterial | |||||||||
| fig|6666666.60966.peg.2493 | CDS | 2305123 | 2307678 | 1 | + | 2556 | Glycogen | Glycogen metabolism | D23_1c2482 | Neut_2291 |
| phosphorylase (EC | ||||||||||
| 2.4.1.1) | ||||||||||
| fig|6666666.60966.peg.2494 | CDS | 2308460 | 2307702 | −2 | − | 759 | Pantoate--beta-alanine | Coenzyme A | D23_1c2483 | Neut_2292 |
| ligase (EC 6.3.2.1) | Biosynthesis; | |||||||||
| <br>Coenzyme A | ||||||||||
| Biosynthesis cluster | ||||||||||
| fig|6666666.60966.peg.2495 | CDS | 2309368 | 2308559 | −1 | − | 810 | 3-methyl-2- | Coenzyme A | D23_1c2484 | Neut_2293 |
| oxobutanoate | Biosynthesis; | |||||||||
| hydroxymethyltransferase | <br>Coenzyme A | |||||||||
| (EC 2.1.2.11) | Biosynthesis cluster | |||||||||
| fig|6666666.60966.peg.2496 | CDS | 2310016 | 2309372 | −1 | − | 645 | Deoxyadenosine kinase | Purine conversions; | D23_1c2485 | Neut_2294 |
| (EC 2.7.1.76)/ | <br>Purine conversions | |||||||||
| Deoxyguanosine kinase | ||||||||||
| (EC 2.7.1.113) | ||||||||||
| fig|6666666.60966.peg.2497 | CDS | 2310525 | 2310013 | −3 | − | 513 | 2-amino-4-hydroxy-6- | Folate Biosynthesis | D23_1c2486 | Neut_2295 |
| hydroxymethyldihydropteridine | ||||||||||
| pyrophosphokinase (EC | ||||||||||
| 2.7.6.3) | ||||||||||
| fig|6666666.60966.peg.2498 | CDS | 2311910 | 2310522 | −2 | − | 1389 | Poly(A) polymerase (EC | Polyadenylation | D23_1c2487 | Neut_2296 |
| 2.7.7.19) | bacterial | |||||||||
| fig|6666666.60966.peg.2499 | CDS | 2313230 | 2312073 | −2 | − | 1158 | Cardiolipin synthetase | Cardiolipin synthesis; | D23_1c2488 | Neut_2297 |
| (EC 2.7.8.—) | <br>Glycerolipid and | |||||||||
| Glycerophospholipid | ||||||||||
| Metabolism in Bacteria | ||||||||||
| fig|6666666.60966.peg.2500 | CDS | 2314054 | 2313227 | −1 | − | 828 | Endonuclease/exonuclease/ | -none- | D23_1c2489 | Neut_2298 |
| phosphatase family | ||||||||||
| protein | ||||||||||
| fig|6666666.60966.peg.2501 | CDS | 2315160 | 2314060 | −3 | − | 1101 | Quinolinate synthetase | Mycobacterium | D23_1c2490 | Neut_2299 |
| (EC 2.5.1.72) | virulence operon | |||||||||
| possibly involved in | ||||||||||
| quinolinate biosynthesis; | ||||||||||
| <br>NAD and NADP | ||||||||||
| cofactor biosynthesis | ||||||||||
| global | ||||||||||
| fig|6666666.60966.peg.2502 | CDS | 2315495 | 2316031 | 2 | + | 537 | FIG00859627: | -none- | D23_1c2491 | Neut_2300 |
| hypothetical protein | ||||||||||
| fig|6666666.60966.peg.2503 | CDS | 2316137 | 2316652 | 2 | + | 516 | LptA, protein essential | Lipopolysaccharide | D23_1c2492 | Neut_2301 |
| for LPS transport across | assembly | |||||||||
| the periplasm | ||||||||||
| fig|6666666.60966.peg.2504 | CDS | 2316704 | 2317426 | 2 | + | 723 | Lipopolysaccharide ABC | Lipopolysaccharide | D23_1c2493 | Neut_2302 |
| transporter, ATP- | assembly | |||||||||
| binding protein LptB | ||||||||||
| fig|6666666.60966.peg.2505 | CDS | 2317432 | 2318895 | 1 | + | 1464 | RNA polymerase sigma- | Flagellar motility; | D23_1c2494 | Neut_2303 |
| 54 factor RpoN | <br>Flagellum; | |||||||||
| <br>Transcription | ||||||||||
| initiation, bacterial | ||||||||||
| sigma factors | ||||||||||
| fig|6666666.60966.peg.2506 | CDS | 2319070 | 2319405 | 1 | + | 336 | Ribosome hibernation | Ribosome activity | D23_1c2495 | Neut_2304 |
| protein YhbH | modulation | |||||||||
| fig|6666666.60966.peg.2507 | CDS | 2319646 | 2320116 | 1 | + | 471 | PTS system nitrogen- | -none- | D23_1c2496 | Neut_2305 |
| specific IIA component, | ||||||||||
| PtsN | ||||||||||
| fig|6666666.60966.peg.2508 | CDS | 2320103 | 2321074 | 2 | + | 972 | HPr | HPr catabolite | D23_1c2497 | Neut_2306 |
| kinase/phosphorylase | repression system | |||||||||
| (EC 2.7.1.—) (EC 2.7.4.—) | ||||||||||
| fig|6666666.60966.peg.2509 | CDS | 2321107 | 2321223 | 1 | + | 117 | hypothetical protein | -none- | D23_1c2498 | NA |
| fig|6666666.60966.peg.2510 | CDS | 2321260 | 2321874 | 1 | + | 615 | 3-polyprenyl-4- | Ubiquinone | D23_1c2499 | Neut_2307 |
| hydroxybenzoate | Biosynthesis; | |||||||||
| carboxy-lyase UbiX (EC | <br>Ubiquinone | |||||||||
| 4.1.1.—) | Biosynthesis-gjo | |||||||||
| fig|6666666.60966.peg.2511 | CDS | 2322562 | 2321924 | −1 | − | 639 | 5- | 5-FCL-like protein; | D23_1c2500 | Neut_2308 |
| formyltetrahydrofolate | <br>Folate Biosynthesis; | |||||||||
| cyclo-ligase (EC 6.3.3.2) | <br>One-carbon | |||||||||
| metabolism by | ||||||||||
| tetrahydropterines | ||||||||||
| fig|6666666.60966.peg.2512 | CDS | 2323682 | 2322555 | −2 | − | 1128 | A/G-specific adenine | DNA repair, bacterial | D23_1c2501 | Neut_2309 |
| glycosylase (EC 3.2.2.—) | ||||||||||
| fig|6666666.60966.peg.2513 | CDS | 2324249 | 2323704 | −2 | − | 546 | Intracellular septation | CBSS-211586.9.peg.2729 | D23_1c2503 | Neut_2310 |
| protein IspA | ||||||||||
| fig|6666666.60966.peg.2514 | CDS | 2326043 | 2324346 | −2 | − | 1698 | Lipid A export ATP- | KDO2-Lipid A | D23_1c2504 | Neut_2311 |
| binding/permease | biosynthesis cluster 2 | |||||||||
| protein MsbA (EC | ||||||||||
| 3.6.3.25) | ||||||||||
| fig|6666666.60966.peg.2515 | CDS | 2327134 | 2326562 | −1 | − | 573 | hypothetical protein | -none- | D23_1c2505 | Neut_2312 |
| fig|6666666.60966.peg.2516 | CDS | 2329375 | 2327231 | −1 | − | 2145 | Copper resistance | Copper homeostasis | D23_1c2506 | Neut_2313 |
| protein D | ||||||||||
| fig|6666666.60966.peg.2517 | CDS | 2329755 | 2329381 | −3 | − | 375 | Copper resistance | -none- | D23_1c2507 | Neut_2314 |
| protein CopC precursor | ||||||||||
| fig|6666666.60966.peg.2518 | CDS | 2330496 | 2329909 | −3 | − | 588 | hypothetical protein | -none- | D23_1c2508 | Neut_2074 |
| fig|6666666.60966.peg.2519 | CDS | 2331308 | 2330568 | −2 | − | 741 | putative (U92432) ORF4 | -none- | D23_1c2509 | Neut_2316 |
| (Nitrosospira sp. NpAV) | ||||||||||
| fig|6666666.60966.peg.2520 | CDS | 2332640 | 2331375 | −2 | − | 1266 | Particulate methane | Particulate methane | D23_1c2510 | Neut_2317 |
| monooxygenase B- | monooxygenase | |||||||||
| subunit (EC 1.14.13.25) | (pMMO) | |||||||||
| fig|6666666.60966.peg.2521 | CDS | 2333470 | 2332640 | −1 | − | 831 | Particulate methane | Particulate methane | D23_1c2511 | Neut_2318 |
| monooxygenase A- | monooxygenase | |||||||||
| subunit (EC 1.14.13.25) | (pMMO) | |||||||||
| fig|6666666.60966.peg.2522 | CDS | 2334459 | 2333644 | −3 | − | 816 | Particulate methane | Particulate methane | D23_1c2512 | Neut_2319 |
| monooxygenase C- | monooxygenase | |||||||||
| subunit (EC 1.14.13.25) | (pMMO) | |||||||||
| fig|6666666.60966.peg.2523 | CDS | 2334883 | 2335908 | 1 | + | 1026 | TsaC protein (YrdC-Sua5 | -none- | D23_1c2513 | Neut_2320 |
| domains) required for | ||||||||||
| threonylcarbamoyladenosine | ||||||||||
| t(6)A37 | ||||||||||
| modification in tRNA | ||||||||||
| fig|6666666.60966.peg.2524 | CDS | 2335923 | 2336666 | 3 | + | 744 | Hypothetical protein | -none- | D23_1c2514 | Neut_2321 |
| CbbY | ||||||||||
| fig|6666666.60966.peg.2525 | CDS | 2337688 | 2336702 | −1 | − | 987 | Lipoprotein NlpD | Stationary phase repair | D23_1c2515 | Neut_2322 |
| cluster | ||||||||||
| fig|6666666.60966.peg.2526 | CDS | 2338471 | 2337803 | −1 | − | 669 | Protein-L-isoaspartate | Protein-L-isoaspartate O- | D23_1c2516 | Neut_2323 |
| O-methyltransferase | methyltransferase; | |||||||||
| (EC 2.1.1.77) | <br>Stationary phase | |||||||||
| repair cluster; <br>Ton | ||||||||||
| and Tol transport | ||||||||||
| systems | ||||||||||
| fig|6666666.60966.peg.2528 | CDS | 2339405 | 2338662 | −2 | − | 744 | 5-nucleotidase SurE (EC | Housecleaning | D23_1c2517 | Neut_2324 |
| 3.1.3.5) @ | nucleoside triphosphate | |||||||||
| Exopolyphosphatase | pyrophosphatases; | |||||||||
| (EC 3.6.1.11) | <br>Phosphate | |||||||||
| metabolism; | ||||||||||
| <br>Polyphosphate; | ||||||||||
| <br>Stationary phase | ||||||||||
| repair cluster | ||||||||||
| fig|6666666.60966.peg.2529 | CDS | 2340272 | 2339964 | −2 | − | 309 | Integration host factor | DNA structural proteins, | D23_1c2519 | Neut_2325 |
| alpha subunit | bacterial | |||||||||
| fig|6666666.60966.peg.2530 | CDS | 2342785 | 2340485 | −1 | − | 2301 | Phenylalanyl-tRNA | tRNA aminoacylation, | D23_1c2520 | Neut_2326 |
| synthetase beta chain | Phe | |||||||||
| (EC 6.1.1.20) | ||||||||||
| fig|6666666.60966.peg.2531 | CDS | 2343901 | 2342882 | −1 | − | 1020 | Phenylalanyl-tRNA | tRNA aminoacylation, | D23_1c2521 | Neut_2327 |
| synthetase alpha chain | Phe | |||||||||
| (EC 6.1.1.20) | ||||||||||
| fig|6666666.60966.peg.2532 | CDS | 2344231 | 2343989 | −1 | − | 243 | LSU ribosomal protein | -none- | D23_1c2522 | Neut_2328 |
| L20p | ||||||||||
| fig|6666666.60966.peg.2533 | CDS | 2345202 | 2344723 | −3 | − | 480 | Translation initiation | Translation initiation | D23_1c2524 | Neut_2330 |
| factor 3 | factors bacterial | |||||||||
| fig|6666666.60966.peg.2534 | CDS | 2347209 | 2345302 | −3 | − | 1908 | Threonyl-tRNA | tRNA aminoacylation, | D23_1c2525 | Neut_2331 |
| synthetase (EC 6.1.1.3) | Thr | |||||||||
| fig|6666666.60966.peg.2535 | CDS | 2348256 | 2347537 | −3 | − | 720 | Cytochrome c-type | -none- | D23_1c2526 | Neut_1790 |
| protein TorY | ||||||||||
| fig|6666666.60966.peg.2536 | CDS | 2348966 | 2348259 | −2 | − | 708 | Cytochrome c family | -none- | D23_1c2527 | Neut_2333 |
| protein | ||||||||||
| fig|6666666.60966.peg.2537 | CDS | 2350169 | 2349048 | −2 | − | 1122 | FIG00859557: | -none- | D23_1c2528 | Neut_1792 |
| hypothetical protein | ||||||||||
| fig|6666666.60966.peg.2538 | CDS | 2351878 | 2350166 | −1 | − | 1713 | Hydroxylamine | -none- | D23_1c2529 | Neut_2335 |
| oxidoreductase | ||||||||||
| precursor (EC 1.7.3.4) | ||||||||||
| fig|6666666.60966.peg.2539 | CDS | 2352170 | 2353255 | 2 | + | 1086 | tRNA-specific 2- | RNA methylation | D23_1c2530 | Neut_2336 |
| thiouridylase MnmA | ||||||||||
| fig|6666666.60966.peg.2540 | CDS | 2354395 | 2353256 | −1 | − | 1140 | Twitching motility | -none- | D23_1c2531 | Neut_2337 |
| protein PilT | ||||||||||
| fig|6666666.60966.peg.2541 | CDS | 2355448 | 2354405 | −1 | − | 1044 | Twitching motility | -none- | D23_1c2532 | Neut_2338 |
| protein PilT | ||||||||||
| fig|6666666.60966.peg.2543 | CDS | 2355643 | 2356359 | 1 | + | 717 | Hypothetical protein | A Hypothetical Protein | D23_1c2533 | Neut_2339 |
| YggS, proline synthase | Related to Proline | |||||||||
| co-transcribed bacterial | Metabolism; <br>CBSS- | |||||||||
| homolog PROSC | 630.2.peg.3360 | |||||||||
| fig|6666666.60966.peg.2544 | CDS | 2356597 | 2356328 | −1 | − | 270 | 4Fe—4S ferredoxin, iron- | Inorganic Sulfur | D23_1c2534 | Neut_2340 |
| sulfur binding | Assimilation | |||||||||
| fig|6666666.60966.peg.2545 | CDS | 2357097 | 2356603 | −3 | − | 495 | Phosphopantetheine | CBSS- | D23_1c2535 | Neut_2341 |
| adenylyltransferase (EC | 266117.6.peg.1260; | |||||||||
| 2.7.7.3) | <br>CBSS-269801.1.peg.1715; | |||||||||
| <br>Coenzyme A | ||||||||||
| Biosynthesis | ||||||||||
| fig|6666666.60966.peg.2546 | CDS | 2357644 | 2357090 | −1 | − | 555 | 16S rRNA | CBSS- | D23_1c2536 | Neut_2342 |
| (guanine(966)-N(2))- | 266117.6.peg.1260; | |||||||||
| methyltransferase (EC | <br>CBSS- | |||||||||
| 2.1.1.171) ## SSU rRNA | 269801.1.peg.1715; | |||||||||
| m(2)G966 | <br>Heat shock Cell | |||||||||
| division Proteases and a | ||||||||||
| Methyltransferase; | ||||||||||
| <br>RNA methylation | ||||||||||
| fig|6666666.60966.peg.2547 | CDS | 2358960 | 2357659 | −3 | − | 1302 | FIG015287: Zinc | Heat shock Cell division | D23_1c2537 | Neut_2343 |
| protease | Proteases and a | |||||||||
| Methyltransferase | ||||||||||
| fig|6666666.60966.peg.2548 | CDS | 2359437 | 2359126 | −3 | − | 312 | Transposase | -none- | D23_1c2538 | Neut_2344 |
| fig|6666666.60966.peg.2549 | CDS | 2360187 | 2359819 | −3 | − | 369 | Mobile element protein | -none- | D23_1c2539 | Neut_1814 |
| fig|6666666.60966.peg.2550 | CDS | 2360570 | 2360247 | −2 | − | 324 | Putative periplasmic | -none- | D23_1c2540 | Neut_2357 |
| protein | ||||||||||
| fig|6666666.60966.peg.2551 | CDS | 2361073 | 2360771 | −1 | − | 303 | hypothetical protein | -none- | D23_1c2541 | Neut_2349 |
| fig|6666666.60966.peg.2552 | CDS | 2361307 | 2361110 | −1 | − | 198 | CsbD family protein | -none- | D23_1c2542 | Neut_2359 |
| fig|6666666.60966.peg.2553 | CDS | 2361551 | 2361384 | −2 | − | 168 | protein of unknown | -none- | D23_1c2543 | NA |
| function DUF1328 | ||||||||||
| fig|6666666.60966.peg.2554 | CDS | 2361863 | 2362066 | 2 | + | 204 | Mobile element protein | -none- | D23_1c2544 | Neut_2365 |
| fig|6666666.60966.peg.2555 | CDS | 2362071 | 2362247 | 3 | + | 177 | hypothetical protein | -none- | D23_1c2545 | NA |
| fig|6666666.60966.peg.2556 | CDS | 2362394 | 2362957 | 2 | + | 564 | Alkyl hydroperoxide | Thioredoxin-disulfide | D23_1c2546 | Neut_2366 |
| reductase protein C (EC | reductase | |||||||||
| 1.6.4.—) | ||||||||||
| fig|6666666.60966.peg.2557 | CDS | 2363052 | 2363633 | 3 | + | 582 | putative lipoprotein | -none- | D23_1c2547 | Neut_2367 |
| fig|6666666.60966.peg.2558 | CDS | 2364440 | 2363661 | −2 | − | 780 | Putative | -none- | D23_1c2548 | Neut_2368 |
| stomatin/prohibitin- | ||||||||||
| family membrane | ||||||||||
| protease subunit | ||||||||||
| aq_911 | ||||||||||
| fig|6666666.60966.peg.2559 | CDS | 2365869 | 2364442 | −3 | − | 1428 | Putative membrane- | -none- | D23_1c2549 | Neut_2369 |
| bound ClpP-class | ||||||||||
| protease associated | ||||||||||
| with aq_911 | ||||||||||
| fig|6666666.60966.peg.2560 | CDS | 2366482 | 2365880 | −1 | − | 603 | ADP-ribose | CBSS-216591.1.peg.168; | D23_1c2550 | Neut_2370 |
| pyrophosphatase (EC | <br>NADand NADP | |||||||||
| 3.6.1.13) | cofactor biosynthesis | |||||||||
| global; <br>Nudix | ||||||||||
| proteins (nucleoside | ||||||||||
| triphosphate hydrolases) | ||||||||||
| fig|6666666.60966.peg.2561 | CDS | 2367579 | 2366665 | −3 | − | 915 | putative membrane | -none- | D23_1c2551 | Neut_2371 |
| protein | ||||||||||
| fig|6666666.60966.peg.2562 | CDS | 2367673 | 2368539 | 1 | + | 867 | Protein YicC | CBSS-323097.3.peg.2594 | D23_1c2552 | Neut_2372 |
| fig|6666666.60966.peg.2563 | CDS | 2369652 | 2368633 | −3 | − | 1020 | C4-dicarboxylate | -none- | D23_1c2553 | Neut_2373 |
| transporter/malic acid | ||||||||||
| transport protein | ||||||||||
| fig|6666666.60966.peg.2564 | CDS | 2371015 | 2370053 | −1 | − | 963 | Mobile element protein | -none- | D23_1c2554 | Neut_1746 |
| fig|6666666.60966.peg.2565 | CDS | 2371724 | 2371065 | −2 | − | 660 | Glucose-1-phosphate | Rhamnose containing | D23_1c2555 | Neut_2374 |
| thymidylyltransferase | glycans; <br>dTDP- | |||||||||
| (EC 2.7.7.24) | rhamnose synthesis | |||||||||
| fig|6666666.60966.peg.2566 | CDS | 2372737 | 2371739 | −1 | − | 999 | COG3178: Predicted | -none- | D23_1c2556 | Neut_2375 |
| phosphotransferase | ||||||||||
| related to Ser/Thr | ||||||||||
| protein kinases | ||||||||||
| fig|6666666.60966.peg.2567 | CDS | 2372902 | 2373210 | 1 | + | 309 | Putative cytoplasmic | -none- | D23_1c2557 | Neut_2376 |
| protein | ||||||||||
| fig|6666666.60966.peg.2568 | CDS | 2373276 | 2374775 | 3 | + | 1500 | MG(2+) CHELATASE | -none- | D23_1c2559 | Neut_2377 |
| FAMILY PROTEIN/ | ||||||||||
| ComM-related protein | ||||||||||
| fig|6666666.60966.peg.2569 | CDS | 2376191 | 2374794 | −2 | − | 1398 | Replicative DNA | -none- | D23_1c2560 | Neut_2378 |
| helicase (EC 3.6.1.—) | ||||||||||
| fig|6666666.60966.peg.2571 | CDS | 2376752 | 2376297 | −2 | − | 456 | LSU ribosomal protein | Primosomal replication | D23_1c2561 | Neut_2379 |
| L9p | protein N clusters with | |||||||||
| ribosomal proteins | ||||||||||
| fig|6666666.60966.peg.2572 | CDS | 2377049 | 2376771 | −2 | − | 279 | SSU ribosomal protein | Primosomal replication | D23_1c2562 | Neut_2380 |
| S18p @ SSU ribosomal | protein N clusters with | |||||||||
| protein S18p, zinc- | ribosomal proteins | |||||||||
| independent | ||||||||||
| fig|6666666.60966.peg.2573 | CDS | 2377399 | 2377091 | −1 | − | 309 | Primosomal replication | Primosomal replication | D23_1c2563 | Neut_2381 |
| protein N | protein N clusters with | |||||||||
| ribosomal proteins | ||||||||||
| fig|6666666.60966.peg.2574 | CDS | 2377721 | 2377401 | −2 | − | 321 | SSU ribosomal protein | Primosomal replication | D23_1c2564 | Neut_2382 |
| S6p | protein N clusters with | |||||||||
| ribosomal proteins | ||||||||||
| fig|6666666.60966.peg.2576 | CDS | 2378765 | 2378340 | −2 | − | 426 | hypothetical protein | -none- | D23_1c2565 | NA |
| fig|6666666.60966.peg.2578 | CDS | 2379069 | 2380031 | 3 | + | 963 | Mobile element protein | -none- | D23_1c2566 | Neut_1746 |
| fig|6666666.60966.peg.2580 | CDS | 2380409 | 2380864 | 2 | + | 456 | Mobile element protein | -none- | D23_1c2567 | Neut_0883 |
| fig|6666666.60966.peg.2581 | CDS | 2381862 | 2380975 | −3 | − | 888 | Acetylglutamate kinase | Arginine Biosynthesis-- | D23_1c2568 | Neut_2384 |
| (EC 2.7.2.8) | gjo; <br>Arginine | |||||||||
| Biosynthesis extended | ||||||||||
| fig|6666666.60966.peg.2582 | CDS | 2382398 | 2381919 | −2 | − | 480 | type IV pili signal | -none- | D23_1c2569 | Neut_2385 |
| transduction protein Pill | ||||||||||
| fig|6666666.60966.peg.2583 | CDS | 2382774 | 2382427 | −3 | − | 348 | twitching motility | -none- | D23_1c2570 | Neut_2386 |
| protein PilH | ||||||||||
| fig|6666666.60966.peg.2584 | CDS | 2383169 | 2383639 | 2 | + | 471 | 21 kDa hemolysin | CBSS-160492.1.peg.550 | D23_1c2571 | Neut_2387 |
| precursor | ||||||||||
| fig|6666666.60966.peg.2585 | CDS | 2383676 | 2385043 | 2 | + | 1368 | Fe—S protein, homolog | -none- | D23_1c2572 | Neut_2388 |
| of lactate | ||||||||||
| dehydrogenase SO1521 | ||||||||||
| fig|6666666.60966.peg.2586 | CDS | 2386032 | 2385136 | −3 | − | 897 | Heme O synthase, | Biogenesis of | D23_1c2573 | Neut_2389 |
| protoheme IX | cytochrome c oxidases; | |||||||||
| farnesyltransferase (EC | <br>CBSS- | |||||||||
| 2.5.1.—) COX10-CtaB | 196164.1.peg.1690; | |||||||||
| <br>CBSS- | ||||||||||
| 316057.3.peg.563 | ||||||||||
| fig|6666666.60966.peg.2587 | CDS | 2386422 | 2386123 | −3 | − | 300 | Probable | -none- | D23_1c2574 | Neut_2390 |
| transmembrane protein | ||||||||||
| fig|6666666.60966.peg.2588 | CDS | 2387398 | 2386679 | −1 | − | 720 | Cytochrome oxidase | Biogenesis of | D23_1c2575 | Neut_2391 |
| biogenesis protein | cytochrome c oxidases; | |||||||||
| Surf1, facilitates heme | <br>CBSS- | |||||||||
| A insertion | 316057.3.peg.563 | |||||||||
| fig|6666666.60966.peg.2589 | CDS | 2388336 | 2387491 | −3 | − | 846 | Cytochrome c oxidase | CBSS-316057.3.peg.563; | D23_1c2576 | Neut_2392 |
| polypeptide III (EC | <br>Terminal | |||||||||
| 1.9.3.1) | cytochrome C oxidases | |||||||||
| fig|6666666.60966.peg.2590 | CDS | 2389047 | 2388529 | −3 | − | 519 | Cytochrome oxidase | Biogenesis of cytochrome c oxidases; | D23_1c2577 | Neut_2393 |
| biogenesis protein | <br>CBSS- | |||||||||
| Cox11-CtaG, copper | 316057.3.peg.563 | |||||||||
| delivery to Cox1 | ||||||||||
| fig|6666666.60966.peg.2591 | CDS | 2390759 | 2389182 | −2 | − | 1578 | Cytochrome c oxidase | Terminal cytochrome C | D23_1c2578 | Neut_2394 |
| polypeptide I (EC | oxidases | |||||||||
| 1.9.3.1) | ||||||||||
| fig|6666666.60966.peg.2592 | CDS | 2391643 | 2390819 | −1 | − | 825 | Cytochrome c oxidase | CBSS-316057.3.peg.563; | D23_1c2579 | Neut_2395 |
| polypeptide II (EC | <br>Terminal | |||||||||
| 1.9.3.1) | cytochrome C oxidases | |||||||||
| fig|6666666.60966.peg.2594 | CDS | 2392145 | 2392567 | 2 | + | 423 | Putative TEGT family | CBSS-326442.4.peg.1852 | D23_1c2580 | NA |
| carrier/transport | ||||||||||
| protein | ||||||||||
| fig|6666666.60966.peg.2595 | CDS | 2392600 | 2392884 | 1 | + | 285 | Putative TEGT family | CBSS-326442.4.peg.1852 | D23_1c2581 | Neut_1715 |
| carrier/transport | ||||||||||
| protein | ||||||||||
| fig|6666666.60966.peg.2596 | CDS | 2393084 | 2393302 | 2 | + | 219 | Copper chaperone | Copper homeostasis | D23_1c2582 | Neut_2397 |
| fig|6666666.60966.peg.2597 | CDS | 2393426 | 2394394 | 2 | + | 969 | Acetyl-coenzyme A | Fatty Acid Biosynthesis | D23_1c2583 | Neut_2398 |
| carboxyl transferase | FASII | |||||||||
| alpha chain (EC 6.4.1.2) | ||||||||||
| fig|6666666.60966.peg.2598 | CDS | 2394357 | 2395742 | 3 | + | 1386 | tRNA(Ile)-lysidine | -none- | D23_1c2584 | Neut_2399 |
| synthetase | ||||||||||
| fig|6666666.60966.peg.2599 | CDS | 2395746 | 2396807 | 3 | + | 1062 | dTDP-glucose 4,6- | CBSS- | D23_1c2585 | Neut_2400 |
| dehydratase (EC | 296591.1.peg.2330; | |||||||||
| 4.2.1.46) | <br>Rhamnose | |||||||||
| containing glycans; | ||||||||||
| <br>dTDP-rhamnose | ||||||||||
| synthesis | ||||||||||
| fig|6666666.60966.peg.2600 | CDS | 2396804 | 2397700 | 2 | + | 897 | dTDP-4- | Rhamnose containing | D23_1c2586 | Neut_2401 |
| dehydrorhamnose | glycans; <br>dTDP- | |||||||||
| reductase (EC | rhamnose synthesis | |||||||||
| 1.1.1.133) | ||||||||||
| fig|6666666.60966.peg.2601 | CDS | 2398663 | 2397710 | −1 | − | 954 | InterPro IPR002142 | -none- | D23_1c2587 | Neut_2402 |
| COGs COG0616 | ||||||||||
| fig|6666666.60966.peg.2602 | CDS | 2399353 | 2398691 | −1 | − | 663 | Outer membrane | Ton and Tol transport | D23_1c2588 | Neut_2403 |
| lipoprotein omp16 | systems | |||||||||
| precursor | ||||||||||
| fig|6666666.60966.peg.2603 | CDS | 2400398 | 2399562 | −2 | − | 837 | SH3, type 3 domain | -none- | D23_1c2590 | Neut_2404 |
| protein | ||||||||||
| fig|6666666.60966.peg.2604 | CDS | 2400602 | 2401477 | 2 | + | 876 | esterase/lipase/thioesterase | -none- | D23_1c2591 | Neut_2408 |
| family active site | ||||||||||
| fig|6666666.60966.peg.2605 | CDS | 2402010 | 2401492 | −3 | − | 519 | Mobile element protein | -none- | D23_1c2592 | Neut_2502 |
| fig|6666666.60966.peg.2606 | CDS | 2402097 | 2403560 | 3 | + | 1464 | hypothetical protein | -none- | D23_1c2593 | Neut_2493 |
| fig|6666666.60966.peg.2607 | CDS | 2403699 | 2404946 | 3 | + | 1248 | Lipoprotein releasing | Lipopolysaccharide | D23_1c2594 | Neut_2492 |
| system transmembrane | assembly; | |||||||||
| protein LolE | <br>Lipoprotein sorting | |||||||||
| system | ||||||||||
| fig|6666666.60966.peg.2608 | CDS | 2404939 | 2405613 | 1 | + | 675 | Lipoprotein releasing | Lipopolysaccharide | D23_1c2595 | Neut_2491 |
| system ATP-binding | assembly; | |||||||||
| protein LolD | <br>Lipoprotein sorting | |||||||||
| system | ||||||||||
| fig|6666666.60966.peg.2609 | CDS | 2406957 | 2405641 | −3 | − | 1317 | FIG065221: Holliday | CBSS-83333.1.peg.876 | D23_1c2596 | Neut_2490 |
| junction DNA helicase | ||||||||||
| fig|6666666.60966.peg.2610 | CDS | 2407570 | 2406950 | −1 | − | 621 | Outer membrane | CBSS-83333.1.peg.876; | D23_1c2597 | Neut_2489 |
| lipoprotein carrier | <br>Lipopolysaccharide | |||||||||
| protein LolA | assembly; | |||||||||
| <br>Lipoprotein sorting | ||||||||||
| system | ||||||||||
| fig|6666666.60966.peg.2611 | CDS | 2409936 | 2407630 | −3 | − | 2307 | Cell division protein | Bacterial cell Division; | D23_1c2598 | Neut_2488 |
| FtsK | <br>Bacterial | |||||||||
| cytoskeleton; | ||||||||||
| <br>Bacterial RNA- | ||||||||||
| metabolizing Zn- | ||||||||||
| dependent hydrolases; | ||||||||||
| <br>CBSS- | ||||||||||
| 83333.1.peg.876 | ||||||||||
| fig|6666666.60966.peg.2612 | CDS | 2411206 | 2410151 | −1 | − | 1056 | InterPro IPR002110 | -none- | D23_1c2600 | Neut_2487 |
| COGs COG0666 | ||||||||||
| fig|6666666.60966.peg.2613 | CDS | 2412939 | 2411203 | −3 | − | 1737 | Succinate | Succinate | D23_1c2601 | Neut_2486 |
| dehydrogenase | dehydrogenase; | |||||||||
| flavoprotein subunit (EC | <br>TCA Cycle | |||||||||
| 1.3.99.1) | ||||||||||
| fig|6666666.60966.peg.2614 | CDS | 2413237 | 2412968 | −1 | − | 270 | Succinate | Succinate | D23_1c2602 | Neut_2485 |
| dehydrogenase | dehydrogenase | |||||||||
| hydrophobic membrane | ||||||||||
| anchor protein | ||||||||||
| fig|6666666.60966.peg.2615 | CDS | 2413803 | 2413315 | −3 | − | 489 | Succinate | Succinate | D23_1c2603 | Neut_2484 |
| dehydrogenase | dehydrogenase | |||||||||
| cytochrome b-556 | ||||||||||
| subunit | ||||||||||
| fig|6666666.60966.peg.2616 | CDS | 2413889 | 2415583 | 2 | + | 1695 | CTP synthase (EC | CTP synthase (EC | D23_1c2604 | Neut_2483 |
| 6.3.4.2) | 6.3.4.2) cluster; | |||||||||
| <br>pyrimidine | ||||||||||
| conversions | ||||||||||
| fig|6666666.60966.peg.2617 | CDS | 2415872 | 2417158 | 2 | + | 1287 | Enolase (EC 4.2.1.11) | Glycolysis and | D23_1c2605 | Neut_2482 |
| Gluconeogenesis | ||||||||||
| fig|6666666.60966.peg.2618 | CDS | 2417185 | 2417436 | 1 | + | 252 | Cell division protein | Bacterial cell Division; | D23_1c2606 | Neut_2481 |
| DivIC (FtsB), stabilizes | <br>Bacterial | |||||||||
| FtsL against RasP | cytoskeleton; | |||||||||
| cleavage | <br>Stationary phase | |||||||||
| repair cluster | ||||||||||
| fig|6666666.60966.peg.2619 | CDS | 2417726 | 2417860 | 2 | + | 135 | hypothetical protein | -none- | D23_1c2607 | NA |
| fig|6666666.60966.peg.2621 | CDS | 2419576 | 2418317 | −1 | − | 1260 | Transcription | Transcription factors | D23_1c2609 | Neut_2479 |
| termination factor Rho | bacterial | |||||||||
| fig|6666666.60966.peg.2622 | CDS | 2420006 | 2419791 | −2 | − | 216 | Thioredoxin | -none- | D23_1c2610 | Neut_2478 |
| fig|6666666.60966.peg.2624 | CDS | 2420605 | 2421762 | 1 | + | 1158 | Membrane-bound lytic | Murein Hydrolases; | D23_1c2611 | Neut_2477 |
| murein transglycosylase | <br>Peptidoglycan | |||||||||
| B precursor (EC 3.2.1.—) | Biosynthesis | |||||||||
| fig|6666666.60966.peg.2625 | CDS | 2422278 | 2421835 | −3 | − | 444 | Universal stress protein | -none- | D23_1c2612 | Neut_2476 |
| family COG0589 | ||||||||||
| fig|6666666.60966.peg.2626 | CDS | 2424743 | 2422389 | −2 | − | 2355 | Partial urea carboxylase | Urea carboxylase and | D23_1c2613 | Neut_2475 |
| 2 (EC 6.3.4.6) | Allophanate hydrolase | |||||||||
| cluster; <br>Urea | ||||||||||
| decomposition | ||||||||||
| fig|6666666.60966.peg.2627 | CDS | 2425462 | 2424797 | −1 | − | 666 | Urea carboxylase- | Urea decomposition | D23_1c2614 | Neut_2474 |
| related | ||||||||||
| aminomethyltransferase | ||||||||||
| (EC 2.1.2.10) | ||||||||||
| fig|6666666.60966.peg.2628 | CDS | 2426187 | 2425459 | −3 | − | 729 | Urea carboxylase- | Urea decomposition | D23_1c2615 | Neut_2473 |
| related | ||||||||||
| aminomethyltransferase | ||||||||||
| (EC 2.1.2.10) | ||||||||||
| fig|6666666.60966.peg.2629 | CDS | 2427740 | 2426202 | −2 | − | 1539 | Urea carboxylase- | Urea decomposition | D23_1c2616 | Neut_2472 |
| related amino acid | ||||||||||
| permease | ||||||||||
| fig|6666666.60966.peg.2630 | CDS | 2427773 | 2427892 | 2 | + | 120 | hypothetical protein | -none- | D23_1c2617 | NA |
| fig|6666666.60966.peg.2631 | CDS | 2428128 | 2428319 | 3 | + | 192 | hypothetical protein | -none- | D23_1c2618 | NA |
| fig|6666666.60966.peg.2632 | CDS | 2428646 | 2428518 | −2 | − | 129 | hypothetical protein | -none- | D23_1c2620 | NA |
| fig|6666666.60966.peg.2633 | CDS | 2428671 | 2432291 | 3 | + | 3621 | Urea carboxylase (EC | Urea carboxylase and | D23_1c2621 | Neut_2470 |
| 6.3.4.6) | Allophanate hydrolase | |||||||||
| cluster; <br>Urea | ||||||||||
| decomposition | ||||||||||
| fig|6666666.60966.peg.2634 | CDS | 2433643 | 2432279 | −1 | − | 1365 | Membrane-bound lytic | CBSS-228410.1.peg.134; | D23_1c2622 | Neut_2469 |
| murein transglycosylase | <br>CBSS- | |||||||||
| D precursor (EC 3.2.1.—) | 342610.3.peg.1536; | |||||||||
| <br>Murein Hydrolases | ||||||||||
| fig|6666666.60966.peg.2635 | CDS | 2434924 | 2433791 | −1 | − | 1134 | Ribonucleotide | Ribonucleotide | D23_1c2623 | Neut_2468 |
| reductase of class Ia | reduction | |||||||||
| (aerobic), beta subunit | ||||||||||
| (EC 1.17.4.1) | ||||||||||
| fig|6666666.60966.peg.2636 | CDS | 2437918 | 2434976 | −1 | − | 2943 | Ribonucleotide | Ribonucleotide | D23_1c2624 | Neut_2467 |
| reductase of class Ia | reduction | |||||||||
| (aerobic), alpha subunit | ||||||||||
| (EC 1.17.4.1) | ||||||||||
| fig|6666666.60966.peg.2637 | CDS | 2438096 | 2441536 | 2 | + | 3441 | Long-chain-fatty-acid-- | Biotin biosynthesis; | D23_1c2625 | Neut_2466 |
| CoA ligase (EC 6.2.1.3) | <br>Biotin synthesis | |||||||||
| cluster; <br>Fatty acid | ||||||||||
| metabolism cluster | ||||||||||
| fig|6666666.60966.peg.2638 | CDS | 2441648 | 2441788 | 2 | + | 141 | hypothetical protein | -none- | D23_1c2626 | NA |
| fig|6666666.60966.peg.2639 | CDS | 2441958 | 2441845 | −3 | − | 114 | hypothetical protein | -none- | D23_1c2627 | NA |
| fig|6666666.60966.peg.2640 | CDS | 2441984 | 2442337 | 2 | + | 354 | S-adenosylmethionine | Polyamine Metabolism | D23_1c2628 | Neut_2465 |
| decarboxylase | ||||||||||
| proenzyme (EC | ||||||||||
| 4.1.1.50), prokaryotic | ||||||||||
| class 1B | ||||||||||
| fig|6666666.60966.peg.2641 | CDS | 2442337 | 2443296 | 1 | + | 960 | Spermidine synthase | Polyamine Metabolism | D23_1c2629 | Neut_2464 |
| (EC 2.5.1.16) | ||||||||||
| fig|6666666.60966.peg.2642 | CDS | 2444178 | 2443342 | −3 | − | 837 | Cytochrome c family | -none- | D23_1c2630 | Neut_2463 |
| protein | ||||||||||
| fig|6666666.60966.peg.2643 | CDS | 2446065 | 2444275 | −3 | − | 1791 | ABC transporter, fused | -none- | D23_1c2631 | Neut_2462 |
| permease and ATPase | ||||||||||
| domains | ||||||||||
| fig|6666666.60966.peg.2644 | CDS | 2446735 | 2446268 | −1 | − | 468 | Single-stranded DNA- | DNA repair, bacterial | D23_1c2632 | Neut_2461 |
| binding protein | ||||||||||
| fig|6666666.60966.peg.2645 | CDS | 2448142 | 2446736 | −1 | − | 1407 | Putative transport | -none- | D23_1c2633 | Neut_2460 |
| protein | ||||||||||
| fig|6666666.60966.peg.2646 | CDS | 2448217 | 2451054 | 1 | + | 2838 | Excinuclease ABC | DNA repair, UvrABC | D23_1c2634 | Neut_2459 |
| subunit A | system | |||||||||
| fig|6666666.60966.peg.2647 | CDS | 2451051 | 2452322 | 3 | + | 1272 | D-glycerate 2-kinase (EC | Glycerate metabolism | D23_1c2635 | Neut_2458 |
| 2.7.1.—) | ||||||||||
| fig|6666666.60966.peg.2648 | CDS | 2455286 | 2452443 | −2 | − | 2844 | Aconitate hydratase (EC | TCA Cycle | D23_1c2637 | Neut_2457 |
| 4.2.1.3) | ||||||||||
| fig|6666666.60966.peg.2649 | CDS | 2455429 | 2456334 | 1 | + | 906 | Aldose 1-epimerase | -none- | D23_1c2638 | Neut_2456 |
| fig|6666666.60966.peg.2650 | CDS | 2456378 | 2456941 | 2 | + | 564 | NADPH-dependent | -none- | D23_1c2639 | Neut_2455 |
| FMN reductase | ||||||||||
| fig|6666666.60966.peg.2651 | CDS | 2457281 | 2457051 | −2 | − | 231 | HrgA protein | -none- | D23_1c2640 | Neut_2454 |
| fig|6666666.60966.peg.2652 | CDS | 2457998 | 2457480 | −2 | − | 519 | HrgA protein | -none- | D23_1c2641 | NA |
| fig|6666666.60966.peg.2653 | CDS | 2459350 | 2458013 | −1 | − | 1338 | hypothetical protein | -none- | D23_1c2642 | NA |
| fig|6666666.60966.peg.2654 | CDS | 2460249 | 2459347 | −3 | − | 903 | hypothetical protein | -none- | D23_1c2643 | NA |
| fig|6666666.60966.peg.2655 | CDS | 2463305 | 2460264 | −2 | − | 3042 | Type I restriction- | Restriction-Modification | D23_1c2644 | NA |
| modification system, | System; <br>Type I | |||||||||
| restriction subunit R (EC | Restriction-Modification | |||||||||
| 3.1.21.3) | ||||||||||
| fig|6666666.60966.peg.2656 | CDS | 2463943 | 2463341 | −1 | − | 603 | hypothetical protein | -none- | D23_1c2645 | NA |
| fig|6666666.60966.peg.2657 | CDS | 2465348 | 2463960 | −2 | − | 1389 | Type I restriction- | Restriction-Modification | D23_1c2646 | NA |
| modification system, | System; <br>Type I | |||||||||
| specificity subunit S (EC | Restriction-Modification | |||||||||
| 3.1.21.3) | ||||||||||
| fig|6666666.60966.peg.2658 | CDS | 2467567 | 2465348 | −1 | − | 2220 | Type I restriction- | Restriction-Modification | D23_1c2647 | Neut_0541 |
| modification system, | System; <br>Type I | |||||||||
| DNA-methyltransferase | Restriction-Modification | |||||||||
| subunit M (EC 2.1.1.72) | ||||||||||
| fig|6666666.60966.peg.2659 | CDS | 2468029 | 2467751 | −1 | − | 279 | Type I restriction- | Restriction-Modification | D23_1c2648 | Neut_2448 |
| modification system, | System; <br>Type I | |||||||||
| DNA-methyltransferase | Restriction-Modification | |||||||||
| subunit M (EC 2.1.1.72) | ||||||||||
| fig|6666666.60966.peg.2660 | CDS | 2468945 | 2468235 | −2 | − | 711 | RNA polymerase sigma | Flagellar motility; | D23_1c2650 | Neut_2447 |
| factor for flagellar | <br>Flagellum; | |||||||||
| operon | <br>Transcription | |||||||||
| initiation, bacterial | ||||||||||
| sigma factors | ||||||||||
| fig|6666666.60966.peg.2661 | CDS | 2469847 | 2468954 | −1 | − | 894 | Flagellar synthesis | Flagellar motility; | D23_1c2651 | Neut_2446 |
| regulator FleN | <br>Flagellum | |||||||||
| fig|6666666.60966.peg.2662 | CDS | 2471090 | 2469840 | −2 | − | 1251 | Flagellar biosynthesis | Flagellar motility; | D23_1c2652 | Neut_2445 |
| protein FlhF | <br>Flagellum | |||||||||
| fig|6666666.60966.peg.2663 | CDS | 2473171 | 2471087 | −1 | − | 2085 | Flagellar biosynthesis | Flagellar motility; | D23_1c2653 | Neut_2444 |
| protein FlhA | <br>Flagellum | |||||||||
| fig|6666666.60966.peg.2664 | CDS | 2474349 | 2473219 | −3 | − | 1131 | Flagellar biosynthesis | Flagellar motility; | D23_1c2654 | Neut_2443 |
| protein FlhB | <br>Flagellum | |||||||||
| fig|6666666.60966.peg.2665 | CDS | 2476208 | 2474601 | −2 | − | 1608 | Peptide chain release | Translation termination | D23_1c2655 | Neut_2442 |
| factor 3 | factors bacterial | |||||||||
| fig|6666666.60966.peg.2666 | CDS | 2478262 | 2476208 | −1 | − | 2055 | Dipeptide transport | ABC transporter | D23_1c2656 | Neut_2441 |
| ATP-binding protein | dipeptide (TC 3.A.1.5.2) | |||||||||
| DppF (TC 3.A.1.5.2) | ||||||||||
| fig|6666666.60966.peg.2667 | CDS | 2479752 | 2478259 | −3 | − | 1494 | Oligopeptide transport | -none- | D23_1c2657 | Neut_2440 |
| system permease | ||||||||||
| protein | ||||||||||
| fig|6666666.60966.peg.2669 | CDS | 2480032 | 2480334 | 1 | + | 303 | Negative regulator of | Flagellum | D23_1c2658 | Neut_2439 |
| flagellin synthesis | ||||||||||
| fig|6666666.60966.peg.2670 | CDS | 2480417 | 2480800 | 2 | + | 384 | Flagellar biosynthesis | Flagellum | D23_1c2659 | Neut_2438 |
| protein FlgN | ||||||||||
| fig|6666666.60966.peg.2671 | CDS | 2481184 | 2483109 | 1 | + | 1926 | tRNA uridine 5- | Cell Division Subsystem | D23_1c2660 | Neut_2437 |
| carboxymethylaminomethyl | including YidCD; | |||||||||
| modification | <br>RNA modification | |||||||||
| enzyme GidA | and chromosome | |||||||||
| partitioning cluster; | ||||||||||
| <br>mnm5U34 | ||||||||||
| biosynthesis bacteria; | ||||||||||
| <br>tRNA modification | ||||||||||
| Bacteria | ||||||||||
| fig|6666666.60966.peg.2672 | CDS | 2483084 | 2483728 | 2 | + | 645 | rRNA small subunit 7- | Cell Division Subsystem | D23_1c2661 | Neut_2436 |
| methylguanosine (m7G) | including YidCD; | |||||||||
| methyltransferase GidB | <br>RNA methylation; | |||||||||
| <br>RNA modification | ||||||||||
| and chromosome | ||||||||||
| partitioning cluster | ||||||||||
| fig|6666666.60966.peg.2673 | CDS | 2483792 | 2484556 | 2 | + | 765 | Chromosome (plasmid) | Bacterial Cell Division; | D23_1c2662 | Neut_2435 |
| partitioning protein | <br>Bacterial | |||||||||
| ParA/Sporulation | Cytoskeleton; | |||||||||
| initiation inhibitor | <br>Bacterial | |||||||||
| protein Soj | Cytoskeleton; <br>Cell | |||||||||
| Division Subsystem | ||||||||||
| including YidCD; | ||||||||||
| <br>RNA modification | ||||||||||
| and chromosome | ||||||||||
| partitioning cluster | ||||||||||
| fig|6666666.60966.peg.2674 | CDS | 2484637 | 2485440 | 1 | + | 804 | Chromosome (plasmid) | Bacterial Cytoskeleton; | D23_1c2663 | Neut_2434 |
| partitioning protein | <br>Bacterial | |||||||||
| ParB/Stage 0 | Cytoskeleton; <br>Cell | |||||||||
| sporulation protein J | Division Subsystem | |||||||||
| including YidCD; | ||||||||||
| <br>RNA modification | ||||||||||
| and chromosome | ||||||||||
| partitioning cluster | ||||||||||
| fig|6666666.60966.peg.2675 | CDS | 2485777 | 2488083 | 1 | + | 2307 | Glucose-6-phosphate | Glycolysis and | D23_1c2664 | Neut_2433 |
| isomerase (EC 5.3.1.9) | Gluconeogenesis | |||||||||
| fig|6666666.60966.peg.2676 | CDS | 2488076 | 2489131 | 2 | + | 1056 | 6-phosphogluconate | D-gluconate and | D23_1c2665 | Neut_2432 |
| dehydrogenase, | ketogluconates | |||||||||
| decarboxylating (EC | metabolism; | |||||||||
| 1.1.1.44) | <br>Pentose phosphate | |||||||||
| pathway | ||||||||||
| fig|6666666.60966.peg.2677 | CDS | 2489149 | 2490591 | 1 | + | 1443 | Glucose-6-phosphate 1- | Pentose phosphate | D23_1c2666 | Neut_2431 |
| dehydrogenase (EC | pathway | |||||||||
| 1.1.1.49) | ||||||||||
| fig|6666666.60966.peg.2678 | CDS | 2490598 | 2490741 | 1 | + | 144 | hypothetical protein | -none- | D23_1c2667 | NA |
| fig|6666666.60966.peg.2679 | CDS | 2491345 | 2490770 | −1 | − | 576 | putative membrane | -none- | D23_1c2668 | Neut_2430 |
| protein | ||||||||||
| fig|6666666.60966.peg.2680 | CDS | 2491701 | 2492270 | 3 | + | 570 | DedA family inner | DedA family of inner | D23_1c2669 | Neut_2429 |
| membrane protein | membrane proteins | |||||||||
| YohD | ||||||||||
| fig|6666666.60966.peg.2681 | CDS | 2492664 | 2492897 | 3 | + | 234 | Mobile element protein | -none- | D23_1c2671 | Neut_2428 |
| fig|6666666.60966.peg.2682 | CDS | 2493050 | 2494789 | 2 | + | 1740 | ABC-type anion | -none- | D23_1c2672 | Neut_2427 |
| transport system, | ||||||||||
| duplicated permease | ||||||||||
| component | ||||||||||
| fig|6666666.60966.peg.2683 | CDS | 2494811 | 2496100 | 2 | + | 1290 | ABC-type | Alkanesulfonate | D23_1c2673 | Neut_2426 |
| nitrate/sulfonate/bicarbonate | assimilation | |||||||||
| transport system, | ||||||||||
| ATPase component | ||||||||||
| fig|6666666.60966.peg.2684 | CDS | 2499268 | 2496263 | −1 | − | 3006 | Exonuclease SbcC | DNA repair, bacterial; | D23_1c2676 | Neut_2425 |
| <br>Rad50-Mre11 DNA | ||||||||||
| repair cluster | ||||||||||
| fig|6666666.60966.peg.2685 | CDS | 2499230 | 2499520 | 2 | + | 291 | hypothetical protein | -none- | D23_1c2677 | NA |
| fig|6666666.60966.peg.2686 | CDS | 2500770 | 2499526 | −3 | − | 1245 | Exonuclease SbcD | DNA repair, bacterial; | D23_1c2678 | Neut_2424 |
| <br>Rad50-Mre11 DNA | ||||||||||
| repair cluster | ||||||||||
| fig|6666666.60966.peg.2687 | CDS | 2501402 | 2500767 | −2 | − | 636 | FIG01057587: | -none- | D23_1c2679 | NA |
| hypothetical protein | ||||||||||
| fig|6666666.60966.peg.2688 | CDS | 2501615 | 2502037 | 2 | + | 423 | Mobile element protein | -none- | D23_1c2680 | Neut_2450 |
| fig|6666666.60966.peg.2689 | CDS | 2502217 | 2502050 | −1 | − | 168 | hypothetical protein | -none- | D23_1c2681 | NA |
| fig|6666666.60966.peg.2691 | CDS | 2503677 | 2502628 | −3 | − | 1050 | hypothetical protein | -none- | D23_1c2682 | Neut_2415 |
| fig|6666666.60966.peg.2692 | CDS | 2503893 | 2504105 | 3 | + | 213 | hypothetical protein | -none- | D23_1c2683 | NA |
| fig|6666666.60966.peg.2693 | CDS | 2505239 | 2504595 | −2 | − | 645 | hypothetical protein | -none- | D23_1c2685 | NA |
| fig|6666666.60966.peg.2694 | CDS | 2506092 | 2505229 | −3 | − | 864 | Mobile element protein | -none- | D23_1c2686 | Neut_2192 |
| fig|6666666.60966.peg.2695 | CDS | 2506385 | 2506089 | −2 | − | 297 | Mobile element protein | -none- | D23_1c2687 | Neut_2193 |
| fig|6666666.60966.peg.2696 | CDS | 2506924 | 2506445 | −1 | − | 480 | DNA primase/helicase, | Phage replication | D23_1c2688 | NA |
| phage-associated | ||||||||||
| fig|6666666.60966.peg.2697 | CDS | 2507166 | 2506921 | −3 | − | 246 | hypothetical protein | -none- | D23_1c2689 | NA |
| fig|6666666.60966.peg.2698 | CDS | 2507393 | 2507166 | −2 | − | 228 | hypothetical protein | -none- | D23_1c2690 | NA |
| fig|6666666.60966.peg.2699 | CDS | 2507735 | 2508577 | 2 | + | 843 | hypothetical protein | -none- | D23_1c2691 | NA |
| fig|6666666.60966.peg.2700 | CDS | 2508650 | 2509111 | 2 | + | 462 | Putative bacteriophage- | -none- | D23_1c2692 | NA |
| related protein | ||||||||||
| fig|6666666.60966.peg.2701 | CDS | 2509108 | 2510448 | 1 | + | 1341 | probable DNA invertase | -none- | D23_1c2693 | Neut_2563 |
| fig|6666666.60966.peg.2702 | CDS | 2510478 | 2510897 | 3 | + | 420 | elements of external | -none- | D23_1c2694 | NA |
| origin; phage-related | ||||||||||
| functions and | ||||||||||
| prophages | ||||||||||
| fig|6666666.60966.peg.2703 | CDS | 2512240 | 2511590 | −1 | − | 651 | Similar to | 2-phosphoglycolate | D23_1c2696 | Neut_2506 |
| phosphoglycolate | salvage | |||||||||
| phosphatase, clustered | ||||||||||
| with ubiquinone | ||||||||||
| biosynthesis SAM- | ||||||||||
| dependent O- | ||||||||||
| methyltransferase | ||||||||||
| fig|6666666.60966.peg.2704 | CDS | 2512973 | 2512269 | −2 | − | 705 | 3-demethylubiquinol 3- | Ubiquinone | D23_1c2697 | Neut_2507 |
| O-methyltransferase | Biosynthesis; | |||||||||
| (EC 2.1.1.64) | <br>Ubiquinone | |||||||||
| Biosynthesis-gjo | ||||||||||
| fig|6666666.60966.peg.2705 | CDS | 2513079 | 2512963 | −3 | − | 117 | hypothetical protein | -none- | D23_1c2698 | NA |
| fig|6666666.60966.peg.2706 | CDS | 2513892 | 2513197 | −3 | − | 696 | Outer membrane | Osmoregulation | D23_1c2699 | Neut_2508 |
| protein A precursor | ||||||||||
| fig|6666666.60966.peg.2708 | CDS | 2514251 | 2515009 | 2 | + | 759 | ABC-type multidrug | CBSS-196164.1.peg.1690 | D23_1c2700 | Neut_2509 |
| transport system, | ||||||||||
| ATPase component | ||||||||||
| fig|6666666.60966.peg.2709 | CDS | 2515006 | 2515752 | 1 | + | 747 | gliding motility protein | -none- | D23_1c2701 | Neut_2510 |
| GldF | ||||||||||
| fig|6666666.60966.peg.2710 | CDS | 2515776 | 2517128 | 3 | + | 1353 | Mucin 2 precursor | -none- | D23_1c2702 | Neut_2511 |
| fig|6666666.60966.peg.2711 | CDS | 2517144 | 2517959 | 3 | + | 816 | Formamidopyrimidine- | DNA Repair Base | D23_1c2703 | Neut_2512 |
| DNA glycosylase (EC | Excision | |||||||||
| 3.2.2.23) | ||||||||||
| fig|6666666.60966.peg.2712 | CDS | 2518479 | 2517994 | −3 | − | 486 | Thioredoxin | -none- | D23_1c2704 | Neut_2513 |
| fig|6666666.60966.peg.2713 | CDS | 2520458 | 2518644 | −2 | − | 1815 | GTP-binding protein | Universal GTPases | D23_1c2705 | Neut_2514 |
| TypA/BipA | ||||||||||
| fig|6666666.60966.peg.2714 | CDS | 2520591 | 2521196 | 3 | + | 606 | Riboflavin synthase | Riboflavin, FMN and FAD | D23_1c2706 | Neut_2515 |
| eubacterial/eukaryotic | metabolism; | |||||||||
| (EC 2.5.1.9) | <br>Riboflavin, FMN and | |||||||||
| FAD metabolism in | ||||||||||
| plants; <br>Riboflavin | ||||||||||
| synthesis cluster; | ||||||||||
| <br>riboflavin to FAD | ||||||||||
| fig|6666666.60966.peg.2715 | CDS | 2521193 | 2522302 | 2 | + | 1110 | 3,4-dihydroxy-2- | Riboflavin, FMN and FAD | D23_1c2707 | Neut_2516 |
| butanone 4-phosphate | metabolism; | |||||||||
| synthase (EC 4.1.99.12)/ | <br>Riboflavin, FMN and | |||||||||
| GTP cyclohydrolase II | FAD metabolism; | |||||||||
| (EC 3.5.4.25) | <br>Riboflavin, FMN and | |||||||||
| FAD metabolism in | ||||||||||
| plants; <br>Riboflavin, | ||||||||||
| FMN and FAD | ||||||||||
| metabolism in plants; | ||||||||||
| <br>Riboflavin synthesis | ||||||||||
| cluster; <br>Riboflavin | ||||||||||
| synthesis cluster; | ||||||||||
| <br>riboflavin to FAD | ||||||||||
| fig|6666666.60966.peg.2716 | CDS | 2522529 | 2523026 | 3 | + | 498 | 6,7-dimethyl-8- | Possible RNA | D23_1c2708 | Neut_2517 |
| ribityllumazine synthase | degradation cluster; | |||||||||
| (EC 2.5.1.78) | <br>Riboflavin, FMN and | |||||||||
| FAD metabolism; | ||||||||||
| <br>Riboflavin, FMN and | ||||||||||
| FAD metabolism in | ||||||||||
| plants; <br>Riboflavin | ||||||||||
| synthesis cluster | ||||||||||
| fig|6666666.60966.peg.2717 | CDS | 2523023 | 2523526 | 2 | + | 504 | Transcription | Riboflavin synthesis | D23_1c2709 | Neut_2518 |
| termination protein | cluster; | |||||||||
| NusB | <br>Transcription | |||||||||
| factors bacterial | ||||||||||
| fig|6666666.60966.peg.2719 | CDS | 2523801 | 2524787 | 3 | + | 987 | Thiamine- | 5-FCL-like protein; | D23_1c2710 | Neut_2519 |
| monophosphate kinase | <br>Riboflavin synthesis | |||||||||
| (EC 2.7.4.16) | cluster; <br>Thiamin | |||||||||
| biosynthesis | ||||||||||
| fig|6666666.60966.peg.2720 | CDS | 2524864 | 2525307 | 1 | + | 444 | Phosphatidylglycerophosphatase | Glycerolipid and | D23_1c2711 | Neut_2520 |
| A (EC 3.1.3.27) | Glycerophospholipid | |||||||||
| Metabolism in Bacteria; | ||||||||||
| <br>Riboflavin synthesis | ||||||||||
| cluster | ||||||||||
| fig|6666666.60966.peg.2721 | CDS | 2525304 | 2525846 | 3 | + | 543 | C-terminal domain of | DNA repair system | D23_1c2712 | Neut_2521 |
| CinA type S; Protein | including RecA, MutS | |||||||||
| Implicated in DNA | and a hypothetical | |||||||||
| repair function with | protein; <br>NAD and | |||||||||
| RecA and MutS | NADP cofactor | |||||||||
| biosynthesis global; | ||||||||||
| <br>NAD and NADP | ||||||||||
| cofactor biosynthesis | ||||||||||
| global; <br>Possible RNA | ||||||||||
| degradation cluster; | ||||||||||
| <br>Riboflavin, FMN and | ||||||||||
| FAD metabolism in | ||||||||||
| plants; <br>Riboflavin | ||||||||||
| synthesis cluster | ||||||||||
| fig|6666666.60966.peg.2722 | CDS | 2527502 | 2526306 | −2 | − | 1197 | FIG00859610: | -none- | D23_1c2713 | Neut_2522 |
| hypothetical protein | ||||||||||
| fig|6666666.60966.peg.2723 | CDS | 2529448 | 2527829 | −1 | − | 1620 | ATP-dependent DNA | -none- | D23_1c2714 | Neut_2523 |
| helicase RecQ | ||||||||||
| fig|6666666.60966.peg.2724 | CDS | 2529855 | 2529445 | −3 | − | 411 | Ribosome-associated | DNA replication cluster | D23_1c2715 | Neut_2524 |
| heat shock protein | 1; <br>Heat shock dnaK | |||||||||
| implicated in the | gene cluster extended | |||||||||
| recycling of the 50S | ||||||||||
| subunit (S4 paralog) | ||||||||||
| fig|6666666.60966.peg.2725 | CDS | 2530686 | 2529877 | −3 | − | 810 | InterPro IPR002781 | -none- | D23_1c2716 | Neut_2525 |
| COGs COG0730 | ||||||||||
| fig|6666666.60966.peg.2726 | CDS | 2532376 | 2530694 | −1 | − | 1683 | FIG003847: | CBSS-269482.4.peg.5018 | D23_1c2717 | Neut_2526 |
| Oxidoreductase | ||||||||||
| (flavoprotein) | ||||||||||
| fig|6666666.60966.peg.2727 | CDS | 2532913 | 2532488 | −1 | − | 426 | Transcriptional | -none- | D23_1c2718 | Neut_2527 |
| regulator, ArsR family | ||||||||||
| fig|6666666.60966.peg.2728 | CDS | 2533377 | 2532910 | −3 | − | 468 | GENE II AND X | -none- | D23_1c2719 | Neut_2528 |
| PROTEINS | ||||||||||
| fig|6666666.60966.peg.2729 | CDS | 2533835 | 2533407 | −2 | − | 429 | Probable | -none- | D23_1c2720 | Neut_2529 |
| transmembrane protein | ||||||||||
| fig|6666666.60966.peg.2730 | CDS | 2533940 | 2534806 | 2 | + | 867 | FIG146518: Zn- | CBSS-269482.4.peg.5018 | D23_1c2721 | Neut_2530 |
| dependent hydrolases, | ||||||||||
| including glyoxylases | ||||||||||
| fig|6666666.60966.peg.2731 | CDS | 2535475 | 2534891 | −1 | − | 585 | FIG001587: exported | -none- | D23_1c2722 | Neut_2531 |
| protein | ||||||||||
| fig|6666666.60966.peg.2732 | CDS | 2537039 | 2535534 | −2 | − | 1506 | FIG00859025: | -none- | D23_1c2723 | Neut_2532 |
| hypothetical protein | ||||||||||
| fig|6666666.60966.peg.2733 | CDS | 2537388 | 2537077 | −3 | − | 312 | hypothetical protein | -none- | D23_1c2724 | NA |
| fig|6666666.60966.rna.11 | RNA | 226254 | 226324 | 3 | + | 71 | tRNA-Gly-CCC | tRNAs | NA | NA |
| fig|6666666.60966.rna.2 | RNA | 6795 | 6868 | 3 | + | 74 | tRNA-Cys-GCA | tRNAs | NA | NA |
| fig|6666666.60966.rna.39 | RNA | 1810921 | 1810848 | −1 | − | 74 | tRNA-Gly-TCC | -none- | NA | NA |
| fig|6666666.60966.rna.23 | RNA | 969765 | 969839 | 3 | + | 75 | tRNA-Gln-TTG | -none- | NA | NA |
| fig|6666666.60966.rna.36 | RNA | 1758968 | 1759042 | 2 | + | 75 | tRNA-Val-CAC | tRNAs | NA | NA |
| fig|6666666.60966.rna.38 | RNA | 1810812 | 1810738 | −3 | − | 75 | tRNA-Thr-GGT | -none- | NA | NA |
| fig|6666666.60966.rna.1 | RNA | 6614 | 6689 | 2 | + | 76 | tRNA-Gly-GCC | tRNAs | NA | NA |
| fig|6666666.60966.rna.7 | RNA | 120428 | 120503 | 2 | + | 76 | tRNA-Ala-TGC | -none- | NA | NA |
| fig|6666666.60966.rna.12 | RNA | 284547 | 284472 | −3 | − | 76 | tRNA-Glu-TTC | -none- | NA | NA |
| fig|6666666.60966.rna.13 | RNA | 284648 | 284573 | −2 | − | 76 | tRNA-Ala-GGC | tRNAs | NA | NA |
| fig|6666666.60966.rna.14 | RNA | 493566 | 493641 | 3 | + | 76 | tRNA-Thr-CGT | -none- | NA | NA |
| fig|6666666.60966.rna.16 | RNA | 561828 | 561903 | 3 | + | 76 | tRNA-Val-TAC | -none- | NA | NA |
| fig|6666666.60966.rna.20 | RNA | 859357 | 859282 | −1 | − | 76 | tRNA-Lys-TTT | -none- | NA | NA |
| fig|6666666.60966.rna.21 | RNA | 948801 | 948876 | 3 | + | 76 | tRNA-Thr-TGT | -none- | NA | NA |
| fig|6666666.60966.rna.24 | RNA | 1157662 | 1157587 | −1 | − | 76 | tRNA-Arg-CCT | -none- | NA | NA |
| fig|6666666.60966.rna.25 | RNA | 1199325 | 1199250 | −3 | − | 76 | tRNA-His-GTG | -none- | NA | NA |
| fig|6666666.60966.rna.29 | RNA | 1470510 | 1470435 | −3 | − | 76 | tRNA-Asn-GTT | -none- | NA | NA |
| fig|6666666.60966.rna.33 | RNA | 1618239 | 1618314 | 3 | + | 76 | tRNA-Met-CAT | -none- | NA | NA |
| fig|6666666.60966.rna.34 | RNA | 1673498 | 1673423 | −2 | − | 76 | tRNA-Arg-CCG | tRNAs | NA | NA |
| fig|6666666.60966.rna.37 | RNA | 1809438 | 1809363 | −3 | − | 76 | tRNA-Trp-CCA | tRNAs | NA | NA |
| fig|6666666.60966.rna.42 | RNA | 2107281 | 2107356 | 3 | + | 76 | tRNA-Phe-GAA | tRNAs | NA | NA |
| fig|6666666.60966.rna.6 | RNA | 120349 | 120425 | 1 | + | 77 | tRNA-Ile-GAT | -none- | NA | NA |
| fig|6666666.60966.rna.10 | RNA | 196762 | 196838 | 1 | + | 77 | tRNA-Met-CAT | -none- | NA | NA |
| fig|6666666.60966.rna.15 | RNA | 524553 | 524629 | 3 | + | 77 | tRNA-Val-GAC | tRNAs | NA | NA |
| fig|6666666.60966.rna.17 | RNA | 561963 | 562039 | 3 | + | 77 | tRNA-Asp-GTC | -none- | NA | NA |
| fig|6666666.60966.rna.18 | RNA | 728392 | 728316 | −1 | − | 77 | tRNA-Pro-CGG | tRNAs | NA | NA |
| fig|6666666.60966.rna.26 | RNA | 1199452 | 1199376 | −1 | − | 77 | tRNA-Arg-TCT | -none- | NA | NA |
| fig|6666666.60966.rna.27 | RNA | 1199573 | 1199497 | −2 | − | 77 | tRNA-Pro-TGG | -none- | NA | NA |
| fig|6666666.60966.rna.28 | RNA | 1427736 | 1427812 | 3 | + | 77 | tRNA-Met-CAT | -none- | NA | NA |
| fig|6666666.60966.rna.41 | RNA | 2107137 | 2107213 | 3 | + | 77 | tRNA-Arg-ACG | tRNAs | NA | NA |
| fig|6666666.60966.rna.44 | RNA | 2339644 | 2339568 | −1 | − | 77 | tRNA-Pro-GGG | tRNAs | NA | NA |
| fig|6666666.60966.rna.19 | RNA | 835520 | 835604 | 2 | + | 85 | tRNA-Leu-GAG | tRNAs | NA | NA |
| fig|6666666.60966.rna.32 | RNA | 1597631 | 1597715 | 2 | + | 85 | tRNA-Leu-CAG | tRNAs | NA | NA |
| fig|6666666.60966.rna.40 | RNA | 1811116 | 1811032 | −1 | − | 85 | tRNA-Tyr-GTA | -none- | NA | NA |
| fig|6666666.60966.rna.4 | RNA | 97072 | 96987 | −1 | − | 86 | tRNA-Leu-TAG | -none- | NA | NA |
| fig|6666666.60966.rna.31 | RNA | 1574940 | 1574854 | −3 | − | 87 | tRNA-Leu-CAA | tRNAs | NA | NA |
| fig|6666666.60966.rna.30 | RNA | 1550222 | 1550135 | −2 | − | 88 | tRNA-Ser-TGA | -none- | NA | NA |
| fig|6666666.60966.rna.3 | RNA | 6894 | 6982 | 3 | + | 89 | tRNA-Leu-TAA | -none- | NA | NA |
| fig|6666666.60966.rna.22 | RNA | 956464 | 956374 | −1 | − | 91 | tRNA-Ser-GGA | tRNAs | NA | NA |
| fig|6666666.60966.rna.35 | RNA | 1757250 | 1757342 | 3 | + | 93 | tRNA-Ser-CGA | tRNAs | NA | NA |
| fig|6666666.60966.rna.43 | RNA | 2120297 | 2120205 | −2 | − | 93 | tRNA-Ser-GCT | -none- | NA | NA |
| fig|6666666.60966.peg.111 | CDS | 108515 | 108628 | 2 | + | 114 | hypothetical protein | -none- | NA | NA |
| fig|6666666.60966.peg.353 | CDS | 326760 | 326647 | −3 | − | 114 | hypothetical protein | -none- | NA | NA |
| fig|6666666.60966.peg.404 | CDS | 375917 | 375804 | −2 | − | 114 | hypothetical protein | -none- | NA | NA |
| fig|6666666.60966.peg.432 | CDS | 397539 | 397426 | −3 | − | 114 | hypothetical protein | -none- | NA | NA |
| fig|6666666.60966.peg.509 | CDS | 474482 | 474369 | −2 | − | 114 | hypothetical protein | -none- | NA | NA |
| fig|6666666.60966.peg.589 | CDS | 543008 | 543121 | 2 | + | 114 | hypothetical protein | -none- | NA | NA |
| fig|6666666.60966.peg.838 | CDS | 770105 | 770218 | 2 | + | 114 | hypothetical protein | -none- | NA | NA |
| fig|6666666.60966.peg.923 | CDS | 855159 | 855046 | −3 | − | 114 | hypothetical protein | -none- | NA | NA |
| fig|6666666.60966.peg.943 | CDS | 873193 | 873306 | 1 | + | 114 | hypothetical protein | -none- | NA | NA |
| fig|6666666.60966.peg.1081 | CDS | 1010260 | 1010373 | 1 | + | 114 | hypothetical protein | -none- | NA | NA |
| fig|6666666.60966.peg.1333 | CDS | 1235666 | 1235779 | 2 | + | 114 | hypothetical protein | -none- | NA | NA |
| fig|6666666.60966.peg.1414 | CDS | 1326350 | 1326463 | 2 | + | 114 | hypothetical protein | -none- | NA | NA |
| fig|6666666.60966.peg.1695 | CDS | 1575540 | 1575653 | 3 | + | 114 | hypothetical protein | -none- | NA | NA |
| fig|6666666.60966.peg.1875 | CDS | 1749599 | 1749486 | −2 | − | 114 | Mobile element protein | -none- | NA | NA |
| fig|6666666.60966.peg.2082 | CDS | 1936491 | 1936378 | −3 | − | 114 | hypothetical protein | -none- | NA | NA |
| fig|6666666.60966.peg.2205 | CDS | 2047715 | 2047828 | 2 | + | 114 | hypothetical protein | -none- | NA | NA |
| fig|6666666.60966.peg.2370 | CDS | 2201390 | 2201277 | −2 | − | 114 | hypothetical protein | -none- | NA | NA |
| fig|6666666.60966.peg.2413 | CDS | 2236764 | 2236651 | −3 | − | 114 | hypothetical protein | -none- | NA | NA |
| fig|6666666.60966.peg.2577 | CDS | 2379043 | 2378930 | −1 | − | 114 | hypothetical protein | -none- | NA | NA |
| fig|6666666.60966.peg.421 | CDS | 392634 | 392518 | −3 | − | 117 | hypothetical protein | -none- | NA | NA |
| fig|6666666.60966.peg.431 | CDS | 397234 | 397350 | 1 | + | 117 | hypothetical protein | -none- | NA | NA |
| fig|6666666.60966.peg.1104 | CDS | 1033773 | 1033889 | 3 | + | 117 | hypothetical protein | -none- | NA | NA |
| fig|6666666.60966.peg.1856 | CDS | 1730271 | 1730155 | −3 | − | 117 | hypothetical protein | -none- | NA | NA |
| fig|6666666.60966.peg.2044 | CDS | 1907891 | 1907775 | −2 | − | 117 | hypothetical protein | -none- | NA | NA |
| fig|6666666.60966.peg.2046 | CDS | 1908400 | 1908516 | 1 | + | 117 | hypothetical protein | -none- | NA | NA |
| fig|6666666.60966.peg.2250 | CDS | 2086632 | 2086516 | −3 | − | 117 | hypothetical protein | -none- | NA | NA |
| fig|6666666.60966.peg.2378 | CDS | 2209362 | 2209246 | −3 | − | 117 | hypothetical protein | -none- | NA | NA |
| fig|6666666.60966.peg.28 | CDS | 31960 | 31841 | −1 | − | 120 | hypothetical protein | -none- | NA | NA |
| fig|6666666.60966.peg.536 | CDS | 496598 | 496717 | 2 | + | 120 | hypothetical protein | -none- | NA | NA |
| fig|6666666.60966.peg.866 | CDS | 794273 | 794392 | 2 | + | 120 | hypothetical protein | -none- | NA | NA |
| fig|6666666.60966.peg.1031 | CDS | 956342 | 956223 | −2 | − | 120 | hypothetical protein | -none- | NA | NA |
| fig|6666666.60966.peg.1238 | CDS | 1152349 | 1152230 | −1 | − | 120 | hypothetical protein | -none- | NA | NA |
| fig|6666666.60966.peg.1279 | CDS | 1184453 | 1184572 | 2 | + | 120 | hypothetical protein | -none- | NA | NA |
| fig|6666666.60966.peg.1566 | CDS | 1462529 | 1462410 | −2 | − | 120 | hypothetical protein | -none- | NA | NA |
| fig|6666666.60966.peg.1604 | CDS | 1492079 | 1491960 | −2 | − | 120 | hypothetical protein | -none- | NA | NA |
| fig|6666666.60966.peg.1610 | CDS | 1495100 | 1495219 | 2 | + | 120 | hypothetical protein | -none- | NA | NA |
| fig|6666666.60966.peg.1938 | CDS | 1820165 | 1820046 | −2 | − | 120 | hypothetical protein | -none- | NA | NA |
| fig|6666666.60966.peg.1940 | CDS | 1820392 | 1820511 | 1 | + | 120 | hypothetical protein | -none- | NA | NA |
| fig|6666666.60966.peg.2194 | CDS | 2040715 | 2040596 | −1 | − | 120 | hypothetical protein | -none- | NA | NA |
| fig|6666666.60966.peg.2229 | CDS | 2069192 | 2069073 | −2 | − | 120 | hypothetical protein | -none- | NA | NA |
| fig|6666666.60966.peg.2542 | CDS | 2355482 | 2355601 | 2 | + | 120 | hypothetical protein | -none- | NA | NA |
| fig|6666666.60966.peg.477 | CDS | 444630 | 444508 | −3 | − | 123 | hypothetical protein | -none- | NA | NA |
| fig|6666666.60966.peg.634 | CDS | 579242 | 579364 | 2 | + | 123 | hypothetical protein | -none- | NA | NA |
| fig|6666666.60966.peg.927 | CDS | 859107 | 859229 | 3 | + | 123 | hypothetical protein | -none- | NA | NA |
| fig|6666666.60966.peg.1015 | CDS | 941818 | 941940 | 1 | + | 123 | hypothetical protein | -none- | NA | NA |
| fig|6666666.60966.peg.1388 | CDS | 1298114 | 1298236 | 2 | + | 123 | hypothetical protein | -none- | NA | NA |
| fig|6666666.60966.peg.1755 | CDS | 1633195 | 1633073 | −1 | − | 123 | hypothetical protein | -none- | NA | NA |
| fig|6666666.60966.peg.2224 | CDS | 2067753 | 2067631 | −3 | − | 123 | hypothetical protein | -none- | NA | NA |
| fig|6666666.60966.peg.2271 | CDS | 2103666 | 2103788 | 3 | + | 123 | hypothetical protein | -none- | NA | NA |
| fig|6666666.60966.peg.2336 | CDS | 2170340 | 2170462 | 2 | + | 123 | hypothetical protein | -none- | NA | NA |
| fig|6666666.60966.peg.2415 | CDS | 2237130 | 2237008 | −3 | − | 123 | Hydroxyacylglutathione | CBSS-228410.1.peg.134; | NA | NA |
| hydrolase (EC 3.1.2.6) | <br>CBSS- | |||||||||
| 342610.3.peg.1536; | ||||||||||
| <br>Glutathione: Non- | ||||||||||
| redox reactions; | ||||||||||
| <br>Methylglyoxal | ||||||||||
| Metabolism | ||||||||||
| fig|6666666.60966.peg.82 | CDS | 79801 | 79676 | −1 | − | 126 | hypothetical protein | -none- | NA | NA |
| fig|6666666.60966.peg.585 | CDS | 541998 | 542123 | 3 | + | 126 | hypothetical protein | -none- | NA | NA |
| fig|6666666.60966.peg.1268 | CDS | 1176741 | 1176866 | 3 | + | 126 | hypothetical protein | -none- | NA | NA |
| fig|6666666.60966.peg.1473 | CDS | 1385674 | 1385799 | 1 | + | 126 | hypothetical protein | -none- | NA | NA |
| fig|6666666.60966.peg.1510 | CDS | 1423155 | 1423030 | −3 | − | 126 | hypothetical protein | -none- | NA | NA |
| fig|6666666.60966.peg.1690 | CDS | 1573599 | 1573474 | −3 | − | 126 | hypothetical protein | -none- | NA | NA |
| fig|6666666.60966.peg.1758 | CDS | 1635456 | 1635331 | −3 | − | 126 | hypothetical protein | -none- | NA | NA |
| fig|6666666.60966.peg.1935 | CDS | 1816227 | 1816352 | 3 | + | 126 | hypothetical protein | -none- | NA | NA |
| fig|6666666.60966.peg.1966 | CDS | 1832788 | 1832913 | 1 | + | 126 | hypothetical protein | -none- | NA | NA |
| fig|6666666.60966.peg.2285 | CDS | 2119314 | 2119439 | 3 | + | 126 | hypothetical protein | -none- | NA | NA |
| fig|6666666.60966.peg.21 | CDS | 28650 | 28522 | −3 | − | 129 | hypothetical protein | -none- | NA | NA |
| fig|6666666.60966.peg.27 | CDS | 31632 | 31760 | 3 | + | 129 | hypothetical protein | -none- | NA | NA |
| fig|6666666.60966.peg.247 | CDS | 231537 | 231665 | 3 | + | 129 | hypothetical protein | -none- | NA | NA |
| fig|6666666.60966.peg.300 | CDS | 272364 | 272492 | 3 | + | 129 | hypothetical protein | -none- | NA | NA |
| fig|6666666.60966.peg.864 | CDS | 792354 | 792226 | −3 | − | 129 | hypothetical protein | -none- | NA | NA |
| fig|6666666.60966.peg.1166 | CDS | 1092637 | 1092509 | −1 | − | 129 | hypothetical protein | -none- | NA | NA |
| fig|6666666.60966.peg.1314 | CDS | 1216530 | 1216658 | 3 | + | 129 | hypothetical protein | -none- | NA | NA |
| fig|6666666.60966.peg.1730 | CDS | 1612183 | 1612311 | 1 | + | 129 | hypothetical protein | -none- | NA | NA |
| fig|6666666.60966.peg.2328 | CDS | 2162434 | 2162306 | −1 | − | 129 | hypothetical protein | -none- | NA | NA |
| fig|6666666.60966.peg.122 | CDS | 124194 | 124063 | −3 | − | 132 | hypothetical protein | -none- | NA | NA |
| fig|6666666.60966.peg.154 | CDS | 155514 | 155645 | 3 | + | 132 | hypothetical protein | -none- | NA | NA |
| fig|6666666.60966.peg.874 | CDS | 801546 | 801677 | 3 | + | 132 | hypothetical protein | -none- | NA | NA |
| fig|6666666.60966.peg.894 | CDS | 823808 | 823939 | 2 | + | 132 | hypothetical protein | -none- | NA | NA |
| fig|6666666.60966.peg.960 | CDS | 886681 | 886550 | −1 | − | 132 | hypothetical protein | -none- | NA | NA |
| fig|6666666.60966.peg.1188 | CDS | 1108861 | 1108730 | −1 | − | 132 | hypothetical protein | -none- | NA | NA |
| fig|6666666.60966.peg.1578 | CDS | 1468706 | 1468837 | 2 | + | 132 | hypothetical protein | -none- | NA | NA |
| fig|6666666.60966.peg.1950 | CDS | 1824304 | 1824435 | 1 | + | 132 | hypothetical protein | -none- | NA | NA |
| fig|6666666.60966.peg.1983 | CDS | 1850338 | 1850469 | 1 | + | 132 | hypothetical protein | -none- | NA | NA |
| fig|6666666.60966.peg.2066 | CDS | 1923319 | 1923450 | 1 | + | 132 | hypothetical protein | -none- | NA | NA |
| fig|6666666.60966.peg.2445 | CDS | 2263603 | 2263472 | −1 | − | 132 | hypothetical protein | -none- | NA | NA |
| fig|6666666.60966.peg.2570 | CDS | 2376200 | 2376331 | 2 | + | 132 | hypothetical protein | -none- | NA | NA |
| fig|6666666.60966.peg.296 | CDS | 267656 | 267790 | 2 | + | 135 | hypothetical protein | -none- | NA | NA |
| fig|6666666.60966.peg.1086 | CDS | 1016149 | 1016015 | −1 | − | 135 | hypothetical protein | -none- | NA | NA |
| fig|6666666.60966.peg.1167 | CDS | 1092703 | 1092837 | 1 | + | 135 | hypothetical protein | -none- | NA | NA |
| fig|6666666.60966.peg.1560 | CDS | 1459112 | 1459246 | 2 | + | 135 | hypothetical protein | -none- | NA | NA |
| fig|6666666.60966.peg.1597 | CDS | 1486647 | 1486513 | −3 | − | 135 | hypothetical protein | -none- | NA | NA |
| fig|6666666.60966.peg.1949 | CDS | 1824258 | 1824124 | −3 | − | 135 | hypothetical protein | -none- | NA | NA |
| fig|6666666.60966.peg.2059 | CDS | 1916861 | 1916995 | 2 | + | 135 | hypothetical protein | -none- | NA | NA |
| fig|6666666.60966.peg.2151 | CDS | 1995848 | 1995982 | 2 | + | 135 | FIG00858674: | -none- | NA | NA |
| hypothetical protein | ||||||||||
| fig|6666666.60966.peg.2230 | CDS | 2069201 | 2069335 | 2 | + | 135 | hypothetical protein | -none- | NA | NA |
| fig|6666666.60966.peg.2363 | CDS | 2194044 | 2194178 | 3 | + | 135 | LSU ribosomal protein | Cell Division Subsystem | NA | NA |
| L34p | including YidCD; | |||||||||
| <br>RNA modification | ||||||||||
| cluster | ||||||||||
| fig|6666666.60966.peg.2527 | CDS | 2338623 | 2338489 | −3 | − | 135 | hypothetical protein | -none- | NA | NA |
| fig|6666666.60966.peg.1276 | CDS | 1182314 | 1182177 | −2 | − | 138 | hypothetical protein | -none- | NA | NA |
| fig|6666666.60966.peg.1317 | CDS | 1218021 | 1218158 | 3 | + | 138 | hypothetical protein | -none- | NA | NA |
| fig|6666666.60966.peg.1606 | CDS | 1493209 | 1493072 | −1 | − | 138 | hypothetical protein | -none- | NA | NA |
| fig|6666666.60966.peg.1867 | CDS | 1739233 | 1739370 | 1 | + | 138 | Error-prone, lesion | -none- | NA | NA |
| bypass DNA polymerase | ||||||||||
| V(UmuC) | ||||||||||
| fig|6666666.60966.peg.2117 | CDS | 1966387 | 1966250 | −1 | − | 138 | hypothetical protein | -none- | NA | NA |
| fig|6666666.60966.peg.2227 | CDS | 2068598 | 2068735 | 2 | + | 138 | hypothetical protein | -none- | NA | NA |
| fig|6666666.60966.peg.163 | CDS | 160970 | 160830 | −2 | − | 141 | hypothetical protein | -none- | NA | NA |
| fig|6666666.60966.peg.173 | CDS | 168825 | 168965 | 3 | + | 141 | hypothetical protein | -none- | NA | NA |
| fig|6666666.60966.peg.1286 | CDS | 1189481 | 1189621 | 2 | + | 141 | hypothetical protein | -none- | NA | NA |
| fig|6666666.60966.peg.1416 | CDS | 1328534 | 1328674 | 2 | + | 141 | hypothetical protein | -none- | NA | NA |
| fig|6666666.60966.peg.1422 | CDS | 1330733 | 1330873 | 2 | + | 141 | hypothetical protein | -none- | NA | NA |
| fig|6666666.60966.peg.1759 | CDS | 1635699 | 1635839 | 3 | + | 141 | hypothetical protein | -none- | NA | NA |
| fig|6666666.60966.peg.1775 | CDS | 1649712 | 1649572 | −3 | − | 141 | Mobile element protein | -none- | NA | NA |
| fig|6666666.60966.peg.1984 | CDS | 1850712 | 1850572 | −3 | − | 141 | hypothetical protein | -none- | NA | NA |
| fig|6666666.60966.peg.2003 | CDS | 1866906 | 1867046 | 3 | + | 141 | hypothetical protein | -none- | NA | NA |
| fig|6666666.60966.peg.2080 | CDS | 1935668 | 1935808 | 2 | + | 141 | hypothetical protein | -none- | NA | NA |
| fig|6666666.60966.peg.2487 | CDS | 2301272 | 2301132 | −2 | − | 141 | hypothetical protein | -none- | NA | NA |
| fig|6666666.60966.peg.369 | CDS | 342367 | 342224 | −1 | − | 144 | hypothetical protein | -none- | NA | NA |
| fig|6666666.60966.peg.635 | CDS | 579509 | 579652 | 2 | + | 144 | hypothetical protein | -none- | NA | NA |
| fig|6666666.60966.peg.1001 | CDS | 928837 | 928980 | 1 | + | 144 | hypothetical protein | -none- | NA | NA |
| fig|6666666.60966.peg.1642 | CDS | 1524746 | 1524603 | −2 | − | 144 | hypothetical protein | -none- | NA | NA |
| fig|6666666.60966.peg.2114 | CDS | 1962886 | 1963029 | 1 | + | 144 | hypothetical protein | -none- | NA | NA |
| fig|6666666.60966.peg.2593 | CDS | 2391861 | 2392004 | 3 | + | 144 | hypothetical protein | -none- | NA | NA |
| fig|6666666.60966.peg.205 | CDS | 197036 | 196890 | −2 | − | 147 | Integrase | -none- | NA | NA |
| fig|6666666.60966.peg.284 | CDS | 260995 | 261141 | 1 | + | 147 | hypothetical protein | -none- | NA | NA |
| fig|6666666.60966.peg.1885 | CDS | 1759287 | 1759141 | −3 | − | 147 | hypothetical protein | -none- | NA | NA |
| fig|6666666.60966.peg.2453 | CDS | 2272001 | 2271855 | −2 | − | 147 | hypothetical protein | -none- | NA | NA |
| fig|6666666.60966.peg.2620 | CDS | 2417974 | 2417828 | −1 | − | 147 | hypothetical protein | -none- | NA | NA |
| fig|6666666.60966.peg.2623 | CDS | 2420545 | 2420399 | −1 | − | 147 | hypothetical protein | -none- | NA | NA |
| fig|6666666.60966.peg.108 | CDS | 106117 | 106266 | 1 | + | 150 | hypothetical protein | -none- | NA | NA |
| fig|6666666.60966.peg.813 | CDS | 746234 | 746085 | −2 | − | 150 | hypothetical protein | -none- | NA | NA |
| fig|6666666.60966.peg.1296 | CDS | 1205130 | 1205279 | 3 | + | 150 | hypothetical protein | -none- | NA | NA |
| fig|6666666.60966.peg.1334 | CDS | 1235992 | 1235843 | −1 | − | 150 | hypothetical protein | -none- | NA | NA |
| fig|6666666.60966.peg.2300 | CDS | 2134634 | 2134485 | −2 | − | 150 | hypothetical protein | -none- | NA | NA |
| fig|6666666.60966.peg.35 | CDS | 36062 | 35910 | −2 | − | 153 | hypothetical protein | -none- | NA | NA |
| fig|6666666.60966.peg.1312 | CDS | 1215961 | 1216113 | 1 | + | 153 | hypothetical protein | -none- | NA | NA |
| fig|6666666.60966.peg.2143 | CDS | 1990257 | 1990105 | −3 | − | 153 | hypothetical protein | -none- | NA | NA |
| fig|6666666.60966.peg.359 | CDS | 335237 | 335392 | 2 | + | 156 | hypothetical protein | -none- | NA | NA |
| fig|6666666.60966.peg.546 | CDS | 506105 | 505950 | −2 | − | 156 | FIG00858972: | -none- | NA | NA |
| hypothetical protein | ||||||||||
| fig|6666666.60966.peg.1174 | CDS | 1095978 | 1095823 | −3 | − | 156 | Mobile element protein | -none- | NA | NA |
| fig|6666666.60966.peg.1384 | CDS | 1296435 | 1296280 | −3 | − | 156 | hypothetical protein | -none- | NA | NA |
| fig|6666666.60966.peg.2575 | CDS | 2378324 | 2378169 | −2 | − | 156 | hypothetical protein | -none- | NA | NA |
| fig|6666666.60966.peg.89 | CDS | 85217 | 85059 | −2 | − | 159 | hypothetical protein | -none- | NA | NA |
| fig|6666666.60966.peg.556 | CDS | 516983 | 516825 | −2 | − | 159 | hypothetical protein | -none- | NA | NA |
| fig|6666666.60966.peg.562 | CDS | 523304 | 523462 | 2 | + | 159 | hypothetical protein | -none- | NA | NA |
| fig|6666666.60966.peg.1099 | CDS | 1029431 | 1029589 | 2 | + | 159 | hypothetical protein | -none- | NA | NA |
| fig|6666666.60966.peg.1571 | CDS | 1466563 | 1466405 | −1 | − | 159 | hypothetical protein | -none- | NA | NA |
| fig|6666666.60966.peg.613 | CDS | 562226 | 562065 | −2 | − | 162 | hypothetical protein | -none- | NA | NA |
| fig|6666666.60966.peg.886 | CDS | 814562 | 814401 | −2 | − | 162 | hypothetical protein | -none- | NA | NA |
| fig|6666666.60966.peg.1114 | CDS | 1043720 | 1043559 | −2 | − | 162 | hypothetical protein | -none- | NA | NA |
| fig|6666666.60966.peg.291 | CDS | 265661 | 265825 | 2 | + | 165 | FIG00856904: | -none- | NA | NA |
| hypothetical protein | ||||||||||
| fig|6666666.60966.peg.2077 | CDS | 1934012 | 1933848 | −2 | − | 165 | hypothetical protein | -none- | NA | NA |
| fig|6666666.60966.peg.620 | CDS | 568234 | 568401 | 1 | + | 168 | Methyltransferase (EC | -none- | NA | NA |
| 2.1.1.—) | ||||||||||
| fig|6666666.60966.peg.2317 | CDS | 2149354 | 2149521 | 1 | + | 168 | Mobile element protein | -none- | NA | NA |
| fig|6666666.60966.peg.2420 | CDS | 2241817 | 2241650 | −1 | − | 168 | hypothetical protein | -none- | NA | NA |
| fig|6666666.60966.peg.856 | CDS | 785317 | 785147 | −1 | − | 171 | hypothetical protein | -none- | NA | NA |
| fig|6666666.60966.peg.1487 | CDS | 1401876 | 1401706 | −3 | − | 171 | FIG00858878: | -none- | NA | NA |
| hypothetical protein | ||||||||||
| fig|6666666.60966.peg.2286 | CDS | 2119703 | 2119873 | 2 | + | 171 | hypothetical protein | -none- | NA | NA |
| fig|6666666.60966.peg.2707 | CDS | 2514260 | 2514090 | −2 | − | 171 | hypothetical protein | -none- | NA | NA |
| fig|6666666.60966.peg.862 | CDS | 790885 | 790712 | −1 | − | 174 | hypothetical protein | -none- | NA | NA |
| fig|6666666.60966.peg.1450 | CDS | 1360555 | 1360382 | −1 | − | 174 | Mobile element protein | -none- | NA | NA |
| fig|6666666.60966.peg.1572 | CDS | 1466783 | 1466956 | 2 | + | 174 | hypothetical protein | -none- | NA | NA |
| fig|6666666.60966.peg.1608 | CDS | 1494659 | 1494835 | 2 | + | 177 | hypothetical protein | -none- | NA | NA |
| fig|6666666.60966.peg.2416 | CDS | 2237303 | 2237127 | −2 | − | 177 | hypothetical protein | -none- | NA | NA |
| fig|6666666.60966.peg.2668 | CDS | 2479940 | 2479764 | −2 | − | 177 | hypothetical protein | -none- | NA | NA |
| fig|6666666.60966.peg.748 | CDS | 694556 | 694377 | −2 | − | 180 | hypothetical protein | -none- | NA | NA |
| fig|6666666.60966.peg.1667 | CDS | 1550475 | 1550296 | −3 | − | 180 | hypothetical protein | -none- | NA | NA |
| fig|6666666.60966.peg.2116 | CDS | 1965779 | 1965600 | −2 | − | 180 | hypothetical protein | -none- | NA | NA |
| fig|6666666.60966.peg.2144 | CDS | 1990362 | 1990541 | 3 | + | 180 | Mobile element protein | -none- | NA | NA |
| fig|6666666.60966.peg.2400 | CDS | 2229074 | 2228895 | −2 | − | 180 | hypothetical protein | -none- | NA | NA |
| fig|6666666.60966.peg.287 | CDS | 262264 | 262446 | 1 | + | 183 | hypothetical protein | -none- | NA | NA |
| fig|6666666.60966.peg.422 | CDS | 392649 | 392831 | 3 | + | 183 | hypothetical protein | -none- | NA | NA |
| fig|6666666.60966.peg.1562 | CDS | 1459862 | 1460044 | 2 | + | 183 | hypothetical protein | -none- | NA | NA |
| fig|6666666.60966.peg.2388 | CDS | 2218996 | 2219178 | 1 | + | 183 | hypothetical protein | -none- | NA | NA |
| fig|6666666.60966.peg.338 | CDS | 308508 | 308323 | −3 | − | 186 | hypothetical protein | -none- | NA | NA |
| fig|6666666.60966.peg.1842 | CDS | 1720173 | 1719988 | −3 | − | 186 | hypothetical protein | -none- | NA | NA |
| fig|6666666.60966.peg.286 | CDS | 262147 | 261959 | −1 | − | 189 | hypothetical protein | -none- | NA | NA |
| fig|6666666.60966.peg.1202 | CDS | 1125016 | 1124828 | −1 | − | 189 | hypothetical protein | -none- | NA | NA |
| fig|6666666.60966.peg.1304 | CDS | 1209919 | 1209731 | −1 | − | 189 | FIG00858878: | -none- | NA | NA |
| hypothetical protein | ||||||||||
| fig|6666666.60966.peg.2395 | CDS | 2224520 | 2224332 | −2 | − | 189 | hypothetical protein | -none- | NA | NA |
| fig|6666666.60966.peg.250 | CDS | 233011 | 233202 | 1 | + | 192 | hypothetical protein | -none- | NA | NA |
| fig|6666666.60966.peg.794 | CDS | 729662 | 729471 | −2 | − | 192 | hypothetical protein | -none- | NA | NA |
| fig|6666666.60966.peg.1764 | CDS | 1639415 | 1639606 | 2 | + | 192 | hypothetical protein | -none- | NA | NA |
| fig|6666666.60966.peg.808 | CDS | 741018 | 740824 | −3 | − | 195 | hypothetical protein | -none- | NA | NA |
| fig|6666666.60966.peg.276 | CDS | 255673 | 255870 | 1 | + | 198 | Mobile element protein | -none- | NA | NA |
| fig|6666666.60966.peg.749 | CDS | 694591 | 694788 | 1 | + | 198 | hypothetical protein | -none- | NA | NA |
| fig|6666666.60966.peg.2718 | CDS | 2523733 | 2523536 | −1 | − | 198 | hypothetical protein | -none- | NA | NA |
| fig|6666666.60966.peg.217 | CDS | 203959 | 204159 | 1 | + | 201 | Mobile element protein | -none- | NA | NA |
| fig|6666666.60966.peg.682 | CDS | 631759 | 631959 | 1 | + | 201 | FIG00859622: | -none- | NA | NA |
| hypothetical protein | ||||||||||
| fig|6666666.60966.peg.208 | CDS | 199189 | 199392 | 1 | + | 204 | Cold shock protein CspA | Cold shock, CspA family | NA | NA |
| of proteins | ||||||||||
| fig|6666666.60966.peg.380 | CDS | 348880 | 348677 | −1 | − | 204 | SSU ribosomal protein | -none- | NA | NA |
| S16p | ||||||||||
| fig|6666666.60966.peg.2149 | CDS | 1995706 | 1995503 | −1 | − | 204 | dTDP-4- | Rhamnose containing | NA | NA |
| dehydrorhamnose | glycans; <br>dTDP- | |||||||||
| reductase (EC | rhamnose synthesis | |||||||||
| 1.1.1.133) | ||||||||||
| fig|6666666.60966.peg.1148 | CDS | 1073050 | 1073259 | 1 | + | 210 | hypothetical protein | -none- | NA | NA |
| fig|6666666.60966.peg.2464 | CDS | 2281343 | 2281134 | −2 | − | 210 | hypothetical protein | -none- | NA | NA |
| fig|6666666.60966.peg.522 | CDS | 484104 | 484316 | 3 | + | 213 | LSU ribosomal protein | -none- | NA | NA |
| L29p (L35e) | ||||||||||
| fig|6666666.60966.peg.1481 | CDS | 1395113 | 1394901 | −2 | − | 213 | hypothetical protein | -none- | NA | NA |
| fig|6666666.60966.peg.292 | CDS | 265809 | 266024 | 3 | + | 216 | hypothetical protein | -none- | NA | NA |
| fig|6666666.60966.peg.511 | CDS | 475254 | 475469 | 3 | + | 216 | SSU ribosomal protein | Mycobacterium | NA | NA |
| S12p (S23e) | virulence operon | |||||||||
| involved in protein | ||||||||||
| synthesis (SSU ribosomal | ||||||||||
| proteins); | ||||||||||
| <br>Ribosomal protein | ||||||||||
| S12p Asp | ||||||||||
| methylthiotransferase | ||||||||||
| fig|6666666.60966.peg.529 | CDS | 490129 | 490347 | 1 | + | 219 | Translation initiation | Translation initiation | NA | NA |
| factor 1 | factors bacterial | |||||||||
| fig|6666666.60966.peg.2374 | CDS | 2207422 | 2207640 | 1 | + | 219 | hypothetical protein | -none- | NA | NA |
| fig|6666666.60966.peg.2105 | CDS | 1956719 | 1956940 | 2 | + | 222 | hypothetical protein | -none- | NA | NA |
| fig|6666666.60966.peg.2690 | CDS | 2502317 | 2502538 | 2 | + | 222 | hypothetical protein | -none- | NA | NA |
| fig|6666666.60966.peg.2153 | CDS | 1996354 | 1996578 | 1 | + | 225 | hypothetical protein | -none- | NA | NA |
| fig|6666666.60966.peg.2138 | CDS | 1985283 | 1985510 | 3 | + | 228 | hypothetical protein | -none- | NA | NA |
| fig|6666666.60966.peg.442 | CDS | 405529 | 405299 | −1 | − | 231 | hypothetical protein | -none- | NA | NA |
| fig|6666666.60966.peg.1716 | CDS | 1598000 | 1597770 | −2 | − | 231 | hypothetical protein | -none- | NA | NA |
| fig|6666666.60966.peg.2439 | CDS | 2259000 | 2258770 | −3 | − | 231 | hypothetical protein | -none- | NA | NA |
| fig|6666666.60966.peg.1111 | CDS | 1042874 | 1043110 | 2 | + | 237 | Mobile element protein | -none- | NA | NA |
| fig|6666666.60966.peg.1999 | CDS | 1865704 | 1865468 | −1 | − | 237 | hypothetical protein | -none- | NA | NA |
| fig|6666666.60966.peg.1214 | CDS | 1136308 | 1136069 | −1 | − | 240 | hypothetical protein | -none- | NA | NA |
| fig|6666666.60966.peg.1733 | CDS | 1614273 | 1614031 | −3 | − | 243 | hypothetical protein | -none- | NA | NA |
| fig|6666666.60966.peg.48 | CDS | 47253 | 47498 | 3 | + | 246 | Alpha-L-Rha alpha-1,3- | Rhamnose containing | NA | NA |
| L-rhamnosyltransferase | glycans | |||||||||
| (EC 2.4.1.—) | ||||||||||
| fig|6666666.60966.peg.423 | CDS | 393586 | 393338 | −1 | − | 249 | Mobile element protein | -none- | NA | NA |
| fig|6666666.60966.peg.429 | CDS | 396754 | 396506 | −1 | − | 249 | Transglycosylase- | -none- | NA | NA |
| associated protein | ||||||||||
| fig|6666666.60966.peg.1147 | CDS | 1072594 | 1072842 | 1 | + | 249 | hypothetical protein | -none- | NA | NA |
| fig|6666666.60966.peg.1951 | CDS | 1824656 | 1824408 | −2 | − | 249 | Plasmid stabilization | -none- | NA | NA |
| system protein | ||||||||||
| fig|6666666.60966.peg.2579 | CDS | 2380195 | 2380446 | 1 | + | 252 | Mobile element protein | -none- | NA | NA |
| fig|6666666.60966.peg.523 | CDS | 484294 | 484548 | 1 | + | 255 | SSU ribosomal protein | -none- | NA | NA |
| S17p (S11e) | ||||||||||
| fig|6666666.60966.peg.1022 | CDS | 948522 | 948782 | 3 | + | 261 | Stringent starvation | Carbon Starvation | NA | NA |
| protein B | ||||||||||
| fig|6666666.60966.peg.1957 | CDS | 1826664 | 1826936 | 3 | + | 273 | hypothetical protein | -none- | NA | NA |
| fig|6666666.60966.peg.2273 | CDS | 2108052 | 2108336 | 3 | + | 285 | putative DNA transport | -none- | NA | NA |
| competence protein | ||||||||||
| fig|6666666.60966.peg.46 | CDS | 46807 | 46481 | −1 | − | 327 | Conserved domain | -none- | NA | NA |
| protein | ||||||||||
| fig|6666666.60966.peg.2109 | CDS | 1959886 | 1960239 | 1 | + | 354 | hypothetical protein | -none- | NA | NA |
| fig|6666666.60966.peg.2429 | CDS | 2248841 | 2248488 | −2 | − | 354 | hypothetical protein | -none- | NA | NA |
| fig|6666666.60966.peg.1579 | CDS | 1468834 | 1469334 | 1 | + | 501 | hypothetical protein | -none- | NA | NA |
| fig|6666666.60966.peg.293 | CDS | 266114 | 266689 | 2 | + | 576 | hypothetical protein | -none- | NA | NA |
| SUPPLEMENTARY TABLE 2 |
| Selected D23 sequences |
| SEQ ID | ||
| and | ||
| length | Description | Sequence |
| SEQ ID | amoC1 | MATTLGTSSASSVSSRGYDMSLWYDSKFYKFGLITMLLVAIFWVWYQRYF |
| NO: 4 | (D23_1c22 | AYSHGMDSMEPEFDRVWMGLWRVHMAIMPLFALVTWGWIWKTRDTEEQLN |
| (271 | 72) | NLDPKLEIKRYFYYMMWLGVYIFGVYWGGSFFTEQDASWHQVIIRDTSFT |
| aa) | protein | PSHVVVFYGSFPMYIVCGVATYLYAMTRLPLFHRGISFPLVMAIAGPLMI |
| LPNVGLNEWGHAFWFMEELFSAPLHWGFVVLGWAGLFQGGVAAQIITRYS | ||
| NLTDVVWNNQSKEILNNRVVA | ||
| SEQ ID | amoC1 | ATGGCAACTACGTTAGGAACGAGCAGTGCCTCATCAGTCTCATCAAGAGG |
| NO: 5 | (D23_1c22 | CTATGACATGTCACTGTGGTATGACTCCAAATTTTATAAATTTGGTTTAA |
| (816 | 72) DNA | TAACCATGTTGTTGGTAGCGATATTCTGGGTATGGTATCAACGTTACTTT |
| nt) | GCCTATTCACACGGAATGGATTCAATGGAACCAGAGTTTGACCGTGTATG | |
| GATGGGCCTGTGGCGTGTGCACATGGCCATTATGCCGCTGTTTGCACTGG | ||
| TAACCTGGGGCTGGATCTGGAAAACACGTGATACAGAAGAGCAATTGAAT | ||
| AACCTGGATCCGAAACTGGAAATCAAACGCTACTTCTACTACATGATGTG | ||
| GCTGGGTGTATACATTTTTGGTGTTTACTGGGGTGGTAGCTTCTTTACGG | ||
| AGCAAGATGCCTCCTGGCACCAGGTGATTATTCGTGACACCAGCTTTACA | ||
| CCAAGTCACGTAGTCGTGTTTTATGGATCATTTCCGATGTACATCGTCTG | ||
| CGGAGTTGCAACCTATCTGTATGCAATGACCCGTCTGCCGCTGTTTCATC | ||
| GTGGAATTTCTTTCCCACTGGTGATGGCGATTGCAGGTCCTCTGATGATT | ||
| CTGCCAAACGTTGGTCTGAATGAATGGGGTCATGCTTTCTGGTTCATGGA | ||
| AGAGCTGTTCAGCGCACCGCTGCATTGGGGTTTTGTAGTGCTCGGTTGGG | ||
| CTGGGTTATTCCAGGGTGGAGTTGCTGCCCAAATCATTACCCGTTATTCC | ||
| AACCTGACTGACGTGGTCTGGAATAATCAAAGCAAAGAAATTCTGAATAA | ||
| CCGGGTTGTAGCTTAG | ||
| SEQ ID | amoA1 | VSIFRTEEILKAAKMPPEAVHMSRLIDAVYFPILVVLLVGTYHMHFMLLA |
| NO: 6 | (D23_1c22 | GDWDFWMDWKDRQWWPVVTPIVGITYCSAIMYYLWVNYRQPFGATLCVVC |
| (276 | 71) | LLIGEWLTRYWGFYWWSHYPLNFVTPGIMLPGALMLDFTMYLTRNWLVTA |
| aa) | protein | LVGGGFFGLLFYPGNWAIFGPTHLPIVVEGTLLSMADYMGHLYVRTGTPE |
| YVRHIEQGSLRTFGGHTTVIAAFFAAFVSMLMFAVWWYLGKVYCTAFFYV | ||
| KGKRGRIVQRNDVTAFGEEGFPEGIK | ||
| SEQ ID | amoA1 | GTGAGTATATTTAGAACAGAAGAGATCCTGAAAGCGGCCAAGATGCCGCC |
| NO: 7 | (D23_1c22 | GGAAGCGGTCCATATGTCACGCCTGATTGATGCGGTTTATTTTCCGATTC |
| (831 | 71) DNA | TGGTTGTTCTGTTGGTAGGTACCTACCATATGCACTTCATGTTGTTGGCA |
| nt) | GGTGACTGGGATTTCTGGATGGACTGGAAAGATCGTCAATGGTGGCCTGT | |
| AGTAACACCTATTGTAGGCATTACCTATTGCTCGGCAATTATGTATTACC | ||
| TGTGGGTCAACTACCGTCAACCATTTGGTGCGACTCTGTGCGTAGTGTGT | ||
| TTGCTGATAGGTGAGTGGCTGACACGTTACTGGGGTTTCTACTGGTGGTC | ||
| ACACTATCCACTCAATTTTGTAACCCCAGGTATCATGCTCCCGGGTGCAT | ||
| TGATGTTGGATTTCACAATGTATCTGACACGTAACTGGTTGGTGACTGCA | ||
| TTGGTTGGGGGTGGATTCTTTGGTCTGCTGTTTTACCCGGGTAACTGGGC | ||
| AATCTTTGGTCCGACCCATCTGCCAATCGTTGTAGAAGGAACACTGTTGT | ||
| CGATGGCTGACTATATGGGTCACCTGTATGTTCGTACGGGTACACCTGAG | ||
| TATGTTCGTCATATTGAACAAGGTTCATTACGTACCTTTGGTGGTCACAC | ||
| CACAGTTATTGCAGCATTCTTCGCTGCGTTTGTATCCATGCTGATGTTTG | ||
| CAGTCTGGTGGTATCTTGGAAAAGTTTACTGCACAGCCTTCTTCTACGTT | ||
| AAAGGTAAAAGAGGACGTATCGTGCAGCGCAATGATGTTACGGCATTTGG | ||
| TGAAGAAGGGTTTCCAGAGGGGATCAAATAA | ||
| SEQ ID | amoB1 | MGIKNLYKRGMMGLCGVAVYAMAALTMTVTLDVSTVAAHGERSQEPFLRM |
| NO: 8 | (D23_1c22 | RTVQWYDVKWGPEVTKVNENAQITGKFHLAEDWPRAAARPDFAFFNVGSP |
| (421 | 70) | SSVYVRLSTKINGHPWFISGPLQIGRDYAFEVQLRARIPGRHHMHAMLNV |
| aa) | protein | KDAGPIAGPGAWMNITGSWDDFTNPLKLLTGETIDSETFNLSNGIFWHIL |
| WMSIGIFWIGIFVARPMFLPRSRVLLAYGDDLLLDPMDKKITWVLAILTL | ||
| AIVWGGYRYTETKHPYTVPIQAGQSKVAPLPVAPNPVAIKITDANYDVPG | ||
| RALRVSMEVTNNGDTPVTFGEFTTAGIRFVNSTGRKYLDPQYPRELVAVG | ||
| LNFDDDGAIQPGETKQLRMEAKDALWEIQRLMALLGDPESRFGGLLMSWD | ||
| SEGNRHINSIAGPVIPVFTKL | ||
| SEQ ID | amoB1 | ATGGGTATCAAGAACCTTTATAAACGTGGAATGATGGGACTTTGTGGCGT |
| NO: 9 | (D23_1c22 | TGCTGTTTATGCAATGGCGGCACTGACCATGACAGTGACACTAGATGTCT |
| (1266 | 70) DNA | CAACAGTAGCAGCCCATGGAGAACGATCCCAGGAACCGTTTCTTCGGATG |
| nt) | CGTACAGTACAGTGGTACGATGTTAAGTGGGGTCCGGAAGTAACCAAAGT | |
| CAATGAGAATGCCCAAATTACCGGCAAATTTCACTTGGCTGAAGACTGGC | ||
| CGCGTGCGGCAGCAAGACCGGATTTCGCATTCTTTAACGTAGGTAGCCCA | ||
| AGCTCGGTATACGTGCGTTTGAGTACGAAGATTAATGGCCACCCATGGTT | ||
| TATTTCAGGTCCGCTGCAAATTGGTCGTGACTATGCGTTCGAAGTTCAGC | ||
| TGAGAGCACGTATTCCAGGACGCCATCACATGCACGCCATGTTAAACGTT | ||
| AAAGATGCAGGTCCAATTGCAGGACCGGGTGCATGGATGAACATTACCGG | ||
| AAGCTGGGATGATTTTACTAATCCACTCAAGCTGCTGACAGGCGAAACAA | ||
| TTGACTCAGAAACATTCAACCTGTCAAACGGTATTTTCTGGCATATTCTC | ||
| TGGATGTCAATTGGTATATTTTGGATTGGTATCTTTGTAGCGCGTCCGAT | ||
| GTTCCTGCCACGTAGCCGGGTATTGCTCGCTTATGGTGATGATCTGTTGC | ||
| TGGATCCGATGGATAAGAAAATCACCTGGGTACTTGCAATCCTGACCTTG | ||
| GCTATAGTATGGGGTGGATACCGCTATACAGAAACCAAGCATCCATACAC | ||
| AGTACCTATCCAGGCTGGTCAATCCAAAGTTGCACCATTACCGGTAGCAC | ||
| CAAATCCGGTAGCAATCAAAATTACAGATGCTAACTATGACGTACCGGGA | ||
| CGTGCACTGCGTGTATCGATGGAAGTAACCAACAACGGTGATACACCAGT | ||
| CACATTTGGTGAATTTACCACAGCAGGTATTCGTTTCGTTAACAGTACCG | ||
| GCCGCAAGTACCTGGATCCACAGTATCCTCGTGAACTGGTTGCAGTAGGC | ||
| TTGAATTTTGATGATGATGGTGCAATTCAGCCAGGCGAGACCAAGCAATT | ||
| GAGGATGGAAGCCAAAGATGCTCTGTGGGAAATCCAACGTCTGATGGCGT | ||
| TGCTGGGTGACCCGGAAAGCCGTTTTGGTGGACTGTTAATGTCTTGGGAT | ||
| TCAGAAGGTAATCGCCATATCAACAGTATTGCTGGTCCGGTGATTCCAGT | ||
| CTTTACCAAGCTCTAA | ||
| SEQ ID | amoC2 | MATTLGTSSASSVSSRGYDMSLWYDSKFYKFGLITMLLVAIFWVWYQRYF |
| NO: 10 | (D23_1c25 | AYSHGMDSMEPEFDRVWMGLWRVHMAIMPLFALVTWGWIWKTRDTEEQLN |
| (271 | 12) | NLDPKLEIKRYFYYMMWLGVYIFGVYWGGSFFTEQDASWHQVIIRDTSFT |
| aa) | protein | PSHVVVFYGSFPMYIVCGVATYLYAMTRLPLFHRGISFPLVMAIAGPLMI |
| LPNVGLNEWGHAFWFMEELFSAPLHWGFVVLGWAGLFQGGVAAQIITRYS | ||
| NLTDVVWNNQSKEILNNRVVA | ||
| SEQ ID | amoC2 | ATGGCAACTACGTTAGGAACGAGCAGTGCCTCATCAGTCTCATCAAGAGG |
| NO: 11 | (D23_1c25 | CTATGACATGTCACTGTGGTATGACTCCAAATTTTATAAATTTGGTTTAA |
| (816 | 12) DNA | TAACCATGTTGTTGGTAGCGATATTCTGGGTATGGTATCAACGTTACTTT |
| nt) | GCCTATTCACACGGAATGGATTCAATGGAACCAGAGTTTGACCGTGTATG | |
| GATGGGCCTGTGGCGTGTGCACATGGCCATTATGCCGCTGTTTGCACTGG | ||
| TAACCTGGGGCTGGATCTGGAAAACACGTGATACAGAAGAGCAATTGAAT | ||
| AACCTGGATCCGAAACTGGAAATCAAACGCTACTTCTACTACATGATGTG | ||
| GCTGGGTGTATACATTTTTGGTGTTTACTGGGGTGGTAGCTTCTTTACGG | ||
| AGCAAGATGCCTCCTGGCACCAGGTGATTATTCGTGACACCAGCTTTACA | ||
| CCAAGTCACGTAGTCGTGTTTTATGGATCATTTCCGATGTACATCGTCTG | ||
| CGGAGTTGCAACCTATCTGTATGCAATGACCCGTCTGCCGCTGTTTCATC | ||
| GTGGAATTTCTTTCCCACTGGTGATGGCGATTGCAGGTCCTCTGATGATT | ||
| CTGCCAAACGTTGGTCTGAATGAATGGGGTCATGCTTTCTGGTTCATGGA | ||
| AGAGCTGTTCAGCGCACCGCTGCATTGGGGTTTTGTAGTGCTCGGTTGGG | ||
| CTGGGTTATTCCAGGGTGGAGTTGCTGCCCAAATCATTACCCGTTATTCC | ||
| AACCTGACTGACGTGGTCTGGAATAATCAAAGCAAAGAAATTCTGAATAA | ||
| CCGGGTTGTAGCTTAG | ||
| SEQ ID | amoA2 | VSIFRTEEILKAAKMPPEAVHMSRLIDAVYFPILVVLLVGTYHMHFMLLA |
| NO: 12 | (D23_1c25 | GDWDFWMDWKDRQWWPVVTPIVGITYCSAIMYYLWVNYRQPFGATLCVVC |
| (276 | 11) | LLIGEWLTRYWGFYWWSHYPLNFVTPGIMLPGALMLDFTMYLTRNWLVTA |
| aa) | protein | LVGGGFFGLLFYPGNWAIFGPTHLPIVVEGTLLSMADYMGHLYVRTGTPE |
| YVRHIEQGSLRTFGGHTTVIAAFFAAFVSMLMFAVWWYLGKVYCTAFFYV | ||
| KGKRGRIVQRNDVTAFGEEGFPEGIK | ||
| SEQ ID | amoA2 | GTGAGTATATTTAGAACAGAAGAGATCCTGAAAGCGGCCAAGATGCCGCC |
| NO: 13 | (D23_1c25 | GGAAGCGGTCCATATGTCACGCCTGATTGATGCGGTTTATTTTCCGATTC |
| (831 | 11) DNA | TGGTTGTTCTGTTGGTAGGTACCTACCATATGCACTTCATGTTGTTGGCA |
| nt) | GGTGACTGGGATTTCTGGATGGACTGGAAAGATCGTCAATGGTGGCCTGT | |
| AGTAACACCTATTGTAGGCATTACCTATTGCTCGGCAATTATGTATTACC | ||
| TGTGGGTCAACTACCGTCAACCATTTGGTGCGACTCTGTGCGTAGTGTGT | ||
| TTGCTGATAGGTGAGTGGCTGACACGTTACTGGGGTTTCTACTGGTGGTC | ||
| ACACTATCCACTCAATTTTGTAACCCCAGGTATCATGCTCCCGGGTGCAT | ||
| TGATGTTGGATTTCACAATGTATCTGACACGTAACTGGTTGGTGACTGCA | ||
| TTGGTTGGGGGTGGATTCTTTGGTCTGCTGTTTTACCCGGGTAACTGGGC | ||
| AATCTTTGGTCCGACCCATCTGCCAATCGTTGTAGAAGGAACACTGTTGT | ||
| CGATGGCTGACTATATGGGTCACCTGTATGTTCGTACGGGTACACCTGAG | ||
| TATGTTCGTCATATTGAACAAGGTTCATTACGTACCTTTGGTGGTCACAC | ||
| CACAGTTATTGCAGCATTCTTCGCTGCGTTTGTATCCATGCTGATGTTTG | ||
| CAGTCTGGTGGTATCTTGGAAAAGTTTACTGCACAGCCTTCTTCTACGTT | ||
| AAAGGTAAAAGAGGACGTATCGTGCAGCGCAATGATGTTACGGCATTTGG | ||
| TGAAGAAGGGTTTCCAGAGGGGATCAAATAA | ||
| SEQ ID | amoB2 | MGIKNLYKRGMMGLCGVAVYAMAALTMTVTLDVSTVAAHGERSQEPFLRM |
| NO: 14 | (D23_1c25 | RTVQWYDVKWGPEVTKVNENAQITGKFHLAEDWPRAAARPDFAFFNVGSP |
| (421 | 10) | SSVYVRLSTKINGHPWFISGPLQIGRDYAFEVQLRARIPGRHHMHAMLNV |
| aa) | protein | KDAGPIAGPGAWMNITGSWDDFTNPLKLLTGETIDSETFNLSNGIFWHIL |
| WMSIGIFWIGIFVARPMFLPRSRVLLAYGDDLLLDPMDKKITWVLAILTL | ||
| AIVWGGYRYTETKHPYTVPIQAGQSKVAPLPVAPNPVAIKITDANYDVPG | ||
| RALRVSMEVTNNGDTPVTFGEFTTAGIRFVNSTGRKYLDPQYPRELVAVG | ||
| LNFDDDGAIQPGETKQLRMEAKDALWEIQRLMALLGDPESRFGGLLMSWD | ||
| SEGNRHINSIAGPVIPVFTKL | ||
| SEQ ID | amoB2 | ATGGGTATCAAGAACCTTTATAAACGTGGAATGATGGGACTTTGTGGCGT |
| NO: 15 | (D23_1c25 | TGCTGTTTATGCAATGGCGGCACTGACCATGACAGTGACACTAGATGTCT |
| (1266 | 10) DNA | CAACAGTAGCAGCCCATGGAGAACGATCCCAGGAACCGTTTCTTCGGATG |
| nt) | CGTACAGTACAGTGGTACGATGTTAAGTGGGGTCCGGAAGTAACCAAAGT | |
| CAATGAGAATGCCCAAATTACCGGCAAATTTCACTTGGCTGAAGACTGGC | ||
| CGCGTGCGGCAGCAAGACCGGATTTCGCATTCTTTAACGTAGGTAGCCCA | ||
| AGCTCGGTATACGTGCGTTTGAGTACGAAGATTAATGGCCACCCATGGTT | ||
| TATTTCAGGTCCGCTGCAAATTGGTCGTGACTATGCGTTCGAAGTTCAGC | ||
| TGAGAGCACGTATTCCAGGACGCCATCACATGCACGCCATGTTAAACGTT | ||
| AAAGATGCAGGTCCAATTGCAGGACCGGGTGCATGGATGAACATTACCGG | ||
| AAGCTGGGATGATTTTACTAATCCACTCAAGCTGCTGACAGGCGAAACAA | ||
| TTGACTCAGAAACATTCAACCTGTCAAACGGTATTTTCTGGCATATTCTC | ||
| TGGATGTCAATTGGTATATTTTGGATTGGTATCTTTGTAGCGCGTCCGAT | ||
| GTTCCTGCCACGTAGCCGGGTATTGCTCGCTTATGGTGATGATCTGTTGC | ||
| TGGATCCGATGGATAAGAAAATCACCTGGGTACTTGCAATCCTGACCTTG | ||
| GCTATAGTATGGGGTGGATACCGCTATACAGAAACCAAGCATCCATACAC | ||
| AGTACCTATCCAGGCTGGTCAATCCAAAGTTGCACCATTACCGGTAGCAC | ||
| CAAATCCGGTAGCAATCAAAATTACAGATGCTAACTATGACGTACCGGGA | ||
| CGTGCACTGCGTGTATCGATGGAAGTAACCAACAACGGTGATACACCAGT | ||
| CACATTTGGTGAATTTACCACAGCAGGTATTCGTTTCGTTAACAGTACCG | ||
| GCCGCAAGTACCTGGATCCACAGTATCCTCGTGAACTGGTTGCAGTAGGC | ||
| TTGAATTTTGATGATGATGGTGCAATTCAGCCAGGCGAGACCAAGCAATT | ||
| GAGGATGGAAGCCAAAGATGCTCTGTGGGAAATCCAACGTCTGATGGCGT | ||
| TGCTGGGTGACCCGGAAAGCCGTTTTGGTGGACTGTTAATGTCTTGGGAT | ||
| TCAGAAGGTAATCGCCATATCAACAGTATTGCTGGTCCGGTGATTCCAGT | ||
| CTTTACCAAGCTCTAA | ||
| SEQ ID | amoC3 | MATNILKDKAAQQVADKPTYDKSEWFDAKYYKFGLLPILAVAVMWVYFQR |
| NO: 16 | (D23_1c16 | TYAYSHGMDSMEPEFDRIWMGLWRVQMAALPLIALFTWGWLYKTRNTAEQ |
| (274 | 05) | LANLTPKQEIKRYFYFLMWLGVYIFAVYWGSSFFTEQDASWHQVIIRDTS |
| aa) | protein | FTPSHIPLFYGSFPVYIIMGVSMIIYANTRLPLYNKGWSFPLIMTVAGPL |
| MSLPNVGLNEWGHAFWFMEELFSAPLHWGFVILAWAALFQGGLAVQIIAR | ||
| FSNLLDVEWNKQDRAILDDVVTAP | ||
| SEQ ID | amoC3 | ATGGCTACAAATATATTAAAAGACAAAGCTGCACAGCAGGTTGCTGATAA |
| NO: 17 | (D23_1c16 | ACCAACTTATGATAAATCCGAGTGGTTTGATGCTAAATACTATAAATTCG |
| (825 | 05) DNA | GGCTGCTACCTATCTTAGCTGTAGCTGTGATGTGGGTTTATTTCCAGCGC |
| nt) | ACATACGCCTATTCTCACGGCATGGATTCAATGGAACCGGAATTTGACCG | |
| GATCTGGATGGGCTTGTGGCGTGTTCAAATGGCCGCTCTGCCTCTTATAG | ||
| CACTTTTTACGTGGGGATGGTTATATAAAACCCGCAATACTGCAGAACAG | ||
| CTTGCCAATCTGACTCCAAAGCAGGAAATAAAGCGGTATTTCTATTTCCT | ||
| CATGTGGCTTGGGGTCTATATATTTGCAGTTTACTGGGGATCAAGCTTCT | ||
| TTACCGAGCAGGACGCTTCATGGCACCAGGTGATTATCAGGGATACAAGT | ||
| TTTACTCCTAGCCATATTCCTCTGTTTTATGGTTCATTCCCGGTATACAT | ||
| CATCATGGGAGTATCGATGATTATTTACGCCAACACCCGGTTGCCGCTGT | ||
| ACAACAAAGGGTGGTCATTCCCTCTGATCATGACCGTAGCAGGACCGTTG | ||
| ATGAGTCTGCCTAACGTTGGCCTGAACGAGTGGGGACACGCCTTCTGGTT | ||
| CATGGAAGAACTTTTCAGCGCACCGCTGCACTGGGGCTTCGTGATTCTGG | ||
| CTTGGGCTGCCCTGTTCCAGGGTGGGCTTGCAGTACAGATCATAGCTCGC | ||
| TTTTCCAACTTGCTTGACGTGGAGTGGAATAAACAAGACAGAGCCATATT | ||
| GGACGATGTCGTAACTGCTCCTTAA | ||
| SEQ ID | hao1 | MRLGEYLKGMLLCAGLLLIGPVQADISTVPDETYEALKLDRSKATPKETY |
| NO: 18 | (D23_1c25 | DALVKRYKDPAHGAGKGTMGDYWEPIALSIYMDPSTFYKPPVSPKEIAER |
| (570 | 29) | KDCVECHSDETPVWVRAWKRSTHANLDKIRNLKPEDPLFYKKGKLEEVEN |
| aa) | protein | NLRSMGKLGEKEALKEVGCIDCHVDINAKKKADHTKDVRMPTADVCGTCH |
| LREFAERESERDTMIWPNGQWPDGRPSHALDYTANIETTVWAAMPQREVA | ||
| EGCTMCHTNQNKCDNCHTRHEFSAAESRKPEACATCHSGVDHNNYEAYIM | ||
| SKHGKLAEMNRENWNWNVRLKDAFSKGGQTAPTCAACHMEYEGEYTHNIT | ||
| RKTRWANYPFVPGIAENITSDWSEARLDSWVVTCTQCHSERFARSYLDLM | ||
| DKGTLEGLAKYQEANAIVHKMYEDGTLTGQKTNRPNPPAPEKPGFGIFTQ | ||
| LFWSKGNNPASLELKVLEMAENNLAKMHVGLAHVNPGGWTYTEGWGPMNR | ||
| AYVEIQDEYTKMQEMTALQARVNKLEGKKTSLLDLKGAGEKISLGGLGGG | ||
| MLLAGAIALIGWRKRKQTQA | ||
| SEQ ID | hao1 | ATGAGATTAGGGGAGTATTTGAAGGGGATGCTGCTGTGTGCGGGCCTGTT |
| NO: 19 | (D23_1c25 | GTTGATTGGGCCGGTACAGGCGGATATATCGACGGTACCGGATGAGACGT |
| (1713 | 29) DNA | ATGAAGCATTGAAGCTGGATCGCAGCAAAGCCACGCCGAAAGAGACCTAT |
| nt) | GATGCGCTGGTGAAGCGTTACAAGGATCCTGCACATGGTGCTGGCAAGGG | |
| CACGATGGGAGACTACTGGGAACCGATAGCGCTTAGTATCTACATGGACC | ||
| CGAGCACCTTTTACAAACCACCGGTTTCCCCGAAAGAAATTGCTGAGCGC | ||
| AAAGACTGCGTTGAATGCCACTCTGATGAAACGCCGGTTTGGGTAAGAGC | ||
| ATGGAAACGCAGCACCCACGCCAACCTGGACAAAATACGCAACCTCAAGC | ||
| CGGAAGATCCGCTTTTTTACAAAAAAGGCAAGCTGGAAGAAGTTGAGAAC | ||
| AACCTGCGCTCCATGGGCAAACTTGGAGAGAAGGAAGCGCTCAAGGAAGT | ||
| AGGCTGTATTGACTGTCACGTTGACATCAACGCCAAAAAGAAAGCAGATC | ||
| ACACCAAAGACGTACGCATGCCTACAGCTGACGTTTGCGGAACCTGTCAC | ||
| CTGAGAGAATTTGCCGAGCGTGAATCCGAGCGTGACACCATGATCTGGCC | ||
| GAATGGCCAGTGGCCTGACGGACGTCCATCCCACGCACTGGACTACACAG | ||
| CCAACATTGAAACCACCGTTTGGGCAGCCATGCCGCAACGTGAAGTGGCA | ||
| GAAGGTTGCACCATGTGCCACACCAACCAGAACAAATGCGACAACTGCCA | ||
| TACCCGCCATGAATTTTCGGCGGCAGAATCCCGCAAACCGGAAGCCTGTG | ||
| CCACCTGTCACAGCGGCGTGGATCATAATAACTATGAAGCCTACATTATG | ||
| TCCAAGCACGGCAAACTGGCTGAAATGAACCGGGAGAACTGGAACTGGAA | ||
| TGTTCGTCTGAAAGACGCCTTCTCCAAAGGAGGTCAGACCGCACCGACCT | ||
| GTGCAGCCTGCCACATGGAATACGAAGGGGAATATACCCATAACATCACC | ||
| CGTAAGACCCGCTGGGCAAACTACCCGTTTGTTCCGGGGATTGCAGAAAA | ||
| CATCACCAGCGACTGGTCAGAAGCTCGTCTGGATTCCTGGGTTGTGACCT | ||
| GTACCCAATGTCACTCGGAACGGTTTGCCCGCTCCTACCTGGATCTCATG | ||
| GACAAAGGTACCCTGGAAGGGTTGGCTAAATACCAGGAAGCCAATGCCAT | ||
| TGTTCACAAAATGTATGAAGACGGCACCCTGACTGGTCAAAAAACCAATC | ||
| GTCCGAATCCACCGGCGCCAGAGAAACCGGGTTTTGGTATCTTCACCCAA | ||
| CTGTTCTGGTCCAAGGGTAACAACCCGGCCTCACTTGAACTGAAAGTGCT | ||
| GGAAATGGCAGAAAACAACCTGGCCAAAATGCACGTAGGACTGGCACACG | ||
| TTAATCCAGGTGGCTGGACATATACCGAAGGTTGGGGCCCGATGAACCGT | ||
| GCCTATGTTGAAATCCAGGATGAATACACCAAGATGCAGGAAATGACAGC | ||
| TCTGCAAGCGCGTGTTAACAAACTGGAAGGTAAAAAAACCAGCCTGCTTG | ||
| ACCTCAAGGGAGCGGGAGAAAAGATCTCGCTGGGAGGACTGGGAGGTGGC | ||
| ATGTTGCTGGCGGGAGCGATTGCTCTGATTGGCTGGCGTAAACGTAAGCA | ||
| AACGCAAGCTTGA | ||
| SEQ ID | hao2 | MRLGEYLKGMLLCAGLLLIGPVQADISTVPDETYEALKLDRSKATPKETY |
| NO: 20 | (D23_1c19 | DALVKRYKDPAHGAGKGTMGDYWEPIALSIYMDPSTFYKPPVSPKEIAER |
| (570 | 26) | KDCVECHSDETPVWVRAWKRSTHANLDKIRNLKPEDPLFYKKGKLEEVEN |
| aa) | protein | NLRSMGKLGEKEALKEVGCIDCHVDINAKKKADHTKDVRMPTADVCGTCH |
| LREFAERESERDTMIWPNGQWPDGRPSHALDYTANIETTVWAAMPQREVA | ||
| EGCTMCHTNQNKCDNCHTRHEFSAAESRKPEACATCHSGVDHNNYEAYIM | ||
| SKHGKLAEMNRENWNWNVRLKDAFSKGGQTAPTCAACHMEYEGEYTHNIT | ||
| RKTRWANYPFVPGIAENITSDWSEARLDSWVVTCTQCHSERFARSYLDLM | ||
| DKGTLEGLAKYQEANAIVHKMYEDGTLTGQKTNRPNPPAPEKPGFGIFTQ | ||
| LFWSKGNNPASLELKVLEMAENNLAKMHVGLAHVNPGGWTYTEGWGPMNR | ||
| AYVEIQDEYTKMQEMTALQARVNKLEGKKTSLLDLKGAGEKISLGGLGGG | ||
| MLLAGAIALIGWRKRKQTQA | ||
| SEQ ID | hao2 | ATGAGATTAGGGGAGTATTTGAAGGGGATGCTGCTGTGTGCGGGCCTGTT |
| NO: 21 | (D23_1c19 | GTTGATTGGGCCGGTACAGGCGGATATATCGACGGTACCGGATGAGACGT |
| (1713 | 26) DNA | ATGAAGCATTGAAGCTGGATCGCAGCAAAGCCACGCCGAAAGAGACCTAT |
| nt) | GATGCGCTGGTGAAGCGTTACAAGGATCCTGCACATGGTGCTGGCAAGGG | |
| CACGATGGGAGACTACTGGGAACCGATAGCGCTTAGTATCTACATGGACC | ||
| CGAGCACCTTTTACAAACCACCGGTTTCCCCGAAAGAAATTGCTGAGCGC | ||
| AAAGACTGCGTTGAATGCCACTCTGATGAAACGCCGGTTTGGGTAAGAGC | ||
| ATGGAAACGCAGCACCCACGCCAACCTGGACAAAATACGCAACCTCAAGC | ||
| CGGAAGATCCGCTTTTTTACAAAAAAGGCAAGCTGGAAGAAGTTGAGAAC | ||
| AACCTGCGCTCCATGGGCAAACTTGGAGAGAAGGAAGCGCTCAAGGAAGT | ||
| AGGCTGTATTGACTGTCACGTTGACATCAACGCCAAAAAGAAAGCAGATC | ||
| ACACCAAAGACGTACGCATGCCTACAGCTGACGTTTGCGGAACCTGTCAC | ||
| CTGAGAGAATTTGCCGAGCGTGAATCCGAGCGTGACACCATGATCTGGCC | ||
| GAATGGCCAGTGGCCTGACGGACGTCCATCCCACGCACTGGACTACACAG | ||
| CCAACATTGAAACCACCGTTTGGGCAGCCATGCCGCAACGTGAAGTGGCA | ||
| GAAGGTTGCACCATGTGCCACACCAACCAGAACAAATGCGACAACTGCCA | ||
| TACCCGCCATGAATTTTCGGCGGCAGAATCCCGCAAACCGGAAGCCTGTG | ||
| CCACCTGTCACAGCGGCGTGGATCATAATAACTATGAAGCCTACATTATG | ||
| TCCAAGCACGGCAAACTGGCTGAAATGAACCGGGAGAACTGGAACTGGAA | ||
| TGTTCGTCTGAAAGACGCCTTCTCCAAAGGAGGTCAGACCGCACCGACCT | ||
| GTGCAGCCTGCCACATGGAATACGAAGGGGAATATACCCATAACATCACC | ||
| CGTAAGACCCGCTGGGCAAACTACCCGTTTGTTCCGGGGATTGCAGAAAA | ||
| CATCACCAGCGACTGGTCAGAAGCTCGTCTGGATTCCTGGGTTGTGACCT | ||
| GTACCCAATGTCACTCGGAACGGTTTGCCCGCTCCTACCTGGATCTCATG | ||
| GACAAAGGTACCCTGGAAGGGTTGGCTAAATACCAGGAAGCCAATGCCAT | ||
| TGTTCACAAAATGTATGAAGACGGCACCCTGACTGGTCAAAAAACCAATC | ||
| GTCCGAATCCACCGGCGCCAGAGAAACCGGGTTTTGGTATCTTCACCCAA | ||
| CTGTTCTGGTCCAAGGGTAACAACCCGGCCTCACTTGAACTGAAAGTGCT | ||
| GGAAATGGCAGAAAACAACCTGGCCAAAATGCACGTAGGACTGGCACACG | ||
| TTAATCCAGGTGGCTGGACATATACCGAAGGTTGGGGCCCGATGAACCGT | ||
| GCCTATGTTGAAATCCAGGATGAATACACCAAGATGCAGGAAATGACAGC | ||
| TCTGCAAGCGCGTGTTAACAAACTGGAAGGTAAAAAAACCAGCCTGCTTG | ||
| ACCTCAAGGGAGCGGGAGAAAAGATCTCGCTGGGAGGACTGGGAGGTGGC | ||
| ATGTTGCTGGCGGGAGCGATTGCTCTGATTGGCTGGCGTAAACGTAAGCA | ||
| AACGCAAGCTTGA | ||
| SEQ ID | hao3 | MRLGEYLKGMLLCAGLLLIGPVQADISTVPDETYEALKLDRSKATPKETY |
| NO: 22 | (D23_1c17 | DALVKRYKDPAHGAGKGTMGDYWEPIALSIYMDPSTFYKPPVSPKEIAER |
| (570 | 88) | KDCVECHSDETPVWVRAWKRSTHANLDKIRNLKPEDPLFYKKGKLEEVEN |
| aa) | protein | NLRSMGKLGEKEALKEVGCIDCHVDINAKKKADHTKDVRMPTADVCGTCH |
| LREFAERESERDTMIWPNGQWPDGRPSHALDYTANIETTVWAAMPQREVA | ||
| EGCTMCHTNQNKCDNCHTRHEFSAAESRKPEACATCHSGVDHNNYEAYIM | ||
| SKHGKLAEMNRENWNWNVRLKDAFSKGGQTAPTCAACHMEYEGEYTHNIT | ||
| RKTRWANYPFVPGIAENITSDWSEARLDSWVVTCTQCHSERFARSYLDLM | ||
| DKGTLEGLAKYQEANAIVHKMYEDGTLTGQKTNRPNPPAPEKPGFGIFTQ | ||
| LFWSKGNNPASLELKVLEMAENNLAKMHVGLAHVNPGGWTYTEGWGPMNR | ||
| AYVEIQDEYTKMQEMTALQARVNKLEGKKTSLLDLKGAGEKISLGGLGGG | ||
| MLLAGAIALIGWRKRKQTQA | ||
| SEQ ID | hao3 | ATGAGATTAGGGGAGTATTTGAAGGGGATGCTGCTGTGTGCGGGCCTGTT |
| NO: 23 | (D23_1c17 | GTTGATTGGGCCGGTACAGGCGGATATATCGACGGTACCGGATGAGACGT |
| (1713 | 88) DNA | ATGAAGCATTGAAGCTGGATCGCAGCAAAGCCACGCCGAAAGAGACCTAT |
| nt) | GATGCGCTGGTGAAGCGTTACAAGGATCCTGCGCATGGTGCTGGCAAGGG | |
| CACGATGGGAGACTACTGGGAACCGATAGCGCTTAGTATCTACATGGACC | ||
| CGAGCACCTTTTACAAACCACCGGTTTCCCCGAAAGAAATTGCTGAGCGC | ||
| AAAGACTGCGTTGAATGCCACTCTGATGAAACGCCGGTTTGGGTAAGAGC | ||
| ATGGAAACGCAGCACCCACGCCAACCTGGACAAAATACGCAACCTCAAGC | ||
| CGGAAGATCCGCTTTTTTACAAAAAAGGCAAGCTGGAAGAAGTTGAGAAC | ||
| AACCTGCGCTCCATGGGCAAACTTGGAGAGAAGGAAGCGCTCAAGGAAGT | ||
| AGGCTGTATTGACTGTCACGTTGACATCAACGCCAAAAAGAAAGCAGATC | ||
| ACACCAAAGACGTACGCATGCCTACAGCTGACGTTTGCGGAACCTGTCAC | ||
| CTGAGAGAATTTGCCGAGCGTGAATCCGAGCGTGACACCATGATCTGGCC | ||
| GAATGGCCAGTGGCCTGACGGACGTCCATCCCACGCACTGGACTACACAG | ||
| CCAACATTGAAACCACCGTTTGGGCAGCCATGCCGCAACGTGAAGTGGCA | ||
| GAAGGTTGCACCATGTGCCACACCAACCAGAACAAATGCGACAACTGCCA | ||
| TACCCGCCATGAATTTTCGGCGGCAGAATCCCGCAAACCGGAAGCCTGTG | ||
| CCACCTGTCACAGCGGCGTGGATCATAATAACTATGAAGCCTACATTATG | ||
| TCCAAGCACGGCAAACTGGCTGAAATGAACCGGGAGAACTGGAACTGGAA | ||
| TGTTCGTCTGAAAGACGCCTTCTCCAAAGGAGGTCAGACCGCACCGACCT | ||
| GTGCAGCCTGCCACATGGAATACGAAGGGGAATATACCCATAACATCACC | ||
| CGTAAGACCCGCTGGGCAAACTACCCGTTTGTTCCGGGGATTGCAGAAAA | ||
| CATCACCAGCGACTGGTCAGAAGCTCGTCTGGATTCCTGGGTTGTGACCT | ||
| GTACCCAATGTCACTCGGAACGGTTTGCCCGCTCCTACCTGGATCTCATG | ||
| GACAAAGGTACCCTGGAAGGGTTGGCTAAATACCAGGAAGCCAATGCCAT | ||
| TGTTCACAAAATGTATGAAGACGGCACCCTGACTGGTCAAAAAACCAATC | ||
| GTCCGAATCCACCGGCGCCAGAGAAACCGGGTTTTGGTATCTTCACCCAA | ||
| CTGTTCTGGTCCAAGGGTAACAACCCGGCCTCACTTGAACTGAAAGTGCT | ||
| GGAAATGGCAGAAAACAACCTGGCCAAAATGCACGTAGGACTGGCACACG | ||
| TTAATCCAGGTGGCTGGACATATACCGAAGGTTGGGGCCCGATGAACCGT | ||
| GCCTATGTTGAAATCCAGGATGAATACACCAAGATGCAGGAAATGACAGC | ||
| TCTGCAAGCGCGTGTTAACAAACTGGAAGGTAAAAAAACCAGCCTGCTTG | ||
| ACCTCAAGGGAGCGGGAGAAAAGATCTCGCTGGGAGGACTGGGAGGTGGC | ||
| ATGTTGCTGGCGGGAGCGATTGCTCTGATTGGCTGGCGTAAACGTAAGCA | ||
| AACGCAAGCTTGA | ||
| SEQ ID | c554 | MKIIIACGLVAAALFTLTSGQSLAADAPFEGRKKCSSCHKPQAQSWKHTA |
| NO: 24 | cycA1 | HAKAMESLKPNVKVEAKQKAKLDPTKDYTQDKDCVGCHVDGFGQKGGYTI |
| (235 | (D23_1c25 | DSPKPMLTGVGCESCHGPGRKYRGDHRKAGQAFEKSGKKAPRKTLASKGQ |
| aa) | 27) | DFNFEERCSACHLNYEGSPWKGAKPPYTPYTPEVDPKYTFKFDEMVKDVK |
| protein | AMHEHYKLDGVFDGEPKFKFHDEFQANAKTAKKGK | |
| SEQ ID | c554 | ATGAAAATAATAATAGCCTGCGGACTGGTTGCTGCAGCCCTGTTCACCCT |
| NO: 25 | cycA1 | GACAAGTGGGCAGAGTCTGGCAGCGGATGCTCCGTTTGAAGGTCGGAAAA |
| (708 | (D23_1c25 | AGTGCAGTTCCTGTCACAAACCACAAGCCCAGTCGTGGAAACATACTGCC |
| nt) | 27) DNA | CACGCCAAGGCGATGGAATCGCTCAAGCCCAATGTCAAAGTGGAAGCCAA |
| ACAAAAAGCCAAACTGGATCCTACCAAGGACTACACCCAGGACAAAGACT | ||
| GCGTAGGTTGCCACGTGGATGGATTTGGCCAGAAAGGCGGCTACACGATA | ||
| GACTCCCCCAAACCCATGCTGACTGGCGTAGGCTGTGAATCCTGCCACGG | ||
| GCCTGGACGTAAATACCGGGGAGATCACCGCAAGGCCGGGCAAGCATTTG | ||
| AGAAATCGGGCAAAAAAGCGCCGCGCAAGACCCTGGCAAGCAAGGGGCAA | ||
| GACTTTAATTTTGAAGAACGTTGCAGCGCCTGCCATCTGAACTATGAAGG | ||
| GTCACCCTGGAAAGGAGCAAAACCTCCCTATACCCCGTATACACCGGAAG | ||
| TGGATCCGAAATACACCTTCAAGTTTGACGAGATGGTAAAAGACGTCAAA | ||
| GCCATGCACGAGCATTACAAACTGGATGGCGTATTTGACGGAGAGCCTAA | ||
| ATTCAAGTTCCATGACGAATTCCAGGCCAACGCTAAAACTGCCAAAAAAG | ||
| GAAAATAG | ||
| SEQ ID | cycA2 | MKIIIACGLVAAALFTLTSGQSLAADAPFEGRKKCSSCHKPQAQSWKHTA |
| NO: 26 | (D23_1c19 | HAKAMESLKPNVKVEAKQKAKLDPTKDYTQDKDCVGCHVDGFGQKGGYTI |
| (235 | 24) | DSPKPMLTGVGCESCHGPGRKYRGDHRKAGQAFEKSGKKAPRKTLASKGQ |
| aa) | protein | DFNFEERCSACHLNYEGSPWKGAKPPYTPYTPEVDPKYTFKFDEMVKDVK |
| AMHEHYKLDGVFDGEPKFKFHDEFQANAKTAKKGK | ||
| SEQ ID | cycA2 | ATGAAAATAATAATAGCCTGCGGACTGGTTGCTGCAGCCCTGTTCACCCT |
| NO: 27 | (D23_1c19 | GACAAGTGGGCAGAGTCTGGCAGCGGATGCTCCGTTTGAAGGTCGGAAAA |
| (708 | 24) DNA | AGTGCAGTTCCTGTCACAAACCACAAGCCCAGTCGTGGAAACATACTGCC |
| nt) | CACGCCAAGGCGATGGAATCGCTCAAGCCCAATGTCAAAGTGGAAGCCAA | |
| ACAAAAAGCCAAACTGGATCCTACCAAGGACTACACCCAGGACAAAGACT | ||
| GCGTAGGTTGCCACGTGGATGGATTTGGCCAGAAAGGCGGCTACACGATA | ||
| GACTCCCCCAAACCCATGCTGACTGGCGTAGGCTGTGAATCCTGCCACGG | ||
| GCCTGGACGTAAATACCGGGGAGATCACCGCAAGGCTGGGCAAGCATTTG | ||
| AGAAATCGGGCAAAAAAGCGCCGCGCAAGACCCTGGCAAGCAAGGGGCAA | ||
| GACTTTAATTTTGAAGAACGTTGCAGCGCCTGCCATCTGAACTATGAAGG | ||
| GTCACCCTGGAAAGGAGCAAAACCTCCCTATACCCCGTATACACCGGAAG | ||
| TGGATCCGAAATACACCTTCAAGTTTGACGAGATGGTAAAAGACGTCAAA | ||
| GCCATGCACGAGCATTACAAACTGGATGGCGTATTTGACGGAGAGCCTAA | ||
| ATTCAAGTTCCATGACGAATTCCAGGCCAACGCTAAAACTGCCAAAAAAG | ||
| GAAAATAG | ||
| SEQ ID | cycA3 | MKIIIACGLVAAALFTLTSGQSLAADAPFEGRKKCSSCHKPQAQSWKHTA |
| NO: 28 | (D23_1c17 | HAKAMESLKPNVKVEAKQKAKLDPTKDYTQDKDCVGCHVDGFGQKGGYTI |
| (235 | 86) | DSPKPMLTGVGCESCHGPGRKYRGDHRKAGQAFEKSGKKAPRKTLASKGQ |
| aa) | protein | DFNFEERCSACHLNYEGSPWKGAKPPYTPYTPEVDPKYTFKFDEMVKDVK |
| AMHEHYKLDGVFDGEPKFKFHDEFQANAKTAKKGK | ||
| SEQ ID | cycA3 | ATGAAAATAATAATAGCCTGCGGACTGGTTGCTGCAGCCCTGTTCACCCT |
| NO: 29 | (D23_1c17 | GACAAGTGGGCAGAGTCTGGCAGCGGATGCTCCGTTTGAAGGTCGGAAAA |
| (708 | 86) DNA | AGTGCAGTTCCTGTCACAAACCACAAGCCCAGTCGTGGAAACATACTGCC |
| nt) | CACGCCAAGGCGATGGAATCGCTCAAGCCCAATGTCAAAGTGGAAGCCAA | |
| ACAAAAAGCCAAACTGGATCCTACCAAGGACTACACCCAGGACAAAGACT | ||
| GCGTAGGTTGCCACGTGGATGGATTTGGCCAGAAAGGCGGCTACACGATA | ||
| GACTCCCCCAAACCCATGCTGACTGGCGTAGGCTGTGAATCCTGCCACGG | ||
| GCCTGGACGTAAATACCGGGGAGATCACCGCAAGGCTGGGCAAGCATTTG | ||
| AGAAATCGGGCAAAAAAGCGCCGCGCAAGACCCTGGCAAGCAAGGGGCAA | ||
| GACTTTAATTTTGAAGAACGTTGCAGCGCCTGCCATCTGAACTATGAAGG | ||
| GTCACCCTGGAAAGGAGCAAAACCTCCCTATACCCCGTATACACCGGAAG | ||
| TGGATCCGAAATACACCTTCAAGTTTGACGAGATGGTAAAAGACGTCAAA | ||
| GCCATGCACGAGCATTACAAACTGGATGGCGTATTTGACGGAGAGCCTAA | ||
| ATTCAAGTTCCATGACGAATTCCAGGCCAACGCTAAAACTGCCAAAAAAG | ||
| GAAAATAG | ||
| SEQ ID | cM552 | MTRLQKGSIGTLLTGALLGIALVAVVFGGEAALSTEEFCTSCHSMSYPQS |
| NO: 30 | cycB1 | ELKESTHYGALGVNPTCKDCHIPQGIENFHLAVATHVVDGARELWLEMVN |
| (239 | (D23_1c19 | DYSTLEKFNERRLEMAHDARMNLKKWDSITCRTCHVKPAPPGESAQAEHK |
| aa) | 23) | KMETEGATCIDCHQNLVHEEAPMTDLNASLAAGKLVLKPEEGDGDDDDDV |
| protein | DVDDEEEDEEVEVEVEETETADDSDSASSSNHDDDSDDE | |
| SEQ ID | cM552 | ATGACTAGACTGCAAAAAGGATCAATTGGTACTTTACTGACAGGAGCTCT |
| NO: 31 | cycB1 | GCTGGGAATAGCATTGGTGGCTGTGGTTTTTGGTGGGGAAGCTGCGTTAT |
| (720 | (D23_1c19 | CGACCGAAGAGTTTTGTACCAGCTGTCATTCCATGTCATACCCACAGAGT |
| nt) | 23) DNA | GAATTAAAAGAATCCACCCACTATGGTGCATTGGGGGTTAATCCGACTTG |
| TAAAGACTGTCATATTCCACAAGGGATAGAAAATTTCCACCTGGCAGTAG | ||
| CAACTCACGTGGTTGATGGTGCCAGAGAACTTTGGTTGGAGATGGTCAAT | ||
| GACTACTCCACCCTGGAGAAGTTCAACGAAAGAAGATTGGAAATGGCGCA | ||
| TGATGCCCGGATGAACCTCAAGAAATGGGACAGCATCACCTGCCGTACCT | ||
| GTCATGTAAAACCAGCTCCTCCGGGAGAAAGCGCCCAGGCGGAACATAAG | ||
| AAAATGGAAACGGAAGGAGCAACCTGCATAGACTGTCATCAGAATCTGGT | ||
| GCATGAAGAAGCGCCGATGACAGATTTGAATGCAAGTCTTGCTGCAGGCA | ||
| AGCTGGTATTAAAGCCAGAAGAGGGTGACGGTGACGATGACGATGACGTT | ||
| GACGTTGATGACGAGGAGGAGGATGAAGAAGTCGAGGTGGAAGTTGAAGA | ||
| AACTGAAACAGCTGACGACAGCGACTCCGCTTCCTCCAGCAACCATGATG | ||
| ACGATAGTGATGATGAGTAA | ||
| SEQ ID | cycB2 | MTRLQKGSIGTLLTGALLGIALVAVVFGGEAALSTEEFCTSCHSMSYPQS |
| NO: 32 | (D23_1c25 | ELKESTHYGALGVNPTCKDCHIPQGIENFHLAVATHVVDGARELWLEMVN |
| (239 | 26) | DYSTLEKFNERRLEMAHDARMNLKKWDSITCRTCHVKPAPPGESAQAEHK |
| aa) | protein | KMETEGATCIDCHQNLVHEEAPMTDLNASLAAGKLVLKPEEGDDDDDDDV |
| DVDDEEEDEEVEVEVEETETADDSDSASSSNHDDDSDDE | ||
| SEQ ID | cycB2 | ATGACTAGACTGCAAAAAGGATCAATTGGCACTTTACTGACAGGAGCTCT |
| NO: 33 | (D23_1c25 | GCTGGGAATAGCATTGGTGGCTGTGGTTTTTGGTGGGGAAGCTGCGTTAT |
| (720 | 26) DNA | CGACCGAAGAGTTTTGTACCAGCTGTCATTCCATGTCATACCCACAGAGT |
| nt) | GAATTAAAAGAATCCACCCACTATGGTGCATTGGGGGTTAATCCGACTTG | |
| TAAAGACTGTCATATTCCACAAGGGATAGAAAATTTCCACCTGGCAGTAG | ||
| CAACTCACGTGGTTGATGGTGCCAGAGAACTTTGGTTGGAGATGGTCAAT | ||
| GACTACTCCACCCTGGAGAAGTTCAACGAAAGAAGATTGGAAATGGCGCA | ||
| TGATGCCCGGATGAACCTCAAGAAATGGGACAGCATCACCTGCCGTACCT | ||
| GTCATGTAAAACCAGCTCCTCCGGGAGAAAGCGCCCAGGCGGAACATAAG | ||
| AAAATGGAAACGGAAGGAGCAACCTGCATAGACTGTCATCAGAATCTGGT | ||
| GCATGAAGAAGCGCCGATGACAGATTTGAATGCAAGTCTTGCTGCAGGCA | ||
| AGCTGGTATTAAAGCCAGAAGAGGGTGACGATGACGATGACGATGACGTT | ||
| GACGTTGATGACGAGGAGGAGGATGAAGAAGTCGAGGTGGAAGTTGAAGA | ||
| AACTGAAACAGCTGACGACAGCGACTCCGCTTCCTCCAGCAACCATGATG | ||
| ACGATAGTGATGATGAGTAA | ||
All publications and patents mentioned herein are hereby incorporated by reference in their entirety as if each individual publication or patent was specifically and individually indicated to be incorporated by reference.
While specific embodiments of the subject invention have been discussed, the above specification is illustrative and not restrictive. Many variations of the invention will become apparent to those skilled in the art upon review of this specification and the claims below. The full scope of the invention should be determined by reference to the claims, along with their full scope of equivalents, and the specification, along with such variations.
Certain embodiments are within the following claims.
1. A purified preparation of optimized Nitrosomonas eutropha (N. eutropha) bacterium having at least one property selected from:
an optimized growth rate;
an optimized NH4+ oxidation rate; and
an optimized resistance to NH4+.
2. The preparation of N. eutropha bacterium of claim 1, wherein the optimized growth rate is a rate allowing a continuous culture of N. eutropha at an OD600 (optical density at 600 nm) of about 0.15-0.18 to reach an OD600 of about 0.5-0.6 in about 1-2 days.
3. The preparation of N. eutropha bacterium of claim 1 or 2, wherein the optimized growth rate is a doubling time of about 8 hours when cultured under batch culture conditions.
4. The preparation of N. eutropha bacterium of any of claims 1-3, wherein the optimized NH4+ oxidation rate is a rate of at least about 125 micromoles per minute of oxidizing NH4+ to NO2−.
5. The preparation of N. eutropha bacterium of any of claims 1-4, wherein the optimized resistance to NH4+ is an ability to grow in medium comprising about 200 mM NH4+ for at least about 48 hours.
6. The preparation of N. eutropha bacterium of any of claims 1-5, which has at least two properties selected from an optimized growth rate, an optimized NH4+ oxidation rate, and an optimized resistance to NH4+.
7. The preparation of N. eutropha bacterium of claim 1-6, which has an optimized growth rate, an optimized NH4+ oxidation rate, and an optimized resistance to NH4+.
8. The preparation of N. eutropha bacterium of any of claims 1-7, which comprises a chromosome that hybridizes under very high stringency to SEQ ID NO: 1.
9. The preparation of N. eutropha bacterium of any of claim 1-8, which comprises an AmoA protein having an identity to SEQ ID NO: 6 or 12 selected from at least about 80%, 85%, 90%, 95%, 98%, 99%, 99.5%, and 100% identical, an AmoB protein having an identity to SEQ ID NO: 8 or 14 selected from at least about 80%, 85%, 90%, 95%, 98%, 99%, 99.5%, and 100% identical, an amoC gene having an identity to SEQ ID NO: 4, 10, or 16 selected from at least about 80%, 85%, 90%, 95%, 98%, 99%, 99.5%, and 100% identical, a hydroxylamine oxidoreductase protein having an identity to SEQ ID NO: 18, 20, or 22 selected from at least 80%, 85%, 90%, 95%, 98%, 99%, 99.5%, and 100% identical, a cytochrome c554 protein having an identity to SEQ ID NO: 24, 26, or 28 selected from at least about 80%, 85%, 90%, 95%, 98%, 99%, 99.5%, and 100% identical, or a cytochrome cM552 protein having an identity to SEQ ID NO: 30 or 32 selected from at least about 80%, 85%, 90%, 95%, 98%, 99%, 99.5%, and 100% identical.
10. The preparation of N. eutropha bacterium of any of claims 1-9, which comprises 1-5, 5-10, 10-15, 15-20, 20-25, 25-30, or all of the sequence characteristics of Table 2.
11. The preparation of N. eutropha bacterium of claim 10, which comprises an AmoA1 or AmoA2 protein having (or gene encoding) a mutation relative to N. eutropha strain C91 at position 1, e.g., a V at position 1.
12. The preparation of N. eutropha bacterium of any of claims 10-11, which comprises an AmoA1 or AmoA2 protein having (or gene encoding) a mutation relative to N. eutropha strain C91 at position 160, e.g., an L at position 160.
13. The preparation of N. eutropha bacterium of any of claims 10-12, which comprises an AmoA1 or AmoA2 protein having (or gene encoding) a mutation relative to N. eutropha strain C91 at position 167, e.g., an A at position 167.
14. The preparation of N. eutropha bacterium of any of claims 10-13, which comprises an AmoB1 or AmoB2 protein having (or gene encoding) a mutation relative to N. eutropha strain C91 at position 33, e.g., a V at position 33.
15. The preparation of N. eutropha bacterium of any of claims 10-14, which comprises an AmoB1 or AmoB2 protein having (or gene encoding) a mutation relative to N. eutropha strain C91 at position 165, e.g., an I at position 165.
16. The preparation of N. eutropha bacterium of any of claims 10-15, which comprises an AmoC3 protein having (or gene encoding) a mutation relative to N. eutropha strain C91 at position 79, e.g., an A at position 79.
17. The preparation of N. eutropha bacterium of any of claims 10-16, which comprises an AmoC3 protein having (or gene encoding) a mutation relative to N. eutropha strain C91 at position 271, e.g., a V at position 271.
18. The preparation of N. eutropha bacterium of any of claims 10-17, which comprises a Hao1, Hao2, or Hao3 protein having (or gene encoding) a mutation relative to N. eutropha strain C91 at position 85, e.g., an S at position 85.
19. The preparation of N. eutropha bacterium of any of claims 10-18, which comprises a Hao1, Hao2, or Hao3 protein having (or gene encoding) a mutation relative to N. eutropha strain C91 at position 312, e.g., an E at position 312.
20. The preparation of N. eutropha bacterium of any of claims 10-19, which comprises a Hao1 protein having (or gene encoding) a mutation relative to N. eutropha strain C91 at position 163, e.g., an A at position 163.
21. The preparation of N. eutropha bacterium of any of claims 10-20, which comprises a c554 CycA1, c554 CycA2, or c554 CycA3 protein having (or gene encoding) a mutation relative to N. eutropha strain C91 at position 65, e.g., a T at position 65.
22. The preparation of N. eutropha bacterium of any of claims 10-21, which comprises a c554 CycA1 protein having (or gene encoding) a mutation relative to N. eutropha strain C91 at position 186, e.g., a T at position 186.
23. The preparation of N. eutropha bacterium of any of claims 10-22, which comprises a cM552 CycB1 or cM552 CycB2 protein having (or gene encoding) a mutation relative to N. eutropha strain C91 at position 63, e.g., a V at position 63.
24. The preparation of N. eutropha bacterium of any of claims 10-23, which comprises a cM552 CycB1 or cM552 CycB2 protein having (or gene encoding) a mutation relative to N. eutropha strain C91 at position 189, e.g., a P at position 189.
25. The preparation of N. eutropha bacterium of any of claims 10-24, which comprises a cM552 CycB1 or cM552 CycB2 protein having (or gene encoding) a mutation relative to N. eutropha strain C91 at position 206, e.g., an insE at position 206.
26. The preparation of N. eutropha bacterium of any of claims 10-25, which comprises a cM552 CycB1 or cM552 CycB2 protein having (or gene encoding) a mutation relative to N. eutropha strain C91 at position 207, e.g., an insE at position 207.
27. The preparation of N. eutropha bacterium of any of claims 10-26, which comprises a cM552 CycB1 protein having (or gene encoding) a mutation relative to N. eutropha strain C91 at position 195, e.g., an insD at position 195.
28. The preparation of N. eutropha bacterium of any of claims 10-27, which comprises a cM552 CycB1 protein having (or gene encoding) a mutation relative to N. eutropha strain C91 at position 196, e.g., an insD at position 196.
29. The preparation of N. eutropha bacterium of any of claims 10-28, which comprises a cM552 CycB1 protein having (or gene encoding) a mutation relative to N. eutropha strain C91 at position 197, e.g., an insD at position 197.
30. The preparation of N. eutropha bacterium of any of the preceding claims, which comprises at least one structural difference, e.g., at least one mutation, relative to a wild-type bacterium such as N. eutropha strain C91.
31. The preparation of N. eutropha bacterium of any of the preceding claims, which comprises a nucleic acid that can be amplified using a pair of primers described herein, e.g., a primer comprising a sequence of SEQ ID NO: 64 and a primer comprising a sequence of SEQ ID NO: 65.
32. The preparation of N. eutropha bacterium of any of the preceding claims, which comprises a nucleic acid or protein at least 80%, 85%, 90%, 95%, 98%, 99%, 99.5%, or 100% identical to a gene of FIG. 6 or a protein encoded by a gene of FIG. 6.
33. The preparation of N. eutropha bacterium of any of the preceding claims, which comprises a nucleic acid or protein at least 80%, 85%, 90%, 95%, 98%, 99%, 99.5%, or 100% identical to a sequence of any of SEQ ID NOS: 64-66 or a protein encoded by a sequence of any of SEQ ID NOS: 64-66.
34. An N. eutropha bacterium, or a purified preparation thereof, comprising a mutation in an ammonia monooxygenase gene, a hydroxylamine oxidoreductase gene, a cytochrome c554 gene, or a cytochrome cm552 gene relative to a wild-type bacterium such as N. eutropha strain C91.
35. The N. eutropha bacterium, or a purified preparation thereof, of claim 34, wherein said mutation is in the amoA1 gene.
36. The N. eutropha bacterium, or a purified preparation thereof, of claim 34, wherein said mutation is in the amoA2 gene.
37. The N. eutropha bacterium, or a purified preparation thereof, of claim 34, wherein said mutation is in the amoB1 gene.
38. The N. eutropha bacterium, or a purified preparation thereof, of claim 34, wherein said mutation is in the amoB2 gene.
39. The N. eutropha bacterium, or a purified preparation thereof, of claim 34, wherein said mutation is in the amoC3 gene.
40. The N. eutropha bacterium, or a purified preparation thereof, of any of claims 34-39, wherein said mutation is at a position described herein, e.g., in Table 2.
41. The N. eutropha bacterium, or a purified preparation thereof, of any of claims 34-39, wherein said mutation is a mutation described herein, e.g., in Table 2.
42. The N. eutropha bacterium, or a purified preparation thereof, of claim 34, wherein said mutation is in the hao1 gene.
43. The N. eutropha bacterium, or a purified preparation thereof, of claim 34, wherein said mutation is in the hao2 gene.
44. The N. eutropha bacterium, or a purified preparation thereof, of claim 34, wherein said mutation is in the hao3 gene.
45. The N. eutropha bacterium, or a purified preparation thereof, of any of claims 42-44, wherein said mutation is at a position described herein, e.g., in Table 2.
46. The N. eutropha bacterium, or a purified preparation thereof, of any of claims 42-44, wherein said mutation is a mutation described herein, e.g., in Table 2.
47. The N. eutropha bacterium, or a purified preparation thereof, of claim 34, wherein said mutation is in the c554 cycA1 gene.
48. The N. eutropha bacterium, or a purified preparation thereof, of claim 34, wherein said mutation is in the c554 cycA2 gene.
49. The N. eutropha bacterium, or a purified preparation thereof, of claim 34, wherein said mutation is in the c554 cycA3 gene.
50. The N. eutropha bacterium, or a purified preparation thereof, of any of claims 47-49, wherein said mutation is at a position described herein, e.g., in Table 2.
51. The N. eutropha bacterium, or a purified preparation thereof, of any of claims 47-49, wherein said mutation is a mutation described herein, e.g., in Table 2.
52. The N. eutropha bacterium, or a purified preparation thereof, of claim 34, wherein said mutation is in the cM552 cycB1 gene.
53. The N. eutropha bacterium, or a purified preparation thereof, of claim 34, wherein said mutation is in the c554 cycB2 gene.
54. The N. eutropha bacterium, or a purified preparation thereof, of any of claims 52-53, wherein said mutation is at a position described herein, e.g., in Table 2.
55. The N. eutropha bacterium, or a purified preparation thereof, of any of claims 52-53, wherein said mutation is a mutation described herein, e.g., in Table 2.
56. The purified preparation of optimized N. eutropha bacterium of claim 1, comprising a mutation in an ammonia monooxygenase gene, a hydroxylamine oxidoreductase gene, a cytochrome c554 gene, or a cytochrome cm552 gene.
57. The purified preparation of optimized N. eutropha bacterium of claim 56, wherein said mutation is in the amoA1 gene.
58. The purified preparation of optimized N. eutropha bacterium of claim 56, wherein said mutation is in the amoA2 gene.
59. The purified preparation of optimized N. eutropha bacterium of claim 56, wherein said mutation is in the amoB1 gene.
60. The purified preparation of optimized N. eutropha bacterium of claim 56, wherein said mutation is in the amoB2 gene.
61. The purified preparation of optimized N. eutropha bacterium of claim 56, wherein said mutation is in the amoC3 gene.
62. The purified preparation of optimized N. eutropha bacterium of any of claims 57-61, wherein said mutation is at a position described herein, e.g., in Table 2.
63. The purified preparation of optimized N. eutropha bacterium of any of claims 57-61, wherein said mutation is a mutation described herein, e.g., in Table 2.
64. The purified preparation of optimized N. eutropha bacterium of claim 56, wherein said mutation is in the hao1 gene.
65. The purified preparation of optimized N. eutropha bacterium of claim 56, wherein said mutation is in the hao2 gene.
66. The purified preparation of optimized N. eutropha bacterium of claim 56, wherein said mutation is in the hao3 gene.
67. The purified preparation of optimized N. eutropha bacterium of any of claims 64-66, wherein said mutation is at a position described herein, e.g., in Table 2.
68. The purified preparation of optimized N. eutropha bacterium of any of claims 64-66, wherein said mutation is a mutation described herein, e.g., in Table 2.
69. The purified preparation of optimized N. eutropha bacterium of claim 56, wherein said mutation is in the c554 cycA1 gene.
70. The purified preparation of optimized N. eutropha bacterium of claim 56, wherein said mutation is in the c554 cycA2 gene.
71. The purified preparation of optimized N. eutropha bacterium of claim 56, wherein said mutation is in the c554 cycA3 gene.
72. The purified preparation of optimized N. eutropha bacterium of any of claims 69-71, wherein said mutation is at a position described herein, e.g., in Table 2.
73. The purified preparation of optimized N. eutropha bacterium of any of claims 69-71, wherein said mutation is a mutation described herein, e.g., in Table 2.
74. The purified preparation of optimized N. eutropha bacterium of claim 56, wherein said mutation is in the cM552 cycB1 gene.
75. The purified preparation of optimized N. eutropha bacterium of claim 56, wherein said mutation is in the cM552 cycB2 gene.
76. The purified preparation of optimized N. eutropha bacterium of any of claims 56, 74, and 75, wherein said mutation is at a position described herein, e.g., in Table 2.
77. The purified preparation of optimized N. eutropha bacterium of any of claims 56, 74, and 75, wherein said mutation is a mutation described herein, e.g., in Table 2.
78. The N. eutropha bacterium, or a purified preparation thereof, of claim 34, which has a mutation in at least 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, or 35 positions of one or more of amoA1 gene, amoA2 gene, amoB1 gene, amoB2 gene, amoC3 gene, hao1 gene, hao2 gene, hao3 gene, c554 cycA1 gene, c554 cycA2 gene, c554 cycA3 gene, cM552 cycB1 gene, and c554 cycB2 gene.
79. The purified preparation of optimized N. eutropha bacterium of claim 56, which has a mutation in at least 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, or 35 positions of one or more of amoA1 gene, amoA2 gene, amoB1 gene, amoB2 gene, amoC3 gene, hao1 gene, hao2 gene, hao3 gene, c554 cycA1 gene, c554 cycA2 gene, c554 cycA3 gene, cM552 cycB1 gene, and c554 cycB2 gene.
80. A N. eutropha bacterium comprising a chromosome that hybridizes at high stringency to SEQ ID NO: 1.
81. The N. eutropha bacterium of claim 80, wherein the chromosome hybridizes at very high stringency to SEQ ID NO: 1.
82. The N. eutropha bacterium of claim 80 or 81, which comprises at least one of the genes of FIGS. 6-8, or a gene with at least 80% identity thereto.
83. The N. eutropha bacterium of claim 80 or 81, which comprises at least one of the genes of FIGS. 6-8.
84. The N. eutropha bacterium of any of claims 80-82, which lacks any plasmid that is at least about 80% identical to SEQ ID NO: 2 or SEQ ID NO: 3.
85. The N. eutropha bacterium of claim any of claims 80-84, which lacks any plasmid.
86. A N. eutropha bacterium comprising one or more of an AmoA1 gene at least about 98.9% identical to SEQ ID NO: 7 and an amoA2 gene at least about 98.8% identical to SEQ ID NO: 13.
87. A N. eutropha bacterium comprising one or more of an AmoA1 protein at least about 99.0% identical to SEQ ID NO: 6 and an AmoA2 protein at least about 99.0% identical to SEQ ID NO: 12.
88. A N. eutropha bacterium comprising one or more of an amoB1 gene at least about 99.2% identical to SEQ ID NO: 9 and an amoB2 gene at least about 99.2% identical to SEQ ID NO: 15.
89. The N. eutropha bacterium of claim 88, further comprising one or more of an AmoA1 or amoA2 gene at least about 98.9% identical to SEQ ID NO: 7 or 13.
90. An N. eutropha bacterium comprising one or more of an AmoB1 protein at least about 99.6% identical to SEQ ID NO: 8 or an AmoB1 protein at least about 99.6% identical to SEQ ID NO: 14.
91. The N. eutropha bacterium of claim 90, further comprising one or more of an AmoA1 protein at least about 99.0% identical to SEQ ID NO: 6 and an AmoA2 protein at least about 99.0% identical to SEQ ID NO: 12.
92. An N. eutropha bacterium comprising one or more of an amoC1 gene at least about 99.9% identical to SEQ ID NO: 5, an amoC2 gene at least about 99.9% identical to SEQ ID NO: 11, and an amoC3 gene at least about 99.0% identical to SEQ ID NO: 17.
93. The N. eutropha bacterium of claim 92, further comprising one or more of an amoA1 gene at least about 98.9% identical to SEQ ID NO: 7, an amo2 gene at least about 98.9% identical to SEQ ID NO: 13, an amoB1 gene at least about 99.2% identical to SEQ ID NO: 9, and an amoB2 gene at least about 99.2% identical to SEQ ID NO: 15.
94. A N. eutropha bacterium comprising an AmoC3 protein at least about 99.4% identical to SEQ ID NO: 16.
95. The N. eutropha bacterium of claim 94, further comprising one or more of an AmoA1 protein at least about 99.0% identical to SEQ ID NO: 6, an AmoA2 protein at least about 99.0% identical to SEQ ID NO: 12, an AmoB1 protein at least about 99.6% identical to SEQ ID NO: 8, and an AmoB1 protein at least about 99.6% identical to SEQ ID NO: 14.
96. A N. eutropha bacterium comprising one or more of a hao1 gene at least about 99.1% identical to SEQ ID NO: 19, a hao2 gene at least about 99.5% identical to SEQ ID NO: 21, and a hao3 gene at least about 99.3% identical to SEQ ID NO: 23.
97. The N. eutropha bacterium of claim 96, further comprising one or more of an amoA1 gene at least about 98.9% identical to SEQ ID NO: 7, an amo2 gene at least about 98.9% identical to SEQ ID NO: 13, an amoB1 gene at least about 99.2% identical to SEQ ID NO: 9, an amoB2 gene at least about 99.2% identical to SEQ ID NO: 15, an amoC1 gene at least about 99.9% identical to SEQ ID NO: 5, an amoC2 gene at least about 99.9% identical to SEQ ID NO: 11, and an amoC3 gene at least about 99.0% identical to SEQ ID NO: 17.
98. A N. eutropha bacterium comprising one or more of a Hao1 protein at least about 99.6% identical to SEQ ID NO: 18, a Hao2 protein at least about 99.7% identical to SEQ ID NO: 20, and a Hao3 protein at least about 99.7% identical to SEQ ID NO: 22.
99. The N. eutropha bacterium of claim 98, further comprising an AmoA1 protein at least about 99.0% identical to SEQ ID NO: 6, an AmoA2 protein at least about 99.0% identical to SEQ ID NO: 12, an AmoB1 protein at least about 99.6% identical to SEQ ID NO: 8, an AmoB1 protein at least about 99.6% identical to SEQ ID NO: 14, or an AmoC3 protein at least about 99.4% identical to SEQ ID NO: 16.
100. An N. eutropha bacterium comprising one or more of a cycA1 gene at least about 98.1% identical to SEQ ID NO: 25, a cycA2 gene at least about 98.8% identical to SEQ ID NO: 27, and a cycA3 gene at least about 99.4% identical to SEQ ID NO: 28.
101. The N. eutropha bacterium of claim 100, further comprising one or more of an amoA1 gene at least about 98.9% identical to SEQ ID NO: 7, an amo2 gene at least about 98.9% identical to SEQ ID NO: 13, an amoB1 gene at least about 99.2% identical to SEQ ID NO: 9, an amoB2 gene at least about 99.2% identical to SEQ ID NO: 15, an amoC1 gene at least about 99.9% identical to SEEQ ID NO: 5, an amoC2 gene at least about 99.9% identical to SEQ ID NO: 11, an amoC3 gene at least about 99.0% identical to SEQ ID NO: 17, a hao1 gene at least about 99.1% identical to SEQ ID NO: 19, a hao2 gene at least about 99.5% identical to SEQ ID NO: 21, and a hao3 gene at least about 99.3% identical to SEQ ID NO: 23.
102. An N. eutropha bacterium comprising one or more of a CycA1 protein at least about 99.2% identical to SEQ ID NO: 24, a CycA2 protein at least about 99.7% identical to SEQ ID NO: 26, and a CycA3 protein at least about 99.7% identical to SEQ ID NO: 28.
103. The N. eutropha bacterium of claim 102, further comprising one or more of an AmoA1 protein at least about 99.0% identical to SEQ ID NO: 6, an AmoA2 protein at least about 99.0% identical to SEQ ID NO: 12, an AmoB1 protein at least about 99.6% identical to SEQ ID NO: 8, an AmoB1 protein at least about 99.6% identical to SEQ ID NO: 14, an AmoC3 protein at least about 99.4% identical to SEQ ID NO: 16, a Hao1 protein at least about 99.6% identical to SEQ ID NO: 18, a Hao2 protein at least about 99.7% identical to SEQ ID NO: 20, and a Hao3 protein at least about 99.7% identical to SEQ ID NO: 22.
104. A N. eutropha bacterium comprising one or more of a cycB1 gene at least about 96.8% identical to SEQ ID NO: 31 and a cycB2 gene at least about 97.2% identical to SEQ ID NO: 33.
105. The N. eutropha bacterium of claim 104, further comprising one or more of an amoA1 gene at least about 98.9% identical to SEQ ID NO: 7, an amo2 gene at least about 98.9% identical to SEQ ID NO: 13, an amoB1 gene at least about 99.2% identical to SEQ ID NO: 9, an amoB2 gene at least about 99.2% identical to SEQ ID NO: 15, an amoC1 gene at least about 99.9% identical to SEQ ID NO: 5, an amoC2 gene at least about 99.9% identical to SEQ ID NO: 11, an amoC3 gene at least about 99.0% identical to SEQ ID NO: 17, a hao1 gene at least about 99.1% identical to SEQ ID NO: 19, a hao2 gene at least about 99.5% identical to SEQ ID NO: 21, a hao3 gene at least about 99.3% identical to SEQ ID NO: 23, a cycA1 gene at least about 98.1% identical to SEQ ID NO: 25, a cycA2 gene at least about 98.8% identical to SEQ ID NO: 27, and a cycA3 gene at least about 99.4% identical to SEQ ID NO: 28.
106. A N. eutropha bacterium comprising one or more of a CycB1 protein at least about 97.2% identical to SEQ ID NO: 30 or a CycB2 protein at least about 98.8% identical to SEQ ID NO: 32.
107. The N. eutropha bacterium of claim 106, further comprising one or more of an AmoA1 protein at least about 99.0% identical to SEQ ID NO: 6, an AmoA2 protein at least about 99.0% identical to SEQ ID NO: 12, an AmoB1 protein at least about 99.6% identical to SEQ ID NO: 8, an AmoB1 protein at least about 99.6% identical to SEQ ID NO: 14, an AmoC3 protein at least about 99.4% identical to SEQ ID NO: 16, a Hao1 protein at least about 99.6% identical to SEQ ID NO: 18, a Hao2 protein at least about 99.7% identical to SEQ ID NO: 20, a Hao3 protein at least about 99.7% identical to SEQ ID NO: 22, a CycA1 protein at least about 99.2% identical to SEQ ID NO: 24, a CycA2 protein at least about 99.7% identical to SEQ ID NO: 26, and a CycA3 protein at least about 99.7% identical to SEQ ID NO: 28.
108. A N. eutropha bacterium comprising one or more genes according to SEQ ID NOS: 5, 7, 9, 11, 13, 15, 17, 19, 21, 23, 25, 27, 29, 31, and 33.
109. A N. eutropha bacterium comprising one or more proteins according to SEQ ID NOS: 4, 6, 8, 10, 12, 14, 16, 18, 20, 22, 24, 26, 28, 30, and 32.
110. A N. eutropha bacterium comprising a protein that is mutant relative to N. eutropha strain C91 at at least 1, 2, 3, 4, 5, 10, 15, 20, 25, 30, or all of the amino acid positions listed in Table 2.
111. A N. eutropha bacterium comprising proteins that are mutant relative to N. eutropha strain C91 at all of the amino acid positions listed in Table 2.
112. The N. eutropha bacterium of any one of claims 1-111, which is transgenic.
113. The N. eutropha bacterium of any one of claims 80-112, having at least one property selected from an optimized growth rate, an optimized NH4+ oxidation rate, and an optimized resistance to NH4+.
114. The N. eutropha bacterium of claim 113, which has at least two properties selected from an optimized growth rate, an optimized NH4+ oxidation rate, and an optimized resistance to NH4+.
115. The N. eutropha bacterium of claim 113, which has an optimized growth rate, an optimized NH4+ oxidation rate, and an optimized resistance to NH4+.
116. A composition comprising the N. eutropha bacterium of any one of claims 1-115, wherein the composition is substantially free of other organisms.
117. A composition comprising the N. eutropha bacterium of one any of claims 1-115 and further comprising a second organism, wherein the composition is substantially free of other organisms.
118. The composition of claim 117, wherein the second organism is an ammonia oxidizing bacterium.
119. The composition of claim 117, wherein the second organism is selected from the group consisting of Nitrosomonas, Nitrosococcus, Nitrosospria, Nitrosocystis, Nitrosolobus, Nitrosovibrio, Lactobacillus, Streptococcus, and Bifidobacter, and combinations thereof.
120. A composition comprising a cell suspension of an actively dividing culture of N. eutropha bacteria having an OD600 of at least about 0.2, wherein the composition is substantially free of other organisms.
121. A composition for topical administration, comprising the N. eutropha bacterium of any one of claims 1-115 and a pharmaceutically or cosmetically acceptable excipient suitable for topical administration.
122. The composition of claim 121, which is substantially free of other organisms.
123. The composition of claim 121, further comprising a second organism.
124. The composition of claim 123, wherein the second organism is an ammonia oxidizing bacterium.
125. The composition of claim 123, wherein the second organism is selected from the group consisting of Nitrosomonas, Nitrosococcus, Nitrosospria, Nitrosocystis, Nitrosolobus, Nitrosovibrio, Lactobacillus, Streptococcus, and Bifidobacter, and combinations thereof.
126. The composition of any of claims 121-125, which is provided as or disposed in a powder, cosmetic, cream, stick, aerosol, salve, wipe, or bandage.
127. The composition of any of claims 121-126, which further comprises a moisturizing agent, deodorizing agent, scent, colorant, insect repellant, cleansing agent, or UV-blocking agent.
128. The composition of any of claims 121-127, wherein the excipient comprises an anti-adherent, binder, coat, disintegrant, filler, flavor, color, lubricant, glidant, sorbent, preservative, or sweetener.
129. The composition of any of claims 121-128, wherein the concentration of N. eutropha in the composition is about 1011-1012 CFU/L.
130. The composition of any of claims 121-129, wherein the concentration of N. eutropha in the composition is about 109 CFU/ml.
131. The composition of any of claims 121-130, wherein the mass ratio of N. eutropha to pharmaceutical excipient is in a range of about 0.1 grams per liter to about 1 gram per liter.
132. A composition comprising at least about 1,000 L at about 1012 CFUs/L of the N. eutropha bacterium of any one of claims 1-115.
133. A composition comprising at least about 1, 2, 5, 10, 20, 50, 100, 200, or 500 g of the N. eutropha bacterium of any one of claims 1-115, e.g., as a dry formulation such as a powder.
134. An article of clothing comprising the N. eutropha of any one of claims 1-115, e.g., at a concentration that provides one or more of a treatment or prevention of a skin disorder, a treatment or prevention of a disease or condition associated with low nitrite levels, a treatment or prevention of body odor, a treatment to supply nitric oxide to a subject, or a treatment to inhibit microbial growth.
135. The article of clothing of claim 134, which is packaged.
136. The article of clothing of claim 134-135, which is packaged in a material that is resistant to gaseous exchange or resistant to water.
137. A cloth comprising the N. eutropha of any one of claims 1-115.
138. A yarn comprising the N. eutropha of any one of claims 1-115.
139. A thread comprising the N. eutropha of any one of claims 1-115.
140. A method of obtaining, e.g., manufacturing, an N. eutropha bacterium having an optimized growth rate, an optimized NH4+ oxidation rate, or an optimized resistance to NH4+, comprising:
(a) culturing the bacterium under conditions that select for one or more of an optimized growth rate, an optimized NH4+ oxidation rate, or an optimized resistance to NH4+, thereby producing a culture;
(b) testing a sample from the culture for an optimized growth rate, an optimized NH4+ oxidation rate, or an optimized resistance to NH4+; and
(c) repeating the culturing and testing steps until a bacterium having an optimized growth rate, an optimized NH4+ oxidation rate, or an optimized resistance to NH4+ is obtained.
141. The method of claim 140, further comprising a step of obtaining an N. eutropha bacterium from a source.
142. The method of claim 141, wherein the source is soil or the skin of an individual.
143. The method of claim 142, wherein culturing the bacterium under conditions that select for one or more of an optimized growth rate, an optimized NH4+ oxidation rate, or an optimized resistance to NH4+ comprises culturing the bacterium in N. europae medium that comprises about 200 mM NH4+.
144. The method of claim 143, which comprises a step of creating an axenic culture.
145. The method of claim 143 or 144, which comprises a step of co-culturing the N. eutropha together with at least one other type of ammonia oxidizing bacteria.
146. The method of any of claims 140-145, wherein the N. eutropha of step (a) lack an optimized growth rate, an optimized NH4+ oxidation rate, and an optimized resistance to NH4+.
147. The method of any of claims 140-146, wherein step (c) comprises repeating the culturing and testing steps until a bacterium having at least two of an optimized growth rate, an optimized NH4+ oxidation rate, and an optimized resistance to NH4+ is obtained.
148. An N. eutropha bacterium produced by the method of any of claims 140-147.
149. A method of testing a preparation of N. eutropha, comprising:
assaying the N. eutropha for one or more of an optimized growth rate, an optimized NH4+ oxidation rate, or an optimized resistance to NH4+; and
if the N. eutropha has one or more of an optimized growth rate, an optimized NH4+ oxidation rate, or an optimized resistance to NH4+, classifying the N. eutropha as accepted.
150. The method of claim 149, further comprising a step of testing the preparation for contaminating organisms.
151. The method of any of claims 149-150, further comprising a step of removing a sample from the preparation and conducting testing on the sample.
152. The method of any of claims 149-151, further comprising testing medium in which the N. eutropha is cultured.
153. The method of any of claims 149-152, further comprising packaging N. eutropha from the preparation into a package.
154. The method of any of claims 149-153, further comprising placing N. eutropha from the preparation into commerce.
155. A method of producing, e.g., manufacturing N. eutropha, comprising contacting N. eutropha with culture medium and culturing the N. eutropha until an OD600 of at least about 0.5 is reached.
156. The method of claim 155, further comprising assaying the N. eutropha and culture medium for contaminating organisms.
157. The method of any of claims 155-156, further comprising assaying the N. eutropha for one or more of an optimized growth rate, an optimized NH4+ oxidation rate, or an optimized resistance to NH4+.
158. The method of any of claims 155-157, which comprises producing at least at least about 1,000 L per day at about 1012 CFUs/L of N. eutropha.
159. A method of producing, e.g., manufacturing, N. eutropha, comprising contacting N. eutropha with culture medium and culturing the N. eutropha until about at least about 1,000 L at about 1012 CFUs/L N. eutropha are produced.
160. The method of claim 159, further comprising a step of assaying the N. eutropha for one or more of an optimized growth rate, an optimized NH4+ oxidation rate, or an optimized resistance to NH4+.
161. The method of any of claims 159-160, further comprising a step of testing the N. eutropha or culture medium for contaminating organisms.
162. The method of any of claims 159-161, wherein the N. eutropha brought into contact with the culture medium is an N. eutropha having one or more of an optimized growth rate, an optimized NH4+ oxidation rate, or an optimized resistance to NH4+.
163. A method of producing, e.g., manufacturing N. eutropha, comprising:
(a) contacting N. eutropha with a culture medium; and
(b) culturing the N. eutropha for 1-2 days, thereby creating a culture, until the culture reaches an OD600 of about 0.5-0.6.
164. The method of claim 163, further comprising a step of assaying the N. eutropha for one or more of an optimized growth rate, an optimized NH4+ oxidation rate, or an optimized resistance to NH4+.
165. The method of any of claims 163-164, further comprising a step of testing the culture for contaminating organisms.
166. The method of any of claims 163-165, wherein the N. eutropha of step (a) is an N. eutropha having one or more of an optimized growth rate, an optimized NH4+ oxidation rate, or an optimized resistance to NH4+.
167. The method of any of claims 163-166, which comprises producing at least at least about 1,000 L per day at about 1012 CFUs/L of N. eutropha.
168. An N. eutropha bacterium produced by the method of any of claims 155-167.
169. A preparation of N. eutropha made by the method of any of claims 155-167.
170. The preparation of claim 169, wherein the preparation comprises at least about 0.1 to about 100 milligrams (mg) of N. eutropha.
171. A reaction mixture comprising N. eutropha at an optical density of about 0.5 to about 0.6.
172. A method of producing N. eutropha-bearing clothing, comprising contacting an article of clothing with of the N. eutropha of any one of claims 1-115.
173. The method of claim 172, which comprises producing at least 10, 100, or 1000 articles of clothing.
174. The method of claim 172, which comprises contacting the article of clothing with at least 1010 CFUs of N. eutropha.
175. The method of claim 172, further comprising packaging the clothing.
176. A method of obtaining a formulation of N. eutropha, combining contacting N. eutropha of any of claims 1-115 with a pharmaceutically or cosmetically acceptable excipient.
177. The method of claim 176, further comprising mixing the N. eutropha and the excipient.
178. The method of claim 176, which is performed under conditions that are substantially free of contaminating organisms.
179. A method of packaging N. eutropha, comprising assembling N. eutropha of any of claim 1-115 into a package.
180. The method of claim 179, wherein the package is resistant to gaseous exchange or resistant to water.
181. The method of claim 179, wherein the package is permeable to gaseous exchange, NH3, NH4+, or NO2−.
182. A method of inhibiting microbial growth on a subject's skin, comprising topically administering to a subject in need thereof an effective dose of the N. eutropha bacteria of any one of claims 1-115.
183. The method of claim 182, wherein the effective dose is approximately 1.5×1010 CFU.
184. The method of any of claims 182-183, wherein the administration is performed twice per day.
185. The method of any of claims 182-184, wherein the subject is a human.
186. The method of any of claims 182-185, wherein the microbial growth to be inhibited is growth of Pseudomonas aeruginosa, Staphylococcus aureus, Streptococcus pyogenes, or Acinetobacter baumannii.
187. A method of supplying nitric oxide to a subject, comprising positioning an effective dose of the N. eutropha bacteria of any one of claims 1-115 in close proximity to the subject.
188. A method of reducing body odor, comprising topically administering to a subject in need thereof an effective dose of the N. eutropha bacteria of any one of claims 1-115.
189. A method of treating a disease associated with low nitrite levels, comprising topically administering to a subject in need thereof a therapeutically effective dose of the N. eutropha bacteria of any of claims 1-115.
190. The method of claim 189, wherein the disease is HIV dermatitis, infection in a diabetic foot ulcer, atopic dermatitis, acne, e.g., acne vulgaris, eczema, contact dermatitis, allergic reaction, psoriasis, skin infections, vascular disease, vaginal yeast infection, a sexually transmitted disease, heart disease, atherosclerosis, baldness, leg ulcers secondary to diabetes or confinement to bed, angina, particularly chronic, stable angina pectoris, ischemic diseases, congestive heart failure, myocardial infarction, ischemia reperfusion injury, laminitis, hypertension, hypertrophic organ degeneration, Raynaud's phenomenon, fibrosis, fibrotic organ degeneration, allergies, autoimmune sensitization, end stage renal disease, obesity, impotence, or cancer.
191. A method of treating a skin disorder, comprising topically administering to a subject in need thereof a therapeutically effective dose of the N. eutropha bacteria of any of claims 1-115.
192. The method of claim 191, wherein the skin disorder is acne, e.g., acne vulgaris, rosacea, eczema, or psoriasis.
193. The method of claim 191, wherein the skin disorder is an ulcer, e.g., venous ulcer, e.g., leg ulcer, e.g., venous leg ulcer, e.g., infection in a diabetic foot ulcer.
194. The method of any one of claims 191-193, wherein topically administering comprises pre-treating the subject with N. eutropha, e.g., an N. eutropha of any of claims 1-115.
195. The method of any one of claims 191-194, wherein topically administering comprises topically administering prior to occurrence of the skin disorder.
196. The method of any one of claims 191-195, wherein topically administering comprises topically administering subsequent to occurrence of the skin disorder.
197. A method of promoting wound healing or closure, comprising administering to a wound an effective dose of the N. eutropha bacteria of any of claims 1-115.
198. The method of claim 197, wherein the wound comprises one or more undesirable bacteria, e.g., pathogenic bacteria.
199. The method of claim 197, wherein the wound comprises Staphylococcus aureus, Pseudomonas aeruginosa, or Acinetobacter baumannii.
200. The method of claim 197, wherein the N. eutropha is administered to the subject prior to occurrence of the wound.
201. The method of claim 197, wherein administering to the wound comprises administering to the subject prior to occurrence of the wound.
202. The method of any one of claims 197-201, further comprising administering N. eutropha to the wound subsequent to occurrence of the wound.
203. A method of killing or inhibiting growth of pathogenic bacteria comprising contacting, e.g., applying, N. eutropha bacteria, e.g., an N. eutropha bacterium of any of claims 1-115, to the skin.
204. The method of claim 203, wherein the pathogenic bacteria contribute to one or more of the following conditions: HIV dermatitis, an ulcer, e.g., venous ulcer, e.g., leg ulcer, e.g., venous leg ulcer, e.g., infection in a diabetic foot ulcer, atopic dermatitis, acne, e.g., acne vulgaris, eczema, contact dermatitis, allergic reaction, psoriasis, uticaria, rosacea, skin infections, vascular disease, vaginal yeast infection, a sexually transmitted disease, heart disease, atherosclerosis, baldness, leg ulcers secondary to diabetes or confinement to bed, angina, particularly chronic, stable angina pectoris, ischemic diseases, congestive heart failure, myocardial infarction, ischemia reperfusion injury, laminitis, hypertension, hypertrophic organ degeneration, Raynaud's phenomenon, fibrosis, fibrotic organ degeneration, allergies, autoimmune sensitization, end stage renal disease, obesity, impotence, pneumonia, primary immunodeficiency, epidermal lysis bulosa, or cancer.
205. The method of claim 204, wherein the condition is an ulcer, e.g., venous ulcer, e.g., leg ulcer, e.g., venous leg ulcer, e.g., infection in a diabetic foot ulcer.
206. The method of claim 204, wherein the condition is a venous leg ulcer.
207. The method of claim 204, wherein the condition is acne, e.g., acne vulgaris.
208. The method of claim 204, wherein the condition is acne vulgaris.
209. The method of any one of claims 203-208, wherein the pathogenic bacteria is one or more of Propionibacterium acnes, Pseudomonas aeruginosa, Staphylococcus aureus, Streptococcus pyogenes, or Acinetobacter baumannii.
210. The method of any one of claims 203-209, further comprising determining whether the subject is in need of killing or inhibiting growth of pathogenic bacteria, e.g., determining that the subject is in need of killing or inhibiting growth of pathogenic bacteria.
211. The method of any one of claims 203-210, further comprising selecting the subject in need of killing or inhibiting growth of pathogenic bacteria.
212. A method of changing a composition of a skin microbiome of a subject comprising:
administering, e.g., applying, a preparation comprising ammonia oxidizing bacteria to a surface of the skin,
wherein the amount and frequency of administration, e.g., application, is sufficient to reduce the proportion of pathogenic bacteria on the surface of the skin.
213. The method of claim 212, further comprising, selecting the subject on the basis of the subject being in need of a reduction in the proportion of pathogenic bacteria on the surface of the skin.
214. The method of any one of claims 212-213, wherein the preparation comprises at least one of ammonia, ammonium salts, and urea.
215. The method of any one of claims 212-214, wherein the preparation comprises a controlled release material, e.g., slow release material.
216. The method of any one of claims 212-215, wherein the preparation of ammonia oxidizing bacteria, further comprises an excipient, e.g., one of a pharmaceutically acceptable excipient or a cosmetically acceptable excipient.
217. The method of claim 216, wherein the excipient, e.g., one of the pharmaceutically acceptable excipient and the cosmetically acceptable excipient, is suitable for one of topical, nasal, pulmonary, and gastrointestinal administration.
218. The method of any one of claims 216-217, wherein the excipient, e.g., one of the pharmaceutically acceptable excipient and the cosmetically acceptable excipient, is a surfactant.
219. The method of claim 218, wherein the surfactant is selected from the group consisting of cocamidopropyl betaine (ColaTeric COAB), polyethylene sorbitol ester (e.g., Tween 80), ethoxylated lauryl alcohol (RhodaSurf 6 NAT), sodium laureth sulfate/lauryl glucoside/cocamidopropyl betaine (Plantapon 611 L UP), sodium laureth sulfate (e.g., RhodaPex ESB 70 NAT), alkyl polyglucoside (e.g., Plantaren 2000 N UP), sodium laureth sulfate (Plantaren 200), Dr. Bronner's Castile soap, Lauramine oxide (ColaLux Lo), sodium dodecyl sulfate (SDS), polysulfonate alkyl polyglucoside (PolySufanate 160 P), sodium lauryl sulfate (Stepanol-WA Extra K), and any combination thereof.
220. The method of any one of claims 212-219, wherein the preparation is substantially free of other organisms.
221. The method of any one of claims 212-220, wherein the preparation is disposed in a powder, cosmetic, cream, stick, aerosol, salve, wipe, or bandage.
222. The method of any one of claims 212-221, wherein the preparation is provided as a powder, cosmetic, cream, stick, aerosol, salve, wipe, or bandage.
223. The method of any one of claims 212-222, wherein the preparation comprises a moisturizing agent, deodorizing agent, scent, colorant, insect repellant, cleansing agent, or UV-blocking agent.
224. The method of any one of claims 216-217, wherein the excipient, e.g., the pharmaceutically acceptable excipient or the cosmetically acceptable excipient, comprises an anti-adherent, binder, coat, disintegrant, filler, flavor, color, lubricant, glidant, sorbent, preservative, or sweetener.
225. The method of any one of claims 212-224, wherein the preparation comprising ammonia oxidizing bacteria comprises about 108 to about 1014 CFU/L.
226. The method of claim 225, wherein the preparation comprises between about 1×109 CFU/L to about 10×109 CFU/L.
227. The method of any one of claims 212-226, wherein the preparation comprising ammonia oxidizing bacteria comprises between about 50 milligrams (mg) and about 1000 mg of ammonia oxidizing bacteria.
228. The method of any one of claims 216-227, wherein the mass ratio of ammonia oxidizing bacteria to the excipient, e.g., the pharmaceutically acceptable excipient or the cosmetically acceptable excipient is in a range of about 0.1 grams per liter to about 1 gram per liter.
229. The method of any one of claims 212-228, wherein the preparation of ammonia oxidizing bacteria are useful for treating or preventing a skin disorder, a treatment or prevention of a disease or condition associated with low nitrite levels, a treatment or prevention of body odor, a treatment to supply nitric oxide to a subject, or a treatment to inhibit microbial growth, e.g., pathogenic bacterial growth.
230. The method of any one of claims 212-229, wherein the ammonia oxidizing bacteria is selected from the group consisting of Nitrosomonas, Nitrosococcus, Nitrosospria, Nitrosocystis, Nitrosolobus, Nitrosovibrio, and combinations thereof.
231. The method of any one of claims 212-230, wherein the preparation comprises an organism selected from the group consisting of Lactobacillus, Streptococcus, Bifidobacter, and combinations thereof.
232. The method of any one of claims 212-230, wherein the preparation is substantially free of organisms other than ammonia oxidizing bacteria.
233. The method of any one of claims 212-232, wherein the preparation of ammonia oxidizing bacteria comprises ammonia oxidizing bacteria in a growth state.
234. The method of any one of claims 212-232, wherein the preparation of ammonia oxidizing bacteria comprises ammonia oxidizing bacteria in a storage state.
235. The method of any one of claims 212-234, to deliver a cosmetic product.
236. The method of any one of claims 212-234, to deliver a therapeutic product.
237. The method of any one of claims 212-236, wherein the preparation is useful for treatment of at least one of HIV dermatitis, infection in a diabetic foot ulcer, atopic dermatitis, acne, e.g., acne vulgaris, eczema, contact dermatitis, allergic reaction, psoriasis, uticaria, rosacea, skin infections, vascular disease, vaginal yeast infection, a sexually transmitted disease, heart disease, atherosclerosis, baldness, leg ulcers secondary to diabetes or confinement to bed, angina, particularly chronic, stable angina pectoris, ischemic diseases, congestive heart failure, myocardial infarction, ischemia reperfusion injury, laminitis, hypertension, hypertrophic organ degeneration, Raynaud's phenomenon, fibrosis, fibrotic organ degeneration, allergies, autoimmune sensitization, end stage renal disease, obesity, impotence, pneumonia, primary immunodeficiency, epidermal lysis bulosa, or cancer.
238. The method of claim 237, wherein the preparation is useful for treatment of at least one of acne, e.g., acne vulgaris, eczema, psoriasis, uticaria, rosacea, and skin infections.
239. The method of any one of claims 212-238, wherein the preparation is provided in a container, the preparation and the container having a weight of less than about 50, 100, 200, 300, 400, 500, 600, 700, 800, 900, 1000, 1500, or 2000 grams.
240. The method of any one of claims 212-239, wherein the preparation has less than about 0.1% to about 10% of surfactant.
241. The method of any one of claims 212-240, wherein the preparation is substantially free of surfactant.
242. The method of any one of claims 212-241, wherein the preparation comprises a chelator.
243. The method of any one of claims 212-242, wherein the preparation is applied about 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, or 24 times per day.
244. The method of any one of claims 212-243, wherein the preparation is applied one time per day.
245. The method of any one of claims 212-243, wherein the preparation is applied two times per day.
246. The method of any one of claims 212-245, wherein the preparation is applied for about 1-3, 3-5, 5-7, 7-9, 5-10, 10-14, 12-18, 12-21, 21-28, 28-35, 35-42, 42-49, 49-56, 46-63, 63-70, 70-77, 77-84, or 84-91 days.
247. The method of any one of claims 212-246, wherein the preparation is applied for about 16 days.
248. The method of any one of claims 212-247 further comprising obtaining a sample from the surface of the skin.
249. The method of claim 248, further comprising isolating DNA of bacteria in the sample.
250. The method of any one of claims 248-249, further comprising sequencing DNA of bacteria in the sample.
251. The method of any one of claims 212-250, wherein administering the ammonia oxidizing bacteria provides for an increase in the proportion of non-pathogenic bacteria on the surface.
252. The method of claim 251, wherein the non-pathogenic bacteria is commensal non-pathogenic bacteria.
253. The method of claim 252, wherein the non-pathogenic bacteria is commensal non-pathogenic bacteria of the genus Staphylococcus.
254. The method of claim 253, wherein the non-pathogenic bacteria is commensal non-pathogenic bacteria Staphylococcus epidermidis.
255. The method of any one of claims 252-254, wherein the non-pathogenic bacteria of the genus Staphylococcus is, or is identified as being, increased after about 2 weeks.
256. The method of claim 255, wherein the non-pathogenic bacteria Staphylococcus epidermidis is, or is identified as being, increased after about 2 weeks.
257. The method of any one of claims 212-256, wherein potentially pathogenic or disease associated Propionibacteria is, or is identified as being, reduced after about 2 weeks.
258. The method of any one of claims 212-257, wherein potentially pathogenic or disease associated Stenotrophomonas is, or is identified as being, reduced after about 2 weeks.
259. The method of any one of claims 212-258, wherein the surface of the skin comprises a wound.
260. A method of treating acne e.g., acne vulgaris, by the method of any one of claims 212-259.
261. A method of treating eczema by the method of any one of claims 212-259.
262. A method of treating psoriasis by the method of any one of claims 212-259.
263. A method of treating uticaria by the method of any one of claims 212-259.
264. A method of treating rosacea by the method of any one of claims 212-259.
265. A method of treating a skin infection by the method of any one of claims 212-259.
266. A method of reducing an amount of undesirable bacteria on a surface of a subject by the method of any one of claims 212-258.
267. A nucleic acid comprising a sequence of 15-100 consecutive nucleotides from within SEQ ID NO: 66, or a reverse complement thereof, provided that the nucleic acid has a non-naturally occurring sequence, or another modification, e.g., a label, or both.
268. The nucleic acid of claim 267, wherein the sequence of 15-100 consecutive nucleotides is a sequence not found in N. Eutropha strain C91.
269. The nucleic acid of claim 267 or 268, further comprising a heterologous sequence 5′ to the sequence of 15-100 consecutive nucleotides from within SEQ ID NO: 66.
270. The nucleic acid of claim 267 or 268, further comprising a heterologous sequence 3′ to the sequence of 15-100 consecutive nucleotides from within SEQ ID NO: 66.
271. The nucleic acid of claim 267 or 268, further comprising a first heterologous sequence 5′ to the sequence of 15-100 consecutive nucleotides from within SEQ ID NO: 66 and a second heterologous sequence 3′ to the sequence of 15-100 consecutive nucleotides from within SEQ ID NO: 66.
272. The nucleic acid of any of claims 267-271, which has a length of 15-20, 20-25, 25-30, 30-24, or 25-40 nucleotides.
273. The nucleic acid of any of claims 267-272, which is bound, e.g., covalently bound, to a detectable label, e.g., a fluorescent label.
274. A composition comprising:
a first nucleic acid comprising 15-100 consecutive nucleotides from within SEQ ID NO: 66; and
a second nucleic acid comprising 15-100 consecutive nucleotides from within a reverse complement of SEQ ID NO: 66,
provided that the first nucleic acid or the second nucleic acid or both has a non-naturally occurring sequence or a modification such as a label, or both.
275. The composition of claim 274, wherein the first nucleic acid, the second nucleic acid, or each of the first nucleic acid and second nucleic acid does not comprise a sequence found in N. Eutropha strain C91.
276. The composition of claim 274 or 275, wherein the first nucleic acid, the second nucleic acid, or each of the first nucleic acid and second nucleic acid further comprises a heterologous sequence 5′ to the sequence of 15-100 consecutive nucleotides from within SEQ ID NO: 66.
277. The composition of any of claims 274-276, wherein the first nucleic acid, the second nucleic acid, or each of the first nucleic acid and second nucleic acid further comprises a heterologous sequence 3′ to the sequence of 15-100 consecutive nucleotides from within SEQ ID NO: 66.
278. The composition of any of claims 274-277, wherein the first nucleic acid, the second nucleic acid, or each of the first nucleic acid and second nucleic acid has a length of 15-20, 20-25, 25-30, 30-24, or 25-40 nucleotides.
279. The composition of any of claims 274-278, wherein the first nucleic acid, the second nucleic acid, or each of the first nucleic acid and second nucleic acid is bound, e.g., covalently bound, to a detectable label, e.g., a fluorescent label.
280. A nucleic acid consisting of the sequence AATCTGTCTCCACAGGCAGC (SEQ ID NO: 64).
281. A nucleic acid consisting of the sequence TATACCCACCACCCACGCTA (SEQ ID NO: 65).
282. A molecule comprising the nucleic acid of claim 280 or 281 and a detectable label, e.g., a fluorescent label.
283. A composition comprising a first nucleic acid consisting of the sequence AATCTGTCTCCACAGGCAGC (SEQ ID NO: 64) and a second nucleic acid consisting of the sequence TATACCCACCACCCACGCTA (SEQ ID NO: 65).
284. A composition comprising:
a first molecule comprising (i) a first nucleic acid consisting of the sequence AATCTGTCTCCACAGGCAGC (SEQ ID NO: 64) and optionally comprising (ii) a detectable label, e.g., a fluorescent label; and
a second molecule comprising (i) a second nucleic acid consisting of the sequence TATACCCACCACCCACGCTA (SEQ ID NO: 65) and optionally comprising (ii) a detectable label, e.g., a fluorescent label.
285. A method of detecting whether a D23 N. eutropha nucleic acid is present in a sample, comprising:
performing a polymerase chain reaction (PCR) on the sample using primers specific to N. eutropha D23, and
determining whether a PCR product is produced, wherein the presence of a PCR product indicates that the D23 N. eutropha nucleic acid was present in the sample.