Patent application title:

AMMONIA-OXIDIZING NITROSOMONAS EUTROPHA STRAIN D23

Publication number:

US20170037363A1

Publication date:
Application number:

15/304,151

Filed date:

2015-04-15

Abstract:

This disclosure provides, inter alia, an optimized strain of Nitrosomonas eutropha (N. eutropha) designated D23, D23-100, or AOB D23-100. N. eutropha bacteria disclosed in this application have desirable properties, e.g., optimized properties, such as the ability to suppress growth of pathogenic bacteria, and an enhanced ability to produce nitric oxide and nitric oxide precursors. The N. eutropha herein may be used, for instance, to treat diseases associated with low nitrite levels, skin diseases, and diseases caused by pathogenic bacteria.

Inventors:

Interested in similar patents?

Get notified when new applications in this technology area are published.

Classification:

C12N1/20 »  CPC main

Microorganisms, e.g. protozoa; Compositions thereof ; Processes of propagating, maintaining or preserving microorganisms or compositions thereof; Processes of preparing or isolating a composition containing a microorganism; Culture media therefor Bacteria; Culture media therefor

A61K35/747 »  CPC further

Medicinal preparations containing materials or reaction products thereof with undetermined constitution; Microorganisms or materials therefrom; Bacteria; Probiotics; Lactic acid bacteria, e.g. enterococci, pediococci, lactococci, streptococci or leuconostocs Lactobacilli, e.g. L. acidophilus or L. brevis

A61K35/744 »  CPC further

Medicinal preparations containing materials or reaction products thereof with undetermined constitution; Microorganisms or materials therefrom; Bacteria; Probiotics Lactic acid bacteria, e.g. enterococci, pediococci, lactococci, streptococci or leuconostocs

C12Q1/02 »  CPC further

Measuring or testing processes involving enzymes, nucleic acids or microorganisms ; Compositions therefor; Processes of preparing such compositions involving viable microorganisms

A61K8/99 »  CPC further

Cosmetics or similar toilet preparations characterised by the composition containing materials, or derivatives thereof of undetermined constitution from microorganisms other than algae or fungi, e.g. protozoa or bacteria

A61Q17/04 »  CPC further

Barrier preparations; Preparations brought into direct contact with the skin for affording protection against external influences, e.g. sunlight, X-rays or other harmful rays, corrosive materials, bacteria or insect stings Topical preparations for affording protection against sunlight or other radiation; Topical sun tanning preparations

A01N63/00 »  CPC further

Biocides, pest repellants or attractants, or plant growth regulators containing microorganisms, viruses, microbial fungi, animals or substances produced by, or obtained from, microorganisms, viruses, microbial fungi or animals, e.g. enzymes or fermentates

A61K35/74 »  CPC further

Medicinal preparations containing materials or reaction products thereof with undetermined constitution; Microorganisms or materials therefrom Bacteria

A61K35/745 »  CPC further

Medicinal preparations containing materials or reaction products thereof with undetermined constitution; Microorganisms or materials therefrom; Bacteria; Probiotics; Lactic acid bacteria, e.g. enterococci, pediococci, lactococci, streptococci or leuconostocs Bifidobacteria

Description

This application claims priority to Greek Patent Application Number 20140100217, filed Apr. 15, 2014, U.S. Provisional Application No. 62/002,084, filed May 22, 2014, U.S. Provisional Application No. 62/012,811, filed Jun. 16, 2014, U.S. Provisional Application No. 62/053,588, filed Sep. 22, 2014, and Greek Patent Application Number 20150100115, filed Mar. 13, 2015, the contents of which are incorporated herein by reference in their entireties.

SEQUENCE LISTING

The instant application contains a Sequence Listing which has been submitted electronically in ASCII format and is hereby incorporated by reference in its entirety. Said ASCII copy, created on Apr. 13, 2015, is named N2060-7001WO.txt and is 3,590,980 bytes in size.

BACKGROUND

Beneficial bacteria can be used to suppress the growth of pathogenic bacteria. Bacteria and other microorganisms are ubiquitous in the environment. The discovery of pathogenic bacteria and the germ theory of disease have had a tremendous effect on health and disease states. Bacteria are a normal part of the environment of all living things. In the gut, these bacteria are not pathogenic under normal conditions, and in fact improve health by rendering the normal intestinal contents less hospitable for disease causing organisms. Disease prevention is accomplished in a number of ways: nutrients are consumed, leaving less for pathogens; conditions are produced, such as pH and oxygen tension, which are not hospitable for pathogens; compounds are produced that are toxic to pathogens; pathogens are consumed as food by these microorganisms; less physical space remains available for pathogens; and specific binding sites are occupied leaving fewer binding sites available for pathogens. The presence of these desirable bacteria is seen as useful in preventing disease states.

There is a need in the art for improved beneficial bacteria that can suppress the growth of pathogenic bacteria.

SUMMARY

This disclosure provides, inter alia, an optimized strain of Nitrosomonas eutropha (N. eutropha) designated D23, D23-100 or AOB D23-100, the terms which may be used interchangeably throughout the disclosure.

Ammonia oxidizing bacterial of the genus Nitrosomonas are ubiquitous Gram-negative obligate chemolithoautotrophic bacteria with a unique capacity to generate energy exclusively from the conversion of ammonia to nitrite.

N. eutropha bacteria disclosed in this application have desirable, e.g. optimized, properties such as the ability to suppress growth of pathogenic bacteria, and an enhanced ability to produce nitric oxide (NO) and nitric oxide (NO2) precursors. The N. eutropha, e.g., optimized N. eutropha, e.g., purified preparations of optimized N. eutropha herein may be used, for instance, to treat diseases, e.g., diseases associated with low nitrite levels, skin disorders, and diseases caused by pathogenic bacteria. When referring to N. eutropha throughout the disclosure, it may be referring to an optimized strain of N. eutropha or a purified preparation of optimized N. eutropha.

The present disclosure provides, inter alia, a Nitrosomonas eutropha (N. eutropha) bacterium, e.g., an optimized N. eutropha, e.g., a purified preparation of optimized N. eutropha, having at least one property selected from:

    • an optimized growth rate;
    • an optimized NH4+ oxidation rate; and
    • an optimized resistance to ammonium ion (NH4+).

The bacterium is optionally axenic.

In embodiments, the optimized growth rate is a rate allowing a continuous culture of N. eutropha at an OD600 (optical density at 600 nm) of about 0.15-0.18 to reach an OD600 of about 0.5-0.6 in about 1-2 days. In embodiments, optimized growth rate is a doubling time of about 8 hours when cultured under batch culture conditions. In embodiments, the optimized NH4+ oxidation rate is a rate of at least about 125 micromoles per minute of oxidizing NH4+ to NO2. In embodiments, the optimized resistance to NH4+ is an ability to grow in medium comprising about 200 mM NH4+ for at least about 48 hours.

In some embodiments, the purified preparation of optimized N. eutropha bacterium (which is optionally axenic) has at least two properties selected from an optimized growth rate, an optimized NH4+ oxidation rate, and an optimized resistance to NH4+. In some embodiments, the purified preparation of optimized N. eutropha bacterium (which is optionally axenic) has an optimized growth rate, an optimized NH4+ oxidation rate, and an optimized resistance to NH4+. In some embodiments, the purified preparation of optimized N. eutropha bacterium (which is optionally axenic) comprises a chromosome that hybridizes under very high stringency to SEQ ID NO: 1.

In some embodiments, the purified preparation of optimized N. eutropha bacterium (which is optionally axenic) comprises an AmoA protein having an identity to SEQ ID NO: 6 or 12 selected from at least about 80%, 85%, 90%, 95%, 98%, 99%, 99.5%, and 100% identical, an AmoB protein having an identity to SEQ ID NO: 8 or 14 selected from at least about 80%, 85%, 90%, 95%, 98%, 99%, 99.5%, and 100% identical, an amoC gene having an identity to SEQ ID NO: 4, 10, or 16 selected from at least about 80%, 85%, 90%, 95%, 98%, 99%, 99.5%, and 100% identical, a hydroxylamine oxidoreductase protein having an identity to SEQ ID NO: 18, 20, or 22 selected from at least 80%, 85%, 90%, 95%, 98%, 99%, 99.5%, and 100% identical, a cytochrome c554 protein having an identity to SEQ ID NO: 24, 26, or 28 selected from at least about 80%, 85%, 90%, 95%, 98%, 99%, 99.5%, and 100% identical, or a cytochrome cM552 protein having an identity to SEQ ID NO: 30 or 32 selected from at least about 80%, 85%, 90%, 95%, 98%, 99%, 99.5%, and 100% identical.

In some embodiments, the purified preparation of optimized N. eutropha bacterium (which is optionally axenic) comprises 1-5, 5-10, 10-15, 15-20, 20-25, 25-30, or all of the sequence characteristics of Table 2. For instance, in some embodiments, the bacterium or preparation comprises an AmoA1 or AmoA2 protein having (or gene encoding) a mutation relative to N. eutropha strain C91 at position 1, e.g., a V at position 1. In some embodiments, the bacterium or preparation comprises an AmoA1 or AmoA2 protein having (or gene encoding) a mutation relative to N. eutropha strain C91 at position 160, e.g., an L at position 160. In some embodiments, the bacterium or preparation comprises an AmoA1 or AmoA2 protein having (or gene encoding) a mutation relative to N. eutropha strain C91 at position 167, e.g., an A at position 167. In some embodiments, the bacterium or preparation comprises an AmoB1 or AmoB2 protein having (or gene encoding) a mutation relative to N. eutropha strain C91 at position 33, e.g., a V at position 33. In some embodiments, the bacterium or preparation comprises an AmoB1 or AmoB2 protein having (or gene encoding) a mutation relative to N. eutropha strain C91 at position 165, e.g., an I at position 165. In some embodiments, the bacterium or preparation comprises an AmoC3 protein having (or gene encoding) a mutation relative to N. eutropha strain C91 at position 79, e.g., an A at position 79. In some embodiments, the bacterium or preparation comprises an AmoC3 protein having (or gene encoding) a mutation relative to N. eutropha strain C91 at position 271, e.g., a V at position 271. In some embodiments, the bacterium or preparation comprises a Hao1, Hao2, or Hao3 protein having (or gene encoding) a mutation relative to N. eutropha strain C91 at position 85, e.g., an S at position 85. In some embodiments, the bacterium or preparation comprises a Hao1, Hao2, or Hao3 protein having (or gene encoding) a mutation relative to N. eutropha strain C91 at position 312, e.g., an E at position 312. In some embodiments, the bacterium or preparation comprises a Hao1 protein having (or gene encoding) a mutation relative to N. eutropha strain C91 at position 163, e.g., an A at position 163. In some embodiments, the bacterium or preparation comprises a c554 CycA1, c554 CycA2, or c554 CycA3 protein having (or gene encoding) a mutation relative to N. eutropha strain C91 at position 65, e.g., a T at position 65. In some embodiments, the bacterium or preparation comprises a c554 CycA1 protein having (or gene encoding) a mutation relative to N. eutropha strain C91 at position 186, e.g., a T at position 186. In some embodiments, the bacterium or preparation comprises a cM552 CycB1 or cM552 CycB2 protein having (or gene encoding) a mutation relative to N. eutropha strain C91 at position 63, e.g., a V at position 63. In some embodiments, the bacterium or preparation comprises a cM552 CycB1 or cM552 CycB2 protein having (or gene encoding) a mutation relative to N. eutropha strain C91 at position 189, e.g., a P at position 189. In some embodiments, the bacterium or preparation comprises a cM552 CycB1 or cM552 CycB2 protein having (or gene encoding) a mutation relative to N. eutropha strain C91 at position 206, e.g., an insE at position 206. In some embodiments, the bacterium or preparation comprises a cM552 CycB1 or cM552 CycB2 protein having (or gene encoding) a mutation relative to N. eutropha strain C91 at position 207, e.g., an insE at position 207. In some embodiments, the bacterium or preparation comprises a cM552 CycB1 protein having (or gene encoding) a mutation relative to N. eutropha strain C91 at position 195, e.g., an insD at position 195. In some embodiments, the bacterium or preparation comprises a cM552 CycB1 protein having (or gene encoding) a mutation relative to N. eutropha strain C91 at position 196, e.g., an insD at position 196. In some embodiments, the bacterium or preparation comprises a cM552 CycB1 protein having (or gene encoding) a mutation relative to N. eutropha strain C91 at position 197, e.g., an insD at position 197.

Combinations of two or more sequence characteristics of Table 2 are also described. The two or more sequence characteristics may be in the same gene or different genes. The two or more sequence characteristics may be in the same protein or different proteins. For instance, in some embodiments, the bacterium or preparation comprises an AmoA1 or AmoA2 protein having (or gene encoding) a mutation relative to N. eutropha strain C91 at position 1, e.g., a V at position 1 and a mutation relative to N. eutropha strain C91 at position 160, e.g., an L at position 160. In some embodiments, the bacterium or preparation comprises an AmoA1 or AmoA2 protein having (or gene encoding) a mutation relative to N. eutropha strain C91 at position 1, e.g., a V at position 1 and a mutation relative to N. eutropha strain C91 at position 167, e.g., an A at position 167. In some embodiments, the bacterium or preparation comprises an AmoA1 or AmoA2 protein having (or gene encoding) a mutation relative to N. eutropha strain C91 at position 160, e.g., an L at position 160 and a mutation relative to N. eutropha strain C91 at position 167, e.g., an A at position 167.

In some embodiments, the bacterium or preparation comprises an AmoB1 or AmoB2 protein having (or gene encoding) a mutation relative to N. eutropha strain C91 at position 33, e.g., a V at position 33 and a mutation relative to N. eutropha strain C91 at position 165, e.g., an I at position 165.

In some embodiments, the bacterium or preparation comprises an AmoC3 protein having (or gene encoding) a mutation relative to N. eutropha strain C91 at position 79, e.g., an A at position 79 and a mutation relative to N. eutropha strain C91 at position 271, e.g., a V at position 271.

In some embodiments, the bacterium or preparation comprises a Hao1, Hao2, or Hao3 protein having (or gene encoding) a mutation relative to N. eutropha strain C91 at position 85, e.g., an S at position 85 and a mutation relative to N. eutropha strain C91 at position 312, e.g., an E at position 312. In some embodiments, the bacterium or preparation comprises a Hao1 protein having (or gene encoding) a mutation relative to N. eutropha strain C91 at position 85, e.g., an S at position 85 and a mutation relative to N. eutropha strain C91 at position 163, e.g., an A at position 163. In some embodiments, the bacterium or preparation comprises a Hao1 protein having (or gene encoding) a mutation relative to N. eutropha strain C91 at position 312, e.g., an E at position 312 and a mutation relative to N. eutropha strain C91 at position 163, e.g., an A at position 163.

In some embodiments, the bacterium or preparation comprises a c554 CycA1 protein having (or gene encoding) a mutation relative to N. eutropha strain C91 at position 65, e.g., a T at position 65 and a mutation relative to N. eutropha strain C91 at position 186, e.g., a T at position 186.

In some embodiments, the bacterium or preparation comprises a cM552 CycB1 protein having (or gene encoding) mutations at any two or more of the following amino acid positions: 63, 189, 194, 195, 196, 197, 206, and 207. For instance, the two or more amino acid positions may comprise: 63 and 189, 63 and 194, 63 and 195, 63 and 196, 63 and 197, 63 and 206, 63 and 207, 189 and 194, 189 and 195, 189 and 196, 189 and 194, 189 and 195, 189 and 196, 189 and 197, 189 and 206, 189 and 207, 194 and 195, 194 and 196, 194 and 197, 194 and 206, 194 and 207, 195 and 196, 195 and 197, 195 and 206, 195 and 207, 196 and 197, 196 and 206, 196 and 207, 197 and 206, 197 and 207, or 206 and 207. In some embodiments, the bacterium or preparation comprises a cM552 CycB1 protein having (or gene encoding) any two or more mutations selected from the group consisting of: I63V, S189P, D194G, 195insD, 196insD, 197insD, 206insE, and 207insE. For instance, the two or more mutations can be selected from the group consisting of: I63V and S189P, I63V and D194G, I63V and 195insD, I63V and 196insD, I63V and 197insD, I63V and 206insE, I63V and 207insE, S189P and D194G, S189P and 195insD, S189P and 196insD, S189P and 197insD, S189P and 206insE, S189P and 207insE, D194G and 195insD, D194G and 196insD, D194G and 197insD, D194G and 206insE, D194G and 207insE, 195insD and 196insD, 195insD and 197insD, 195insD and 206insE, 195insD and 207insE, 196insD and 197insD, 196insD and 206insE, 196insD and 207insE, 197insD and 206insE, 197insD and 207insE, and 206insE and 207insE.

In some embodiments, the bacterium or preparation comprises a cM552 CycB2 protein having (or gene encoding) mutations at any two or more of the following amino acid positions: 63, 189, 206, and 207. For instance, the two or more amino acid positions may comprise: 63 and 189, 63 and 206, 63 and 207, 189 and 206, 189 and 207, or 206 and 207. In some embodiments, the bacterium or preparation comprises a cM552 CycB2 protein having (or gene encoding) any two or more mutations selected from the group consisting of: I63V, S189P, 206insE, and 207insE. For instance, the two or more mutations can be selected from the group consisting of: I63V and S189P, I63V and 206insE, I63V and 207insE, S189P and 206insE, S189P and 207insE, and 206insE and 207insE.

Combinations of three or more sequence characteristics of Table 2 are also described. For instance, in some embodiments, the bacterium or preparation comprises an AmoA1 or AmoA2 protein having (or gene encoding) a mutation relative to N. eutropha strain C91 at position 1, e.g., a V at position 1 and a mutation relative to N. eutropha strain C91 at position 160, e.g., an L at position 160, and a mutation relative to N. eutropha strain C91 at position 167, e.g., an A at position 167.

In some embodiments, the bacterium or preparation comprises a Hao1 protein having (or gene encoding) a mutation relative to N. eutropha strain C91 at position 85, e.g., an S at position 85 and a mutation relative to N. eutropha strain C91 at position 312, e.g., an E at position 312, and a mutation relative to N. eutropha strain C91 at position 163, e.g., an A at position 163.

In some embodiments, the bacterium or preparation comprises a cM552 CycB1 protein having (or gene encoding) mutations at any three or more (e.g., 4, 5, 6, 7, or all) of the following amino acid positions: 63, 189, 194, 195, 196, 197, 206, and 207. For instance, the three mutations may be at positions 195, 196, and 197. In some embodiments, the bacterium or preparation comprises a cM552 CycB1 protein having (or gene encoding) any three or more (e.g., 4, 5, 6, 7, or all) mutations selected from the group consisting of: I63V, S189P, D194G, 195insD, 196insD, 197insD, 206insE, and 207insE. For instance, the three mutations may be 195insD, 196insD, and 197insD.

In some embodiments, the bacterium or preparation comprises a cM552 CycB2 protein having (or gene encoding) mutations at any three or more (e.g., all) of the following amino acid positions: 63, 189, 206, and 207. In some embodiments, the bacterium or preparation comprises a cM552 CycB2 protein having (or gene encoding) any three or more (e.g., all) mutations selected from the group consisting of: I63V, S189P, 206insE, and 207insE.

In some embodiments, the bacterium or preparation comprises mutations relative to N. eutropha strain C91 in at least two genes, e.g., at least two genes listed in Table 2. The two genes may be, for instance, AmoA1 and AmoA2, AmoA1 and AmoB1, AmoA1 and AmoB2, AmoA1 and AmoC1, AmoA1 and AmoC2, AmoA1 and AmoC3, AmoA1 and Hao1, AmoA1 and Hao2, AmoA1 and Hao3, AmoA1 and c554 CycA1, AmoA1 and c554 CycA2, AmoA1 and c554 CycA3, AmoA1 and cM552 CycB1, AmoA1 and cM552 CycB2, AmoA2 and AmoB1, AmoA2 and AmoB2, AmoA2 and AmoC1, AmoA2 and AmoC2, AmoA2 and AmoC3, AmoA2 and Hao1, AmoA2 and Hao2, AmoA2 and Hao3, AmoA2 and c554 CycA1, AmoA2 and c554 CycA2, AmoA2 and c554 CycA3, AmoA2 and cM552 CycB1, AmoA2 and cM552 CycB2, AmoB1 and AmoB2, AmoB1 and AmoC1, AmoB1 and AmoC2, AmoB1 and AmoC3, AmoB1 and Hao1, AmoB1 and Hao2, AmoB1 and Hao3, AmoB1 and c554 CycA1, AmoB1 and c554 CycA2, AmoB1 and c554 CycA3, AmoB1 and cM552 CycB1, AmoB1 and cM552 CycB2, AmoB2 and AmoC1, AmoB2 and AmoC2, AmoB2 and AmoC3, AmoB2 and Hao1, AmoB2 and Hao2, AmoB2 and Hao3, AmoB2 and c554 CycA1, AmoB2 and c554 CycA2, AmoB2 and c554 CycA3, AmoB2 and cM552 CycB1, AmoB2 and cM552 CycB2, AmoC1 and AmoC2, AmoC1 and AmoC3, AmoC1 and Hao1, AmoC1 and Hao2, AmoC1 and Hao3, AmoC1 and c554 CycA1, AmoC1 and c554 CycA2, AmoC1 and c554 CycA3, AmoC1 and cM552 CycB1, AmoC1 and cM552 CycB2, AmoC2 and AmoC3, AmoC2 and Hao1, AmoC2 and Hao2, AmoC2 and Hao3, AmoC2 and c554 CycA1, AmoC2 and c554 CycA2, AmoC2 and c554 CycA3, AmoC2 and cM552 CycB1, AmoC2 and cM552 CycB2, AmoC3 and Hao1, AmoC3 and Hao2, AmoC3 and Hao3, AmoC3 and c554 CycA1, AmoC3 and c554 CycA2, AmoC3 and c554 CycA3, AmoC3 and cM552 CycB1, AmoC3 and cM552 CycB2, Hao1 and Hao2, Hao1 and Hao3, Hao1 and c554 CycA1, Hao1 and c554 CycA2, Hao1 and c554 CycA3, Hao1 and cM552 CycB1, Hao1 and cM552 CycB2, Hao2 and Hao3, Hao2 and c554 CycA1, Hao2 and c554 CycA2, Hao2 and c554 CycA3, Hao2 and cM552 CycB1, Hao2 and cM552 CycB2, Hao3 and c554 CycA1, Hao3 and c554 CycA2, Hao3 and c554 CycA3, Hao3 and cM552 CycB1, Hao3 and cM552 CycB2, c554 CycA1 and c554 CycA2, c554 CycA1 and c554 CycA3, c554 CycA1 and cM552 CycB1, c554 CycA1 and cM552 CycB2, c554 CycA2 and c554 CycA3, c554 CycA2 and cM552 CycB1, c554 CycA2 and cM552 CycB2, c554 CycA3 and cM552 CycB1, c554 CycA3 and cM552 CycB2, or cM552 CycB1 and cM552 CycB2.

In some embodiments, the bacterium or preparation comprises mutations relative to N. eutropha strain C91 in at least three genes, e.g., at least three (e.g., 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, or all) genes listed in Table 2. The three genes may be, for instance AmoA1 and AmoA2 and AmoA3; AmoC1 and AmoC2 and AmoC3; or Hao1 and Hao2 and Hao3.

In some embodiments, the bacterium or preparation comprises at least one structural difference, e.g., at least one mutation, relative to a wild-type bacterium such as N. eutropha strain C91. In some embodiments, the bacterium or preparation comprises a nucleic acid that can be amplified using a pair of primers described herein, e.g., a primer comprising a sequence of SEQ ID NO: 64 and a primer comprising a sequence of SEQ ID NO: 65. In some embodiments, the bacterium or preparation comprises a nucleic acid or protein at least 80%, 85%, 90%, 95%, 98%, 99%, 99.5%, or 100% identical to a gene of FIG. 6, 7, or 8, or a protein encoded by a gene of FIG. 6, 7, or 8. In some embodiments, the bacterium or preparation comprises a nucleic acid or protein at least 80%, 85%, 90%, 95%, 98%, 99%, 99.5%, or 100% identical to a sequence of any of SEQ ID NOS: 64-66 or a protein encoded by a sequence of any of SEQ ID NOS: 64-66.

In some aspects, the present disclosure provides, inter alia, an N. eutropha bacterium, or a purified preparation thereof, comprising a mutation in an ammonia monooxygenase gene, a hydroxylamine oxidoreductase gene, a cytochrome c554 gene, or a cytochrome cM552 gene. The mutation may be relative to a wild-type bacterium such as N. eutropha strain C91. The mutation may be in one or more of the amoA1 gene, the amoA2 gene, amoB1 gene, the amoB2 gene, and the amoC3 gene. The N. eutropha bacterium, or a purified preparation thereof may have a mutation at a position described herein, e.g., in Table 2. The N. eutropha bacterium, or a purified preparation thereof may have a mutation wherein said mutation is a mutation described herein, e.g., in Table 2.

In some embodiments, the mutation may be in one or more of the hao1 gene, the hao2 gene, or the hao3 gene. The N. eutropha bacterium, or a purified preparation thereof may have a mutation at a position described herein, e.g., in Table 2. The N. eutropha bacterium, or a purified preparation thereof may have a mutation wherein said mutation is a mutation described herein, e.g., in Table 2.

In some embodiments, the mutation may be in one or more of the c554 cycA1 gene, the c554 cycA2 gene, and the c554 cycA3 gene. The N. eutropha bacterium, or a purified preparation thereof may have a mutation at a position described herein, e.g., in Table 2. The N. eutropha bacterium, or a purified preparation thereof may have a mutation wherein said mutation is a mutation described herein, e.g., in Table 2.

In some embodiments, the mutation may be in one or more of the cM552 cycB1 gene and the cM552 cycB2 gene. The N. eutropha bacterium, or a purified preparation thereof may have a mutation at a position described herein, e.g., in Table 2. The N. eutropha bacterium, or a purified preparation thereof may have a mutation wherein said mutation is a mutation described herein, e.g., in Table 2.

In certain aspects the N. eutropha bacterium, or a purified preparation thereof, described in the preceding four paragraphs may be based on a N. eutropha bacterium, e.g., an optimized N. eutropha, e.g., a purified preparation of optimized N. eutropha, having at least one property selected from:

    • an optimized growth rate;
    • an optimized NH4+ oxidation rate; and
    • an optimized resistance to ammonium ion (NH4+).

In certain aspects, the N. eutropha bacterium, or a purified preparation thereof, described in the preceding five paragraphs may have a mutation in at least 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, or 35 positions of one or more of amoA1 gene, amoA2 gene, amoB1 gene, amoB2 gene, amoC3 gene, hao1 gene, hao2 gene, hao3 gene, c554 cycA1 gene, c554 cycA2 gene, c554 cycA3 gene, cM552 cycB1 gene, and c554 cycB2 gene.

In some embodiments, the N. eutropha bacterium has an optimized growth rate, e.g., an optimized growth rate described herein, and a structural difference such as a mutation (e.g., relative to a wild-type strain such as N. eutropha strain C91), e.g., a mutation described herein, e.g., a mutation of Table 2. In some embodiments, the N. eutropha bacterium has an optimized NH4+ oxidation rate, e.g., an optimized NH4+ oxidation rate described herein, and a structural difference such as a mutation (e.g., relative to a wild-type strain such as N. eutropha strain C91), e.g., a mutation described herein, e.g., a mutation of Table 2. In some embodiments, the N. eutropha bacterium has an optimized resistance to NH4+, e.g., an optimized resistance to NH4+ described herein, and a structural difference such as a mutation (e.g., relative to a wild-type strain such as N. eutropha strain C91), e.g., a mutation described herein, e.g., a mutation of Table 2.

In some embodiments, the N. eutropha bacterium comprises a nucleic acid that can be amplified using a pair of primers described herein, e.g., a primer comprising a sequence of SEQ ID NO: 64 and a primer comprising a sequence of SEQ ID NO: 65.

In certain aspects, this disclosure provides an N. eutropha bacterium (which is optionally axenic) comprising a chromosome that hybridizes at high stringency to SEQ ID NO: 1.

In embodiments, the chromosome hybridizes at very high stringency to SEQ ID NO: 1. In embodiments, the N. eutropha bacterium (which is optionally axenic) comprises a gene that is at least about 80%, 85%, 90%, 95%, 97%, 98%, 99%, or 100% identical to one or more genes of FIGS. 6-8 (e.g., 10, 20, 30, 40, 50, 100, or all genes of any one or more of FIGS. 6, 7, and 8).

In embodiments, the N. eutropha bacterium (which is optionally axenic) lacks any plasmid that is at least about 80%, 85%, 90%, 95%, 97%, 98%, 99%, or 100% identical to SEQ ID NO: 2 (pNeut1) or SEQ ID NO: 3 (pNeut2), as described by Stein et al. Whole-genome analysis of the ammonia-oxidizing bacterium, Nitrosomonas eutropha C91: implications for niche adaptation. Environmental Microbiology (2007) 9(12), 2993-3007. In embodiments, the N. eutropha (which is optionally axenic) lacks one or more genes present on the plasmids of SEQ ID NO: 2 or SEQ ID NO: 3. For instance, the N. eutropha (which is optionally axenic) may lack at least 2, 3, 4, 5, 10, 15, or 20 genes present on one or both of pNeut1 and pNeut2. pNeut1 contains 55 protein-coding sequences while pNeutP2 contains 52 protein-coding sequences. In embodiments, the N. eutropha bacterium (which is optionally axenic) lacks any plasmid.

In certain aspects, this disclosure provides an N. eutropha bacterium (which is optionally axenic) comprising one or more of an amoA1 gene at least about 98.9% identical to SEQ ID NO: 7 and an amoA2 gene at least about 98.8% identical to SEQ ID NO: 13.

In certain aspects, this disclosure provides an N. eutropha bacterium (which is optionally axenic) comprising one or more of an AmoA1 protein at least about 99.0% identical to SEQ ID NO: 6 and an AmoA2 protein at least about 99.0% identical to SEQ ID NO: 12.

In certain aspects, this disclosure provides an N. eutropha bacterium (which is optionally axenic) comprising one or more of an amoB1 gene at least about 99.2% identical to SEQ ID NO: 9 and an amoB2 gene at least about 99.2% identical to SEQ ID NO: 15.

In embodiments, the N. eutropha bacterium (which is optionally axenic) further comprises one or more of an amoA1 or amoA2 gene at least about 98.9% identical to SEQ ID NO: 7 or 13.

In certain aspects, this disclosure provides an N. eutropha bacterium (which is optionally axenic) comprising one or more of an AmoB1 protein at least about 99.6% identical to SEQ ID NO: 8 and an AmoB1 protein at least about 99.6% identical to SEQ ID NO: 14.

In embodiments, the N. eutropha bacterium (which is optionally axenic) further comprises one or more of an AmoA1 protein at least about 99.0% identical to SEQ ID NO: 6 and an AmoA2 protein at least about 99.0% identical to SEQ ID NO: 12.

In certain aspects, this disclosure provides an N. eutropha bacterium (which is optionally axenic) comprising one or more of an amoC1 gene at least about 99.9% identical to SEQ ID NO: 5, an amoC2 gene at least about 99.9% identical to SEQ ID NO: 11, and an amoC3 gene at least about 99.0% identical to SEQ ID NO: 17.

In embodiments, the N. eutropha bacterium (which is optionally axenic) further comprises one or more of an amoA1 gene at least about 98.9% identical to SEQ ID NO: 7, an amo2 gene at least about 98.9% identical to SEQ ID NO: 13, an amoB1 gene at least about 99.2% identical to SEQ ID NO: 9, and an amoB2 gene at least about 99.2% identical to SEQ ID NO: 15.

In certain aspects, this disclosure provides an N. eutropha bacterium (which is optionally axenic) comprising an AmoC3 protein at least about 99.4% identical to SEQ ID NO: 16.

In embodiments, the N. eutropha bacterium (which is optionally axenic) further comprises one or more of an AmoA1 protein at least about 99.0% identical to SEQ ID NO: 6, an AmoA2 protein at least about 99.0% identical to SEQ ID NO: 12, an AmoB1 protein at least about 99.6% identical to SEQ ID NO: 8, and an AmoB1 protein at least about 99.6% identical to SEQ ID NO: 14.

In certain aspects, this disclosure provides an N. eutropha bacterium (which is optionally axenic) comprising one or more of a hao1 gene at least about 99.1% identical to SEQ ID NO: 19, a hao2 gene at least about 99.5% identical to SEQ ID NO: 21, and a hao3 gene at least about 99.3% identical to SEQ ID NO: 23.

In embodiments, the N. eutropha bacterium (which is optionally axenic) further comprises one or more of an amoA1 gene at least about 98.9% identical to SEQ ID NO: 7, an amo2 gene at least about 98.9% identical to SEQ ID NO: 13, an amoB1 gene at least about 99.2% identical to SEQ ID NO: 9, an amoB2 gene at least about 99.2% identical to SEQ ID NO: 15, an amoC1 gene at least about 99.9% identical to SEQ ID NO: 5, an amoC2 gene at least about 99.9% identical to SEQ ID NO: 11, and an amoC3 gene at least about 99.0% identical to SEQ ID NO: 17.

In certain aspects, this disclosure provides an N. eutropha bacterium (which is optionally axenic) comprising one or more of a Hao1 protein at least about 99.6% identical to SEQ ID NO: 18, a Hao2 protein at least about 99.7% identical to SEQ ID NO: 20, and a Hao3 protein at least about 99.7% identical to SEQ ID NO: 22.

In embodiments, the N. eutropha bacterium (which is optionally axenic) further comprises an AmoA1 protein at least about 99.0% identical to SEQ ID NO: 6, an AmoA2 protein at least about 99.0% identical to SEQ ID NO: 12, an AmoB1 protein at least about 99.6% identical to SEQ ID NO: 8, an AmoB1 protein at least about 99.6% identical to SEQ ID NO: 14, or an AmoC3 protein at least about 99.4% identical to SEQ ID NO: 16.

In certain aspects, this disclosure provides an N. eutropha bacterium (which is optionally axenic) comprising one or more of a cycA1 gene at least about 98.1% identical to SEQ ID NO: 25, a cycA2 gene at least about 98.8% identical to SEQ ID NO: 27, and a cycA3 gene at least about 99.4% identical to SEQ ID NO: 28.

In embodiments, the N. eutropha bacterium (which is optionally axenic) further comprises one or more of an amoA1 gene at least about 98.9% identical to SEQ ID NO: 7, an amo2 gene at least about 98.9% identical to SEQ ID NO: 13, an amoB1 gene at least about 99.2% identical to SEQ ID NO: 9, an amoB2 gene at least about 99.2% identical to SEQ ID NO: 15, an amoC1 gene at least about 99.9% identical to SEEQ ID NO: 5, an amoC2 gene at least about 99.9% identical to SEQ ID NO: 11, an amoC3 gene at least about 99.0% identical to SEQ ID NO: 17, a hao1 gene at least about 99.1% identical to SEQ ID NO: 19, a hao2 gene at least about 99.5% identical to SEQ ID NO: 21, and a hao3 gene at least about 99.3% identical to SEQ ID NO: 23.

In certain aspects, this disclosure provides an N. eutropha bacterium (which is optionally axenic) comprising one or more of a CycA1 protein at least about 99.2% identical to SEQ ID NO: 24, a CycA2 protein at least about 99.7% identical to SEQ ID NO: 26, and a CycA3 protein at least about 99.7% identical to SEQ ID NO: 28.

In embodiments, the N. eutropha bacterium (which is optionally axenic) further comprises one or more of an AmoA1 protein at least about 99.0% identical to SEQ ID NO: 6, an AmoA2 protein at least about 99.0% identical to SEQ ID NO: 12, an AmoB1 protein at least about 99.6% identical to SEQ ID NO: 8, an AmoB1 protein at least about 99.6% identical to SEQ ID NO: 14, an AmoC3 protein at least about 99.4% identical to SEQ ID NO: 16, a Hao1 protein at least about 99.6% identical to SEQ ID NO: 18, a Hao2 protein at least about 99.7% identical to SEQ ID NO: 20, and a Hao3 protein at least about 99.7% identical to SEQ ID NO: 22.

In certain aspects, this disclosure provides an N. eutropha bacterium (which is optionally axenic) comprising one or more of a cycB1 gene at least about 96.8% identical to SEQ ID NO: 31 and a cycB2 gene at least about 97.2% identical to SEQ ID NO: 33.

In embodiments, the N. eutropha bacterium (which is optionally axenic) further comprises one or more of an amoA1 gene at least about 98.9% identical to SEQ ID NO: 7, an amo2 gene at least about 98.9% identical to SEQ ID NO: 13, an amoB1 gene at least about 99.2% identical to SEQ ID NO: 9, an amoB2 gene at least about 99.2% identical to SEQ ID NO: 15, an amoC1 gene at least about 99.9% identical to SEQ ID NO: 5, an amoC2 gene at least about 99.9% identical to SEQ ID NO: 11, an amoC3 gene at least about 99.0% identical to SEQ ID NO: 17, a hao1 gene at least about 99.1% identical to SEQ ID NO: 19, a hao2 gene at least about 99.5% identical to SEQ ID NO: 21, a hao3 gene at least about 99.3% identical to SEQ ID NO: 23, a cycA1 gene at least about 98.1% identical to SEQ ID NO: 25, a cycA2 gene at least about 98.8% identical to SEQ ID NO: 27, and a cycA3 gene at least about 99.4% identical to SEQ ID NO: 28.

In certain aspects, this disclosure provides an N. eutropha bacterium (which is optionally axenic) comprising one or more of a CycB1 protein at least about 97.2% identical to SEQ ID NO: 30 or a CycB2 protein at least about 98.8% identical to SEQ ID NO: 32.

In embodiments, the N. eutropha bacterium (which is optionally axenic) further comprises one or more of an AmoA1 protein at least about 99.0% identical to SEQ ID NO: 6, an AmoA2 protein at least about 99.0% identical to SEQ ID NO: 12, an AmoB1 protein at least about 99.6% identical to SEQ ID NO: 8, an AmoB1 protein at least about 99.6% identical to SEQ ID NO: 14, an AmoC3 protein at least about 99.4% identical to SEQ ID NO: 16, a Hao1 protein at least about 99.6% identical to SEQ ID NO: 18, a Hao2 protein at least about 99.7% identical to SEQ ID NO: 20, a Hao3 protein at least about 99.7% identical to SEQ ID NO: 22, a CycA1 protein at least about 99.2% identical to SEQ ID NO: 24, a CycA2 protein at least about 99.7% identical to SEQ ID NO: 26, and a CycA3 protein at least about 99.7% identical to SEQ ID NO: 28.

In certain aspects, this disclosure provides an N. eutropha bacterium (which is optionally axenic) comprising one or more genes according to SEQ ID NOS: 5, 7, 9, 11, 13, 15, 17, 19, 21, 23, 25, 27, 29, 31, and 33.

In certain aspects, this disclosure provides an N. eutropha bacterium (which is optionally axenic) comprising one or more proteins according to SEQ ID NOS: 4, 6, 8, 10, 12, 14, 16, 18, 20, 22, 24, 26, 28, 30, and 32.

In certain aspects, this disclosure provides an N. eutropha bacterium (which is optionally axenic) comprising a protein that is mutant relative to N. eutropha strain C91 at at least 1, 2, 3, 4, 5, 10, 15, 20, 25, 30, or all of the amino acid positions listed in Table 2.

In certain aspects, this disclosure provides an N. eutropha bacterium (which is optionally axenic) comprising proteins that are mutant relative to N. eutropha strain C91 at all of the amino acid positions listed in Table 2.

In certain aspects, this disclosure provides an N. eutropha bacterium (which is optionally axenic) of strain D23, 25 vials of said bacterium, designated AOB D23-100, having been deposited with the ATCC patent depository on Apr. 8, 2014 under ATCC accession number PTA-121157.

In embodiments, the N. eutropha bacterium (which is optionally axenic) is transgenic.

In embodiments, the N. eutropha bacterium (which is optionally axenic) has at least one property selected from an optimized growth rate, an optimized NH4+ oxidation rate, and an optimized resistance to NH4+.

In embodiments, the N. eutropha bacterium (which is optionally axenic) has at least two properties selected from an optimized growth rate, an optimized NH4+ oxidation rate, and an optimized resistance to NH4+.

In embodiments, the N. eutropha bacterium (which is optionally axenic) has an optimized growth rate, an optimized NH4+ oxidation rate, and an optimized resistance to NH4+.

In embodiments, the N. eutropha bacterium as described herein (e.g., strain D23) is substantially free of bacteria, other ammonia oxidizing bacteria, fungi, viruses, or pathogens (e.g., animal pathogens, e.g., human pathogens), or any combination thereof.

In certain aspects, this disclosure provides a composition comprising the N. eutropha bacterium as described herein (e.g., strain D23), wherein the composition is substantially free of other organisms.

In certain aspects, this disclosure provides a composition comprising the N. eutropha bacterium as described herein (e.g., strain D23) and further comprising a second organism (e.g., a second strain or species), wherein the composition is substantially free of other organisms (e.g., strains or species). In embodiments, the second organism is an ammonia oxidizing bacterium. In embodiments, the second organism is selected from the group consisting of Nitrosomonas, Nitrosococcus, Nitrosospria, Nitrosocystis, Nitrosolobus, Nitrosovibrio, Lactobacillus, Streptococcus, and Bifidobacter, and combinations thereof.

This disclosure also provides a composition comprising the N. eutropha bacterium as described herein (e.g., strain D23) and further comprising a second and a third organism (e.g., of other strains or species), wherein the composition is substantially free of other organisms (e.g., strains or species). This disclosure also provides a composition comprising the N. eutropha bacterium as described herein (e.g., strain D23) and further comprising 2, 3, 4, 5, 6, 7, 8, 9, or 10 other organisms (e.g., of other strains or species), wherein the composition is substantially free of other organisms (e.g., strains or species).

In some aspects, this disclosure provides a composition comprising a cell suspension of an actively dividing culture of N. eutropha bacteria having an OD600 of at least about 0.1, 0.15, 0.2, 0.25, 0.3, 0.35, 0.4, 0.45, 0.5, 0.6, 0.7, or 0.8, wherein the composition is substantially free of other organisms.

In some aspects, this disclosure provides a composition for topical administration, comprising the N. eutropha bacterium as described herein (e.g., strain D23) and a pharmaceutically or cosmetically acceptable excipient suitable for topical administration. In embodiments, the composition is substantially free of other organisms. In embodiments, the composition further comprises a second organism (e.g., of another strain or specie). In embodiments, the composition further comprises 2, 3, 4, 5, 6, 7, 8, 9, or 10 other organisms (e.g., of other strains or species). The second organism may be, for example, an ammonia oxidizing bacterium. In embodiments, the second organism is selected from the group consisting of Nitrosomonas, Nitrosococcus, Nitrosospria, Nitrosocystis, Nitrosolobus, Nitrosovibrio, Lactobacillus, Streptococcus, and Bifidobacter, and combinations thereof.

In embodiments, the composition is a powder, cosmetic, cream, stick, aerosol, salve, wipe, or bandage. In embodiments, the composition further comprises a moisturizing agent, deodorizing agent, scent, colorant, insect repellant, cleansing agent, or UV-blocking agent. In embodiments, the excipient is an anti-adherent, binder, coat, disintegrant, filler, flavor, color, lubricant, glidant, sorbent, preservative, or sweetener. In embodiments, the concentration of N. eutropha in the composition is about 1011-1013 CFU/L. In embodiments, the concentration of N. eutropha in the composition is about 109 CFU/ml. In embodiments, the mass ratio of N. eutropha to pharmaceutical excipient may be about 0.1 gram per liter to about 100 grams per liter. In some embodiments, the mass ratio of N. eutropha to pharmaceutical excipient is 1 gram per liter.

In some aspects the composition and/or excipient may be in the form of one or more of a liquid, a solid, or a gel. For example, liquid suspensions may include, but are not limited to, water, saline, phosphate-buffered saline, or an ammonia oxidizing storage buffer. Gel formulations may include, but are not limited to agar, silica, polyacrylic acid (for example Carbopol®), carboxymethyl cellulose, starch, guar gum, alginate or chitosan. In some embodiments, the formulation may be supplemented with an ammonia source including, but not limited to ammonium chloride or ammonium sulfate.

In some aspects, this disclosure provides a composition comprising at least about 10, 20, 50, 100, 200, 500, 1,000, 2,000, or 10,000 L, e.g., at about 1011 CFU/L, 1012 CFU/L, 1013 CFU/L of the N. eutropha bacterium as described herein (e.g., strain D23). In some embodiments, the composition is at a concentration of at least about 109 CFU/L, 1010 CFU/L, 1011 CFU/L, or 1012 CFU/L. In some aspects, this disclosure provides a composition comprising at least about 1, 2, 5, 10, 20, 50, 100, 200, or 500 g of the N. eutropha bacterium described herein, e.g., as a dry formulation such as a powder.

In some aspects, this disclosure provides an article of clothing comprising the N. eutropha as described herein (e.g., strain D23). In embodiments, the article of clothing is packaged. In embodiments, the article of clothing is packaged in a material that is resistant to gaseous exchange or resistant to water. The article of clothing may be provided, e.g., at a concentration that provides one or more of a treatment or prevention of a skin disorder, a treatment or prevention of a disease or condition associated with low nitrite levels, a treatment or prevention of body odor, a treatment to supply nitric oxide to a subject, or a treatment to inhibit microbial growth.

In some aspects, this disclosure provides a cloth comprising the N. eutropha as described herein (e.g., strain D23).

In some aspects, this disclosure provides a yarn comprising the N. eutropha as described herein (e.g., strain D23).

In some aspects, this disclosure provides a thread comprising the N. eutropha as described herein (e.g., strain D23).

In some aspects, this disclosure provides a method of obtaining, e.g., manufacturing, an (optionally axenic) N. eutropha bacterium having an optimized growth rate, an optimized NH4+ oxidation rate, or an optimized resistance to NH4+, comprising:

(a) culturing the bacterium under conditions that select for one or more of an optimized growth rate, an optimized NH4+ oxidation rate, or an optimized resistance to NH4+, thereby producing a culture;

(b) testing a sample from the culture for an optimized growth rate, an optimized NH4+ oxidation rate, or an optimized resistance to NH4+; and

(c) repeating the culturing and testing steps until a bacterium having an optimized growth rate, an optimized NH4+ oxidation rate, or an optimized resistance to NH4+ is obtained.

In embodiments, the method comprises a step of obtaining an N. eutropha bacterium from a source, such as soil or the skin of an individual. In embodiments, culturing the bacterium under conditions that select for one or more (e.g., 2 or 3) of an optimized growth rate, an optimized NH4+ oxidation rate, or an optimized resistance to NH4+ comprises culturing the bacterium in N. europaea medium that comprises about 200 mM NH4+. In embodiments, the method comprises a step of creating an axenic culture. In embodiments, the method comprises a step of co-culturing the N. eutropha together with at least one other type of ammonia oxidizing bacteria. In embodiments, the N. eutropha of step (a) lack an optimized growth rate, an optimized NH4+ oxidation rate, and an optimized resistance to NH4+ In embodiments, step (c) comprises repeating the culturing and testing steps until a bacterium having at least two of an optimized growth rate, an optimized NH4+ oxidation rate, and an optimized resistance to NH4+ is obtained.

In some aspects, this disclosure provides an N. eutropha bacterium as described herein (e.g., strain D23), produced by the methods described above.

In some aspects, this disclosure provides a method of testing a preparation of (optionally axenic) N. eutropha, comprising:

assaying the N. eutropha for one or more of an optimized growth rate, an optimized NH4+ oxidation rate, or an optimized resistance to NH4+; and

if the N. eutropha has one or more of an optimized growth rate, an optimized NH4+ oxidation rate, or an optimized resistance to NH4+, classifying the N. eutropha as accepted.

In embodiments, the method further comprises a step of testing the preparation for contaminating organisms. In embodiments, the method further comprises a step of removing a sample from the preparation and conducting testing on the sample. In embodiments, the method further comprises testing medium in which the N. eutropha is cultured. In embodiments, the method further comprises packaging N. eutropha from the preparation into a package. In embodiments, the method further comprises placing N. eutropha from the preparation into commerce.

In some aspects, this disclosure provides a method of producing, e.g., manufacturing N. eutropha, comprising contacting N. eutropha with culture medium and culturing the N. eutropha until an OD600 of at least about 0.3, 0.4, 0.5, 0.6, 0.7, or 0.8 is reached. In some embodiments, the method comprises culturing the N. eutropha until an OD600 of at about 0.3-0.4, 0.4-0.5, 0.5-0.6, 0.6-0.7, or 0.7-0.8 is reached.

In embodiments, the method further comprises assaying the N. eutropha and culture medium for contaminating organisms. In embodiments, the method further comprises assaying the N. eutropha for one or more (e.g., 2 or 3) of an optimized growth rate, an optimized NH4+ oxidation rate, or an optimized resistance to NH4+ In embodiments, the method comprises producing at least at least about 10, 20, 50, 100, 200, 500, 1,000, 2,000, 5,000, or 10,000 L per day of N. eutropha, e.g., at about 1012 CFUs/L. In some embodiments, the N. eutropha is at a concentration of about 109, 1010, 1011, 1012, 1013, or 1014 CFUs/L. In some embodiments, the N. eutropha is at a concentration of least about 109, 1010, 1011, 1012, 1013, or 1014 CFUs/L.

In some aspects, this disclosure provides a method of producing, e.g., manufacturing, N. eutropha, comprising contacting N. eutropha with culture medium and culturing the N. eutropha until about at least about 1,000 L at about 1012 CFU/L N. eutropha are produced.

In embodiments, the method further comprises a step of assaying the N. eutropha for one or more (e.g., 2 or 3) of an optimized growth rate, an optimized NH4+ oxidation rate, or an optimized resistance to NH4+.

In embodiments, the method further comprises a step of testing the N. eutropha or culture medium for contaminating organisms. In embodiments, the N. eutropha brought into contact with the culture medium is an N. eutropha having one or more (e.g., 2 or 3) of an optimized growth rate, an optimized NH4+ oxidation rate, or an optimized resistance to NH4+.

In some aspects, this disclosure provides a method of producing, e.g., manufacturing N. eutropha, comprising:

(a) contacting N. eutropha with a culture medium; and

(b) culturing the N. eutropha for 1-2 days, thereby creating a culture, until the culture reaches an OD600 of about 0.5-0.6.

In embodiments, the method further comprises a step of assaying the N. eutropha for one or more of an optimized growth rate, an optimized NH4+ oxidation rate, or an optimized resistance to NH4+. In embodiments, the method further comprises a step of testing the culture for contaminating organisms, e.g., bacteria, viruses, fungi, or pathogens, or a combination thereof. In embodiments, the N. eutropha of step (a) is an N. eutropha having one or more (e.g., 2 or 3) of an optimized growth rate, an optimized NH4+ oxidation rate, or an optimized resistance to NH4+. In embodiments, the method comprises producing at least at least about 1,000 L per day at about 1012 CFUs/L of N. eutropha.

In some aspects, this disclosure provides a N. eutropha bacterium produced by the methods described above.

In embodiments, a preparation of N. eutropha made by the methods described above. In some aspects, the preparation may comprise about 0.1 milligrams to about 100 milligrams (mg) of N. eutropha.

In some aspects, a reaction mixture may be provided comprising N. eutropha at an optical density of about 0.5 to about 0.6. In some aspects, this disclosure provides a method of producing N. eutropha-bearing clothing, comprising contacting an article of clothing with of the N. eutropha as described herein (e.g., strain D23).

In embodiments, the method comprises producing at least 10, 100, or 1000 articles of clothing. In embodiments, the method comprises contacting the article of clothing with at least 1010 CFUs of N. eutropha. In embodiments, the method further comprises packaging the clothing.

In certain aspects, the present disclosure provides a method of obtaining a formulation of N. eutropha, combining contacting N. eutropha described herein (e.g., strain D23) with a pharmaceutically or cosmetically acceptable excipient.

In embodiments, the method further comprises mixing the N. eutropha and the excipient. In embodiments, the method is performed under conditions that are substantially free of contaminating organisms, e.g., bacteria, viruses, fungi, or pathogens.

In certain aspects, the present disclosure provides a method of packaging N. eutropha, comprising assembling N. eutropha described herein (e.g., strain D23) into a package.

In embodiments, the package is resistant to gaseous exchange or resistant to water. In embodiments, the package is permeable to gaseous exchange, NH3, NH4+, or NO2.

In certain aspects, the present disclosure provides a method of inhibiting microbial growth on a subject's skin, comprising topically administering to a subject in need thereof an effective dose of the N. eutropha bacteria described herein (e.g., strain D23).

In embodiments, the effective dose is approximately 1×109 CFU, 2×109 CFU, 5×109 CFU, 1×1010 CFU, 1.5×1010 CFU, 2×1010 CFU, 5×1010 CFU, or 1×1011 CFU. In embodiments, the effective dose is at least about 1×109 CFU, 2×109 CFU, 5×109 CFU, 1×1010 CFU, 1.5×1010 CFU, 2×1010 CFU, 5×1010 CFU, or 1×1011 CFU. In embodiments, the effective dose is approximately 1×109 CFU-2×109 CFU, 2×109 CFU-5×109 CFU, 5×109 CFU-1×1010 CFU, 1×1010 CFU-1.5×1010 CFU, 1×1010 CFU-2×1010 CFU 1.5×1010 CFU-2×1010 CFU, 2×1010 CFU-5×1010 CFU, or 5×1010 CFU-1×1011 CFU. In embodiments, the bacterium is administered at a concentration of about 1×108, 2×108, 5×108, 1×109, 2×109, 5×109, or 1×1010 CFU/ml. In embodiments, the bacterium is administered at a concentration of at least about 1×108, 2×108, 5×108, 1×109, 2×109, 5×109, or 1×1010 CFU/ml. In embodiments, the bacterium is administered at a concentration of about 1×108-2×108, 2×108-5×108, 5×108-1×109, 1×109-2×109, 2×109-5×109, or 5×109-1×1010 CFU/ml. In embodiments, the administration is performed twice per day. In embodiments, the subject is a human. In embodiments, the microbial growth to be inhibited is growth of Pseudomonas aeruginosa or Staphylococcus aureus (S. aureus or SA), Streptococcus pyogenes (S. pyogenes or SP), or Acinetobacter baumannii (A. baumannii or AB).

In certain aspects, the present disclosure provides a method of supplying nitric oxide to a subject, comprising positioning an effective dose of the N. eutropha bacteria described herein (e.g., strain D23) in close proximity to the subject.

In certain aspects, the present disclosure provides a method of reducing body odor, comprising topically administering to a subject in need thereof an effective dose of the N. eutropha bacteria described herein (e.g., strain D23).

In certain aspects, the present disclosure provides a method of treating a disease associated with low nitrite levels, comprising topically administering to a subject in need thereof a therapeutically effective dose of the N. eutropha bacteria described herein (e.g., strain D23).

In embodiments, the disease is HIV dermatitis, infection in a diabetic foot ulcer, atopic dermatitis, acne, e.g., acne vulgaris, eczema, contact dermatitis, allergic reaction, psoriasis, skin infections, vascular disease, vaginal yeast infection, a sexually transmitted disease, heart disease, atherosclerosis, baldness, leg ulcers secondary to diabetes or confinement to bed, angina, particularly chronic, stable angina pectoris, ischemic diseases, congestive heart failure, myocardial infarction, ischemia reperfusion injury, laminitis, hypertension, hypertrophic organ degeneration, Raynaud's phenomenon, fibrosis, fibrotic organ degeneration, allergies, autoimmune sensitization, end stage renal disease, obesity, impotence, or cancer.

In certain aspects, the present disclosure provides a method of treating a skin disorder, comprising topically administering to a subject in need thereof a therapeutically effective dose of the N. eutropha bacteria as described herein (e.g., strain D23). In related aspects, the disclosure provides an N. eutropha bacteria as described herein (e.g., strain D23) for treating a disorder such as a skin disorder. In related aspects, the disclosure provides an N. eutropha bacteria as described herein (e.g., strain D23) for the manufacture of a medicament, e.g., a medicament for treating a skin disorder.

In embodiments, the skin disorder is acne, e.g., acne vulgaris, rosacea, eczema, or psoriasis. In some embodiments, the skin disorder is an ulcer, e.g., venous ulcer, e.g., leg ulcer, e.g., venous leg ulcer, e.g., infection in a diabetic foot ulcer. In some embodiments, topically administering comprises pre-treating the subject with N. eutropha, e.g., an N. eutropha described herein. In some embodiments, topically administering comprises topically administering prior to occurrence of the skin disorder. In some embodiments, topically administering comprises topically administering subsequent to occurrence of the skin disorder.

In certain aspects, the present disclosure provides a method of promoting wound healing or closure, comprising administering to a wound an effective dose of the N. eutropha bacteria as described herein (e.g., strain D23). In related aspects, the disclosure provides an N. eutropha bacteria as described herein (e.g., strain D23) for promoting wound healing. In related aspects, the disclosure provides an N. eutropha bacteria as described herein (e.g., strain D23) for the manufacture of a medicament, e.g., a medicament for promoting wound healing.

In embodiments, the wound comprises one or more undesirable bacteria, e.g., pathogenic bacteria. In embodiments, the wound comprises S. aureus, P. aeruginosa, P. aeroginosa, or A. baunannii.

In embodiments, the N. eutropha is administered to the subject prior to occurrence of the wound. In embodiments, administering to the wound comprises administering to the subject prior to occurrence of the wound. In embodiments, the method further comprises administering N. eutropha (e.g., an N. eutropha described herein, e.g., strain D23) to the wound subsequent to occurrence of the wound. In some aspects, the disclosure provides a method of killing or inhibiting growth of pathogenic bacteria comprising contacting, e.g., applying, N. eutropha bacteria (e.g., N. eutropha described herein, e.g., strain D23) to the skin.

In embodiments, the pathogenic bacteria contribute to one or more of the following conditions: HIV dermatitis, an ulcer, e.g., venous ulcer, e.g., leg ulcer, e.g., venous leg ulcer, e.g., infection in a diabetic foot ulcer, atopic dermatitis, acne, e.g., acne vulgaris, eczema, contact dermatitis, allergic reaction, psoriasis, uticaria, rosacea, skin infections, vascular disease, vaginal yeast infection, a sexually transmitted disease, heart disease, atherosclerosis, baldness, leg ulcers secondary to diabetes or confinement to bed, angina, particularly chronic, stable angina pectoris, ischemic diseases, congestive heart failure, myocardial infarction, ischemia reperfusion injury, laminitis, hypertension, hypertrophic organ degeneration, Raynaud's phenomenon, fibrosis, fibrotic organ degeneration, allergies, autoimmune sensitization, end stage renal disease, obesity, impotence, pneumonia, primary immunodeficiency, epidermal lysis bulosa, or cancer.

In embodiments, the condition is an ulcer, e.g., venous ulcer, e.g., leg ulcer, e.g., venous leg ulcer, e.g., infection in a diabetic foot ulcer. In embodiments, the condition is a venous leg ulcer. In embodiments, the condition is acne, e.g., acne vulgaris. In embodiments, the condition is acne vulgaris. In embodiments, the pathogenic bacteria is one or more of Propionibacterium acnes, Pseudomonas aeruginosa, Staphylococcus aureus, Streptococcus pyogenes, or Acinetobacter baumannii. In embodiments, the method further comprises determining whether the subject is in need of killing or inhibiting growth of pathogenic bacteria, e.g., determining that the subject is in need of killing or inhibiting growth of pathogenic bacteria. In embodiments, the method further comprises selecting the subject in need of killing or inhibiting growth of pathogenic bacteria.

In some embodiments, the N. eutropha catalyze the following reactions.

At a neutral pH, ammonia generated from ammonium around neutral pH conditions is the substrate of the initial reaction. The conversion of ammonia to nitrite takes place in two steps catalyzed respectively by ammonia monooxygenase (Amo) and hydroxylamine oxidoreductase (Hao), as follows:


NH3+2H++2e−+O2→NH2OH+H2O  (A)


NH2OH+H2O→NO2+4e−+5H+  (B)

In some instances, reaction B is reported as follows, to indicate nitrous acid (HNO2) formation at low pH:


NH2OH+H2O→HNO2+4e−+4H+

In certain embodiments, the N. eutropha has a doubling time of less than 4, 5, 6, 7, 8, 9, or 10 hours, for instance about 8 hours, e.g., 7-9 hours or 6-10 hours, when grown under batch culture conditions. In some embodiments, the doubling time is at least 3, 4, 5, or 6 hours under batch culture conditions. In some embodiments, the N. eutropha has a doubling time of less than 16, 18, 20, 22, 24, or 26 hours, for instance about 20 hours, e.g., 19-21 hours or 18-22 hours, when grown under chemostat (i.e., continuous culture) conditions. In some embodiments, the doubling time is at least 10, 12, 14, 16, or 18 hours under chemostat conditions.

In certain embodiments, a continuous culture of N. eutropha at an OD600 of about 0.15-0.18 is capable of reaching an OD600 of about 0.5-0.6 in about 1-2 days. For instance, in some embodiments, a continuous culture of N. eutropha may grow from an OD600 of about 0.15 to at least 0.3, 0.4, 0.5, 0.6, 0.7, or 0.8 over about 1 day; in embodiments the culture may reach an OD in range of 0.4-0.6 or 0.3-0.7 over about 1 day. In embodiments, the continuous culture of N. eutropha may grow from an OD600 of about 0.15 to at least 0.3, 0.4, 0.5, 0.6, 0.7, or 0.8 over about 2 days; in embodiments the culture may reach an OD in the range of 0.4-0.6 or 0.3-0.7 over about 2 days. In some embodiments, the continuous culture conditions comprise growth in a bioreactor in N. europaea medium, optionally comprising about 200 mM NH4+. In some embodiments, the continuous culture conditions are conditions set out in Example 2.

In certain embodiments, the N. eutropha are capable of converting NH4+ (e.g., at about 200 mM) to nitrite (e.g., reaching up to about 180 mM) at a rate of at least about 50, 75, 125, or 150 micromoles NO2 per minute, e.g., about 100-150, 75-175, 75-125, 100-125, 125-150, or 125-175 micromoles/minute, e.g., about 125 micromoles NO2 per minute. In some embodiments, the reaction rates are measured in an about 1 L chemostat culture of about 109 CFU/ml over the course of 24 hours.

In certain embodiments, the N. eutropha are capable of growing in medium comprising at least 50 mM, 75 mM, 100 mM, 125 mM, 150 mM, 175 mM, 200 mM, 225 mM, 250 mM, 275 mM, or 300 mM NH4+ (or NH3), e.g., about 150-200, 175-225, 200-250, 225-275, 250-300 mM, e.g., about 200 or about 250 mM. In certain embodiments, the N. eutropha is grown in a bioreactor under these concentrations of ammonium. In some embodiments, when the N. eutropha is grown under these concentrations of ammonium, the concentration of nitrate or nitrite is capable of reaching at least 60, 80, 100, 120, 140, 160, or 180 mM, e.g., about 140-180, 160-200, or 140-200 mM, e.g., about 160 or 180 mM.

In certain aspects, the present disclosure provides high density cultures of N. eutropha, e.g., N. eutropha strain D23. For instance, the high density culture composition may comprise a cell suspension of an actively dividing culture of N. eutropha bacteria having an OD600 of at least about 0.1, 0.2, 0.3, 0.4, 0.5, 0.6, or 0.7, e.g., about 0.2-0.6, 0.3-0.6, 0.4-0.6, 0.5-0.6, or 0.4-0.7, wherein the composition is substantially free of other organisms

In some embodiments, the N. eutropha are stable for at least 2 weeks, 1 month, 2 months, 3 months, 4 months, 5 months, or 6 months when stored at 4° C. In some embodiments, the method of storage comprises resuspending the cells in a buffer comprising one or more of Na2HPO4 and MgCl2, for instance 50 mM Na2HPO4 and 2 mM MgCl2, for instance the storage buffer described in Example 2. For example, the storage conditions may be those specified in Example 2. In some embodiments, the N. eutropha are continuously cultured at 200 mM NH4+ at a pH of 6-8, e.g., 7, before storage at 4°. Stability can include one or more of 1) retaining viability, 2) retaining a relevant property such as the ability to produce a given level of nitrite.

In certain embodiments, NH4+ and NH3 may be used interchangeably throughout the disclosure.

This disclosure provides, inter alia, a method of changing a composition of a skin microbiome of a subject. The method comprises administering, e.g., applying, a preparation comprising ammonia oxidizing bacteria to a surface of the skin, wherein the amount and frequency of administration, e.g., application, is sufficient to reduce the proportion of pathogenic bacteria on the surface of the skin.

Ammonia oxidizing bacteria are, in some embodiments, ubiquitous Gram-negative obligate chemolithoautotrophic bacteria with a unique capacity to generate energy exclusively from the conversion of ammonia to nitrite.

In some embodiments, the method may further comprise, selecting the subject on the basis of the subject being in need of a reduction in the proportion of pathogenic bacteria on the surface of the skin.

In some embodiments, the preparation comprising ammonia oxidizing bacteria comprises at least one of ammonia, ammonium salts, and urea.

In some embodiments, the preparation comprising ammonia oxidizing bacteria comprises a controlled release material, e.g., slow release material.

In some embodiments, the preparation of ammonia oxidizing bacteria, comprises an excipient, e.g., one of a pharmaceutically acceptable excipient or a cosmetically acceptable excipient. The excipient, e.g., one of the pharmaceutically acceptable excipient and the cosmetically acceptable excipient, may be suitable for one of topical, nasal, pulmonary, and gastrointestinal administration. The excipient, e.g., one of the pharmaceutically acceptable excipient and the cosmetically acceptable excipient may be a surfactant. The surfactant may be selected from the group consisting of cocamidopropyl betaine (ColaTeric COAB), polyethylene sorbitol ester (e.g., Tween 80), ethoxylated lauryl alcohol (RhodaSurf 6 NAT), sodium laureth sulfate/lauryl glucoside/cocamidopropyl betaine (Plantapon 611 L UP), sodium laureth sulfate (e.g., RhodaPex ESB 70 NAT), alkyl polyglucoside (e.g., Plantaren 2000 N UP), sodium laureth sulfate (Plantaren 200), Dr. Bronner's Castile soap, lauramine oxide (ColaLux Lo), sodium dodecyl sulfate (SDS), polysulfonate alkyl polyglucoside (PolySufanate 160 P), sodium lauryl sulfate (Stepanol-WA Extra K), and any combination thereof. Dr. Bronner's Castile soap comprises water, organic coconut oil, potassium hydroxide, organic olive oil, organic fair deal hemp oil, organic jojoba oil, citric acid, and tocopherol. In some embodiments, the excipient comprises one or more of, e.g., all of, water, organic coconut oil, potassium hydroxide, organic olive oil, organic fair deal hemp oil, organic jojoba oil, citric acid, and tocopherol.

In some embodiments, the preparation may be substantially free of other organisms.

In some embodiments, the preparation may be disposed in a powder, cosmetic, cream, stick, aerosol, salve, wipe, or bandage. The preparation may be provided as a powder, cosmetic, cream, stick, aerosol, salve, wipe, or bandage.

In some embodiments, the preparation may comprise a moisturizing agent, deodorizing agent, scent, colorant, insect repellant, cleansing agent, or UV-blocking agent.

In some embodiments, the excipient, e.g., the pharmaceutically acceptable excipient or the cosmetically acceptable excipient may comprise an anti-adherent, binder, coat, disintegrant, filler, flavor, color, lubricant, glidant, sorbent, preservative, or sweetener.

In some embodiments, the preparation comprising ammonia oxidizing bacteria may comprise between about 108 and about 1014 CFU/L. In certain aspects, the preparation may comprise between about 1×109 CFU/L and about 10×109 CFU/L.

In some embodiments, the preparation comprising ammonia oxidizing bacteria may comprise between about 50 milligrams (mg) and about 1000 mg of ammonia oxidizing bacteria.

In some embodiments, the mass ratio of ammonia oxidizing bacteria to the excipient, e.g., the pharmaceutically acceptable excipient or the cosmetically acceptable excipient is in a range of about 0.1 grams per liter to about 1 gram per liter.

In some embodiments, the preparation of ammonia oxidizing bacteria are useful in the treatment or prevention of a disease or condition associated with low nitrite levels, a treatment or prevention of body odor, a treatment to supply nitric oxide to a subject, or a treatment to inhibit microbial growth, e.g., pathogenic bacterial growth.

In some embodiments, the ammonia oxidizing bacteria is selected from the group consisting of Nitrosomonas, Nitrosococcus, Nitrosospria, Nitrosocystis, Nitrosolobus, Nitrosovibrio, and combinations thereof. The preparation may further comprise an organism selected from the group consisting of Lactobacillus, Streptococcus, Bifidobacter, and combinations thereof. In certain aspects, the preparation is substantially free of organisms other than ammonia oxidizing bacteria.

In some embodiments, the preparation comprising ammonia oxidizing bacteria may comprise ammonia oxidizing bacteria in a growth state. In some embodiments, the preparation comprising ammonia oxidizing bacteria may comprise ammonia oxidizing bacteria in a storage state.

In some embodiments, the methods of the present disclosure may be used to deliver a cosmetic product. In some embodiments, the methods of the present disclosure may be used to deliver a therapeutic product. The preparation may be useful for treatment of at least one of HIV dermatitis, infection in a diabetic foot ulcer, atopic dermatitis, acne, e.g., acne vulgaris, eczema, contact dermatitis, allergic reaction, psoriasis, uticaria, rosacea, skin infections, vascular disease, vaginal yeast infection, a sexually transmitted disease, heart disease, atherosclerosis, baldness, leg ulcers secondary to diabetes or confinement to bed, angina, particularly chronic, stable angina pectoris, ischemic diseases, congestive heart failure, myocardial infarction, ischemia reperfusion injury, laminitis, hypertension, hypertrophic organ degeneration, Raynaud's phenomenon, fibrosis, fibrotic organ degeneration, allergies, autoimmune sensitization, end stage renal disease, obesity, impotence, pneumonia, primary immunodeficiency, epidermal lysis bulosa, or cancer.

In certain aspects, the preparation may be useful for treatment of at least one of acne, e.g., acne vulgaris, eczema, psoriasis, uticaria, rosacea, and skin infections.

In some embodiments, the preparation may be provided in a container, the preparation and the container having a weight of less than about 50, 100, 200, 300, 400, 500, 600, 700, 800, 900, 1000, 1500, or 2000 grams.

In some embodiments, the preparation has less than about 0.1% to about 10% of surfactant. In certain aspects, the preparation may be substantially free of surfactant.

In some embodiments, the preparation may comprise a chelator. In some embodiments, the preparation may be substantially free of a chelator.

In some embodiments, the method may comprise applying the preparation about 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, or 24 times per day. In certain aspects, the preparation may be applied one time per day. In certain other aspects, the preparation may be applied two times per day.

In some embodiments, the preparation may be applied for about 1-3, 3-5, 5-7, 7-9, 5-10, 10-14, 12-18, 12-21, 21-28, 28-35, 35-42, 42-49, 49-56, 46-63, 63-70, 70-77, 77-84, or 84-91 days. In certain aspects, the preparation may be applied for about 16 days.

In some embodiments, the method may further comprise obtaining a sample from the surface of the skin. In certain aspects, the method may further comprise isolating DNA of bacteria in the sample. In certain aspects, the method may further comprise sequencing DNA of bacteria in the sample.

In some embodiments, administering the ammonia oxidizing bacteria provides for an increase in the proportion of non-pathogenic bacteria on the surface. In certain aspects, the non-pathogenic bacteria may be commensal non-pathogenic bacteria. In certain aspects, the non-pathogenic bacteria is commensal non-pathogenic bacteria of a genus of Staphylococcus. In certain aspects, the non-pathogenic bacteria may be commensal non-pathogenic bacteria Staphylococcus epidermidis.

In some embodiments, the proportion of non-pathogenic bacteria Staphylococcus is, or is identified as being, increased after about 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10 weeks. In certain aspects, the proportion of non-pathogenic bacteria Staphylococcus epidermidis Staphylococcus is, or is identified as being, increased after about 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10 weeks.

In some embodiments, potentially pathogenic or disease associated Propionibacteria is, or is identified as being, reduced after about 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10 weeks.

In some embodiments, potentially pathogenic or disease associated Stenotrophomonas is, or is identified as being, reduced after about 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10 weeks.

In some embodiments, the surface of the skin comprises a wound.

In some embodiments, a method of treating acne e.g., acne vulgaris, may be provided by one or more methods of the present disclosure. In some embodiments, a method of treating eczema may be provided by one or more methods of the present disclosure. In some embodiments, a method of treating psoriasis may be provided by one or more methods of the present disclosure. In some embodiments, a method of treating uticaria may be provided by one or more methods of the present disclosure. In some embodiments, a method of treating rosacea may be provided by one or more methods of the present disclosure. In some embodiments, a method of treating skin infection may be provided by one or more methods of the present disclosure. In some embodiments, a method of reducing an amount of undesirable bacteria on a surface of a subject is provided.

In some embodiments, the method herein (e.g., a method of administering a N. eutropha bacterium, e.g., a bacterium of strain D23 to a subject in need thereof), further comprise treating the subject with an antibiotic. In embodiments, the antibiotic is Tetracycline, a Lincosamide such as Clindamycin, a Macrolide such as Erythromycin, an Aminoglycoside such as Gentamicin, a β-lactam such as Piperacillin, β-lactamase inhibitor such as Tazobactam, or any combination thereof (such as a combination of a β-lactam such as Piperacillin and a β-lactamase inhibitor such as Tazobactam). In some embodiments, the antibiotic is an antibiotic to which the bacterium is sensitive. In embodiments, the antibiotic is administered after the bacterium has achieved the desired therapeutic effect. In embodiments, the antibiotic is an antibiotic to which the bacterium is resistant. In embodiments, the antibiotic is administered before or during the period in which the bacterium is producing its therapeutic effect.

It is understood that compositions and methods herein involving a bacterium can also involve a plurality of bacteria. For instance, a method of administering a N. eutropha bacterium can also involve administering a plurality of N. eutropha bacteria.

The present disclosure also provides, in certain aspects, a nucleic acid comprising a sequence of consecutive nucleotides (e.g., 15-100 nucleotides) from within the D23 genome, e.g., a sequence of a gene provided herein, e.g., a gene described in Table 1, FIG. 6-8 or Supplementary Table 1, or SEQ ID NO: 66, or a reverse complement of any of the foregoing. In a related aspect, the present disclosure provides a nucleic acid comprising a sequence of consecutive nucleotides (e.g., 15-100 nucleotides) from within SEQ ID NO: 1 or a reverse complement thereof. In a related aspect, the present disclosure provides a nucleic acid comprising a sequence of consecutive nucleotides (e.g., 15-100 nucleotides) from within a gene of Table 1 (e.g., a sequence of SEQ ID NO: 5, 7, 9, 11, 13, 15, 17, 19, 21, 23, 25, 27, 29, 31, or 33) or a reverse complement thereof.

In some embodiments, the nucleic acid has a non-naturally occurring sequence or another modification such as a label, or both. In some embodiments, the sequence of consecutive nucleotides is not a sequence found in N. Eutropha strain C91. In some embodiments, the nucleic acid comprises a heterologous sequence 5′ to the sequence of 15-100 consecutive nucleotides, or a heterologous sequence 3′ to the sequence of 15-100 consecutive nucleotides, or both. In some embodiments, the nucleic acid has a length of 10-15, 15-20, 20-25, 25-30, 30-24, 35-40 nucleotides. In some embodiments, the nucleic acid is bound, e.g., covalently bound, to a detectable label, e.g., a fluorescent label. In some embodiments, the nucleic acid comprises 10-15, 15-20, 20-25, 25-30, 30-24, 35-40, 40-50, 50-60, 60-70, 70-80, 80-90, or 90-100 consecutive nucleotides from within the D23 genome. In some embodiments, the nucleic acid comprises at least about 10, 15, 20, 25, 30, 35, 40, 50, 60, 70, 80, 90, 100, 150, 200, 250, 300, 350, 400, 450, 500, 600, 700, 800, 900, or 1000 consecutive nucleotides from within the D23 genome. In some embodiments, the nucleic acid is DNA.

In some aspects, the disclosure provides a composition or a kit comprising a first nucleic acid and a second nucleic acid. In some embodiments, the first nucleic acid comprises consecutive nucleotides (e.g., 15-100) from within SEQ ID NO: 1, SEQ ID NO: 66, a gene of FIGS. 6-8, or a gene of Table 1, or a reverse complement thereof. In some embodiments, the second nucleic acid comprises consecutive nucleotides (e.g., 15-100) from within SEQ ID NO: 1, SEQ ID NO: 66, a gene of FIGS. 6-8, or a gene of Table 1, or a reverse complement thereof. In some embodiments, the nucleic acid has a non-naturally occurring sequence, e.g., a sequence not found in N. eutropha strain C91. In some embodiments, the first nucleic acid and the second nucleic acid define an amplicon in a gene of Table 1, e.g., a sequence of SEQ ID NO: 5, 7, 9, 11, 13, 15, 17, 19, 21, 23, 25, 27, 29, 31, or 33) or a reverse complement thereof.

In some embodiments, the first nucleic acid has a sequence that corresponds to a first region of SEQ ID NO: 1, and the reverse complement of the second nucleic acid has a sequence that corresponds to a second region of SEQ ID NO: 1, and the first and second regions are separated by a distance suitable for PCR. In some embodiments, the reverse complement of the first nucleic acid has a sequence that corresponds to a first region of SEQ ID NO: 1, and the second nucleic acid has a sequence that corresponds to a second region of SEQ ID NO: 1, and the first and second regions are separated by a distance suitable for PCR. In an embodiment, the distance suitable for PCR is no more than 50, 100, 150, 200, 250, 300, 350, 400, 450, 500, 600, 700, 800, 900, or 1000 nucleotides of SEQ ID NO: 1. In some embodiments, the first nucleic acid and second nucleic acid delineate an amplicon in SEQ ID NO: 1. In some embodiments, the first nucleic acid and second nucleic acid each has a melting temperature (Tm) suitable for PCR, e.g., about 55-65° or about 60-65° C. In some embodiments, the Tm of the first nucleic acid is within 10, 9, 8, 7, 6, 5, 4, 3, 2, or 1° C. of the Tm of the second nucleic acid.

In some embodiments, the first nucleic acid, the second nucleic acid, or each of the first nucleic acid and second nucleic acid further comprises a heterologous sequence 5′ to the sequence of consecutive nucleotides. Alternatively or in combination, in some embodiments, the first nucleic acid, the second nucleic acid, or each of the first nucleic acid and second nucleic acid further comprises a heterologous sequence 3′ to the sequence of consecutive nucleotides from within SEQ ID NO: 1 or SEQ ID NO: 66. In some embodiments, the first nucleic acid, the second nucleic acid, or each of the first nucleic acid and second nucleic acid has a length of 15-20, 20-25, 25-30, 30-24, or 35-40 nucleotides. In some embodiments, the first nucleic acid, the second nucleic acid, or each of the first nucleic acid and second nucleic acid is bound, e.g., covalently bound, to a detectable label, e.g., a fluorescent label. In some embodiments, the first nucleic acid comprises, or consists of, a sequence of SEQ ID NO: 64. In some embodiments, the second nucleic acid comprises, or consists of, a sequence of SEQ ID NO: 65. In some embodiments, the first nucleic acid, the second nucleic acid, or both, are DNA.

In some embodiments, the composition or kit comprises at least two (e.g., 3, 4, 5, 6, 7, 8, 9, or 10) pairs of primers, each pair recognizing an amplicon in a gene of Table 1 (e.g., a sequence of SEQ ID NO: 5, 7, 9, 11, 13, 15, 17, 19, 21, 23, 25, 27, 29, 31, or 33) or a reverse complement thereof. In some embodiments, a first pair of primers recognizes an amplicon in an Amo gene (e.g., AmoA1, AmoA2, AmoB1, AmoB2, AmoC1, AmoC2, or AmoC3) and the second pair of primers recognizes an amplicon in an Amo gene (e.g., AmoA1, AmoA2, AmoB1, AmoB2, AmoC1, AmoC2, or AmoC3). In some embodiments, a first pair of primers recognizes an amplicon in an AmoA gene (e.g., AmoA1 or AmoA2). In some embodiments, a second pair of primers recognizes an amplicon in an AmoB gene (e.g., AmoB1 or AmoB2). In some embodiments, a third pair of primers recognizes an amplicon in an AmoC gene (e.g., AmoC1, AmoC2, or AmoC3).

In some embodiments, the kit comprises a first container in which the first nucleic acid is disposed and a second container in which the second nucleic acid is disposed. The kit may comprise additional containers, e.g., for a third, fourth, fifth, or sixth nucleic acid. In some embodiments, a pair of primers recognizing an amplicon is stored in a single container.

The present disclosure also provides, in some aspects, a nucleic acid comprising, or consisting of, the sequence of SEQ ID NO: 64. The present disclosure also provides, in some aspects, a nucleic acid comprising, or consisting of, the sequence of SEQ ID NO: 65. The present disclosure also provides, in some aspects, the present disclosure provides a molecule comprising a nucleic acid described herein and a detectable label, e.g., a fluorescent label. The nucleic acid may consist of a sequence of SEQ ID NO: 64 or SEQ ID NO: 65, for example.

The present disclosure provides, in some aspects, a composition comprising a first molecule and a second molecule. In some embodiments, the first molecule comprises a nucleic acid described herein, e.g., a nucleic acid consisting of the sequence of SEQ ID NO: 64, and optionally comprises a detectable label, e.g., a fluorescent label. In some embodiments, the second molecule comprises a nucleic acid described herein, e.g., a nucleic acid consisting of the sequence of SEQ ID NO: 65, and optionally comprises a detectable label, e.g., a fluorescent label.

In some embodiments, the kit comprises a first container in which the first molecule is disposed and a second container in which the second molecule is disposed.

In some embodiments, a kit described herein further comprises one or more of a buffer, an enzyme (e.g., a polymerase such as a thermostable polymerase such as Taq), nucleotides (e.g., dNTPs), and chain-terminating nucleotides (e.g., dideoxy nucleotides) which are optionally dye-labeled; these components may be provided separately or as part of a single composition.

In certain aspects, this disclosure provides a method of detecting whether a D23 N. eutropha nucleic acid is present in a sample, comprising: performing a polymerase chain reaction (PCR) on the sample using primers specific to D23 N. eutropha, and determining whether a PCR product is produced, wherein the presence of a PCR product indicates that the D23 N. eutropha nucleic acid was present in the sample. In embodiments, at least two PCR reactions are performed, e.g., 3, 4, 5, 6, 7, 8, 9 or 10 PCR reactions. In embodiments, the PCR reactions are performed in separate reaction volumes. In embodiments, two or more PCR reactions are performed in multiplex.

In some embodiments, the primers specific to D23 N. eutropha are a first nucleic acid and second nucleic acid described herein, e.g., a first and second nucleic acid from a composition or kit described herein. In some embodiments, the first primer comprises or consists of a sequence of SEQ ID NO: 65, and the second primer comprises or consists of a sequence of SEQ ID NO: 66.

In some embodiments, the PCR reaction is a quantitative or real-time PCR reaction. In some embodiments, the PCR reaction comprises a TaqMan reaction. In some embodiments, the PCR reaction comprises cycling the temperature of a reaction mixture between a denaturing temperature (e.g., about 95° C.), an annealing temperature (e.g., 45-68, 55-65, or 60-65° C.), and an elongation temperature (e.g., about 68° C.) for a number of cycles sufficient to produce a detectable PCR product, e.g., about 10, 15, 20, 25, or 30 cycles. In some embodiments, detecting the PCR product comprises detecting fluorescence from the PCR product. In some embodiments, a positive control is performed, e.g., using a known D23 N. eutropha nucleic acid as a template. In some embodiments, a negative control is used, e.g., using no template or using another bacterial nucleic acid as a template.

In certain aspects, the disclosure provides a method of detecting whether a D23 N. eutropha nucleic acid is present in a sample, comprising detecting binding of a nucleic acid described herein to a sample, wherein the presence of binding indicates that the D23 N. eutropha nucleic acid was present in the sample. In some embodiments, binding is detected by primer extension or RNase protection.

In some embodiments of the methods herein, the sample comprises at least 2, 3, 4, 5, 6, 7, 8, 9, or 10 strains of bacteria. In some embodiments, the sample is from the skin of a subject, e.g., a human subject. In some embodiments, the methods herein comprise detecting one or more additional types of bacterium in the sample, e.g., Pseudomonas aeruginosa, Staphylococcus aureus, Streptococcus pyogenes, or Acinetobacter baumannii.

The disclosure contemplates all combinations of any one or more of the foregoing aspects and/or embodiments, as well as combinations with any one or more of the embodiments set forth in the detailed description and examples.

BRIEF DESCRIPTION OF THE DRAWINGS

FIG. 1 shows the growth of a mixed culture of bacteria comprising N. eutropha strain D23. The optical density at a 600 nm wavelength is plotted relative to time.

FIG. 2A shows the nitrite production of a mixed culture of bacteria comprising N. eutropha strain D23. The nitrite concentration is plotted relative to time.

FIG. 2B-I shows the nitrite production kinetics by N. eutropha D23 in batch culture. The nitrite concentration is plotted relative to time.

FIG. 2B-II shows the nitrite production kinetics by N. eutropha D23 in vitro. The nitrite concentration is plotted relative to time.

FIG. 2C shows N. eutropha D23 stability upon storage at 4° C. The nitrite concentration is plotted relative to time.

FIG. 3A shows the N. eutropha D23's ability to inhibit the growth of P. aeruginosa (left panel) and S. aureus (right panel) in co-culture experiments. The amount of each type of undesirable bacteria (in CFU/ml) is plotted relative to time. In this figure, “AOB” refers to strain D23.

FIG. 3B shows the N. eutropha D23's ability to inhibit the growth of Streptococcus pyogenes (left panel) and Acinetobacter baumannii (right panel) in co-culture experiments. The amount of each type of undesirable bacteria (in CFU/ml) is plotted relative to time. In this figure, “AOB” refers to strain D23.

FIG. 3C shows the N. eutropha D23's ability to inhibit the growth of Propionibacterium acnes in co-culture experiments. The amount of each type of undesirable bacteria (in CFU/ml) is plotted relative to time. In this figure, “AOB” refers to strain D23.

FIG. 4A (top panel) plots the NO2 concentration over time in a co-culture experiment. The bottom panel plots pH over time in a co-culture experiment.

FIG. 4B (top panels) plots the CFU/ml of the indicated bacteria over time in a co-culture experiment. The center panels plot the NO2 concentration over time in a co-culture experiment.

The bottom panels plot pH over time in a co-culture experiment.

FIG. 4C plots the microbicidal activity of D23 against skin pathogens.

FIG. 4D plots the microbicidal activity of D23 against skin pathogens.

FIG. 4E shows an alternative plot of microbicidal activity of D23 against skin pathogens.

FIG. 5A plots the percent wound closure over time in an experiment testing D23's ability to improve wound healing.

FIG. 5B plots CT50 for various D23 treatments.

FIG. 5C plots the percent wound closure over time in an experiment testing D23's ability to improve wound healing.

FIG. 5D plots the percent wound closure over time in an experiment testing D23's ability to improve wound healing.

FIG. 5E plots CT50 for various D23 treatments.

FIG. 5F shows images of D23 enhanced wound healing in diabetic mice at Day 1, Day 11, and Day 15.

FIG. 5G shows blood glucose measurements for various concentrations of D23.

FIG. 5H shows body weight of test subjects over the course of testing.

FIG. 5I shows body weight of test subjects over the course of testing.

FIG. 5J shows PCR scores for a scalp test of subjects. AOB refers to D23 in this Figure.

FIG. 5K shows a schematic of a human volunteer study for an evaluation of a Nitrosomonas-containing topical suspension (AOB-001).

FIG. 5L (left panel) shows PCR analyses of scalp swabs collected during the study. Percent-positive samples for AOB-specific three-gene signature (amoA, amoB, amoC). The right panel shows PCR analyses of scalp swabs collected during the study. Composite PCR scores for a total of six samples collected from each of 23 volunteers. The scoring scheme used for the positive samples collected at each of six sampling points is indicated.

FIG. 5M shows genus-level bacterial diversity as determined by 16S rDNA sequencing in skin swab samples collected before and after topical application of AOB-001. The percentage of the total sequence reads representing each of twelve bacterial genera in samples collected at baseline prior to application (Day 0) and immediately after the one week application (Day 8), or one week after stopping topical application (Day 14), are shown. The proportions of Acinetobacter, Burkholderia, Enterobacter, Escherichia Shigella, Klebsiella, Nitrosomonas, Pantoea, Propionibacterium, Pseudomonas, Serratia, Staphylococcus, and Stenotrophomonas are shown.

FIG. 5N-A shows changes in abundance of Nitrosomonas and other species in skin samples collected before and after AOB-001 application. The percentages of the total 16S rDNA sequence reads representing Nitrosomonas prior to application (Day 0), immediately after the one-week application (Day 8), or one week after terminating application (Day 14) are shown.

FIG. 5N-B shows changes in abundance of Nitrosomonas and other species in skin samples collected before and after AOB-001 application. Changed patterns in abundance of species were detected by 16S rDNA sequencing in Day 0 versus Day 8 samples collected from AOB users.

FIG. 5O shows user evaluation of AOB-001. Assessment of AOB-001 cosmetic effects as provided by 23 volunteers upon completion of the one week application to their scalp and face. Subjects were plotted in order of increasing composite PCT scores. (2=agree strongly; 0=no change; −2=disagree strongly).

FIG. 6 is a table displaying unique D23 genes that have either an assigned open reading frame (ORF) number and a function based on sequence analysis, or a hypothetical gene above 200 base pairs in length. The column headers signify as follows: Feature.ID=a unique identifier for the gene; Type=type of gene, where CDS indicates a protein-coding DNA sequence; Start=starting position of gene in the genome sequence of SEQ ID NO: 1; Stop=end of gene in the genome sequence of SEQ ID NO: 1; Frame=reading frame; Length=length of gene in base pairs; Function=gene or protein function based on sequence analysis; Subsystem=category of gene function; D23GbkId=a gene identifier.

FIG. 7 is a table displaying unique D23 genes below 200 base pairs that have an assigned ORF number. Column headers are as described in FIG. 6.

FIG. 8 is a table displaying unique D23 genes with no assigned ORF number. Column headers are as described in FIG. 6.

FIG. 9 lists unique C91 genes that do not have a homolog in D23.

FIG. 10 is a sequence alignment between the AmoA1 and AmoA2 proteins in N. eutropha strains D23 and C91. The SEQ ID of each protein is listed in Table 1. FIG. 10 discloses SEQ ID NOS 6, 12, 36 and 42, respectively, in order of appearance.

FIG. 11 is a sequence alignment between the AmoB1 and AmoB2 proteins in N. eutropha strains D23 and C91. The SEQ ID of each protein is listed in Table 1. FIG. 11 discloses SEQ ID NOS 8, 14, 38 and 44, respectively, in order of appearance.

FIG. 12 is a sequence alignment between the AmoC1 and AmoC2 proteins in N. eutropha strains D23 and C91. The SEQ ID of each protein is listed in Table 1. FIG. 12 discloses SEQ ID NOS 34, 40, 10 and 4, respectively, in order of appearance.

FIG. 13 is a sequence alignment between the AmoC3 proteins in N. eutropha strains D23 and C91. The SEQ ID of each protein is listed in Table 1. FIG. 13 discloses SEQ ID NOS 46 and 16, respectively, in order of appearance.

FIG. 14 A and FIG. 14 B show a sequence alignment between the Hao1, Hao2, and Hao3 proteins in N. eutropha strains D23 and C91. The SEQ ID of each protein is listed in Table 1. FIG. 14 discloses SEQ ID NOS 20, 22, 18, 50, 52 and 48, respectively, in order of appearance.

FIG. 15 is a sequence alignment between the cycA1, cycA2, and cycA3 genes in N. eutropha strains D23 and C91. The SEQ ID of each protein is listed in Table 1. FIG. 15 discloses SEQ ID NOS 26, 28, 24, 58, 56 and 54, respectively, in order of appearance.

FIG. 16 is a sequence alignment between the cycB1 and cycB2 genes in N. eutropha strains D23 and C91. The SEQ ID of each protein is listed in Table 1. FIG. 16 discloses SEQ ID NOS 30, 32, 60 and 62, respectively, in order of appearance.

FIG. 17 shows a bar graph of proportion of bacteria, by genus versus day.

FIG. 18 shows a bar graph of proportion of bacteria, by genus versus bacteria genus, for day 0, day 1, day 8, day 14, and day 16.

Supplementary Table 1 displays the genome annotation of 2,777 genes identified in strain D23 using sequence analysis. Column headers are as described in FIG. 6. “C91 Alias” refers to a homolog in strain C91. Supplementary Table 1 is appended to the end of the Detailed Description and Examples.

Supplementary Table 2 displays the sequences of selected proteins genes identified in strain D23. Supplementary Table 2 is appended to the end of the Detailed Description and Examples.

DETAILED DESCRIPTION

Ammonia-oxidizing bacteria (AOB) of the genus Nitrosomonas are Gram-negative obligate autotrophic bacteria with a unique capacity to generate nitrite and nitric oxide exclusively from ammonia as an energy source. They are widely present both in soil and water environments and are essential components of environmental nitrification processes. Due to the roles of nitrite and nitric oxide on human skin as important components of several physiological functions, such as vasodilation, skin inflammation and wound healing, these bacteria may have beneficial properties for both healthy and immunopathological skin conditions. These bacteria may be safe for use in humans because they are slow-growing, cannot grow on organic carbon sources, may be sensitive to soaps and antibiotics, and have never been associated with any disease or infection in animals or humans.

1. DEFINITIONS

An ammonia oxidizing bacterium refers to a bacterium capable of oxidizing ammonia or ammonium to nitrite at a rate, e.g., a substantial rate, e.g., a pre-determined rate, e.g., at least the rate depicted in any one of FIG. 2A, 2B, 2C, 4A, 4B, or 5 or at least 90%, 80%, 70%, 60%, 50%, 40%, 30%, 20%, or 10% of that rate. In some embodiments, the substantial rate refers to the conversion of ammonium ions (NH4+)(e.g., at about 200 mM) to nitrite (NO2) at a rate of at least 50, 75, 125, or 150 micromoles NO2 per minute, e.g., about 100-150, 75-175, 75-125, 100-125, 125-150, or 125-175 micromoles/minute, e.g., about 125 micromoles NO2 per minute. Examples of ammonia oxidizing bacteria include N. eutropha strains D23 and C91, and other bacteria in the genera Nitrosomonas, Nitrosococcus, Nitrosospira, Nitrosocystis, Nitrosolobus, and Nitrosovibrio. D23 Nitrosomonas eutropha strain refers to the strain, designated AOB D23-100, deposited with the American Tissue Culture Collection (ATCC) on Apr. 8, 2014 having accession number PTA-121157. The D23 Nitrosomonas eutropha of accession number PTA-121157 has a genome sequence as set out in SEQ ID NO: 1 herein. The nucleic acid sequence(s), e.g., genome sequence, of accession number PTA-121157 are hereby incorporated by reference in their entireties.

Optimized Nitrosomonas eutropha (N. eutropha), as that term is used herein, refers to an N. eutropha having an optimized growth rate; an optimized NH4+ oxidation rate; or optimized resistance to NH4+. In an embodiment it differs from naturally occurring N. eutropha by at least one nucleotide, e.g., a nucleotide in a gene selected from ammonia monooxygenase, hydroxylamine oxidoreductase, cytochrome c554, and cytochrome cM552. The difference can arise, e.g., through selection of spontaneously arising mutation, induced mutation, or directed genetic engineering, of the N. eutropha. In an embodiment it differs from a naturally occurring N. eutropha in that it has a constellation of alleles, not present together in nature. These differences may provide for one or more of a treatment or prevention of a skin disorder, a treatment or prevention of a disease or condition associated with low nitrite levels, a treatment or prevention of body odor, a treatment to supply nitric oxide to a subject, and a treatment to inhibit microbial growth.

As used herein, “axenic” refers to a composition comprising an organism that is substantially free of other organisms. For example, an axenic culture of ammonia oxidizing bacteria is a culture that is substantially free of organisms other than ammonia oxidizing bacteria. For example, an axenic culture of N. eutropha is a culture that is substantially free of organisms other than N. eutropha. In some embodiments, “substantially free” denotes undetectable by a method used to detect other organisms, e.g., plating the culture and examining colony morphology, or PCR for a conserved gene such as 16S RNA. An axenic composition may comprise elements that are not organisms, e.g., it may comprise nutrients or excipients. Any embodiment, preparation, composition, or formulation of ammonia oxidizing bacteria discussed herein may comprise, consist essentially of, or consist of optionally axenic ammonia oxidizing bacteria.

Throughout this disclosure, formulation may refer to a composition or preparation.

As used herein, an “autotroph”, e.g., an autotrophic bacterium, is any organism capable of self-nourishment by using inorganic materials as a source of nutrients and using photosynthesis or chemosynthesis as a source of energy. Autotrophic bacteria may synthesize organic compounds from carbon dioxide and ATP derived from other sources, oxidation of ammonia to nitrite, oxidation of hydrogen sulfide, and oxidation of Fe2+ to Fe3+ Autotrophic bacteria of the present disclosure are incapable of causing infection.

Administered “in combination,” as used herein, means that two (or more) different treatments are delivered to the subject during the course of the subject's affliction with the disorder, e.g., the two or more treatments are delivered after the subject has been diagnosed with the disorder and before the disorder has been cured or eliminated. In some embodiments, the delivery of one treatment is still occurring when the delivery of the second begins, so that there is overlap. This is sometimes referred to herein as “simultaneous” or “concomitant” or “concurrent delivery”. In other embodiments, the delivery of one treatment ends before the delivery of the other treatment begins. This is sometimes referred to herein as “successive” or “sequential delivery.” In embodiments of either case, the treatment is more effective because of combined administration. For example, the second treatment is a more effective, e.g., an equivalent effect is seen with less of the second treatment, or the second treatment reduces symptoms to a greater extent, than would be seen if the second treatment were administered in the absence of the first treatment, or the analogous situation is seen with the first treatment. In some embodiments, delivery is such that the reduction in a symptom, or other parameter related to the disorder is greater than what would be observed with one treatment delivered in the absence of the other. The effect of the two treatments can be partially additive, wholly additive, or greater than additive (i.e., synergistic). The delivery can be such that an effect of the first treatment delivered is still detectable when the second is delivered.

Complete N. europaea medium refers to the N. europaea growth medium described in Ensign et al., “In vitro activation of ammonia monooxygenase from Nitrosomonas europaea by copper.” J Bacteriol. 1993 April; 175(7):1971-80.

To “culture” refers to a process of placing an amount of a desired bacterium under conditions that promote its growth, i.e., promoting cell division. The conditions can involve a specified culture medium, a set temperature range, and/or an agitation rate. Bacteria can be cultured in a liquid culture or on plates, e.g., agar plates.

The term “isolated,” as used herein, refers to material that is removed from its original or native environment (e.g., the natural environment if it is naturally occurring). For example, a naturally-occurring polynucleotide or polypeptide present in a living animal is not isolated, but the same polynucleotide or polypeptide, separated by human intervention from some or all of the co-existing materials in the natural system, is isolated. Such polynucleotides could be part of a vector and/or such polynucleotides or polypeptides could be part of a composition, and still be isolated in that such vector or composition is not part of the environment in which it is found in nature.

The terms “nucleic acid,” “nucleic acid sequence,” “nucleotide sequence,” or “polynucleotide sequence,” and “polynucleotide” are used interchangeably. They refer to a polymeric form of nucleotides of any length, e.g., deoxyribonucleotides or ribonucleotides, or analogs thereof. The polynucleotide may be either single-stranded or double-stranded, and if single-stranded may be the coding strand or non-coding (antisense) strand. A polynucleotide may comprise modified nucleotides, such as methylated nucleotides and nucleotide analogs. The sequence of nucleotides may be interrupted by non-nucleotide components. A polynucleotide may be further modified after polymerization, such as by conjugation with a labeling component.

The nucleic acid may be a recombinant polynucleotide, or a polynucleotide of genomic, cDNA, semisynthetic, or synthetic origin which either does not occur in nature or is linked to another polynucleotide in a nonnatural arrangement.

As used herein, the term “optimized growth rate” refers to one or more of: a doubling time of less than about 4, 5, 6, 7, 8, 9, or 10 hours when cultured under batch conditions as described herein in Example 2; a doubling time of less than about 16, 18, 20, 22, 24, or 26 hours, when grown under chemostat conditions as described herein in Example 2; or growing from an OD600 of about 0.15 to at least about 0.3, 0.4, 0.5, 0.6, 0.7, or 0.8 over about 1 or 2 days. In an embodiment, optimized growth rate is one having a doubling time that it is at least 10, 20, 30, 40, or 50% shorter than that of a naturally occurring N. eutropha.

As used herein, “optimized NH4+ oxidation rate” refers to a rate of at least about 50, 75, 125, or 150 micromoles per minute of converting NH3 or NH4+ into NO2. For instance, the rate may be at least about 50, 75, 125, or 150 micromoles per minute of converting NH4+ (e.g., at about 200 mM) to NO2. In an embodiment, an optimized NH4+ oxidation rate is one in which NH3 or NH4+ is converted into NO2′ at least 10, 20, 30, 40, or 50% more rapidly than is seen with a naturally occurring N. eutropha.

Percent (%) amino acid sequence identity, with respect to the amino acid sequences here (e.g., proteins expressed by N. eutropha D23) is defined as the percentage of amino acid residues in a candidate sequence that are identical with the amino acid residues in the reference sequence, which may be a naturally-occurring N. eutropha sequence or an N. eutropha D23 sequence, after aligning the sequences and introducing gaps, if necessary, to achieve the maximum percent sequence identity, and not considering any conservative substitutions as part of the sequence identity. Alignment for purposes of determining percent amino acid sequence identity can be achieved in various ways that are within the means of those skilled in the art, for instance, using publicly available computer software such as BLAST, ALIGN or Megalign (DNASTAR) software. Those skilled in the art can determine appropriate parameters for measuring alignment, including any algorithms needed to achieve maximal alignment over the full length of the sequences being compared. For instance, the WU-BLAST-2 software may be used to determine amino acid sequence identity (Altschul et al, Methods in Enzymology 266, 460-480 (1996); http://blast.wustl/edu/blast/README.html). WU-BLAST-2 uses several search parameters, most of which are set to the default values. The adjustable parameters are set with the following values: overlap span=1, overlap fraction=0.125, world threshold (T)=I 1. HSP score (S) and HSP S2 parameters are dynamic values and are established by the program itself, depending upon the composition of the particular sequence, however, the minimum values may be adjusted as appropriate.

Amino acid substitutions can be the result of replacing one amino acid with another amino acid having similar structural and/or chemical properties, such as the replacement of a leucine with a serine, i.e., conservative amino acid replacements. Typical but not limiting conservative substitutions are the replacements, for one another, among the aliphatic amino acids Ala, Val, Leu and Ile; interchange of Ser and Thr containing hydroxy residues, interchange of the acidic residues Asp and Glu, interchange between the amide-containing residues Asn and Gln, interchange of the basic residues Lys and Arg, interchange of the aromatic residues Phe and Tyr, and interchange of the small-sized amino acids Ala, Ser, Thr, Met and Gly. Additional conservative substitutions include the replacement of an amino acid by another of similar spatial or steric configuration, for example the interchange of Asn for Asp, or Gln for Glu. Amino acid substitutions can also be the result of replacing one amino acid with another amino acid having dis-similar structural and/or chemical properties, i.e., non-conservative amino acid replacements. Insertions or deletions may optionally be in the range of 1 to 5 amino acids. The variation allowed may be determined by systematically making insertions, deletions or substitutions of amino acids in the sequence and testing the resulting variants for activity in the in vivo or in vitro assays for, e.g., metabolizing urea or ammonia.

Percent (%) sequence identity with respect to the nucleic acid sequences here (e.g., the N. eutropha D23 genome and portions thereof) is defined as the percentage of nucleotides in a candidate sequence that are identical with the nucleotides in the reference sequence, which may be a naturally-occurring N. eutropha sequence or an N. eutropha D23 sequence, after aligning the sequences and introducing gaps, if necessary, to achieve the maximum percent sequence identity. Alignment for purposes of determining percent nucleotide sequence identity can be achieved in various ways that are within the means of those skilled in the art, for instance, using publicly available computer software such as BLAST. Those skilled in the art can determine appropriate parameters for measuring alignment, including any algorithms needed to achieve maximal alignment over the full length of the sequences being compared.

The terms “polypeptide”, “peptide” and “protein” (if single chain) are used interchangeably herein to refer to amino acid polymers. The polymer may be linear or branched, it may comprise modified amino acids, and it may be interrupted by non-amino acids. The terms also encompass an amino acid polymer that has been modified; for example, disulfide bond formation, glycosylation, lipidation, acetylation, phosphorylation, or any other manipulation, such as conjugation with a labeling component. The polypeptide can be isolated from natural sources, can be a produced by recombinant techniques from a eukaryotic or prokaryotic host, or can be a product of synthetic procedures.

As used herein, “optimized resistance to NH4+” refers to an ability to grow in conditions of greater than 50, 75, 100, 125, 150, 175, 200, 225, 250, 275, or 300 mM NH3 or NH4+ for at least about 24 or 48 hours. In an embodiment, an optimized resistance to NH4+ refers to the ability to grow at least 10, 20, 30, 40, or 50% more rapidly, or at least 10, 20, 30, 40, or 50% longer, in the presence of a selected concentration of NH3 or NH4+ than can a naturally occurring N. eutropha.

As used herein with respect to a comparison between nucleic acid or protein sequences, “similar” means having homology. A similar gene or protein may comprise, e.g., substitutions (such as conservative or non-conservative substitutions), insertions (e.g., of at least 1, 2, 3, 4, 5, 10, 15, 20, 25, 30 amino acids, and for example up to 2, 3, 4, 5, 10, 15, 20, 25, 30, or 50 amino acids, or any positive combination thereof, or the number of nucleotides necessary to encode said amino acids), or deletions (e.g., of at least 1, 2, 3, 4, 5, 10, 15, 20, 25, 30 amino acids, and for example up to 2, 3, 4, 5, 10, 15, 20, 25, 30, or 50 amino acids, or any positive combination thereof, or the number of nucleotides necessary to encode said amino acids), or any combination thereof. Each of substitutions, insertions, and deletions may be positioned at the N-terminus, C-terminus, or a central region of the protein or gene. In embodiments, a conservative substitution is one that does not alter the charge and/or polarity and/or approximate size and/or geometry at the substituted position.

As used herein, “transgenic” means comprising one or more exogenous portions of DNA. The exogenous DNA is derived from another organism, e.g., another bacterium, a bacteriophage, an animal, or a plant.

As used herein, treatment of a disease or condition refers to reducing the severity or frequency of at least one symptom of that disease or condition, compared to a similar but untreated patient. Treatment can also refer to halting, slowing, or reversing the progression of a disease or condition, compared to a similar but untreated patient. Treatment may comprise addressing the root cause of the disease and/or one or more symptoms.

As used herein a therapeutically effective amount refers to a dose sufficient to prevent advancement, or to cause regression of a disease or condition, or which is capable of relieving a symptom of a disease or condition, or which is capable of achieving a desired result. A therapeutically effective dose can be measured, for example, as a number of bacteria or number of viable bacteria (e.g., in CFUs) or a mass of bacteria (e.g., in milligrams, grams, or kilograms), or a volume of bacteria (e.g., in mm3).

As used herein, the term “viability” refers to the autotrophic bacteria's, e.g., ammonia oxidizing bacteria's, ability to oxidize ammonia, ammonium, or urea to nitrite at a pre-determined rate. In some embodiments, the rate refers to the conversion of ammonium ions (NH4+) (e.g., at about 200 mM) to nitrite (NO2) at a rate of at least 50, 75, 125, or 150 micromoles NO2 per minute, e.g., about 100-150, 75-175, 75-125, 100-125, 125-150, or 125-175 micromoles/minute, e.g., about 125 micromoles NO2 per minute.

“Growth media” or “AOB media,” as referred to herein comprises the following components of Table 3 or Table 4 herein.

In some embodiments, the states most relevant to the present disclosure are the state of growth, e.g., maximal growth, characterized by a pH of at least about 7.6, ammonia, trace minerals, oxygen and carbon dioxide. Another state may be characterized by a pH of about 7.4 or less and characterized by an absence of carbon dioxide. Under low carbon dioxide conditions, ammonia oxidizing bacteria, e.g., Nitrosomonas, continues to oxidize ammonia into nitrite and generates ATP, but lacking carbon dioxide, e.g., lacking sufficient carbon dioxide, to fix and generate protein, it instead generates polyphosphate, which it uses as an energy storage medium. This may allow the ammonia oxidizing bacteria to remain in a “storage state” for a period of time, e.g., a pre-determined period of time, for example, at least 1, 2, 3, 4, 5, 6, 7, days, 1, 2, 3, 4 weeks, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12 months, 1, 2, 3, 4, or 5 years. In some embodiments, the ammonia oxidizing bacteria may remain in a storage state for at least about 6 months to about 1 year.

As used herein, “growth state” refers to autotrophic bacteria, e.g., ammonia oxidizing bacteria, in a state or in an environment, e.g., a media, e.g., a culture media, e.g., a growth media, that may have a pH of at least about 7.6. Levels of at least one of ammonia, ammonium ions, and urea may be between about 1 micromolar and 1000 millimolar. Levels of trace materials are between about 0.01 micromolar iron and 200 micromolar iron. Levels of oxygen are between about 5% and 100% oxygen saturation (e.g., of media). Levels of carbon dioxide are between about 20 ppm and 10% saturation (e.g., of media). In certain aspects, levels of at least one of ammonia, ammonium ions, and urea may be between about 10 micromolar and 100 millimolar. Levels of trace materials are between about 0.1 micromolar iron and 20 micromolar iron. Levels of oxygen are between about 5% and 100% oxygen saturation. Levels of carbon dioxide are between about 200 ppm and 5% saturation (e.g., of media).

As used herein, “polyphosphate loading state” refers to autotrophic bacteria, e.g., ammonia oxidizing bacteria, in a state or in an environment, e.g., a media, e.g., a culture media, e.g., a growth media, that may have a pH of about 7.4, or less. Levels of at least one of ammonia, ammonium ions, and urea are between about 1 micromolar and 2000 millimolar. Levels of trace materials are between 0.01 micromolar iron and 200 micromolar iron. Levels of oxygen are between about 0% and 100% 02 saturation (e.g., of media). Levels of carbon dioxide are between/less than about zero and 400 ppm, and phosphate levels greater than about 1 micromolar. In certain aspects, levels of at least one of ammonia, ammonium ions, and urea are between about 10 micromolar and 200 millimolar. Levels of trace materials are between 0.1 micromolar iron and 20 micromolar iron. Levels of oxygen are between about 5% and 100% 02 saturation. Levels of carbon dioxide are between/less than about zero and 200 ppm, and phosphate levels greater than about 10 micromolar.

The polyphosphate loading state may be induced for a period of time, e.g., a pre-determined period of time. The pre-determined period of time may the time period that allows sufficient polyphosphate accumulation in the ammonia oxidizing bacteria. This pre-determined period of time is the period of time suitable to provide for sufficient polyphosphate loading to allow for the ammonia oxidizing bacteria to be stored for an extended period of time. The pre-determined period of time may be at least partially based on a period of time of about 0.2-10 times, 0.3-5 times, 0.5-3 times, 0.5-1.5 times, or 0.5 to 1 times the doubling time for the ammonia oxidizing bacteria. The pre-determined period of time may be at least partially based on a period of time of about one doubling time for the ammonia oxidizing bacteria. In some embodiments, the pre-determined period of time is between about 8 hours and 12 hours. In some embodiments, the pre-determined period of time is about 10 hours. In some embodiments, the pre-determined period of time is about 24 hours.

A purpose of the polyphosphate loading state may be to provide AOB with sufficient ammonia, ammonium ions, and/or urea, and O2 such that ATP can be produced, but to deny them CO2 and carbonate such that they are unable to use that ATP to fix CO2 and instead use that ATP to generate polyphosphate which may be stored by the bacteria.

As used herein, the term “storage state” refers to autotrophic bacteria, e.g., ammonia oxidizing bacteria, in a state or in an environment, e.g., a media, e.g., a culture media, e.g., a growth media, having a pH of about 7.4 or less (in some embodiments, the pH may be 7.6 or less). Levels of at least one of ammonia, ammonium ions, and urea are between about _1 and 1000 micromolar. Levels of trace materials are between about 0.1 and 100 micromolar. Levels of oxygen are between about 0 and 100% saturation (e.g., of media). Levels of carbon dioxide are between about 0 and 800 ppm. In certain aspects, levels of at least one of ammonia, ammonium ions, and urea are between about _10 and 100 micromolar. Levels of trace materials are between about 1 and 10 micromolar. Levels of oxygen are between about 0 and 100% saturation (e.g., of media). Levels of carbon dioxide are between about 0 and 400 ppm.

AOB are produced according to some embodiments of the present disclosure by generating AOB biomass during a growth state, then exposing the AOB to a polyphosphate loading state and then removing the media and resuspending the AOB in a buffer, e.g., a storage buffer (i.e., the storage state).

The ammonia oxidizing bacteria may remain in a “storage state” for a period of time, e.g., a pre-determined period of time, for example, at least 1, 2, 3, 4, 5, 6, 7, days, 1, 2, 3, 4 weeks, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12 months, 1, 2, 3, 4, or 5 years. In some embodiments, the ammonia oxidizing bacteria may remain in a storage state for at least about 6 months to about 1 year. Upon revival, the viability of the ammonia oxidizing bacteria is at least about 50%, 60%, 70%, 80%, 90%, or 100% of the viability as of the ammonia oxidizing bacteria prior to storage e.g., in a growth state). In some embodiments, the preparation of ammonia oxidizing bacteria may be prepared, such that no more than 10%, 20%, 30%, 40%, 50%, 60%, or 70% of the ability to oxidize NH4+ is lost upon storage at selected conditions.

The time that it takes to revive the ammonia oxidizing bacteria from a storage state (or a polyphosphate loading state) may be a pre-determined period of time. For example, the pre-determined period of time may be less than about 75 hours, or less than about 72 hours. The pre-determined period of time may at least partially based on a period time of about 0.2-10 times, 0.3-5 times, 0.5-3 times, 0.5-1.5 times, or 0.5 to 1 times the doubling time for the ammonia oxidizing bacteria. The pre-determined period of time may be at least partially based on a period of time of about one doubling time for the ammonia oxidizing bacteria. The pre-determined period of time may be between about 8 hours and 12 hours. The pre-determined period of time may be about 10 hours. The pre-determined time may be less than about 75 hours, 72 hours, 70 hours, 68 hours, 65 hours, 60 hours, 55 hours, 50 hours, 45 hours, 40 hours, 35 hours, 30 hours, 25 hours, 20 hours, 15 hours, 10 hours, 5 hours, 4 hours, 3, hours, 2 hours, or 1 hour. The pre-determined period of time may be between about 5 minutes and 5 hours. The pre-determined period of time may be about 5-10 minutes, 10-15 minutes, 15-20 minutes, 20-25 minutes, 25-30 minutes, 30-45 minutes, 45-60 minutes, 60 minutes-1.5 hours, 1.5 hours-2 hours, 2 hours-2.5 hours, 2.5 hours-3 hours, 3 hours-3.5 hours, 3.5 hours-4 hours, 4 hours-4.5 hours, 4.5 hours-5 hours. In some embodiments, the pre-determined period of time may be about 2 hours. The pre-determined period of time, e.g., may be the time it may take to achieve revival of the ammonia oxidizing bacteria, e.g., achieve viability of the ammonia oxidizing bacteria as compared to the viability of the bacteria prior to storage (e.g., in a growth state), e.g., at least about 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, 90%, 95%, 97%, 98%, 99%, or 100% viability.

2. AMMONIA OXIDIZING BACTERIA (AOBS), N. EUTROPHA STRAIN D23 AND SIMILAR BACTERIA

Autotrophic ammonia oxidizing bacteria, which may be referred to herein as AOBs or AOB, are obligate autotrophic bacteria as noted by Alan B. Hooper and A. Krummel at al. Alan B. Hooper, Biochemical Basis of Obligate Autotrophy in Nitrosomonas europaea, Journal of Bacteriology, February 1969, p. 776-779. Antje Krummel et al., Effect of Organic Matter on Growth and Cell Yield of Ammonia-Oxidizing Bacteria, Arch Microbiol (1982) 133: 50-54. These bacteria derive all metabolic energy only from the oxidation of ammonia to nitrite with nitric oxide (NO) as an intermediate product in their respiration chain and derive virtually all carbon by fixing carbon dioxide. They are incapable of utilizing carbon sources other than a few simple molecules.

Ammonia oxidizing bacteria (AOB) are widely found in the environment, and in the presence of ammonia, oxygen and trace metals will fix carbon dioxide and proliferate. AOB may be slow growing and toxic levels of ammonia may kill fish and other organisms before AOB can proliferate and reduce ammonia to non-toxic levels. Slow growth of AOB also may delay the health benefits of the NO and nitrite the AOB produce when applied to the skin.

Supplementing the aquarium, skin, or process with sufficient viable AOB grown and stored for that purpose is desired. AOB do not form spores, so storage in the dry state with high viability is difficult, and storage in the wet state leaves them metabolically active. Decay of nitrifying capacity during storage of AOB for wastewater treatment has been studied, as for example (Munz G, Lubello C, Oleszkiewicz J A. Modeling the decay of ammonium oxidizing bacteria. Water Res. 2011 January; 45(2): 557-64. Oi: 10.1016/j.watres.2010.09.022.)

Growth, prolonged storage, and restoration of activity of Nitrosomonas is discussed by Cassidy et al. (U.S. Pat. No. 5,314,542) where they disclose growing Nitrosomonas, removing toxic waste products, storing in sterile water of appropriate salinity for periods of time up to one year, and then reviving by adding buffer (CaCO3) and 200 ppm, of ammonium, which reviving takes 72 hours.

As obligate autotrophs, AOB synthesize protein via the fixing of CO2 using the energy and reducing equivalents generated by the oxidation of ammonia to nitrite. Growth requires ammonia, oxygen, minerals and carbon dioxide.

Nitrosomonas may exist in several metabolic states, according to “Polyphosphate and Orthophosphate Content of Nitrosomonas europaea as a Function of Growth” by K. R. Terry and A. B. Hooper, Journal of Bacteriology, July 1970, p. 199-206, Vol. 103, No. I.

In certain embodiments of the disclosure, the ammonia oxidizing bacteria may be axenic. The preparation (formulation or composition) of ammonia oxidizing bacteria may comprise, consist essentially of, or consist of axenic ammonia oxidizing bacteria. The ammonia oxidizing bacteria may be from a genus selected from the group consisting of Nitrosomonas, Nitrosococcus, Nitrosospria, Nitrosocystis, Nitrosolobus, Nitrosovibrio, and combinations thereof.

This disclosure provides, inter alia, N. eutropha strain D23, a unique, e.g., optimized strain of ammonia oxidizing bacteria that can increase production of nitric oxide and nitric oxide precursors on the surface of a subject, e.g., a human subject. This disclosure also provides methods of using the bacteria and articles comprising the bacteria.

In embodiments, the N. eutropha is non-naturally occurring. For instance, it may have accumulated desirable mutations during a period of selection. In other embodiments, desirable mutations may be introduced by an experimenter. In some embodiments, the N. eutropha may be a purified preparation, and may be an optimized N. eutropha.

In preferred embodiments, the N. eutropha strain is autotrophic and so incapable of causing infection. A preferred strain utilizes urea as well as ammonia, so that hydrolysis of the urea in sweat would not be necessary prior to absorption and utilization by the bacteria. Also, in order to grow at low pH, the bacteria may either absorb NH4+ ions or urea. The selected strain should also be capable of living on the external skin of a subject, e.g., a human, and be tolerant of conditions there.

Although this disclosure refers to N. eutropha strain D23 in detail, the preparations, methods, compositions, treatments, wearable articles, and articles of clothing may be used with one or more of: one or more other strains of N. eutropha, one or more other species of Nitrosomonas, and one or more other ammonia oxidizing bacteria. Autotrophic AOBs are obligate autotrophic bacteria as noted by Alan B. Hooper and A. Krummel at al. Alan B. Hooper, Biochemical Basis of Obligate Autotrophy in Nitrosomonas europaea, Journal of Bacteriology, February 1969, p. 776-779. Antje Krummel et al., Effect of Organic Matter on Growth and Cell Yield of Ammonia-Oxidizing Bacteria, Arch Microbiol (1982) 133: 50-54. These bacteria derive all metabolic energy only from the oxidation of ammonia to nitrite with nitric oxide (NO) as an intermediate product in their respiration chain and derive virtually all carbon by fixing carbon dioxide. They are incapable of utilizing carbon sources other than a few simple molecules.

In certain embodiments, the N. eutropha is the strain deposited with the American Tissue Culture Collection (ATCC) on Apr. 8, 2014, designated AOB D23-100 (25 vials) under accession number PTA-121157.

In certain embodiments, the N. eutropha comprises a chromosome having a sequence at least 70%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 99.5% identical to SEQ ID NO: 1 (the strain D23 whole-genome sequence).

In certain embodiments, a bacterium with the above-mentioned sequence characteristics has one or more of (1) an optimized growth rate as measured by doubling time, (2) an optimized growth rate as measured by OD600, (3) an optimized NH4+ oxidation rate, (4) an optimized resistance to NH4+, and (4) an optimized resistance to NO2. Particular sub-combinations of these properties are specified in the following paragraph.

In some embodiments, the N. eutropha described herein has one or more of: (1) an optimized growth rate as measured by doubling time, (2) an optimized growth rate as measured by OD600, (3) an optimized NH4+ oxidation rate, (4) an optimized resistance to, NH4+, and (4) an optimized resistance to, NO2. For instance, the bacterium may have properties (1) and (2); (2) and (3); (3) and (4); or (4) and (5) from the list at the beginning of this paragraph. As another example, the bacterium may have properties (1), (2), and (3); (1), (2), and (4); (1), (2), and (5); (1), (3), and (4); (1), (3), and (5); (1), (4), and (5); (2), (3), and (4); (2), (3), and (5), or (3), (4), and (5) from the list at the beginning of this paragraph. As a further example, the bacterium may have properties (1), (2), (3), and (4); (1), (2), (3), and (5); (1), (2), (4), and (5); (1), (3), (4), and (5); or (2), (3), (4), and (5) from the list at the beginning of this paragraph. In some embodiments, the bacterium has properties (1), (2), (3), (4), and (5) from the list at the beginning of this paragraph.

This disclosure also provides an axenic composition of N. eutropha having one or more of: (1) an optimized growth rate as measured by doubling time, (2) an optimized growth rate as measured by OD600, (3) an optimized NH4+ oxidation rate, (4) an optimized resistance to, NH4+, and (4) an optimized resistance to, NO2. For instance, the axenic N. eutropha composition may have properties (1) and (2); (2) and (3); (3) and (4); or (4) and (5) from the list at the beginning of this paragraph. As another example, the axenic N. eutropha composition may have properties (1), (2), and (3); (1), (2), and (4); (1), (2), and (5); (1), (3), and (4); (1), (3), and (5); (1), (4), and (5); (2), (3), and (4); (2), (3), and (5), or (3), (4), and (5) from the list at the beginning of this paragraph. As a further example, the axenic N. eutropha composition may have properties (1), (2), (3), and (4); (1), (2), (3), and (5); (1), (2), (4), and (5); (1), (3), (4), and (5); or (2), (3), (4), and (5) from the list at the beginning of this paragraph. In some embodiments, the axenic N. eutropha composition has properties (1), (2), (3), (4), and (5) from the list at the beginning of this paragraph.

N. eutropha strain D23, as deposited in the form of 25 vials on Apr. 8, 2014, in the ATCC patent depository, designated AOB D23-100, under accession number PTA-121157, comprises a circular genome having SEQ ID NO: 1 or its complement. Accordingly, in some embodiments, an N. eutropha strain described herein comprises a nucleic acid sequence, e.g., a genome, that is similar to SEQ ID NO: 1 or its complement.

For instance, the N. eutropha may comprise a nucleic acid sequence having a 1,000 base pair portion having at least about 80%, 85%, 90%, 95%, 97%, 98%, 99%, or 99.5% identity to a 1,000 base pair portion of SEQ ID NO: 1 or its complement. The 1,000 base pair portion may span, e.g., nucleotides (n*1,000)+1 to (n+1)*1,000, where n=0, 1, 2, 3 . . . 2538, e.g., nucleotides 1-1,000, 1,001-2,000, and so on through the end of SEQ ID NO: 1.

In embodiments, the N. eutropha comprises a nucleic acid sequence having a 2,000 base pair portion having at least about 80%, 85%, 90%, 95%, 97%, 98%, 99%, or 99.5% identity to a 2,000 base pair portion of SEQ ID NO: 1 or its complement. The 2,000 base pair portion may span, e.g., nucleotides (n*2,000)+1 to (n+1)*2,000, where n=0, 1, 2, 3 . . . 1269, e.g., nucleotides 1-2,000, 2,001-4,000, and so on through the end of SEQ ID NO: 1.

In embodiments, the N. eutropha comprises a nucleic acid sequence having a 5,000 base pair portion having at least about 80%, 85%, 90%, 95%, 97%, 98%, 99%, or 99.5% identity to a 5,000 base pair portion of SEQ ID NO: 1 or its complement. The 5,000 base pair portion may span, e.g., nucleotides (n*5,000)+1 to (n+1)*5,000, where n=0, 1, 2, 3 . . . 508, e.g., nucleotides 1-5,000, 5,001-10,000, and so on through the end of SEQ ID NO: 1.

In embodiments, the N. eutropha comprises a nucleic acid sequence having a 10,000 base pair portion having at least about 80%, 85%, 90%, 95%, 97%, 98%, 99%, or 99.5% identity to a 10,000 base pair portion of SEQ ID NO: 1 or its complement. The 10,000 base pair portion may span, e.g., nucleotides (n*10,000)+1 to (n+1)*10,000, where n=0, 1, 2, 3 . . . 254, e.g., nucleotides 1-10,000, 10,001-20,000, and so on through the end of SEQ ID NO: 1.

In embodiments, the N. eutropha comprises a nucleic acid sequence having a 20,000 base pair portion having at least about 80%, 85%, 90%, 95%, 97%, 98%, 99%, or 99.5% identity to a 20,000 base pair portion of SEQ ID NO: 1 or its complement. The 20,000 base pair portion may span, e.g., nucleotides (n*20,000)+1 to (n+1)*20,000, where n=0, 1, 2, 3 . . . 127, e.g., nucleotides 1-20,000, 20,001-40,000, and so on through the end of SEQ ID NO: 1.

In embodiments, the N. eutropha comprises a nucleic acid sequence having a 50,000 base pair portion having at least about 80%, 85%, 90%, 95%, 97%, 98%, 99%, or 99.5% identity to a 50,000 base pair portion of SEQ ID NO: 1 or its complement. The 50,000 base pair portion may span, e.g., nucleotides (n*50,000)+1 to (n+1)*50,000, where n=0, 1, 2, 3 . . . 51, e.g., nucleotides 1-50,000, 50,001-100,000, and so on through the end of SEQ ID NO: 1.

In embodiments, the N. eutropha comprises a nucleic acid sequence having a 100,000 base pair portion having at least about 80%, 85%, 90%, 95%, 97%, 98%, 99%, or 99.5% identity to a 100,000 base pair portion of SEQ ID NO: 1 or its complement. The 100,000 base pair portion may span, e.g., nucleotides (n*100,000)+1 to (n+1)*100,000, where n=0, 1, 2, 3 . . . 26, e.g., nucleotides 1-100,000, 100,001-20,000, and so on through the end of SEQ ID NO: 1.

In some aspects, the present disclosure provides a composition of N. eutropha comprising a chromosome at least about 70%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 99.5% identical to SEQ ID NO: 1. In some aspects, the present disclosure provides an axenic composition of N. eutropha comprising a chromosome at least about 70%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 99.5% identical to SEQ ID NO: 1.

In certain embodiments, the N. eutropha strain comprises a nucleic acid sequence, e.g., a genome, that hybridizes to SEQ ID NO: 1, or to the genome of the D23 strain deposited in the form of 25 vials with the ATCC patent depository on Apr. 8, 2014, designated AOB D23-100, under accession number PTA-121157, or their complements, under low stringency, medium stringency, high stringency, or very high stringency, or other hybridization condition described herein. As used herein, the term “hybridizes under low stringency, medium stringency, high stringency, or very high stringency conditions” describes conditions for hybridization and washing. Guidance for performing hybridization reactions can be found in Current Protocols in Molecular Biology, John Wiley & Sons, N.Y. (1989), 6.3.1-6.3.6, which is incorporated by reference. Aqueous and nonaqueous methods are described in that reference and either can be used. Specific hybridization conditions referred to herein are as follows: 1) low stringency hybridization conditions in 6× sodium chloride/sodium citrate (SSC) at about 45° C., followed by two washes in 0.2×SSC, 0.1% SDS at least at 50° C. (the temperature of the washes can be increased to 55° C. for low stringency conditions); 2) medium stringency hybridization conditions in 6×SSC at about 45° C., followed by one or more washes in 0.2×SSC, 0.1% SDS at 60° C.; 3) high stringency hybridization conditions in 6×SSC at about 45° C., followed by one or more washes in 0.2×SSC, 0.1% SDS at 65° C.; 4) very high stringency hybridization conditions are 0.5M sodium phosphate, 7% SDS at 65° C., followed by one or more washes at 0.2×SSC, 1% SDS at 65° C. Very high stringency conditions (4) are suitable conditions and the ones that should be used unless otherwise specified.

The genome of strain D23 (SEQ ID NO: 1) was compared with the genome of N. eutropha C91. An annotation of the D23 genome is shown in Supplementary Table 1, which lists the positions of 2,777 genes in SEQ ID NO: 1 as identified by sequence analysis. In certain embodiments, the N. eutropha described herein comprises one or more genes or proteins listed in Supplementary Table 1, or a gene or protein similar to one of said genes or proteins.

Accordingly, in some embodiments, the N. eutropha comprises a gene of Supplementary Table 1, or a protein encoded by said gene. In certain embodiments, the N. eutropha comprises a gene that is similar (e.g., at least 70%, 80%, 85%, 90%, 95%, 97%, 98%, 99%, or 99.5% identical) to a gene of Supplementary Table 1, or a protein encoded by said gene. In embodiments, the N. eutropha comprises genes or proteins that are identical or similar to at least 2, 3, 4, 5, 10, 20, 30, 40, 50, 100, 150, 200, 250, 300, 350, 400, 450, 500, 1000, 1500, 2000, 2500, or all the genes of Supplementary Table 1, or a protein encoded by said genes.

In some embodiments, the N. eutropha described herein (e.g., strain D23) comprises one or more genes or proteins that are absent from strain C91, or a gene or protein similar to one of said genes or proteins. Examples of these genes are set out in FIG. 6-8 and are described in more detail in Example 4 herein.

Accordingly, with respect to FIG. 6, in some embodiments, the N. eutropha comprises genes that are identical or similar (e.g., at least 70%, 80%, 85%, 90%, 95%, 97%, 98%, 99%, or 99.5% identical) to 1, 2, 3, 4, 5, 10, 15, 20, 30, 40, 50, 60, 70, 80, 90, 100, 110, 120, 130, 140, 150, 160, or all of the genes in FIG. 6. In some embodiments, the N. eutropha comprises proteins that are identical or similar (e.g., at least 70%, 80%, 85%, 90%, 95%, 97%, 98%, 99%, or 99.5% identical) to 1, 2, 3, 4, 5, 10, 15, 20, 30, 40, 50, 60, 70, 80, 90, 100, 110, 120, 130, 140, 150, 160, or all of the proteins encoded by the genes listed in FIG. 6.

With respect to FIG. 7, in some embodiments, the N. eutropha comprises genes that are identical or similar (e.g., at least 70%, 80%, 85%, 90%, 95%, 97%, 98%, 99%, or 99.5% identical) to 1, 2, 3, 4, 5, 10, 15, 20, 30, 40, 50, 60, 70, 80, 90, 100, 110, 120, 130, 140, 150, 160, or all of the genes in FIG. 7. In some embodiments, the N. eutropha comprises proteins that are identical or similar (e.g., at least 70%, 80%, 85%, 90%, 95%, 97%, 98%, 99%, or 99.5% identical) to 1, 2, 3, 4, 5, 10, 15, 20, 30, 40, 50, 60, 70, 80, 90, 100, 110, 120, 130, 140, 150, 160, or all of the proteins encoded by the genes listed in FIG. 7.

With respect to FIG. 8, in some embodiments, the N. eutropha comprises genes that are identical or similar (e.g., at least 70%, 80%, 85%, 90%, 95%, 97%, 98%, 99%, or 99.5% identical) to 1, 2, 3, 4, 5, 10, 15, 20, 30, 40, 50, 60, 70, 80, 90, 100, 110, 120, 130, 140, 150, 200, or all of the genes in FIG. 8. In some embodiments, the N. eutropha comprises proteins that are identical or similar (e.g., at least 70%, 80%, 85%, 90%, 95%, 97%, 98%, 99%, or 99.5% identical) to 1, 2, 3, 4, 5, 10, 15, 20, 30, 40, 50, 60, 70, 80, 90, 100, 110, 120, 130, 140, 150, 200, or all of the proteins encoded by the genes listed in FIG. 8.

With respect to FIGS. 6-8 collectively, in some embodiments, the N. eutropha comprises genes that are identical or similar (e.g., at least 70%, 80%, 85%, 90%, 95%, 97%, 98%, 99%, or 99.5% identical) to 1, 2, 3, 4, 5, 10, 20, 40, 60, 80, 100, 150, 200, 250, 300, 350, 400, 450, 500, or all of the genes in FIGS. 6-8. In some embodiments, the N. eutropha comprises proteins that are identical or similar (e.g., at least 70%, 80%, 85%, 90%, 95%, 97%, 98%, 99%, or 99.5% identical) to 1, 2, 3, 4, 5, 10, 20, 40, 60, 80, 100, 150, 200, 250, 300, 350, 400, 450, 500, or all of the proteins encoded by genes listed in FIGS. 6-8.

In some embodiments, the N. eutropha described herein (e.g., strain D23) lacks one or more genes or proteins that are unique to strain C91, or a gene or protein similar to one of said genes or proteins. Examples of these genes are set out in FIG. 9 and are described in more detail in Example 4 herein. Accordingly, in some embodiments, the N. eutropha described herein lacks at least 1, 2, 3, 4, 5, 10, 20, 50, 100, 150, 200, 250, or all of the genes of FIG. 9. In some embodiments, the N. eutropha described herein lacks up to 2, 3, 4, 5, 10, 20, 50, 100, 150, 200, 250, or all of the genes of FIG. 9. In embodiments, the N. eutropha described herein lacks about 1-5, 5-10, 10-20, 20-50, 50-100, 100-150, 150-200, 200-250, or 250-all of the genes of FIG. 9.

Sequencing of the D23 genome revealed several genes of potential interest, including genes involved in ammonia metabolism (e.g., ammonia monooxygenase, hydroxylamine oxidoreductase, cytochrome c554, and cytochrome cM552). All of these genes are present in multiple copies, and in general the copies are not identical to each other. One set of genes of interest is the ammonia monooxygenase synthesis operon amoCAB, which is present in two copies, along with a third copy of amoC. The operons have homologs in C91, i.e., Neut_2078/7/6 and Neut_2319/8/7. Another set of genes of interest is hydroxylamine oxidoreductase (hao), which is present in three copies. The hao homologs in C91 are designated Neut_1672, 1793, and 2335. A third set of genes of interest is the cytochrome c554 gene encoded by cycA, which is present in three copies. The corresponding C91 genes are designated Neut_1670, 1791, and 2333. A fourth set of genes of interest is the cytochrome cM552 genes encoded by cycB, which are present in two copies. The homologous C91 genes are designated Neut_1790 and 2332. Each group of genes is summarized in Table 1 and is discussed in more detail below.

TABLE 1
Sequences of ammonia metabolism genes in N. eutropha
strain D23.
SEQ ID in SEQ ID in
strain D23 strain C91 Type Gene name
1. ammonia monooxygenase
4 34 Protein amoC1
5 35 DNA amoC1
6 36 Protein amoA1
7 37 DNA amoA1
8 38 Protein amoB1
9 39 DNA amoB1
10 40 Protein amoC2
11 41 DNA amoC2
12 42 Protein amoA2
13 43 DNA amoA2
14 44 Protein amoB2
15 45 DNA amoB2
16 46 Protein amoC3
17 47 DNA amoC3
2. hydroxylamine oxidoreductase
18 48 Protein hao1
19 49 DNA hao1
20 50 Protein hao2
21 51 DNA hao2
22 52 Protein hao3
23 53 DNA hao3
3. cytochrome c554
24 54 Protein c554 cycA1
25 55 DNA c554 cycA1
26 56 Protein c554 cycA2
27 57 DNA c554 cycA2
28 58 Protein c554 cycA3
29 59 DNA c554 cycA3
4. cytochrome cM552
30 60 Protein cM552 cycB1
31 61 DNA cM552 cycB1
32 62 Protein cM552 cycB2
33 63 DNA cM552 cycB2

In some aspects, the N. eutropha described herein comprises genes identical to or similar to the genes and proteins of Table 1.

More particularly, in certain aspects, this disclosure provides a composition of N. eutropha, e.g., a purified preparation of N. eutropha comprising a nucleic acid sequence at least about 70%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 99.5% identical to an ammonia monooxygenase sequence of Table 1. In certain aspects, this disclosure provides a composition of N. eutropha comprising a nucleic acid sequence at least about 70%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 99.5% identical to a hydroxylamine oxidoreductase sequence of Table 1. In certain aspects, this disclosure provides a composition of N. eutropha comprising a nucleic acid sequence at least about 70%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 99.5% identical to a cytochrome c554 sequence of Table 1. In certain aspects, this disclosure provides a composition of N. eutropha comprising nucleic acid sequences at least about 70%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 99.5% identical to a cytochrome cM552 sequence of Table 1.

In certain aspects, this disclosure provides a composition of N. eutropha comprising an amino acid sequence at least about 70%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, 99.2%, 99.3%, 99.4%, 99.5%, or 99.6% identical to an ammonia monooxygenase sequence of Table 1. In certain aspects, this disclosure provides a composition of N. eutropha comprising an amino acid sequence at least about 70%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, 99.4%, 99.5%, 99.6%, or 99.7% identical to hydroxylamine oxidoreductase sequence of Table 1. In certain aspects, this disclosure provides a composition of N. eutropha comprising an amino acid sequence at least about 70%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, 99.1%, 99.2%, 99.3%, 99.5%, 99.6%, or 99.7% identical to a cytochrome c554 sequence of Table 1. In certain aspects, this disclosure provides a composition of N. eutropha comprising amino acid sequences at least about 70%, 80%, 85%, 90%, 95%, 96%, 97%, 97.1%, 97.2%, 97.5%, 98%, 98.5%, 98.6%, 98.7%, 98.8%, 99%, or 99.5% identical to a cytochrome cM552 sequence of Table 1.

In some embodiments, the N. eutropha are present in an axenic composition, and e.g., in the form of a purified preparation of optimized N. eutropha.

More particularly, in certain aspects, this disclosure provides an axenic composition of N. eutropha comprising a nucleic acid sequence at least about 70%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 98.5%, 98.8%, 98.9%, 99%, 99.2%, 99.3%, 99.4%, 99.5%, or 99.6% identical to an ammonia monooxygenase sequence of Table 1. In certain aspects, this disclosure provides an axenic composition of N. eutropha comprising a nucleic acid sequence at least about 70%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 99.5% identical to a hydroxylamine oxidoreductase sequence of Table 1. In certain aspects, this disclosure provides an axenic composition of N. eutropha comprising a nucleic acid sequence at least about 70%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 99.5% identical to a cytochrome c554 sequence of Table 1. In certain aspects, this disclosure provides an axenic composition of N. eutropha comprising nucleic acid sequences at least about 70%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 99.5% identical to a cytochrome cM552 sequence of Table 1.

In certain aspects, this disclosure provides an axenic composition of N. eutropha comprising an amino acid sequence at least about 70%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 98.5%, 98.8%, 98.9%, 99%, 99.2%, 99.3%, 99.4%, 99.5%, or 99.6% identical to an ammonia monooxygenase sequence of Table 1. In certain aspects, this disclosure provides an axenic composition of N. eutropha comprising an amino acid sequence at least about 70%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, 99.4%, 99.5%, 99.6%, or 99.7% identical to hydroxylamine oxidoreductase sequence of Table 1. In certain aspects, this disclosure provides an axenic composition of N. eutropha comprising an amino acid sequence at least about 70%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, 99.1%, 99.2%, 99.3%, 99.5%, 99.6%, or 99.7% identical to a cytochrome c554 sequence of Table 1. In certain aspects, this disclosure provides an axenic composition of N. eutropha comprising amino acid sequences at least about 70%, 80%, 85%, 90%, 95%, 96%, 97%, 97.1%, 97.2%, 97.5%, 98%, 98.5%, 98.6%, 98.7%, 98.8%, 99%, or 99.5% identical to a cytochrome cM552 sequence of Table 1.

In some embodiments, the N. eutropha comprises a gene or protein comprising a sequence at least about 70%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 99.5% identical to a strain D23 sequence of Table 1, e.g., any of SEQ IDs 4-33. Substitutions may be conservative or non-conservative; also, insertions and deletions are contemplated. In some embodiments, the N. eutropha comprises a gene or protein comprising a sequence of Table 1, e.g., any of SEQ IDs 4-33. In some embodiments, the protein has an N-terminal and/or C-terminal extension or deletion of up to about 1, 2, 3, 4, 5, 6, 8, 10, 15, 20, 25, 50, or 100 amino acids.

Alignment of the nucleic acid sequences of Table 1 shows the percent identity between homologs in C91 and D23. The following paragraphs discuss this percent identity and describe various genes having homology to the D23 genes of Table 1.

More specifically, the amoA1 genes are about 98.8% identical (i.e., at 821/831 positions). Accordingly, in some embodiments, the N. eutropha described herein comprise D23 nucleotides at at least 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, or all of the positions that differ in this gene between strains C91 and D23. In embodiments, the N. eutropha described herein comprise D23 nucleotides at at most 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, or all of the positions that differ in this gene between strains C91 and D23. In embodiments, the N. eutropha described herein comprise a gene at least about 98.8%, 98.9%, 99.0%, 99.2%, 99.4%, 99.6%, 99.8%, or 100% identical to the D23 amoA1 gene.

The amoA2 genes are about 98.8% identical (i.e., at 821/831 positions). Accordingly, in some embodiments, the N. eutropha described herein comprise D23 nucleotides at at least 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, or all of the positions that differ in this gene between strains C91 and D23. In embodiments, the N. eutropha described herein comprise D23 nucleotides at at most 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, or all of the positions that differ in this gene between strains C91 and D23. In embodiments, the N. eutropha described herein comprise a gene at least about 98.8%, 98.9%, 99.0%, 99.2%, 99.4%, 99.6%, 99.8%, or 100% identical to the D23 amoA2 gene.

The amoB1 genes are about 99.1% identical (i.e., at 1255/1266 positions). Accordingly, in some embodiments, the N. eutropha described herein comprise D23 nucleotides at at least 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, or all of the positions that differ in this gene between strains C91 and D23. In embodiments, the N. eutropha described herein comprise D23 nucleotides at at most 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, or all of the positions that differ in this gene between strains C91 and D23. In embodiments, the N. eutropha described herein comprise a gene at least about 99.1%, 99.2%, 99.4%, 99.6%, 99.8%, or 100% identical to the D23 amoB1 gene.

The amoB2 genes are about 99.1% identical (i.e., at 1254/1266 positions). Accordingly, in some embodiments, the N. eutropha described herein comprise D23 nucleotides at at least 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12 or all of the positions that differ in this gene between strains C91 and D23. In embodiments, the N. eutropha described herein comprise D23 nucleotides at at most 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12 or all of the positions that differ in this gene between strains C91 and D23. In embodiments, the N. eutropha described herein comprise a gene at least about 99.1%, 99.2%, 99.4%, 99.6%, 99.8%, or 100% identical to the D23 amoB2 gene.

The amoC1 genes are about 99.8% identical (i.e., at 814/816 positions). Accordingly, in some embodiments, the N. eutropha described herein comprise D23 nucleotides at at least 1, 2, or all of the positions that differ in this gene between strains C91 and D23. In embodiments, the N. eutropha described herein comprise D23 nucleotides at at most 1, 2, or all of the positions that differ in this gene between strains C91 and D23. In embodiments, the N. eutropha described herein comprise a gene at least about 99.8%, 99.9%, or 100% identical to the D23 amoC1 gene.

The amoC2 genes are about 99.8% identical (i.e., at 814/816 positions). Accordingly, in some embodiments, the N. eutropha described herein comprise D23 nucleotides at at least 1, 2, or all of the positions that differ in this gene between strains C91 and D23. In embodiments, the N. eutropha described herein comprise D23 nucleotides at at most 1, 2, or all of the positions that differ in this gene between strains C91 and D23. In embodiments, the N. eutropha described herein comprise a gene at least about 99.8%, 99.9%, or 100% identical to the D23 amoC2 gene.

The amoC3 genes are about 98.9% identical (i.e., at 816/825 positions). Accordingly, in some embodiments, the N. eutropha described herein comprise D23 nucleotides at at least 1, 2, 3, 4, 5, 6, 7, 8, 9, or all of the positions that differ in this gene between strains C91 and D23. In embodiments, the N. eutropha described herein comprise D23 nucleotides at at most 1, 2, 3, 4, 5, 6, 7, 8, 9, or all of the positions that differ in this gene between strains C91 and D23. In embodiments, the N. eutropha described herein comprise a gene at least about 98.9%, 99.0%, 99.2%, 99.4%, 99.6%, 99.8%, or 100% identical to the D23 amoC3 gene.

The hao1 genes are about 99.0% identical (i.e., at 1696/1713 positions). Accordingly, in some embodiments, the N. eutropha described herein comprise D23 nucleotides at at least 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, or all of the positions that differ in this gene between strains C91 and D23. In embodiments, the N. eutropha described herein comprise D23 nucleotides at at most 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, or all of the positions that differ in this gene between strains C91 and D23. In embodiments, the N. eutropha described herein comprise a gene at least about 99.0%, 99.2%, 99.4%, 99.6%, 99.8%, or 100% identical to the D23 hao1 gene.

The hao2 genes are about 99.4% identical (i.e., at 1702/1713 positions). Accordingly, in some embodiments, the N. eutropha described herein comprise D23 nucleotides at at least 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, or all of the positions that differ in this gene between strains C91 and D23. In embodiments, the N. eutropha described herein comprise D23 nucleotides at at most 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, or all of the positions that differ in this gene between strains C91 and D23. In embodiments, the N. eutropha described herein comprise a gene at least about 99.4%, 99.6%, 99.8%, or 100% identical to the D23 hao2 gene.

The hao3 genes are about 99.2% identical (i.e., at 1700/1713 positions). Accordingly, in some embodiments, the N. eutropha described herein comprise D23 nucleotides at at least 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, or all of the positions that differ in this gene between strains C91 and D23. In embodiments, the N. eutropha described herein comprise D23 nucleotides at at most 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, or all of the positions that differ in this gene between strains C91 and D23. In embodiments, the N. eutropha described herein comprise a gene at least about 99.2%, 99.4%, 99.6%, 99.8%, or 100% identical to the D23 hao3 gene.

The cycA1 genes are about 98.0% identical (i.e., at 694/708 positions). Accordingly, in some embodiments, the N. eutropha described herein comprise D23 nucleotides at at least 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, or all of the positions that differ in this gene between strains C91 and D23. In embodiments, the N. eutropha described herein comprise D23 nucleotides at at most 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, or all of the positions that differ in this gene between strains C91 and D23. In embodiments, the N. eutropha described herein comprise a gene at least about 98.0%, 98.2%, 98.4%, 98.6%, 98.8%, 99.0%, 99.2%, 99.4%, 99.6%, 99.8%, or 100% identical to the D23 cycA1 gene.

The cycA2 genes are about 98.7% identical (i.e., at 699/708 positions). Accordingly, in some embodiments, the N. eutropha described herein comprise D23 nucleotides at at least 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, or all of the positions that differ in this gene between strains C91 and D23. In embodiments, the N. eutropha described herein comprise D23 nucleotides at at most 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, or all of the positions that differ in this gene between strains C91 and D23. In embodiments, the N. eutropha described herein comprise a gene at least about 98.7%, 98.8%, 99.0%, 99.2%, 99.4%, 99.6%, 99.8%, or 100% identical to the D23 cycA2 gene.

The cycA3 genes are about 99.3% identical (i.e., at 703/708 positions). Accordingly, in some embodiments, the N. eutropha described herein comprise D23 nucleotides at at least 1, 2, 3, 4, 5, or all of the positions that differ in this gene between strains C91 and D23. In embodiments, the N. eutropha described herein comprise D23 nucleotides at at most 1, 2, 3, 4, 5, or all of the positions that differ in this gene between strains C91 and D23. In embodiments, the N. eutropha described herein comprise a gene at least about 99.3%, 99.4%, 99.6%, 99.8%, or 100% identical to the D23 cycA3 gene.

The cycB1 genes are about 96.7% identical (i.e., at 696/720 positions). Accordingly, in some embodiments, the N. eutropha described herein comprise D23 nucleotides at at least 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, or all of the positions that differ in this gene between strains C91 and D23. In embodiments, the N. eutropha described herein comprise D23 nucleotides at at most 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, or all of the positions that differ in this gene between strains C91 and D23. In embodiments, the N. eutropha described herein comprise a gene at least about 96.7%, 96.8%, 97.0%, 97.2%, 97.4%, 97.6%, 97.8%, 98.0%, 98.2%, 98.4%, 98.4%, 98.6%, 98.8%, 99.0%, 99.2%, 99.4%, 99.6%, 99.8%, or 100% identical to the D23 cycB1 gene.

The cycB2 genes are about 97.1% identical (i.e., at 702/723 positions). Accordingly, in some embodiments, the N. eutropha described herein comprise D23 nucleotides at at least 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, or all of the positions that differ in this gene between strains C91 and D23. In embodiments, the N. eutropha described herein comprise D23 nucleotides at at most 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, or all of the positions that differ in this gene between strains C91 and D23. In embodiments, the N. eutropha described herein comprise a gene at least about 97.1%, 97.2%, 97.4%, 97.6%, 97.8%, 98.0%, 98.2%, 98.4%, 98.4%, 98.6%, 98.8%, 99.0%, 99.2%, 99.4%, 99.6%, 99.8%, or 100% identical to the D23 cycB2 gene.

The following four paragraphs describe genes and proteins of Table 1 in more detail.

Ammonia monooxygenase is an enzyme involved in ammonia oxidation, that catalyzes the reaction NH3+O2+2e+2H+ NH2OH+H2O (Ensign et al., 1993). In N. eutropha strain D23, the ammonia monooxygenase operon comprises three genes designated amoA, amoB, and amoC. Strain D23 comprises two copies of the entire operon, and a third copy of amoC. These genes and the corresponding proteins are listed in Table 1 above. In certain embodiments, the N. eutropha described herein comprise 1 or 2 ammonia monooxygenase subunit A genes and/or protein of Table 1 (e.g., the D23 sequences of Table 1), or genes and/or proteins similar thereto. In some embodiments, the N. eutropha described herein comprise 1 or 2 ammonia monooxygenase subunit B genes and/or proteins of Table 1 (e.g., the D23 sequences of Table 1), or genes and/or proteins similar thereto. In certain embodiments, the N. eutropha described herein comprise 1, 2, or 3 ammonia monooxygenase subunit C genes and/or proteins of Table 1 (e.g., the D23 sequences of Table 1), or genes and/or proteins similar thereto. In some embodiments, the N. eutropha described herein comprise at least one or two each of (a) an ammonia monooxygenase subunit A gene and/or protein of Table 1 (e.g., the D23 sequences of Table 1), (b) an ammonia monooxygenase subunit B gene and/or protein of Table 1 (e.g., the D23 sequences of Table 1), and (c) an ammonia monooxygenase subunit C gene and/or protein of Table 1 (e.g., the D23 sequences of Table 1). For instance, the N. eutropha may comprise all of the ammonia monooxygenase genes and/or proteins of Table 1 (e.g., the D23 sequences of Table 1), or genes and/or proteins similar thereto. Even more specifically, in some embodiments, the N. eutropha comprises all of the D23 ammonia monooxygenase genes of Table 1. In some embodiments, the N. eutropha comprises all of the D23 ammonia monooxygenase proteins of Table 1. Hydroxylamine oxidoreductases catalyze the general reaction NH2OH+O2 NO2+H2O. They typically use heme as a cofactor. N. eutropha strain D23 comprises three hydroxylamine oxidoreductases, designated hao1, hao2, and hao3. These genes and the corresponding proteins are listed in Table 1 above. In some embodiments, the N. eutropha described herein comprise 1, 2, or 3 hydroxylamine oxidoreductase genes and/or proteins of Table 1 (e.g., the D23 sequences of Table 1), or genes and/or proteins similar thereto. For instance, the N. eutropha may comprise all of the hydroxylamine oxidoreductase genes and/or proteins of Table 1 (e.g., the D23 sequences of Table 1), or genes and/or proteins similar thereto. Even more specifically, in some embodiments, the N. eutropha comprises all of the D23 hydroxylamine oxidoreductase genes of Table 1. In some embodiments, the N. eutropha comprises all of the D23 hydroxylamine oxidoreductase proteins of Table 1.

The capacity of D23 to aerobically catabolize ammonia as the sole source of energy and reductant requires two specialized protein complexes, Amo and Hao as well as the cytochromes c554 and cm552, which relay the electrons to the quinone pool. The NO reductase activity of c554 is important during ammonia oxidation at low oxygen concentrations. N. eutropha strain D23 comprises three cytochrome c554 genes, designated cycA1, cycA2, and cycA3. These genes and the corresponding proteins are listed in Table 1 above. In some embodiments, the N. eutropha described herein comprise 1, 2, or 3 cytochrome c554 genes and/or proteins of Table 1 (e.g., the D23 sequences of Table 1), or genes and/or proteins similar thereto. For instance, the N. eutropha may comprise all of the cytochrome c554 genes and/or proteins of Table 1 (e.g., the D23 sequences of Table 1), or genes and/or proteins similar thereto. Even more specifically, in some embodiments, the N. eutropha comprises all of the D23 cytochrome c554 genes of Table 1. In some embodiments, the N. eutropha comprises all of the D23 cytochrome c554 proteins of Table 1.

The capacity of D23 to aerobically catabolize ammonia as the sole source of energy and reductant requires two specialized protein complexes, Amo and Hao as well as the Cytochromes c554 and cM552, which relay the electrons to the quinone pool. Cytochrome cM552 reduces quinones, with electrons originating from Hao. N. eutropha strain D23 comprises two cytochrome cM552 genes, designated cycB1 and cycB2. These genes and the corresponding proteins are listed in Table 1 above. In some embodiments, the N. eutropha described herein comprise 1 or 2 cytochrome cM552 genes and/or proteins of Table 1 (e.g., the D23 sequences of Table 1), or genes and/or proteins similar thereto. For instance, the N. eutropha may comprise both of the cytochrome cM552 genes and/or proteins of Table 1 (e.g., the D23 sequences of Table 1), or genes and/or proteins similar thereto. Even more specifically, in some embodiments, the N. eutropha comprises both of the D23 cytochrome cM552 genes of Table 1. In some embodiments, the N. eutropha comprises both of the D23 Cytochrome cM552 proteins of Table 1.

In some embodiments, the N. eutropha described herein comprises a combination of genes and/or proteins selected from Table 1. This combination may comprise, for instance, genes and/or proteins listed in the preceding four paragraphs. For instance, the combination may comprise genes and/or proteins from two classes within Table 1. Accordingly, in some embodiments, the N. eutropha comprises one or more ammonia monooxygenase genes and/or proteins and one or more hydroxylamine oxidoreductase genes and/or proteins as described in Table 1, or as described in the preceding four paragraphs. In embodiments, the N. eutropha comprises one or more ammonia monooxygenase genes and/or proteins and one or more cytochrome c554 genes and/or proteins as described in Table 1, or as described in the preceding four paragraphs. In embodiments, the N. eutropha comprises one or more ammonia monooxygenase genes and/or proteins and one or more cytochrome cM552 genes and/or proteins as described in Table 1, or as described in the preceding four paragraphs. In embodiments, the N. eutropha comprises one or more hydroxylamine oxidoreductase genes and/or proteins and one or more cytochrome c554 genes and/or proteins as described in Table 1, or as described in the preceding four paragraphs. In embodiments, the N. eutropha comprises one or more hydroxylamine oxidoreductase genes and/or proteins and one or more cytochrome cM552 genes and/or proteins as described in Table 1, or as described in the preceding four paragraphs.

The combination may also comprise genes and/or proteins from three classes within Table 1. Accordingly, in some embodiments, the N. eutropha comprises one or more ammonia monooxygenase genes and/or proteins and one or more hydroxylamine oxidoreductase genes and/or proteins and one or more cytochrome c554 genes and/or proteins as described in Table 1, or as described in the aforementioned four paragraphs. In embodiments, the N. eutropha comprises one or more ammonia monooxygenase genes and/or proteins and one or more hydroxylamine oxidoreductase genes and/or proteins and one or more cytochrome cM552 genes and/or proteins as described in Table 1, or as described in the aforementioned four paragraphs. In embodiments, the N. eutropha comprises one or more one or more ammonia monooxygenase genes and/or proteins and one or more cytochrome c554 genes and/or proteins and/or one or more cytochrome cM552 genes and/or proteins as described in Table 1, or as described in the aforementioned four paragraphs. In embodiments, the N. eutropha comprises one or more one or more hydroxylamine oxidoreductase genes and/or proteins and one or more cytochrome c554 genes and/or proteins and/or one or more cytochrome cM552 genes and/or proteins as described in Table 1, or as described in the aforementioned four paragraphs.

The combination may comprise genes and/or proteins from all four classes within Table 1. Accordingly, in some embodiments, the N. eutropha comprises one or more ammonia monooxygenase genes and/or proteins and one or more hydroxylamine oxidoreductase genes and/or proteins and one or more cytochrome c554 genes and/or proteins and/or one or more cytochrome cM552 genes as described in Table 1, or as described in the aforementioned four paragraphs.

Table 2 (below) lists sequence differences between the D23 and C91 proteins of Table 1. For example, AmoA1 has M at position 1 in C91 but V at position 1 in D23, and this difference is abbreviated as M1V in Table 2. As another example, the D23 CycB1 has an insertion of DDD between residues 194 and 195 of the C91 protein, so that the added residues are residues number 195, 196, and 197 of the D23 protein and this difference is abbreviated as 195insD, 196insD, and 197insD respectively in Table 2. The sequence alignments that form the basis for Table 2 are shown in FIGS. 10-16.

TABLE 2
Amino acid sequence differences between N. eutropha
strains D23 and C91
Protein Sequence characteristics of D23 compared to C91
1. ammonia monooxygenase
AmoA1 M1V, M160L, P167A
AmoA2 M1V, M160L, P167A
AmoB1 I33V, V165I
AmoB2 I33V, V165I
AmoC1 N/A
AmoC2 N/A
AmoC3 V79A, I271V
2. hydroxylamine oxidoreductase
Hao1 N85S, V163A, G312E
Hao2 N85S, G312E
Hao3 N85S, G312E
3. cytochrome c554
c554 CycA1 A65T, A186T
c554 CycA2 A65T
c554 CycA3 A65T
4. cytochrome cM552
cM552 CycB1 I63V, S189P, D194G, 195insD, 196insD,
197insD, 206insE, 207insE
cM552 CycB2 I63V, S189P, 206insE, 207insE

Accordingly, the N. eutropha described herein may comprise one or more of the sequence characteristics listed in Table 2. For instance, the N. eutropha may comprise at least 1, 2, 3, 4, 5, 10, 15, 20, 25, 30, or all of the sequence characteristics of Table 2. In some embodiments, the N. eutropha comprises no more than 2, 3, 4, 5, 10, 15, 20, 25, 30, or all of the sequence characteristics of Table 2. In embodiments, the N. eutropha comprises 1-5, 5-10, 10-15, 15-20, 20-25, 25-30, or all of the sequence characteristics of Table 2. The N. eutropha may also comprise fragments of said proteins.

As to individual categories of genes or proteins, in some embodiments, the N. eutropha comprises at least 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, or all of the sequence characteristics of Table 2, Section 1 (which describes ammonia monooxygenases). In embodiments, the N. eutropha comprises 1-5, 3-7, 4-8, or 5-10 of the sequence characteristics of Table 2, Section 1. For instance, in some embodiments, the N. eutropha comprises at least 1, 2, or 3 sequence characteristics of an amoA gene or protein as listed in Table 2, and/or no more than 2 or 3 of these characteristics. The N. eutropha may also comprise at least 1 or 2 sequence characteristics of an amoB gene or protein as listed in Table 2. In addition, the N. eutropha may comprise at least 1 or 2 sequence characteristics of the amoC3 gene as listed in Table 2. The N. eutropha may also comprise fragments of said proteins.

With respect to hao genes and proteins, the N. eutropha may comprise at least 1, 2, 3, 4, 5, 6, 7, 8, or all of the sequence characteristics of Table 2, Section 2 (which describes hydroxylamine oxidoreductases). In embodiments, the N. eutropha comprises 1-4, 2-5, 3-6, or 4-8 of the sequence characteristics of Table 2, Section 2. The N. eutropha may also comprise at least 1, 2 or 3 sequence characteristics of Hao1 as listed in Table 1, and/or no more than 2 or 3 of these characteristics. The N. eutropha may also comprise at least 1 or 2 sequence characteristics of Hao2 or Hao3 as listed in Table 2. The N. eutropha may also comprise fragments of said proteins.

Turning now to cytochrome c554, the N. eutropha may comprise at least 1, 2, 3, 4, or all of the sequence characteristics of Table 2, Section 3 (which describes cytochrome c554). In embodiments, the N. eutropha comprises at most 2, 3, 4, or all of the sequence characteristics of Table 2 Section 3. In embodiments, the N. eutropha comprises at least 1 or 2 sequence characteristics of cytochrome c554 CycA1 as listed in Table 2. The N. eutropha may also comprise at least 1 sequence characteristic of c554 CycA2 or c554 CycA3 as listed in Table 2. The N. eutropha may also comprise fragments of said proteins.

With respect to the cM552 genes and proteins, the N. eutropha may comprise at least 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, or all of the sequence characteristics of Table 2, Section 4 (which describes cytochrome cM552). In embodiments, the N. eutropha comprises at most 2, 3, 4, 5, 6, 7, 8, 9, 10, or all the sequence characteristics of Table 2, Section 4. For instance, in embodiments the N. eutropha comprises 1-5, 2-7, 3-8, or 5-10 sequence characteristics of Table 2, Section 4. In embodiments, at least 1, 2, 3, 4, 5, 6, or 7 sequence characteristics of cM552 CycB1 as listed in Table 2, and/or no more than 2, 3, 4, 5, 6, or 7 of these characteristics. The N. eutropha may also comprise at least 1, 2, or 3 sequence characteristics of cM552 CycB2 as listed in Table 2, and/or no more than 2 or 3 of these characteristics. The N. eutropha may also comprise fragments of said proteins.

It is understood that the paragraphs above, which refer to sequence characteristics of various N. eutropha proteins, also describe the sequences of nucleic acids that encode these proteins.

The sequencing analysis described herein revealed that strain D23 lacks plasmids. Consequently, in some embodiments, the N. eutropha bacterium lacks plasmids, i.e., all of its DNA is contained in the chromosome. In some embodiments, the N. eutropha bacterium lacks endogenous plasmids, but carries one or more transgenic plasmids.

This D23 strain is not believed to be a product of nature, but rather has acquired certain mutations and characteristics during an extended period of culture and selection in the laboratory. For instance, D23 has an ability to grow in conditions of greater than about 200 or 250 mM NH4+ for more than 24 hours.

In some embodiments, the N. eutropha disclosed herein differ from naturally occurring bacteria in the abundance of siderophores. For instance, the N. eutropha may have elevated or reduced levels of siderophores compared to N. eutropha C91. Generally, siderophores are secreted iron-chelating compounds that help bacteria scavenge iron from their environment. Some siderophores are peptides, and others are small organic molecules.

The AOBs, for example, N. eutropha contemplated in this disclosure may comprise mutations relative to wild-type N. eutropha and/or the N. eutropha sequences disclosed herein. These mutations may, e.g., occur spontaneously, be introduced by random mutagenesis, or be introduced by targeted mutagenesis. For instance, the N. eutropha may lack one or more genes or regulatory DNA sequences that wild-type N. eutropha typically comprises. The N. eutropha may also comprise point mutations, substitutions, insertions, deletions, and/or rearrangements relative to the sequenced strain or a wild-type strain. The N. eutropha may be a purified preparation of optimized N. eutropha.

In certain embodiments, the N. eutropha is transgenic. For instance, it may comprise one or more genes or regulatory DNA sequences that wild-type N. eutropha D23 lacks. More particularly, the N. eutropha may comprise, for instance, a reporter gene, a selective marker, a gene encoding an enzyme, or a promoter (including an inducible or repressible promoter). In some embodiments the additional gene or regulatory DNA sequence is integrated into the bacterial chromosome; in some embodiments the additional gene or regulatory DNA sequence is situated on a plasmid, for instance a plasmid related to a plasmid found in N. eutropha N91.

In some preferred embodiments, the N. eutropha differs by at least one nucleotide from naturally occurring bacteria. For instance, the N. eutropha may differ from naturally occurring bacteria in a gene or protein that is part of a relevant pathway, e.g., an ammonia metabolism pathway, a urea metabolism pathway, or a pathway for producing nitric oxide or nitric oxide precursors. More particularly, the N. eutropha may comprise a mutation that elevates activity of the pathway, e.g., by increasing levels or activity of an element of that pathway.

The above-mentioned mutations can be introduced using any suitable technique. Numerous methods are known for introducing mutations into a given position. For instance, one could use site-directed mutagenesis, oligonucleotide-directed mutagenesis, or site-specific mutagenesis. Non-limiting examples of specific mutagenesis protocols are described in, e.g., Mutagenesis, pp. 13.1-13.105 (Sambrook and Russell, eds., Molecular Cloning A Laboratory Manual, Vol. 3, 3.sup.rd ed. 2001). In addition, non-limiting examples of well-characterized mutagenesis protocols available from commercial vendors include, without limitation, Altered Sites® II in vitro Mutagenesis Systems (Promega Corp., Madison, Wis.); Erase-a-Base® System (Promega, Madison, Wis.); GeneTailor™ Site-Directed Mutagenesis System (Invitrogen, Inc., Carlsbad, Calif.); QuikChange® II Site-Directed Mutagenesis Kits (Stratagene, La Jolla, Calif.); and Transformer™ Site-Directed Mutagenesis Kit (BD-Clontech, Mountain View, Calif.).

In some embodiments, the preparation of ammonia oxidizing bacteria may comprise a concentration or amount of ammonia oxidizing bacteria in order to at least partially treat a condition or disease. The preparation of ammonia oxidizing bacteria may comprise a concentration or amount of ammonia oxidizing bacteria in order to alter, e.g., reduce or increase, an amount, concentration or proportion of a bacterium, or genus of bacteria, on a surface, e.g., a skin surface. The bacteria may be non-pathogenic or pathogenic, or potentially pathogenic.

In some embodiments, the preparation of ammonia oxidizing bacteria may comprise between about 108 to about 1014 CFU/L. The preparation may comprise at least 108, 109, 1010, 1011, 2×1011, 5×1011, 1012, 2×1012, 5×1012, 1013, 2×1013, 5×1013, or 1014; or about 108-109, 109-1010, 1011-1011, 1011-1012, 1012-1013, or 1013-1014 CFU/L. In certain aspects, the preparation may comprise between about 1×109 CFU/L to about 10×109 CFU/L. In certain aspects, the preparation may comprise between about 1×109 CFU to about 10×109 CFU.

In some embodiments, the preparation of ammonia oxidizing bacteria may comprise between about 0.1 milligrams (mg) and about 1000 mg of ammonia oxidizing bacteria. In certain aspects, the preparation may comprise between about 50 mg and about 1000 mg of ammonia oxidizing bacteria. The preparation may comprise between about 0.1-0.5 mg, 0.2-0.7 mg, 0.5-1.0 mg, 0.5-2 mg, 0.5-5 mg, 2.5-5 mg, 2.5-7.0 mg, 5.0-10 mg, 7.5-15 mg, 10-15 mg, 15-20 mg, 15-25 mg, 20-30 mg, 25-50 mg, 25-75 mg, 50-75 mg, 50-100 mg, 75-100 mg, 100-200 mg, 200-300 mg, 300-400 mg, 400-500 mg, 500-600 mg, 600-700 mg, 700-800 mg, 800-900 mg, 900-1000 mg, 100-250 mg, 250-500 mg, 100-500 mg, 500-750 mg, 750-1000 mg, or 500-1000 mg.

In some embodiments, the preparation of ammonia oxidizing bacteria may comprise a mass ratio of ammonia oxidizing bacteria to an excipient, e.g., a pharmaceutically acceptable excipient or a cosmetically acceptable excipient in a range of about 0.1 grams per liter to about 1 gram per liter. The preparation may comprise a mass ratio of ammonia oxidizing bacteria to an excipient in a range of about 0.1-0.2, 0.2-0.3, 0.1-0.5, 0.2-0.7, 0.5-1.0, or 0.7-1.0 grams per liter.

In some embodiments, the preparation of ammonia oxidizing bacteria may be in a growth state. A growth state may be provided by exposing ammonia oxidizing bacteria to an environment that may promote growth. The growth state may be a state, e.g., ammonia oxidizing bacteria in an environment that allows immediate availability of ammonia oxidizing bacteria to convert ammonium ions (NH4+) to nitrite (NO2). The growth state may comprise providing ammonia oxidizing bacteria in an environment having a pH of greater than about 7.6. The growth state may also comprise providing ammonia oxidizing bacteria in an environment having ammonia, ammonium salts, and/or urea, trace minerals and sufficient oxygen and carbon dioxide, as described above in Section 1.

In some embodiments, the preparation of ammonia oxidizing bacteria may be in a polyphosphate loading state, wherein the state or the environment, e.g., a media, e.g., a culture media, e.g., a growth media, may have a pH of less than about 7.4. Levels of at least one of ammonia, ammonium ions, and urea may be between about 10 micromolar and 200 millimolar. Levels of trace materials may be between 0.1 micromolar iron and 20 micromolar iron. Levels of oxygen may be between about 5% and 100% oxygen saturation. Levels of carbon dioxide may be between/less than about zero and 200 ppm, and phosphate levels greater than about 10 micromolar. The purpose of the polyphosphate loading state is to provide AOB with ammonia and oxygen such that ATP can be produced, but to deny them carbon dioxide and carbonate such that they are unable to use that ATP to fix carbon dioxide and instead use that ATP to generate polyphosphate which may be stored.

In some embodiments, the preparation of ammonia oxidizing bacteria may be in a storage state. A storage state may be defined as ammonia oxidizing bacteria in an environment in which they may be stored to be later revived. The storage state may be a state, e.g., ammonia oxidizing bacteria in an environment that allows availability of ammonia oxidizing bacteria after being revived, e.g., after being place in an environment promoting a growth state for a pre-determined period of time.

The storage state may comprise providing ammonia oxidizing bacteria in an environment having a pH of less than about 7.4. The storage state may also comprise providing ammonia oxidizing bacteria in an environment having ammonia, ammonia salts, and/or urea, trace minerals, oxygen, and low concentrations of carbon dioxide, as described above in Section 1.

Storage may also be accomplished by storing at 4° C. for up to several months. The storage buffer in some embodiments may comprise 50 mM Na2HPO4-2 mM MgCl2 (pH 7.6).

In some embodiments, ammonia oxidizing bacteria may be cyropreserved. A 1.25 ml of ammonia oxidizing bacteria mid-log culture may be added to a 2 ml cryotube and 0.75 ml of sterile 80% glycerol. Tubes may be shaken gently, and incubate at room temperature for 15 min to enable uptake of the cryoprotective agents by the cells. The tubes may be directly stored in a −80° C. freezer for freezing and storage.

For resuscitation of cultures, frozen stocks may be thawed on ice for 10-20 minutes, and then centrifuged at 8,000×g for 3 minutes at 4° C. The pellet may be washed by suspending it in 2 ml AOB medium followed by another centrifugation at 8,000×g for 3 minutes at 4° C. to reduce potential toxicity of the cryoprotective agents. The pellet may be resuspended in 2 ml of AOB medium, inoculated into 50 ml of AOB medium containing 50 mM NH4+, and incubated in dark at 30° C. by shaking at 200 rpm.

In some embodiments, the preparation of ammonia oxidizing bacteria may comprise ammonia oxidizing bacteria in a storage state and/or ammonia oxidizing bacteria in a polyphosphate loading state and/or ammonia oxidizing bacteria in a growth state.

Without wishing to be bound by theory, by maintaining ammonia oxidizing bacteria under conditions or in an environment of low carbon dioxide, with sufficient oxygen and ammonia, they may accumulate polyphosphate for a pre-determined period, e.g., for a period of about one doubling time, e.g., for about 8-12 hours, e.g., for about 10 hours. The ammonia oxidizing bacteria may accumulate sufficient polyphosphate to extend their storage viability, storage time, and accelerate their revival. This may occur with or without the addition of buffer and ammonia.

The presence of sufficient stored polyphosphate may allow the ammonia oxidizing bacteria the ATP resources to maintain metabolic activity even in the absence of ammonia and oxygen, and to survive insults that would otherwise be fatal.

The process of oxidation of ammonia to generate ATP has two steps. The first step is the oxidation of ammonia to hydroxylamine by ammonia monoxoygenase (Amo), followed by the conversion of hydroxylamine to nitrite by hydroxylamine oxidoreductase (Hao). Electrons from the second step (conversion of hydroxylamine to nitrite) are used to power the first step (oxidation of ammonia to hydroxylamine).

If an ammonia oxidizing bacteria does not have hydroxylamine to generate electrons for Amo, then hydroxylamine is not available for Hao. For example, acetylene irreversibly inhibits the enzyme crucial for the first step in the oxidation of ammonia to nitrite, the oxidation of ammonia to hydroxylamine. Once AOB are exposed to acetylene, Amo is irreversibly inhibited and new enzyme must be synthesized before hydroxylamine can be generated. In a normal consortium biofilm habitat, AOB may share and receive hydroxylamine form other AOB (even different strains with different susceptibilities to inhibitors) and so the biofilm tends to be more resistant to inhibitors such as acetylene than an individual organism. AOB can use stored polyphosphate to synthesize new Amo, even in the absence of hydroxylamine.

Any embodiment, preparation, composition, or formulation of ammonia oxidizing bacteria discussed herein may comprise, consist essentially of, or consist of optionally axenic ammonia oxidizing bacteria.

3. METHODS OF PRODUCING N. EUTROPHA

Methods of culturing various Nitrosomonas species are known in the art. N. eutropha may be cultured, for example, using N. europaea medium as described in Example 2 below. Ammonia oxidizing bacteria may be cultured, for example, using the media described in Table 3 or Table 4, above.

N. eutropha may be grown, for example, in a liquid culture or on plates. Suitable plates include 1.2% R2A agar, 1.2% agar, 1.2% agarose, and 1.2% agarose with 0.3 g/L pyruvate.

In some embodiments, ammonia oxidizing bacteria, such as N. eutropha is cultured in organic free media. One advantage of using organic free media is that it lacks substrate for heterotrophic bacteria to metabolize except for that produced by the autotrophic bacteria. Another advantage of using the as-grown culture is that substantial nitrite accumulates in the culture media, and this nitrite is also inhibitory of heterotrophic bacteria and so acts as a preservative during storage.

In some embodiments, ammonia oxidizing bacteria such as an N. eutropha strain with improved, e.g. optimized, properties is produced by an iterative process of propagation and selecting for desired properties. In some embodiments, the selection and propagation are carried out simultaneously. In some embodiments, the selection is carried out in a reaction medium (e.g., complete N. europaea medium) comprising 50 mM, 75 mM, 100 mM, 125 mM, 150 mM, 175 mM, 200 mM, 225 mM, 250 mM, 275 mM, or 300 mM NH4+, e.g., at least 200 mM NH4+. In some embodiments, the period of propagation and/or selection is at least 1, 2, 3, or 6 months. In embodiments, the period of propagation and/or selection is at least 1, 2, 4, 6, 8, or 10 years.

In some aspects, the ammonia oxidizing bacteria, such as the N. eutropha are manufactured on a commercial scale. In some embodiments, commercial scale refers to a liquid culturing method with a culture medium volume of at least 10,000, 20,000, 30,000, 50,000, or 100,000 liters (L). In some embodiments, the bacteria are produced in a bioreactor. The bioreactor may maintain the bacteria at a constant temperature, e.g., about 26-30 degrees Celsius using, for example a thermal jacket for insulation, a temperature sensor, and a heating or cooling element. The bioreactor may have an apparatus for stirring the culture to improve distribution of nutrients like ammonia, urea, oxygen, carbon dioxide, and various minerals. The bioreactor may also have an inlet tube for addition of new medium, and an outlet tube for collection of cells. The bioreactor may also have an aerator for distributing oxygen and/or carbon dioxide to the culture. The bioreactor may be, e.g., a batch reactor, a fed batch reactor, or a continuous reactor. In some embodiments, commercial scale production of N. eutropha yields a batch of 1,000 to 100,000 L per day at about 1012 CFU/liter and 1,000 to 100,000. The commercial scale production may yield e.g., a batch of 1,000-5,000, 5,000-10,000, 10,000-50,000, or 50,000-100,000 L/day. The commercial scale production may yield e.g., a batch of 1,000-5,000, 5,000-10,000, 10,000-50,000, or 50,000-100,000 L per batch. In some embodiments, the yield is at a concentration of at least 1010, 1011, 2×1011, 5×1011, or 1012, or about 1010-1011, 1011-1012, 1012-1013, or 1013-1014 CFU/L

In some embodiments, typically including commercial scale production, quality control (QC) testing steps are carried out. The general steps of QC typically comprise, 1) culturing N. eutropha, 2) performing a testing step on the culture or an aliquot thereof, and 3) obtaining a value from the testing step, and optionally: 4) comparing the obtained value to a reference value or range of acceptable values, and 5) if the obtained value meets the acceptable reference value or range, then classifying the culture as acceptable, and if the obtained value does not meet the acceptable reference value or range, then classifying the culture as unacceptable. If the culture is classified as acceptable, the culture may, e.g., be allowed to continue growing and/or may be harvested and added to a commercial product. If the culture is classified as unacceptable, the culture may, e.g., be safely disposed of or the defect may be remedied.

The testing step may comprise measuring the optical density (OD) of the culture. OD is measured in a spectrophotometer, and provides information on the amount of light transmitted through the sample as distinguished from light absorbed or scattered. In some embodiments, the OD600 (e.g., optical density of light with a wavelength of 600 nm) may be determined. This measurement typically indicates the concentration of cells in the medium, where a higher optical density corresponds to a higher cell density.

The testing step may comprise measuring the pH of the culture. The pH of an N. eutropha culture indicates the rate of nitrogen oxidation, and can also indicate whether the culture comprises a contaminating organism. pH may be measured using, e.g., a pH-sensing device comprising a electrode (such as a hydrogen electrode, quinhydron-Electrode, antimony electrode, glass electrode), a pH-sensing device comprising a semiconductor, or a color indicator reagent such as pH paper.

In certain embodiments, producing the ammonia oxidizing bacteria such as N. eutropha comprises carrying out various quality control steps. For instance, one may test the medium in which the N. eutropha is grown, e.g., to determine whether it has an appropriate pH, whether it has a sufficiently low level of waste products, and/or whether it has a sufficiently high level or nutrients. One may also test for the presence of contaminating organisms. A contaminating organism is typically an organism other than an ammonia oxidizing bacteria such as N. eutropha, for instance an organism selected Microbacterium sp., Alcaligenaceae bacterium, Caulobacter sp., Burkodelia multivorans, Escherichia coli, Klebsiella pneumoniae, and Staphylococcus aureus. One may test for contaminants by, e.g., extracting DNA, amplifying it, and sequencing a conserved gene such as 16S rRNA. One may also test for contaminants by plating culture on agar plates and observing colony morphology. N. eutropha typically forms red colonies, so non-red colonies are often indicative of contaminating organisms.

4. COMPOSITIONS COMPRISING AMMONIA OXIDIZING BACTERIA; COMPOSITIONS COMPRISING N. EUTROPHA

The present disclosure provides, inter alia, compositions comprising ammonia oxidizing bacteria, e.g., a preparation of ammonia oxidizing bacteria, or a purified preparation of ammonia oxidizing bacteria e.g., a natural product, or a fortified natural product. The compositions comprising ammonia oxidizing bacteria, e.g., a preparation of ammonia oxidizing bacteria, or a purified preparation of ammonia oxidizing bacteria may be provided in a cosmetic product or a therapeutic product. The preparation may comprise, inter alia, at least one of ammonia, ammonium salts, and urea.

The present disclosure provides, inter alia, compositions comprising N. eutropha, e.g., a purified preparation of an optimized N. eutropha. In some embodiments, the N. eutropha in the compositions has at least one property selected from an optimized growth rate, an optimized NH4+ oxidation rate, and an optimized resistance to NH4+.

In some aspects, the present disclosure provides compositions with a defined number of species. For instance, this disclosure provides a composition having N. eutropha and one other type of organism, and no other types of organism. In other examples, the composition has N. eutropha and 2, 3, 4, 5, 6, 7, 8, 9, or 10 other types of organism, and no other types of organism. The other type of organism in this composition may be, for instance, a bacterium, such as an ammonia-oxidizing bacterium. Suitable ammonia-oxidizing bacteria for this purpose include those in the genera Nitrosomonas, Nitrosococcus, Nitrosospira, Nitrosocystis, Nitrosolobus, or Nitrosovibrio.

In some embodiments, the composition comprising N. eutropha provides conditions that support N. eutropha viability. For instance, the composition may promote N. eutropha growth and metabolism or may promote a dormant state (e.g., freezing) from which viable N. eutropha can be recovered. When the composition promotes growth or metabolism, it may contain water and/or nutrients that N. eutropha consumes, e.g., as ammonium, ammonia, urea, oxygen, carbon dioxide, or trace minerals. In some embodiments, the composition comprising ammonia oxidizing bacteria provides conditions that support ammonia oxidizing bacteria viability. For instance, the composition may promote ammonia oxidizing bacteria growth and metabolism or may promote a dormant state (e.g., freezing) or storage state as described herein, from which viable ammonia oxidizing bacteria can be recovered. When the composition promotes growth or metabolism, it may contain water and/or nutrients that ammonia oxidizing bacteria consumes, e.g., as ammonium ions, ammonia, urea, oxygen, carbon dioxide, or trace minerals.

In some embodiments, one or more other organisms besides ammonia oxidizing bacteria may be included in the preparation of ammonia oxidizing bacteria. For example, an organism of the genus selected from the group consisting of Lactobacillus, Streptococcus, Bifidobacter, and combinations thereof, may be provided in the preparation of ammonia oxidizing bacteria. In some embodiments, the preparation may be substantially free of other organisms.

Preparations of ammonia oxidizing bacteria may comprise between about between about 108 to about 1014 CFU/L. The preparation may comprise at least about 108, 109, 1010, 1011, 2×1011, 5×1011, 1012, 2×1012, 5×1012, 1013, 2×1013, 5×1013, or 1014; or about 108-109, 109-1010, 1010-1011, 1011-1012, 1012-1013, or 1013-1014 CFU/L.

In some embodiments, the preparation may comprise at least 108, 109, 1010, 1011, 2×1011, 5×1011, 1012, 2×1012, 5×1012, 1013, 2×1013, 5×1013, or 1014; or about 108-109, 109-1010, 1010-1011, 1011-1012, 1012-1013, or 1013-1014 CFU/ml.

In some embodiments, the preparation may comprise between about 1×109 to about 10×109 CFU/L. In some embodiments, the preparation may comprise about 3×1010 CFU, e.g., 3×1010 CFU per day. In some embodiments, the preparation may comprise about 1×109 to about 10×109 CFU, e.g., about 1×109 to about 10×109 CFU per day.

In some embodiments, the preparation of ammonia oxidizing bacteria may comprise between about 0.1 milligrams (mg) and about 1000 mg of ammonia oxidizing bacteria. In certain aspects, the preparation may comprise between about 50 mg and about 1000 mg of ammonia oxidizing bacteria. The preparation may comprise between about 0.1-0.5 mg, 0.2-0.7 mg, 0.5-1.0 mg, 0.5-2 mg, 0.5-5 mg, 2.5-5 mg, 2.5-7.0 mg, 5.0-10 mg, 7.5-15 mg, 10-15 mg, 15-20 mg, 15-25 mg, 20-30 mg, 25-50 mg, 25-75 mg, 50-75 mg, 50-100 mg, 75-100 mg, 100-200 mg, 200-300 mg, 300-400 mg, 400-500 mg, 500-600 mg, 600-700 mg, 700-800 mg, 800-900 mg, 900-1000 mg, 100-250 mg, 250-500 mg, 100-500 mg, 500-750 mg, 750-1000 mg, or 500-1000 mg.

In some embodiments, the preparation of ammonia oxidizing bacteria my comprise a mass ratio of ammonia oxidizing bacteria to an excipient, e.g., a pharmaceutically acceptable excipient or a cosmetically acceptable excipient in a range of about 0.1 grams per liter to about 1 gram per liter. The preparation may comprise a mass ratio of ammonia oxidizing bacteria to an excipient in a range of about 0.1-0.2, 0.2-0.3, 0.1-0.5, 0.2-0.7, 0.5-1.0, or 0.7-1.0 grams per liter.

Advantageously, a formulation may have a pH that promotes AOB, e.g., N. eutropha viability, e.g., metabolic activity. Urea would hydrolyze to ammonia and would raise the pH to 7 to 8. AOB are very active at this pH range and would lower the pH to about 6 where the NH3 converts to ammonium and is unavailable. Lower pH levels, e.g. about pH 4, are also acceptable. The ammonia oxidizing bacteria, e.g., N. eutropha may be combined with one or more pharmaceutically or cosmetically acceptable excipients. In some embodiments, “pharmaceutically acceptable excipient” refers to a pharmaceutically-acceptable material, composition, or vehicle, such as a liquid or solid filler, diluent, solvent, or encapsulating material. In some embodiments, each excipient is “pharmaceutically acceptable” in the sense of being compatible with the other ingredients of a pharmaceutical formulation, and suitable for use in contact with the tissue or organ of humans and animals without excessive toxicity, irritation, allergic response, immunogenicity, or other problems or complications, commensurate with a reasonable benefit/risk ratio. See, Remington: The Science and Practice of Pharmacy, 21st ed.; Lippincott Williams & Wilkins: Philadelphia, Pa., 2005; Handbook of Pharmaceutical Excipients, 6th ed.; Rowe et al., Eds.; The Pharmaceutical Press and the American Pharmaceutical Association: 2009; Handbook of Pharmaceutical Additives, 3rd ed.; Ash and Ash Eds.; Gower Publishing Company: 2007; Pharmaceutical Preformulation and Formulation, 2nd ed.; Gibson Ed.; CRC Press LLC: Boca Raton, Fla., 2009.

In some embodiments, a cosmetically acceptable excipient refers to a cosmetically acceptable material, composition, or vehicle, such as a liquid or solid filler, diluent, solvent, or encapsulating material. In some embodiments, each excipient is cosmetically acceptable in the sense of being compatible with the other ingredients of a cosmetic formulation, and suitable for use in contact with the tissue or organ of humans and animals without excessive toxicity, irritation, allergic response, immunogenicity, or other problems or complications, commensurate with a reasonable benefit/risk ratio.

While it is possible for the active ingredient, e.g., ammonia oxidizing bacteria, e.g., N. eutropha, to be administered alone, in many embodiments it present in a pharmaceutical formulation or composition. Accordingly, this disclosure provides a pharmaceutical formulation comprising ammonia oxidizing bacteria, for example, N. eutropha and a pharmaceutically acceptable excipient. Pharmaceutical compositions may take the form of a pharmaceutical formulation as described below.

The pharmaceutical formulations described herein include those suitable for oral, parenteral (including subcutaneous, intradermal, intramuscular, intravenous, and intraarticular), inhalation (including fine particle dusts or mists which may be generated by means of various types of metered doses, pressurized aerosols, nebulizers or insufflators, and including intranasally or via the lungs), rectal and topical (including dermal, transdermal, transmucosal, buccal, sublingual, and intraocular) administration, although the most suitable route may depend upon, for example, the condition and disorder of the recipient.

The formulations may conveniently be presented in unit dosage form and may be prepared by any of the methods known in the art of pharmacy. Typically, methods include the step of bringing the active ingredient (e.g., ammonia oxidizing bacteria, e.g., N. eutropha) into association with a pharmaceutical carrier which constitutes one or more accessory ingredients. In general the formulations are prepared by uniformly and intimately bringing into association the active ingredient with liquid carriers or finely divided solid carriers or both and then, if necessary, shaping the product into the desired formulation.

Formulations may be presented as discrete units such as capsules, cachets or tablets, each containing a predetermined amount of, e.g., N. eutropha; as a powder or granules; as a solution or a suspension in an aqueous liquid or a non-aqueous liquid; or as an oil-in-water liquid emulsion or a water-in-oil liquid emulsion. The active ingredient may also be presented as a bolus, electuary or paste. Various pharmaceutically acceptable carriers and their formulation are described in standard formulation treatises, e.g., Remington's Pharmaceutical Sciences by E. W. Martin. See also Wang, Y. J. and Hanson, M. A., Journal of Parenteral Science and Technology, Technical Report No. 10, Supp. 42:2 S, 1988.

The ammonia oxidizing bacteria, e.g., N. eutropha compositions can, for example, be administered in a form suitable for immediate release or extended release. Suitable examples of sustained-release systems include suitable polymeric materials, for example semi-permeable polymer matrices in the form of shaped articles, e.g., films, or microcapsules; suitable hydrophobic materials, for example as an emulsion in an acceptable oil; or ion exchange resins. Sustained-release systems may be administered orally; rectally; parenterally; intracisternally; intravaginally; intraperitoneally; topically, for example as a powder, ointment, gel, drop or transdermal patch; bucally; or as a spray.

Preparations for administration can be suitably formulated to give controlled release of ammonia oxidizing bacteria, e.g., N. eutropha. For example, the pharmaceutical compositions may be in the form of particles comprising one or more of biodegradable polymers, polysaccharide jellifying and/or bioadhesive polymers, or amphiphilic polymers. These compositions exhibit certain biocompatibility features which allow a controlled release of an active substance. See U.S. Pat. No. 5,700,486.

Exemplary compositions include suspensions which can contain, for example, microcrystalline cellulose for imparting bulk, alginic acid or sodium alginate as a suspending agent, methylcellulose as a viscosity enhancer, dicalcium phosphate, starch, magnesium stearate and/or lactose and/or other excipients, binders, extenders, disintegrants, diluents and lubricants, mannitol, lactose, sucrose and/or cyclodextrins. Also included in such formulations may be high molecular weight excipients such as celluloses (avicel) or polyethylene glycols (PEG). Such formulations can also include an excipient to aid mucosal adhesion such as hydroxy propyl cellulose (HPC), hydroxy propyl methyl cellulose (HPMC), sodium carboxy methyl cellulose (SCMC), maleic anhydride copolymer (e.g., Gantrez), and agents to control release such as polyacrylic copolymer (e.g. Carbopol 934). Lubricants, glidants, flavors, coloring agents and stabilizers may also be added for ease of fabrication and use. The surfactant may be a zwitterionic surfactant, a non-ionic surfactant, or an anionic surfactant.

Excipients, such as surfactants that may be used with embodiments of the present disclosure may include one or more of cocamidopropyl betaine (ColaTeric COAB), polyethylene sorbitol ester (e.g., Tween 80), ethoxylated lauryl alcohol (RhodaSurf 6 NAT), sodium laureth sulfate/lauryl glucoside/cocamidopropyl betaine (Plantapon 611 L UP), sodium laureth sulfate (e.g., RhodaPex ESB 70 NAT), alkyl polyglucoside (e.g., Plantaren 2000 N UP), sodium laureth sulfate (Plantaren 200), Dr. Bronner's Castile soap, Dr. Bronner's Castile baby soap, Lauramine oxide (ColaLux Lo), sodium dodecyl sulfate (SDS), polysulfonate alkyl polyglucoside (PolySufanate 160 P), sodium lauryl sulfate (Stepanol-WA Extra K). and combinations thereof. Dr. Bronner's Castile soap and Dr. Bronner's baby soap comprises water, organic coconut oil, potassium hydroxide, organic olive oil, organic fair deal hemp oil, organic jojoba oil, citric acid, and tocopherol.

In some embodiments, surfactants may be used with ammonia oxidizing bacteria in amounts that allow nitrite production to occur. In some embodiments, the preparation may have less than about 0.0001% to about 10% of surfactant. In some embodiments, the preparation may have between about 0.1% and about 10% surfactant. In some embodiments, the concentration of surfactant used may be between about 0.0001% and about 10%. In some embodiments, the preparation may be substantially free of surfactant.

In some embodiments, the formulation, e.g., preparation, may include other components that may enhance effectiveness of ammonia oxidizing bacteria, or enhance a treatment or indication.

In some embodiments, a chelator may be included in the preparation. A chelator may be a compound that may bind with another compound, e.g., a metal. The chelator may provide assistance in removing an unwanted compound from an environment, or may act in a protective manner to reduce or eliminate contact of a particular compound with an environment, e.g., ammonia oxidizing bacteria, e.g. a preparation of ammonia oxidizing bacteria, e.g., an excipient. In some embodiments, the preparation may be substantially free of chelator.

Formulations may also contain anti-oxidants, buffers, bacteriostats that prevent the growth of undesired bacteria, solutes, and aqueous and non-aqueous sterile suspensions which may include suspending agents and thickening agents. The formulations may be presented in unit-dose or multi-dose containers, for example sealed ampoules and vials, and may be stored in a freeze-dried (lyophilised) condition requiring only the addition of a sterile liquid carrier, for example saline or water-for-injection, immediately prior to use. Extemporaneous solutions and suspensions may be prepared from powders, granules and tablets of the kind previously described. Exemplary compositions include solutions or suspensions which can contain, for example, suitable non-toxic, pharmaceutically acceptable diluents or solvents, such as mannitol, 1,3-butanediol, water, Ringer's solution, an isotonic sodium chloride solution, or other suitable dispersing or wetting and suspending agents, including synthetic mono- or diglycerides, and fatty acids, including oleic acid, or Cremaphor. An aqueous carrier may be, for example, an isotonic buffer solution at a pH of from about 3.0 to about 8.0, a pH of from about 3.5 to about 7.4, for example from 3.5 to 6.0, for example from 3.5 to about 5.0. Useful buffers include sodium citrate-citric acid and sodium phosphate-phosphoric acid, and sodium acetate/acetic acid buffers. The composition in some embodiments does not include oxidizing agents.

Excipients that can be included are, for instance, proteins, such as human serum albumin or plasma preparations. If desired, the pharmaceutical composition may also contain minor amounts of non-toxic auxiliary substances, such as wetting or emulsifying agents, preservatives, and pH buffering agents and the like, for example sodium acetate or sorbitan monolaurate. In some embodiments, excipients, e.g., a pharmaceutically acceptable excipient or a cosmetically acceptable excipient, may comprise an anti-adherent, binder, coat, disintegrant, filler, flavor, color, lubricant, glidant, sorbent, preservative, or sweetener. In some embodiments, the preparation may be substantially free of excipients.

In some embodiments, the preparation may be substantially free of one or more of the compounds or substances listed in the disclosure.

Exemplary compositions for aerosol administration include solutions in saline, which can contain, for example, benzyl alcohol or other suitable preservatives, absorption promoters to enhance bioavailability, and/or other solubilizing or dispersing agents. Conveniently in compositions for aerosol administration the ammonia oxidizing bacteria, e.g., N. eutropha is delivered in the form of an aerosol spray presentation from a pressurized pack or a nebulizer, with the use of a suitable propellant, e.g., dichlorodifluoro-methane, trichlorofluoromethane, dichlorotetrafluoroethane, carbon dioxide or other suitable gas. In the case of a pressurized aerosol the dosage unit can be determined by providing a valve to deliver a metered amount. Capsules and cartridges of e.g., gelatin can be formulated to contain a powder mix of the N. eutropha and a suitable powder base, for example lactose or starch. In certain embodiments, N. eutropha is administered as an aerosol from a metered dose valve, through an aerosol adapter also known as an actuator. Optionally, a stabilizer is also included, and/or porous particles for deep lung delivery are included (e.g., see U.S. Pat. No. 6,447,743).

Formulations may be presented with carriers such as cocoa butter, synthetic glyceride esters or polyethylene glycol. Such carriers are typically solid at ordinary temperatures, but liquefy and/or dissolve at body temperature to release the ammonia oxidizing bacteria, e.g., N. eutropha.

Exemplary compositions for topical administration include a topical carrier such as Plastibase (mineral oil gelled with polyethylene). In some aspects, the composition and/or excipient may be in the form of one or more of a liquid, a solid, or a gel. For example, liquid suspensions may include, but are not limited to, water, saline, phosphate-buffered saline, or an ammonia oxidizing storage buffer. Gel formulations may include, but are not limited to agar, silica, polyacrylic acid (for example Carbopol®), carboxymethyl cellulose, starch, guar gum, alginate or chitosan. In some embodiments, the formulation may be supplemented with an ammonia source including, but not limited to ammonium chloride or ammonium sulfate.

In some embodiments, an ammonia oxidizing bacteria, e.g., N. eutropha composition is formulated to improve NO penetration into the skin. A gel-forming material such as KY jelly or various hair gels would present a diffusion barrier to NO loss to ambient air, and so improve the skin's absorption of NO. The NO level in the skin will generally not greatly exceed 20 nM/L because that level activates GC and would cause local vasodilatation and oxidative destruction of excess NO.

It should be understood that in addition to the ingredients particularly mentioned above, the formulations as described herein may include other agents conventional in the art having regard to the type of formulation in question.

The formulation, e.g., preparation, e.g., composition may be provided in a container, delivery system, or delivery device, having a weight, including or not including the contents of the container, that may be less than about 50, 100, 200, 300, 400, 500, 600, 700, 800, 900, 1000, 1500, or 2000 grams.

Suitable unit dosage formulations are those containing an effective dose, as hereinbefore recited, or an appropriate fraction thereof, of ammonia oxidizing bacteria, e.g., N. eutropha.

A therapeutically effective amount of ammonia oxidizing bacteria, e.g., N. eutropha may be administered as a single pulse dose, as a bolus dose, or as pulse doses administered over time. Thus, in pulse doses, a bolus administration of ammonia oxidizing bacteria, e.g., N. eutropha is provided, followed by a time period wherein ammonia oxidizing bacteria, e.g., N. eutropha is administered to the subject, followed by a second bolus administration. In specific, non-limiting examples, pulse doses are administered during the course of a day, during the course of a week, or during the course of a month.

In some embodiments, a preparation of ammonia oxidizing bacteria, e.g., a formulation, e.g., a composition, may be applied for a pre-determined number of days. This may be based, for example, at least in part, on the severity of the condition or disease, the response to the treatment, the dosage applied and the frequency of the dose. For example, the preparation may be applied for about 1-3, 3-5, 5-7, 7-9, 5-10, 10-14, 12-18, 12-21, 21-28, 28-35, 35-42, 42-49, 49-56, 46-63, 63-70, 70-77, 77-84, 84-91 days, for about 1 month, for about 2 months, for about 3 months. In some embodiments, the ammonia oxidizing bacteria is administered for an indefinite period of time, e.g., greater than one year, greater than 5 years, greater than 10 years, greater than 15 years, greater than 30 years, greater than 50 years, greater than 75 years. In certain aspects, the preparation may be applied for about 16 days.

In some embodiments, a preparation of ammonia oxidizing bacteria, e.g., a formulation, e.g., a composition, may be applied a pre-determined number of times per day. This may be based, for example, at least in part, on the severity of the condition or disease, the response to the treatment, the dosage applied and the frequency of the dose. For example, the preparation may be applied 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24 times per day.

In some embodiments, the preparation may be applied one time per day. In other embodiments, the preparation may be applied two times per day. In some embodiments, the preparation may be applied a first pre-determined amount for a certain number of days, and a second pre-determined amount for a certain subsequent number of days. In some embodiments, the preparation may be applied for about 16 days.

Consumer Products

Ammonia oxidizing bacteria, e.g., N. eutropha may be associated with a variety of consumer products, and examples of such products are set out below. In some embodiments, the ammonia oxidizing bacteria, e.g., N. eutropha associated with a product is admixed with the product, for example, spread evenly throughout the product, and in some embodiments, ammonia oxidizing bacteria, e.g., the N. eutropha associated with a product is layered on the product.

In some embodiments, ammonia oxidizing bacteria, e.g., N. eutropha is associated with a powder. Powders are typically small particulate solids that are not attached to each other and that can flow freely when tilted. Exemplary powders for consumer use include talcum powder and some cosmetics (e.g., powder foundation).

In some embodiments, the ammonia oxidizing bacteria is associated with a cosmetic. The cosmetic may be a substance for topical application intended to alter a person's appearance, e.g., a liquid foundation, a powder foundation, blush, or lipstick. The cosmetic may be any substance recited in the Food and Drug Administration regulations, e.g., under 21 C.F.R. §720.4.

The cosmetic may be at least one of a baby product, e.g., a baby shampoo, a baby lotion, a baby oil, a baby powder, a baby cream; a bath preparation, e.g., a bath oil, a tablet, a salt, a bubble bath, a bath capsule; an eye makeup preparation, e.g., an eyebrow pencil, an eyeliner, an eye shadow, an eye lotion, an eye makeup remover, a mascara; a fragrance preparation, e.g., a colognes, a toilet water, a perfume, a powder (dusting and talcum), a sachet; hair preparations, e.g., hair conditioners, hair sprays, hair straighteners, permanent waves, rinses, shampoos, tonics, dressings, hair grooming aids, wave sets; hair coloring preparations, e.g., hair dyes and colors, hair tints, coloring hair rinses, coloring hair shampoos, hair lighteners with color, hair bleaches; makeup preparations, e.g., face powders, foundations, leg and body paints, lipstick, makeup bases, rouges, makeup fixatives; manicuring preparations, e.g., basecoats and undercoats, cuticle softeners, nail creams and lotions, nail extenders, nail polish and enamel, nail polish and enamel removers; oral hygiene products, e.g., dentrifices, mouthwashes and breath fresheners; bath soaps and detergents, deodorants, douches, feminine hygiene deodorants; shaving preparations, e.g., aftershave lotions, beard softeners, talcum, preshave lotions, shaving cream, shaving soap; skin care preparations, e.g., cleansing, depilatories, face and neck, body and hand, foot powders and sprays, moisturizing, night preparations, paste masks, skin fresheners; and suntan preparations, e.g., gels, creams, and liquids, and indoor tanning preparations.

In some embodiments, the formulations, compositions, or preparations described herein, may comprise, be provided as, or disposed in at least one of a baby product, e.g., a baby shampoo, a baby lotion, a baby oil, a baby powder, a baby cream; a bath preparation, e.g., a bath oil, a tablet, a salt, a bubble bath, a bath capsule; a powder (dusting and talcum), a sachet; hair preparations, e.g., hair conditioners, rinses, shampoos, tonics, face powders, cuticle softeners, nail creams and lotions, oral hygiene products, mouthwashes, bath soaps, douches, feminine hygiene deodorants; shaving preparations, e.g., aftershave lotions, skin care preparations, e.g., cleansing, face and neck, body and hand, foot powders and sprays, moisturizing, night preparations, paste masks, skin fresheners; and suntan preparations, e.g., gels, creams, and liquids.

In some embodiments, ammonia oxidizing bacteria, e.g., N. eutropha is associated with a cosmetic. The cosmetic may be a substance for topical application intended to alter a person's appearance, e.g., a liquid foundation, a powder foundation, blush, or lipstick. Other components may be added to these cosmetic preparations as selected by one skilled in the art of cosmetic formulation such as, for example, water, mineral oil, coloring agent, perfume, aloe, glycerin, sodium chloride, sodium bicarbonate, pH buffers, UV blocking agents, silicone oil, natural oils, vitamin E, herbal concentrates, lactic acid, citric acid, talc, clay, calcium carbonate, magnesium carbonate, zinc oxide, starch, urea, and erythorbic acid, or any other excipient known by one of skill in the art, including those disclosed herein.

In some embodiments, the preparation may be disposed in, or provided as, a powder, cosmetic, cream, stick, aerosol, salve, wipe, or bandage.

In some embodiments, ammonia oxidizing bacteria, e.g., N. eutropha is associated with a cream. The cream may be a fluid comprising a thickening agent, and generally has a consistency that allows it to be spread evenly on the skin. Exemplary creams include moisturizing lotion, face cream, and body lotion.

In some embodiments, ammonia oxidizing bacteria, e.g., the N. eutropha is associated with a stick. A stick is typically a solid that, when placed in contact with a surface, transfers some of the stick contents to the surface. Exemplary sticks include deodorant stick, lipstick, lip balm in stick form, and sunscreen applicator sticks.

In some embodiments, ammonia oxidizing bacteria, e.g., the N. eutropha is associated with an aerosol. An aerosol is typically a colloid of fine solid particles or fine liquid droplets, in a gas such as air. Aerosols may be created by placing the N. eutropha (and optionally carriers) in a vessel under pressure, and then opening a valve to release the contents. The container may be designed to only exert levels of pressure that are compatible with N. eutropha viability. For instance, the high pressure may be exerted for only a short time, and/or the pressure may be low enough not to impair viability. Examples of consumer uses of aerosols include for sunscreen, deodorant, perfume, hairspray, and insect repellant.

In some embodiments, ammonia oxidizing bacteria, e.g., the N. eutropha is associated with a salve. A salve may be a topically applied agent with a liquid or cream-like consistency, intended to protect the skin or promote healing. Examples of salves include burn ointments and skin moisturizers.

In some embodiments, ammonia oxidizing bacteria, e.g., the N. eutropha is associated with a wipe. A wipe may be a flexible material suitable for topically applying a liquid or cream onto skin. The wipe may be, e.g., paper-based or cloth based. Exemplary wipes include tissues and wet wipes.

The compositions comprising ammonia oxidizing bacteria, e.g., N. eutropha may also comprise one or more of a moisturizing agent, deodorizing agent, scent, colorant, insect repellant, cleansing agent, or UV-blocking agent.

For instance, the moisturizing agent may be an agent that reduces or prevents skin dryness. Exemplary moisturizing agents include humectants (e.g., urea, glycerin, alpha hydroxy acids and dimethicone) and emollients (e.g., lanolin, mineral oil and petrolatum). Moisturizing agents may be included, e.g., in ammonia oxidizing bacteria, e.g., N. eutropha-containing creams, balms, lotions, or sunscreen.

A deodorizing agent may be an agent that reduces unwanted odors. A deodorizing agent may work by directly neutralizing odors, preventing perspiration, or preventing the growth of odor-producing bacteria. Exemplary deodorizing agents include aluminum salts (e.g., aluminum chloride or aluminum chlorohydrate), cyclomethicone, talc, baking soda, essential oils, mineral salts, hops, and witch hazel. Deodorizing agents are typically present in spray or stick deodorants, and can also be found in some soaps and clothing.

An insect repellant may be an agent that can be applied to surfaces (e.g., skin) that discourage insects and other arthropods from lighting on the surface. Insect repellants include DEET (N,N-diethyl-m-toluamide), p-menthane-3,8-diol (PMD), icaridin, nepetalactone, citronella oil, neem oil, bog myrtle, dimethyl carbate, Tricyclodecenyl allyl ether, and IR3535 (3-[N-Butyl-N-acetyl]-aminopropionic acid, ethyl ester).

A cleansing agent may be an agent that removes dirt or unwanted bacteria from a surface like skin. Exemplary cleansing agents include bar soaps, liquid soaps, and shampoos.

A UV-blocking agent may be an agent that can be applied to a surface to reduce the amount of ultraviolet light the surface receives. A UV-blocking agent may block UV-A and/or UV-B rays. A UV blocking agent can function by absorbing, reflecting, or scattering UV. Exemplary UV-blocking agents include absorbers, e.g., homosalate, octisalate (also called octyl salicylate), octinoxate (also called octyl methoxycinnamate or OMC), octocrylene, oxybenzone, and avobenzone, and reflectors (e.g., titanium dioxide and zinc oxide). UV-blocking agents are typically presents in sunscreens, and can also be found in skin creams and some cosmetics.

In some embodiments, ammonia oxidizing bacteria, e.g., N. eutropha is associated with a conditioner. Conditioner generally refers to a substance with cream-like consistency that can be applied to hair to improve its appearance, strength, or manageability.

In some embodiments, ammonia oxidizing bacteria, e.g., N. eutropha is associated with cloth. Cloth generally refers to a flexible material suitable to be made into clothing, e.g., having enough material strength to withstand everyday motion by a wearer. Cloth can be fibrous, woven, or knit; it can be made of a naturally occurring material or a synthetic material. Exemplary cloth materials include cotton, flax, wool, ramie, silk, denim, leather, nylon, polyester, and spandex, and blends thereof.

In some embodiments, ammonia oxidizing bacteria, e.g., N. eutropha is associated with yarn. Yarn generally refers to a long, thin spun flexible material that is suitable for knitting or weaving. Yarn can be made of, e.g., wool, cotton, polyester, and blends thereof.

In some embodiments, ammonia oxidizing bacteria, e.g., N. eutropha is associated with thread. Thread generally refers to a long, thin spun flexible material that is suitable for sewing. Thread generally has a thinner diameter than yarn. Thread can be made of, e.g., cotton, polyester, nylon, silk, and blends thereof.

Articles of clothing such as, for example, shoes, shoe inserts, pajamas, sneakers, belts, hats, shirts, underwear, athletic garments, helmets, towels, gloves, socks, bandages, and the like, may also be treated with ammonia oxidizing bacteria, e.g., N. eutropha. Bedding, including sheets, pillows, pillow cases, and blankets may also be treated with ammonia oxidizing bacteria, e.g., N. eutropha. In some embodiments, areas of skin that cannot be washed for a period of time may also be contacted with ammonia oxidizing bacteria, e.g., N. eutropha. For example, skin enclosed in orthopedic casts which immobilize injured limbs during the healing process, and areas in proximity to injuries that must be kept dry for proper healing such as stitched wounds may benefit from contact with the ammonia oxidizing bacteria, e.g., N. eutropha.

In some aspects, the present disclosure provides a wearable article comprising an N. eutropha strain as described herein. A wearable article may be a light article that can be closely associated with a user's body, in a way that does not impede ambulation. Examples of wearable articles include a wristwatch, wristband, headband, hair elastic, hair nets, shower caps, hats, hairpieces, and jewelry. The wearable article comprising an ammonia oxidizing bacteria, e.g., N. eutropha strain described herein may provide, e.g., at a concentration that provides one or more of a treatment or prevention of a skin disorder, a treatment or prevention of a disease or condition associated with low nitrite levels, a treatment or prevention of body odor, a treatment to supply nitric oxide to a subject, or a treatment to inhibit microbial growth.

In some embodiments, the ammonia oxidizing bacteria, e.g., N. eutropha is associated with a product intended to contact the hair, for example, a brush, comb, shampoo, conditioner, headband, hair elastic, hair nets, shower caps, hats, and hairpieces. Nitric oxide formed on the hair, away from the skin surface, may be captured in a hat, scarf or face mask and directed into inhaled air.

Articles contacting the surface of a human subject, such as a diaper, may be associated with ammonia oxidizing bacteria, e.g., N. eutropha. Because diapers are designed to hold and contain urine and feces produced by incontinent individuals, the urea in urine and feces can be hydrolyzed by skin and fecal bacteria to form free ammonia which is irritating and may cause diaper rash. Incorporation of bacteria that metabolize urea into nitrite or nitrate, such as ammonia oxidizing bacteria, e.g., N. eutropha, may avoid the release of free ammonia and may release nitrite and ultimately NO which may aid in the maintenance of healthy skin for both children and incontinent adults. The release of nitric oxide in diapers may also have anti-microbial effects on disease causing organisms present in human feces. This effect may continue even after disposable diapers are disposed of as waste and may reduce the incidence of transmission of disease through contact with soiled disposable diapers

In some embodiments, the product comprising ammonia oxidizing bacteria, e.g., N. eutropha is packaged. The packaging may serve to compact the product or protect it from damage, dirt, or degradation. The packaging may comprise, e.g., plastic, paper, cardboard, or wood. In some embodiments the packaging is impermeable to bacteria. In some embodiments the packaging is permeable to oxygen and/or carbon dioxide.

5. METHODS OF TREATMENT WITH N. EUTROPHA

The present disclosure provides various methods of treating diseases and conditions using ammonia oxidizing bacteria, e.g., N. eutropha. The ammonia oxidizing bacteria, e.g., N. eutropha that may be used to treat diseases and conditions include all the ammonia oxidizing bacteria, e.g., N. eutropha compositions described in this application, e.g. a purified preparation of optimized ammonia oxidizing bacteria, e.g., N. eutropha, e.g. those in Section 2 above, for instance strain D23.

For instance, the disclosure provides uses, for treating a condition or disease (e.g., inhibiting microbial growth on a subject's skin), an optionally axenic composition of N. eutropha comprising a nucleic acid sequence at least about 70%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 99.5% identical to SEQ ID NO: 1; an optionally axenic composition of N. eutropha comprising a nucleic acid sequence at least about 70%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 99.5% identical to any one of the strain D23 nucleic acids of Table 1. In embodiments, the N. eutropha comprises at least 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, or all of the strain D23 nucleic acids of Table 1. In embodiments, the N. eutropha comprises one or more nucleic acids of FIGS. 6-8. As a further example, this disclosure provides uses, for treating a condition or disease, an optionally axenic composition of N. eutropha comprising an amino acid sequence at least about 70%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 99.5% identical to any one of the strain D23 protein sequences of Table 1. In embodiments, the N. eutropha comprises at least 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, or all of the strain D23 protein sequences of Table 1. In embodiments, the N. eutropha comprises one or more proteins encoded by the nucleic acids of FIGS. 6-8. The N. eutropha of this paragraph may be used to treat, e.g., diabetic ulcers, e.g., diabetic foot ulcers, chronic wounds, acne, rosacea, eczema, or psoriasis.

In certain embodiments, the disclosure provides uses, for treating a condition or disease (e.g., inhibiting microbial growth on a subject's skin), an optionally axenic composition of N. eutropha having one or more of: (1) an optimized growth rate, (2) an optimized NH4+ oxidation rate, (3) an optimized resistance to NH3, (4) an optimized resistance to, NH4+, and (5) an optimized resistance to, NO2. For instance, the axenic N. eutropha composition may have properties (1) and (2); (2) and (3); (3) and (4); or (4) and (5) from the list at the beginning of this paragraph. As another example, the axenic N. eutropha composition may have properties (1), (2), and (3); (1), (2), and (4); (1), (2), and (5); (1), (3), and (4); (1), (3), and (5); (1), (4), and (5); (2), (3), and (4); (2), (3), and (5), or (3), (4), and (5) from the list at the beginning of this paragraph. As a further example, the optionally axenic N. eutropha composition may have properties (1), (2), (3), and (4); (1), (2), (3), and (5); (1), (2), (4), and (5); (1), (3), (4), and (5); or (2), (3), (4), and (5) from the list at the beginning of this paragraph. In some embodiments, the axenic N. eutropha composition has properties (1), (2), (3), (4), and (5) from the list at the beginning of this paragraph. The N. eutropha of this paragraph may be used to treat, e.g., diabetic ulcers, e.g., diabetic foot ulcers, chronic wounds, acne, rosacea, eczema, or psoriasis.

In some embodiments, optionally axenic N. eutropha (e.g., strain D23) are used to treat a subject. Subjects may include an animal, a mammal, a human, a non-human animal, a livestock animal, or a companion animal.

In some embodiments, optionally axenic N. eutropha described herein (e.g., the N. eutropha described in this Section and in Section 2 above, e.g., strain D23) are used to inhibit the growth of other organisms. For instance, N. eutropha D23 is well-adapted for long-term colonization of human skin, and in some embodiments it out-competes other bacteria that are undesirable on the skin. Undesirable skin bacteria include, e.g., those that can infect wounds, raise the risk or severity of a disease, or produce odors. Certain undesirable skin bacteria include S. aureus, P. aeruginosa, S. pyogenes, and A. baumannii. The N. eutropha described herein may out-compete other organisms by, e.g., consuming scarce nutrients, or generating byproducts that are harmful to other organisms, e.g., changing the pH of the skin to a level that is not conducive to the undesirable organism's growth.

Accordingly, the present disclosure provides, inter alia, a method of inhibiting microbial growth on a subject's skin, comprising topically administering to a human in need thereof an effective dose of optionally axenic N. eutropha bacteria as described herein (e.g., strain D23). Similarly, the present disclosure provides optionally axenic N. eutropha as described herein (e.g., strain D23) for use in inhibiting microbial growth on a subject's skin. Likewise, the present disclosure provides a use of optionally axenic N. eutropha (e.g., strain D23) in the manufacture of a medicament for inhibiting microbial growth on a subject's skin.

The present disclosure also provides a method of supplying nitric oxide to a subject, comprising positioning an effective dose of optionally axenic N. eutropha bacteria described herein (e.g., strain D23) in close proximity to the subject. Similarly, the present disclosure provides optionally axenic N. eutropha (e.g., strain D23) as described herein for use in supplying nitric oxide to a subject. Likewise, the present disclosure provides a use of optionally axenic N. eutropha (e.g., strain D23) in the manufacture of a medicament or composition suitable for position in close proximity to a subject.

The present disclosure also provides a method of reducing body odor, comprising topically administering to a subject in need thereof an effective dose of optionally axenic N. eutropha bacteria described herein (e.g., strain D23). Similarly, the present disclosure provides optionally axenic N. eutropha as described herein (e.g., strain D23) for use in reducing body odor in a subject. Likewise, the present disclosure provides a use of optionally axenic N. eutropha as described herein (e.g., strain D23) in the manufacture of a medicament or composition for reducing body odor.

The present disclosure also provides a method of treating or preventing a disease associated with low nitrite levels, comprising topically administering to a subject in need thereof a therapeutically effective dose of optionally axenic N. eutropha bacteria described herein (e.g., strain D23). Similarly, the present disclosure provides a topical formulation of optionally axenic N. eutropha as described herein (e.g., strain D23) for use in treating a disease associated with low nitrite levels. Likewise, the present disclosure provides a use of optionally axenic N. eutropha as described herein (e.g., strain D23) in the manufacture of a topical medicament for treating a disease associated with low nitrite levels.

The present disclosure also provides a method of treating or preventing a skin disorder or skin infection, comprising topically administering to a subject in need thereof a therapeutically effective dose of optionally axenic N. eutropha bacteria as described herein (e.g., strain D23). Similarly, the present disclosure provides optionally axenic N. eutropha as described herein (e.g., strain D23) for use in treating a skin disorder in a subject. Likewise, the present disclosure provides a use of optionally axenic N. eutropha as described herein (e.g., strain D23) in the manufacture of a medicament for treating skin disorder. In embodiments, the skin disorder is acne, rosacea, eczema, psoriasis, or urticaria; the skin infection is impetigo.

While not wishing to be bound by theory, it is proposed that treatment of acne with a therapeutically effective dose of optionally axenic N. eutropha bacteria as described herein (e.g., strain D23) may involve the downregulation of inflammation due to NO generation; and/or limiting and/or inhibiting the spread and proliferation of Propionibacterium acnes associated with acne vulgaris through acidified nitrite and NO production.

For instance, the disclosure provides uses, for treating a condition or disease (e.g., inhibiting microbial growth on a subject's skin), a composition of ammonia oxidizing bacteria. In embodiments, the ammonia oxidizing bacteria may be used to treat, e.g., chronic wounds, acne, rosacea, eczema, psoriasis, uticaria, skin infections, or diabetic ulcers, e.g., diabetic foot ulcers.

The systems and methods of the present disclosure may provide for, or contain contents, to be useful for treating or preventing a skin disorder, treating or preventing a disease or condition associated with low nitrite levels, a treating or preventing body odor, treating to supply nitric oxide to a subject, or treating to inhibit microbial growth.

The systems and methods of the present disclosure may provide for reducing an amount of undesirable bacteria from an environment, e.g., a surface of a subject.

The systems and methods of the present disclosure may provide for, or contain contents, to be useful in a treatment of at least one of HIV dermatitis, infection in a diabetic foot ulcer, atopic dermatitis, acne, eczema, contact dermatitis, allergic reaction, psoriasis, uticaria, rosacea, skin infections, vascular disease, vaginal yeast infection, a sexually transmitted disease, heart disease, atherosclerosis, baldness, leg ulcers secondary to diabetes or confinement to bed, angina, particularly chronic, stable angina pectoris, ischemic diseases, congestive heart failure, myocardial infarction, ischemia reperfusion injury, laminitis, hypertension, hypertrophic organ degeneration, Raynaud's phenomenon, fibrosis, fibrotic organ degeneration, allergies, autoimmune sensitization, end stage renal disease, obesity, impotence, pneumonia, primary immunodeficiency, epidermal lysis bulosa, or cancer.

The systems and methods of the present disclosure may provide for, or contain contents, to be useful in a treatment of at least one of acne, eczema, psoriasis, uticaria, rosacea, skin infections and wounds, e.g., an infected wound.

In some embodiments, ammonia oxidizing bacteria may be used to treat a subject. Subjects may include an animal, a mammal, a human, a non-human animal, a livestock animal, or a companion animal.

In some embodiments, ammonia oxidizing bacteria described herein are used to inhibit the growth of other organisms. For instance, ammonia oxidizing bacteria may be well-adapted for long-term colonization of human skin, and in some embodiments it out-competes other bacteria that are undesirable on the skin. Undesirable skin bacteria include, e.g., those that can infect wounds, raise the risk or severity of a disease, or produce odors. Undesirable bacteria may be referred to as pathogenic bacteria. Certain undesirable skin bacteria include Staphylococcus aureus (S. aureus), e.g., methicillin resistant Staphylococcus aureus Pseudomonas aeruginosa (P. aeruginosa), Streptococcus pyogenes (S. pyogenes), Acinetobacter baumannii (A. baumannii), Propionibacteria, and Stenotrophomonas. The ammonia oxidizing bacteria described herein may out-compete other organisms by, e.g., consuming scarce nutrients, or generating byproducts that are harmful to other organisms, e.g., changing the pH of the skin to a level that is not conducive to the undesirable organism's growth.

Accordingly, the present disclosure provides, inter alia, a method of inhibiting microbial growth on a subject's skin, comprising topically administering to a human in need thereof an effective dose of ammonia oxidizing bacteria as described herein. Similarly, the present disclosure provides ammonia oxidizing bacteria as described herein for use in inhibiting microbial growth on a subject's skin. Likewise, the present disclosure provides a use of ammonia oxidizing bacteria in the manufacture of a medicament for inhibiting microbial growth on a subject's skin.

The present disclosure provides, inter alia, a method of changing a composition of a skin microbiome, e.g., modulating a composition of a skin microbiome, e.g., modulating or changing the proportions of the skin microbiome, in an environment, e.g., a surface, e.g., a surface of a subject. The method may comprise administering, e.g., applying, a preparation comprising ammonia oxidizing bacteria to an environment, e.g., a surface, e.g., a surface of a subject. In some embodiments, the amount and frequency of administration, e.g., application, may be sufficient to reduce the proportion of pathogenic bacteria on the surface of the skin. In some embodiments, the subject may be selected on the basis of the subject being in need of a reduction in the proportion of pathogenic bacteria on the surface of the skin.

The present disclosure may further provide obtaining a sample from the surface of the skin, and isolating DNA of bacteria in the sample. Sequencing of the DNA of bacteria in the sample may also be performed to determine or monitor the amount or proportion of bacteria in a sample of a subject.

The present disclosure may also provide for increasing the proportion of non-pathogenic bacteria on the surface. In some embodiments, the non-pathogenic bacteria may be commensal non-pathogenic bacteria. In some embodiments, the non-pathogenic bacteria may be of the Staphylococcus genus. In some embodiments, the non-pathogenic bacteria may be Staphylococcus epidermidis. In some embodiments, the non-pathogenic bacteria that is increased in proportion may be of the Staphylococcus genus, comprising at least about 10%, 15%, 20%, 25%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% Staphylococcus epidermidis.

The increase in the proportion of non-pathogenic bacteria may occur with a pre-determined period of time, e.g., in less than 1 day, 2 days, 3 days, 4 days, 5 days, 1 week, 2 weeks, 3 weeks, or 4 weeks, or in less than 1-3, 3-5, 5-7, 7-9, 5-10, 10-14, 12-18, 12-21, 21-28, 28-35, 35-42, 42-49, 49-56, 46-63, 63-70, 70-77, 77-84, 84-91 days.

The increase in the proportion of Staphylococcus bacteria, e.g., Staphylococcus epidermidis, may be observed in less than about 3 weeks, e.g., about 16 days, e.g., about 2 weeks.

The present disclosure may provide for decreasing the proportion of pathogenic bacteria, e.g., potentially pathogenic bacteria, e.g., disease-associated bacteria on the surface. In some embodiments, the pathogenic bacteria may be Propionibacteria. In some embodiments, the pathogenic bacteria may be Stenotrophomonas.

The decrease in the proportion of pathogenic bacteria may occur with a pre-determined period of time, e.g., in less than 1 day, 2 days, 3 days, 4 days, 5 days, 1 week, 2 weeks, 3 weeks, or 4 weeks, or in less than 1-3, 3-5, 5-7, 7-9, 5-10, 10-14, 12-18, 12-21, 21-28, 28-35, 35-42, 42-49, 49-56, 46-63, 63-70, 70-77, 77-84, 84-91 days.

The decrease in the proportion of Propionibacteria bacteria and/or Stenotrophomonas may be observed in less than about 3 weeks, e.g., about 16 days, e.g., about 2 weeks.

The present disclosure also provides a method of supplying nitric oxide to a subject, comprising positioning an effective dose of ammonia oxidizing bacteria described herein in close proximity to the subject. Similarly, the present disclosure provides ammonia oxidizing bacteria as described herein for use in supplying nitric oxide to a subject. Likewise, the present disclosure provides a use of in the manufacture of a medicament or composition suitable for position in close proximity to a subject.

The present disclosure also provides a method of reducing body odor, comprising topically administering to a subject in need thereof an effective dose of ammonia oxidizing bacteria described herein. Similarly, the present disclosure provides ammonia oxidizing bacteria as described herein for use in reducing body odor in a subject. Likewise, the present disclosure provides a use of ammonia oxidizing bacteria as described herein in the manufacture of a medicament or composition for reducing body odor.

The present disclosure also provides a method of treating or preventing a disease associated with low nitrite levels, comprising topically administering to a subject in need thereof a therapeutically effective dose of ammonia oxidizing bacteria described herein. Similarly, the present disclosure provides a topical formulation of ammonia oxidizing bacteria as described herein for use in treating a disease associated with low nitrite levels. Likewise, the present disclosure provides a use of ammonia oxidizing bacteria as described herein in the manufacture of a topical medicament for treating a disease associated with low nitrite levels.

The present disclosure also provides a method of treating or preventing a skin disorder or skin infection, comprising topically administering to a subject in need thereof a therapeutically effective dose of ammonia oxidizing bacteria as described herein. Similarly, the present disclosure provides ammonia oxidizing bacteria as described herein for use in treating a skin disorder in a subject. Likewise, the present disclosure provides a use of ammonia oxidizing bacteria as described herein in the manufacture of a medicament for treating skin disorder. In embodiments, the skin disorder is acne, rosacea, eczema, psoriasis, or urticaria; the skin infection is impetigo.

While not wishing to be bound by theory, it is proposed that treatment of rosacea with a therapeutically effective dose of optionally axenic N. eutropha bacteria as described herein (e.g., strain D23) may involve downregulation due to NO generation. This may be due to expression of Kazal-type KLK5/KLK7 inhibitor(s) that may reduce formation of the human cathelicidin peptide LL-37 from its precursor propeptide hCAP18.

While not wishing to be bound by theory, it is proposed that treatment of eczema and/or atopic dermatitis with a therapeutically effective dose of optionally axenic N. eutropha bacteria as described herein (e.g., strain D23) may involve downregulation of inflammation due to NO generation; and/or limiting and/or inhibiting the spread and proliferation of S. aureus and other skin pathogens often associated with very high colonization rates and skin loads in atopic dermatitis through acidified nitrite and NO production.

While not wishing to be bound by theory, it is proposed that treatment of psoriasis with a therapeutically effective dose of optionally axenic N. eutropha bacteria as described herein (e.g., strain D23) may involve downregulation of inflammation due to NO generation and reduction in formation of human cathelicidin peptide LL-37.

While not wishing to be bound by theory, it is proposed that treatment of psoriasis with a therapeutically effective dose of optionally axenic N. eutropha bacteria as described herein (e.g., strain D23) may involve downregulation of inflammation due to NO generation.

While not wishing to be bound by theory, it is proposed that treatment of impetigo or other skin and soft tissue infections with a therapeutically effective dose of optionally axenic N. eutropha bacteria as described herein (e.g., strain D23) may involve limiting and/or inhibiting the spread and proliferation of S. aureus and S. pyogenes.

The present disclosure also provides a method of promoting wound healing, comprising administering to a wound an effective dose of optionally axenic N. eutropha bacteria as described herein (e.g., strain D23). Similarly, the present disclosure provides optionally axenic N. eutropha as described herein (e.g., strain D23) for use in treating a wound. Likewise, the present disclosure provides a use of optionally axenic N. eutropha as described herein (e.g., strain D23) in the manufacture of a medicament or a composition for treating a wound.

Optionally axenic N. eutropha as described herein (e.g., strain D23) may be used to promote wound healing in a patient that has an impaired healing ability, e.g., a diabetic patient.

In some embodiments, this disclosure provides methods of using optionally axenic N. eutropha as described herein (e.g., strain D23) to prevent a disease or disorder, e.g., a skin disorder. Prevention, in certain embodiments, means reducing the risk of a subject developing a disease, compared to a similar untreated subject. The risk need not be reduced to zero.

Individuals having a reduced bathing frequency, such as astronauts, submarine crew members, military personnel during a campaign, civilian workers in remote locations, refugees, bedridden individuals and many others may maintain healthier skin by maintaining N. eutropha on the skin. With regard to bedridden individuals, the N. eutropha in some embodiments reduces the frequency or severity of bed sores by augmenting inadequate circulation.

It is appreciated that many modern degenerative diseases may be caused by a lack of NO species, and that AOB on the external skin can supply those species by diffusion, and that application of AOB to the skin resolves long standing medical conditions. In certain embodiments, AOB are applied to a subject to offset modern bathing practices, especially with anionic detergents remove AOB from the external skin.

One suitable method of topical application to apply sufficient N. eutropha and then wear sufficient clothing so as to induce sweating. However, many people will want to derive the benefits of AOB while maintaining their current bathing habits, in which case, a culture of the bacteria can be applied along with sufficient substrate for them to produce NO. A nutrient solution approximating the inorganic composition of human sweat can be used for this purpose. Using bacteria adapted to media approximating human sweat minimizes the time for them to adapt when applied. Since sweat evaporates once excreted onto the skin surface, using a culture media that has a higher ionic strength is desirable. A concentration approximately twice that of human sweat is suitable, but other conditions are also contemplated. AOB's nutritional needs are typically met with NH3 or urea, O2, CO2, and minerals. In some embodiments, the substrate comprises trace minerals including iron, copper, zinc, cobalt, molybdenum, manganese, sodium, potassium, calcium, magnesium, chloride, phosphate, sulfate, or any combination thereof.

In some embodiments, the present disclosure provides a method of treating a wound by applying a bandage comprising N. eutropha to the wound. Also provided are methods of producing such a bandage. The bandage may comprise, for example, an adhesive portion to affix the bandage to undamaged skin near the wound and a soft, flexible portion to cover or overlay the wound. In some embodiments, the bandage contains no other organisms but N. eutropha. The bandage may be made of a permeable material that allows gasses like oxygen and carbon dioxide to reach the N. eutropha when the bandage is applied to the wound. In certain embodiments, the bandage comprises nutrients for N. eutropha such as ammonium, ammonia, urea, or trace minerals. In certain embodiments, the bandage comprises an antibiotic to which the N. eutropha is resistant. The antibiotic resistance may arise from one or more endogenous resistance gene or from one or more transgenic.

In some embodiments, the N. eutropha is administered at a dose of about 108-109 CFU, 109-1010 CFU, 1010-1011 CFU, or 1011-1012 CFU per application. In some embodiments, the N. eutropha is administered topically at a dose of about 1010-1011 CFU, e.g., about 1×1010-5×1010, 1×1010-3×1010, or 1×1010-2×1010 CFU.

In some embodiments, the N. eutropha is administered in a volume of about 1-2, 2-5, 5-10, 10-15, 12-18, 15-20, 20-25, or 25-50 ml per dose. In some embodiments, the solution is at a concentration of about 108-109, 109-1010, or 1010-1011 CFUs/ml. In some embodiments, the N. eutropha is administered as two 15 ml doses per day, where each dose is at a concentration of 109 CFU/ml.

In some embodiments, ammonia oxidizing bacteria, e.g., the N. eutropha is administered once, twice, three, or four times per day. In some embodiments, ammonia oxidizing bacteria, e.g., the N. eutropha is administered once, twice, three, four, five, or six times per week. In some embodiments, ammonia oxidizing bacteria, e.g., the N. eutropha is administered shortly after bathing. In some embodiments, ammonia oxidizing bacteria, e.g., the N. eutropha is administered shortly before sleep.

In certain aspects, the present disclosure provides combination therapies comprising ammonia oxidizing bacteria, e.g., a N. eutropha and a second therapeutic. For instance, the disclosure provides physical admixtures of the two (or more) therapies are physically admixed. In other embodiments, the two (or more) therapies are administered in combination as separate formulation. The second therapy may be, e.g., a pharmaceutical agent, surgery, or any other medical approach that treats the relevant disease or disorder. The following paragraphs describe combination therapies capable of treating diabetic ulcers, chronic wounds, acne, rosacea, eczema, and psoriasis.

For instance, in a combination therapy capable of treating diabetic ulcers, the second therapy may comprise, e.g., a wound dressing (e.g., absorptive fillers, hydrogel dressings, or hydrocolloids), angiotensin, angiotensin analogues, platelet-rich fibrin therapy, hyperbaric oxygen therapy, negative pressure wound therapy, debridement, drainage, arterial revascularization, hyperbaric oxygen therapy, low level laser therapy, and gastrocnemius recession. The combination therapy may comprise one or more of the above-mentioned treatments.

In a combination therapy capable of treating chronic wounds, the second therapy may comprise, e.g., an antibiotic (e.g., topical or systemic, and bacteriocidal or bacteriostatic) such as Penicillins, cephalosporins, polymyxins, rifamycins, lipiarmycins, quinolones, sulfonamides, macrolides, lincosamides, tetracyclines, cyclic lipopeptides, glycylcyclines, oxazolidinones, and lipiarmycins; angiotensin, angiotensin analogues; debridement; drainage; wound irrigation; negative pressure wound therapy; application of heat; arterial revascularization; hyperbaric oxygen therapy; antioxidants such as ascorbic acid, glutathione, lipoic acid, carotenes, α-tocopherol, or ubiquinol; low level laser therapy; gastrocnemius recession; growth factors such as vascular endothelial growth factor, insulin-like growth factor 1-2, platelet derived growth factor, transforming growth factor-β, or epidermal growth factor; application of autologous platelets such as those that secrete one or more growth factors such as vascular endothelial growth factor, insulin-like growth factor 1-2, platelet derived growth factor, transforming growth factor-β, or epidermal growth factor; implantation of cultured keratinocytes; allograft; collagen, for instance a dressing comprising collagen; or protease inhibitors such as SLPI. The combination therapy may comprise one or more of the above-mentioned treatments.

In a combination therapy capable of treating acne, the second therapy may comprise, e.g., a medication (e.g., systemic or topical) such as Benzoyl peroxide, antibiotics (such as erythromycin, clindamycin, or a tetracycline), Salicylic acid, hormones (e.g., comprising a progestin such as desogestrel, norgestimate or drospirenone), retinoids such as tretinoin, adapalene, tazarotene, or isotretinoin. The second therapy may also be a procedure such as comedo extraction, corticosteroid injection, or surgical lancing. The combination therapy may comprise one or more of the above-mentioned treatments.

In a combination therapy capable of treating rosacea, the second therapy may comprise, e.g., an antibiotic, e.g., an oral tetracycline antibiotic such as tetracycline, doxycycline, or minocycline, or a topical antibiotic such as metronidazole; azelaic acid; alpha-hydroxy acid; isotretinoin can be prescribed; sandalwood oil; clonidine; beta-blockers such as nadolol and propranolol; antihistamines (such as loratadine); mirtazapine; methylsulfonylmethane or silymarin, optionally in combination with each other; lasers such as dermatological vascular laser or CO2 laser; or light therapies such as intense pulsed light, low-level light therapy or photorejuvenation. The combination therapy may comprise one or more of the above-mentioned treatments.

In a combination therapy capable of treating eczema, the second therapy may comprise, e.g., a corticosteroid such as hydrocortisone or clobetasol propionate, immunosuppressants (topical or systemic) such as pimecrolimus, tacrolimus, ciclosporin, azathioprine or methotrexate, or light therapy such as with ultraviolet light. The combination therapy may comprise one or more of the above-mentioned treatments.

In a combination therapy capable of treating psoriasis, the second therapy may comprise, e.g., a corticosteroid such as desoximetasone; a retinoid; coal tar; Vitamin D or an analogue thereof such as paricalcitol or calcipotriol; moisturizers and emollients such as mineral oil, vaseline, calcipotriol, decubal, or coconut oil; dithranol; or fluocinonide. The combination therapy may comprise one or more of the above-mentioned treatments.

While not wishing to be bound by theory, it is proposed that treatment of psoriasis with a therapeutically effective dose of ammonia oxidizing bacteria described herein may involve downregulation of inflammation due to NO generation and reduction in formation of human cathelicidin peptide LL-37.

While not wishing to be bound by theory, it is proposed that treatment of psoriasis with a therapeutically effective dose of ammonia oxidizing bacteria as described herein may involve downregulation of inflammation due to NO generation.

While not wishing to be bound by theory, it is proposed that treatment of impetigo or other skin and soft tissue infections with a therapeutically effective dose of ammonia oxidizing bacteria as described herein may involve limiting and/or inhibiting the spread and proliferation of Staphylococcus aureus (S. aureus), e.g., methicillin resistant Staphylococcus aureus, Pseudomonas aeruginosa (P. aeruginosa), Streptococcus pyogenes (S. pyogenes), Acinetobacter baumannii (A. baumannii), Propionibacteria, and Stenotrophomonas.

The present disclosure also provides a method of promoting wound healing, comprising administering to a wound an effective dose of ammonia oxidizing bacteria as described herein. Similarly, the present disclosure provides ammonia oxidizing bacteria as described herein for use in treating a wound. Likewise, the present disclosure provides a use of ammonia oxidizing bacteria as described herein in the manufacture of a medicament or a composition for treating a wound.

Ammonia oxidizing bacteria as described herein may be used to promote wound healing in a patient that has an impaired healing ability, e.g., a diabetic patient.

In some embodiments, this disclosure provides methods of using ammonia oxidizing bacteria as described herein to prevent a disease or disorder, e.g., a skin disorder. Prevention, in certain embodiments, means reducing the risk of a subject developing a disease, compared to a similar untreated subject. The risk need not be reduced to zero.

Individuals having a reduced bathing frequency, such as astronauts, submarine crew members, military personnel during a campaign, civilian workers in remote locations, refugees, bedridden individuals and many others may maintain healthier skin by maintaining ammonia oxidizing bacteria on the skin. With regard to bedridden individuals, the ammonia oxidizing bacteria in some embodiments reduces the frequency or severity of bed sores by augmenting inadequate circulation.

It is appreciated that many modern degenerative diseases may be caused by a lack of NO species, and that ammonia oxidizing bacteria on the external skin can supply those species by diffusion, and that application of ammonia oxidizing bacteria to the skin resolves long standing medical conditions. In certain embodiments, ammonia oxidizing bacteria are applied to a subject to offset modern bathing practices, especially with anionic detergents remove ammonia oxidizing bacteria from the external skin.

One suitable method of topical application to apply sufficient ammonia oxidizing bacteria and then wear sufficient clothing so as to induce sweating. However, many people will want to derive the benefits of ammonia oxidizing bacteria while maintaining their current bathing habits, in which case, a culture of the bacteria can be applied along with sufficient substrate for them to produce NO. A nutrient solution approximating the inorganic composition of human sweat can be used for this purpose. Using bacteria adapted to media approximating human sweat minimizes the time for them to adapt when applied. Since sweat evaporates once excreted onto the skin surface, using a culture media that has a higher ionic strength is desirable. A concentration approximately twice that of human sweat is suitable, but other conditions are also contemplated. Ammonia oxidizing bacteria's nutritional needs are typically met with NH3 or urea, O2, CO2, and minerals. In some embodiments, the substrate comprises trace minerals including iron, copper, zinc, cobalt, molybdenum, manganese, sodium, potassium, calcium, magnesium, chloride, phosphate, sulfate, or any combination thereof.

In some embodiments, the present disclosure provides a method of treating a wound by applying a bandage comprising ammonia oxidizing bacteria to the wound. Also provided are methods of producing such a bandage. The bandage may comprise, for example, an adhesive portion to affix the bandage to undamaged skin near the wound and a soft, flexible portion to cover or overlay the wound. In some embodiments, the bandage contains no other organisms but ammonia oxidizing bacteria. The bandage may made of a permeable material that allows gasses like oxygen and carbon dioxide to reach the ammonia oxidizing bacteria when the bandage is applied to the wound. In certain embodiments, the bandage comprises nutrients for ammonia oxidizing bacteria such as ammonium, ammonia, urea, or trace minerals. In certain embodiments, the bandage comprises an antibiotic to which the ammonia oxidizing bacteria is resistant. The antibiotic resistance may arise from one or more endogenous resistance gene or from one or more transgenes.

In some embodiments, the ammonia oxidizing bacteria, e.g., a preparation of ammonia oxidizing bacteria, is administered at a dose of about 108-109 CFU, 109-1010 CFU, 1010-1011 CFU, or 1011-1012 CFU per application or per day. In some embodiments, the ammonia oxidizing bacteria is administered topically at a dose of about 109-1010 CFU, e.g., about 1×109-5×109, 1×109-3×109, or 1×109-10×109 CFU.

In some embodiments, the ammonia oxidizing bacteria is administered in a volume of about 1-2, 2-5, 5-10, 10-15, 12-18, 15-20, 20-25, or 25-50 ml per dose. In some embodiments, the solution is at a concentration of about 108-109, 109-1010, or 1010-1011 CFU/ml. In some embodiments, the ammonia oxidizing bacteria is administered as two 15 ml doses per day, where each dose is at a concentration of 109 CFU/ml.

In some embodiments, the ammonia oxidizing bacteria is administered once, twice, three, or four times per day. In some embodiments, the ammonia oxidizing bacteria is administered once, twice, three, four, five, or six times per week. In some embodiments, the ammonia oxidizing bacteria is administered shortly after bathing. In some embodiments, the ammonia oxidizing bacteria is administered shortly before sleep.

In some embodiments, the ammonia oxidizing bacteria is administered for about 1-3, 3-5, 5-7, 7-9, 5-10, 10-14, 12-18, 12-21, 21-28, 28-35, 35-42, 42-49, 49-56, 46-63, 63-70, 70-77, 77-84, 84-91 days, e.g., for about 1 month, for about 2 months, for about 3 months. In some embodiments, the ammonia oxidizing bacteria is administered for an indefinite period of time, e.g., greater than one year, greater than 5 years, greater than 10 years, greater than 15 years, greater than 30 years, greater than 50 years, greater than 75 years.

6. EXPERIMENTAL MODELS FOR REFINING D23 TREATMENTS

Treatments comprising ammonia oxidizing bacteria as described herein (optionally in combination with another therapy) can be refined using a number of model systems. These model systems can be used to determine suitable doses and timing of administration.

For instance, with respect to chronic wounds and diabetic ulcers, one may use the mouse skin puncture model. Other models for these disorders include controlled cutaneous ischemia in a guinea pig model, rabbit ear ulcer model, application of calcium to a wound, or topical application of doxorubicin.

With respect to acne, one may use (for example) the Mexican hairless dog model, the Rhino mouse model, or the rabbit ear assay. With respect to rosacea, one may use (for example) intradermal injection of LL-37 into mouse skin or the Syrian hamster model. With respect to eczema, one may use (for example) application of a crude extract of Dermatophagoides farina, application of dinitrochlorobenzene to the ears of sensitized guinea pigs, or NC/Nga mice. With respect to psoriasis, one may use (for example) xenograft models in which involved and uninvolved psoriatic skin are transplanted onto immunodeficient mice, application of an antibody directed against interleukin 15 to the skin of SCID mice, and the Sharpincpdm/Sharpincpdm mouse model.

Treatments comprising ammonia oxidizing bacteria, e.g., N. eutropha as described herein (e.g., strain D23) (optionally in combination with another therapy) can be refined using a number of model systems. These model systems can be used to determine suitable doses and timing of administration.

For instance, with respect to chronic wounds and diabetic ulcers, one may use the mouse skin puncture model described herein in Example 6. Other models for these disorders include controlled cutaneous ischemia in a guinea pig model, rabbit ear ulcer model, application of calcium to a wound, or topical application of doxorubicin.

With respect to acne, one may use (for example) the Mexican Hairless Dog model, the Rhino mouse model, or the rabbit ear assay. With respect to rosacea, one may use (for example) intradermal injection of LL-37 into mouse skin or the Syrian hamster model. With respect to eczema, one may use (for example) application of a crude extract of Dermatophagoides farina, application of dinitrochlorobenzene to the ears of sensitized guinea pigs, or NC/Nga mice. With respect to psoriasis, one may use (for example) xenograft models in which involved and uninvolved psoriatic skin are transplanted onto immunodeficient mice, application of an antibody directed against interleukin 15 to the skin of SCID mice, and the Sharpincpdm/Sharpincpdm mouse model.

7. MECHANISM OF THERAPEUTIC BENEFIT

While not wishing to be bound by theory, it is believed that one or more of the following mechanisms contributes to the beneficial effect of ammonia oxidizing bacteria, e.g., N. eutropha in treating the diseases and conditions discussed herein. Additional mechanistic details are found in International Application WO/2005/030147, which is herein incorporated by reference in its entirety.

In order to understand the beneficial aspects of these bacteria, it is helpful to understand angiogenesis. All body cells, except those within a few hundred microns of the external air, receive all metabolic oxygen from the blood supply. The oxygen is absorbed by the blood in the lung, is carried by red blood cells as oxygenated hemoglobin to the peripheral tissues, where it is exchanged for carbon dioxide, which is carried back and exhaled from the lung. Oxygen must diffuse from the erythrocyte, through the plasma, through the endothelium and through the various tissues until it reached the mitochondria in the cell which consumes it. The human body contains about 5 liters of blood, so the volume of the circulatory system is small compared to that of the body. Oxygen is not actively transported. It passively diffuses down a concentration gradient from the air to the erythrocyte, from the erythrocyte to the cell, and from the cell to cytochrome oxidase where it is consumed. The concentration of oxygen at the site of consumption is the lowest in the body, and the O2 flux is determined by the diffusion resistance and the concentration gradient. Achieving sufficient oxygen supply to all the peripheral tissues requires exquisite control of capillary size and location. If the spacing between capillaries were increased, achieving the same flux of oxygen would require a larger concentration difference and hence a lower O2 concentration at cytochrome oxidase. With more cells between capillaries, the O2 demand would be greater. If the spacing between capillaries were decreased, there would be less space available for the cells that perform the metabolic function of the organ.

In certain aspects, it is appreciated that NO from ammonia oxidizing bacteria is readily absorbed by the outer skin and converted into S-nitrosothiols since the outer skin is free from hemoglobin. M. Stucker et al. have shown that the external skin receives all of its oxygen from the external air in “The cutaneous uptake of atmospheric oxygen contributes significantly to the oxygen supply of human dermis and epidermis. (Journal of Physiology (2002), 538.3, pp. 985-994.) This is readily apparent, because the external skin can be seen to be essentially erythrocyte free. There is circulation of plasma through these layers because they are living and do require the other nutrients in blood, just not the oxygen. S-nitrosothiols formed are stable, can diffuse throughout the body, and constitute a volume source of authentic NO and a source of NO to transnitrosate protein thiols.

In some aspects, it is appreciated that capillary rarefaction may be one of the first indications of insufficient levels of NO. F. T. Tarek et al. have shown that sparse capillaries, or capillary rarefaction, is commonly seen in people with essential hypertension. (Structural Skin Capillary Rarefaction in Essential Hypertension. Hypertension. 1999; 33:998-1001

A great many conditions are associated with the capillary density becoming sparser. Hypertension is one, and researchers reported that sparse capillaries are also seen in the children of people with essential hypertension, and also in people with diabetes. Significant complications of diabetes are hypertension, diabetic nephropathy, diabetic retinopathy, and diabetic neuropathy. R. Candido et al. have found that the last two conditions are characterized by a reduction in blood flow to the affected areas prior to observed symptoms. (Haemodynamics in microvascular complications in type 1 diabetes. Diabetes Metab Res Rev 2002; 18: 286-304.) Reduced capillary density is associated with obesity, and simple weight loss increases capillary density as shown by A Philip et al. in “Effect of Weight Loss on Muscle Fiber Type, Fiber Size, Capilarity, and Succinate Dehydrogenase Activity in Humans. The Journal of Clinical Endocrinology & Metabolism Vol. 84, No. 11 4185-4190, 1999.

Researchers have shown that in primary Raynaud's phenomena (PRP), the nailfold capillaries are sparser (slightly) than in normal controls, and more abundant than in patients that have progressed to systemic sclerosis (SSc). M. Bukhari, Increased Nailfold Capillary Dimensions In Primary Raynaud's Phenomenon And Systemic Sclerosis. British Journal of Rheumatology, Vol. 24 No 35: 1127-1131, 1996. They found that the capillary density decreased from 35 loops/mm2 (normal controls) to 33 (PRP), to 17 (SSc). The average distance between capillary limbs was 18μ, 18μ, and 30μ for controls, PRP and SSc, respectively.

In certain aspects, it is appreciated that the mechanism that the body normally uses to sense “hypoxia” may affect the body's system that regulates capillary density. According to this aspect of the invention, a significant component of “hypoxia” is sensed, not by a decrease in O2 levels, but rather by an increase in NO levels. Lowering of basal NO levels interferes with this “hypoxia” sensing, and so affects many bodily functions regulated through “hypoxia.” For Example, anemia is commonly defined as “not enough hemoglobin,” and one consequence of not enough hemoglobin is “hypoxia”, which is defined as “not enough oxygen.” According to some aspects, these common definitions do not account for the nitric oxide mediated aspects of both conditions.

At rest, acute isovolemic anemia is well tolerated. A ⅔ reduction in hematocrit has minimal effect on venous return PvO2, indicating no reduction in either O2 tension or delivery throughout the entire body. Weiskopf et al. Human cardiovascular and metabolic response to acute, severe isovolemic anemia. JAMA 1998, vol 279, No. 3, 217-221. At 50% reduction (from 140 to 70 g Hb/L), the average PvO2 (over 32 subjects) declined from about 77% to about 74% (of saturation). The reduction in O2 capacity of the blood is compensated for by vasodilatation and tachycardia with the heart rate increasing from 63 to 85 bpm. That the compensation is effective is readily apparent, however, the mechanism is not. A typical explanation is that “hypoxia” sensors detected “hypoxia” and compensated with vasodilatation and tachycardia. However, there was no “hypoxia” to detect. There was a slight decrease in blood lactate (a marker for anaerobic respiration) from 0.77 to 0.62 mM/L indicating less anaerobic respiration and less “hypoxia.” The 3% reduction in venous return PvO2 is the same level of “hypoxia” one would get by ascending 300 meters in altitude (which typically does not produce tachycardia). With the O2 concentration in the venous return staying the same, and the O2 consumption staying the same, there is no place in the body where there is a reduction in O2 concentration. Compensation during isovolemic anemia may not occur because of O2 sensing.

Thus the vasodilatation that is observed in acute isovolemic anemia may be due to the increased NO concentration at the vessel wall. NO mediates dilatation of vessels in response to shear stress and other factors. No change in levels of NO metabolites would be observed, because the production rate of NO is unchanged and continues to equal the destruction rate. The observation of no “hypoxic” compensation with metHb substitution can be understood because metHb binds NO just as Hb does, so there is no NO concentration increase with metHb substitution as there is with Hb withdrawal.

Nitric oxide plays a role in many metabolic pathways. It has been suggested that a basal level of NO exerts a tonal inhibitory response, and that reduction of this basal level leads to a dis-inhibition of those pathways. Zanzinger et al. have reported that NO has been shown to inhibit basal sympathetic tone and attenuate excitatory reflexes. (Inhibition of basal and reflex-mediated sympathetic activity in the RVLM by nitric oxide. Am. J. Physiol. 268 (Regulatory Integrative Comp. Physiol. 37): R958-R962, 1995.)

In some aspects, it is appreciated that one component of a volume source of NO is low molecular weight S-nitrosothiols produced in the erythrocyte free skin from NO produced on the external skin by ammonia oxidizing bacteria. These low molecular weight S-nitrosothiols are stable for long periods, and can diffuse and circulate freely in the plasma. Various enzymes can cleave the NO from various S-nitrosothiols liberating NO at the enzyme site. It is the loss of this volume source of NO from AOB on the skin that leads to disruptions in normal physiology. The advantage to the body of using S-nitrosothiols to generate NO far from a capillary is that O2 is not required for NO production from S-nitrosothiols. Production of NO from nitric oxide synthase (NOS) does require O2. With a sufficient background of S-nitrosothiols, NO can be generated even in anoxic regions. Free NO is not needed either since NO only exerts effects when attached to another molecule, such as the thiol of a cysteine residue or the iron in a heme, so the effects of NO can be mediated by transnitrosation reactions even in the absence of free NO provided that S-nitrosothiols and transnitrosation enzymes are present.

Frank et al. have shown that the angiogenesis that accompanies normal wound healing is produced in part by elevated VEGF which is induced by increased nitric oxide. (Nitric oxide triggers enhanced induction of vascular endothelial growth factor expression in cultured keratinocytes (HaCaT) and during cutaneous wound repair. FASEB J. 13, 2002-2014 (1999).)

NO has a role in the development of cancer, indicating that the bacteria described herein may be used in methods of cancer treatment and prevention. According to certain aspects, it is appreciated that the presence of NO during hypoxia may prevent cells from dividing while under hypoxic stress, when cells are at greater risk for errors in copying DNA. One relevant cell function is the regulation of the cell cycle. This is the regulatory program which controls how and when the cell replicates DNA, assembles it into duplicate chromosomes, and divides. The regulation of the cell cycle is extremely complex, and is not fully understood. However, it is known that there are many points along the path of the cell cycle where the cycle can be arrested and division halted until conditions for doing so have improved. The p53 tumor suppressor protein is a key protein in the regulation of the cell cycle, and it serves to initiate both cell arrest and apoptosis from diverse cell stress signals including DNA damage and p53 is mutated in over half of human cancers as reported by Ashcroft et al. in “Stress Signals Utilize Multiple Pathways To Stabilize p53.” (Molecular And Cellular Biology, May 2000, p. 3224-3233.) Hypoxia does initiate accumulation of p53, and while hypoxia is important in regulating the cell cycle, hypoxia alone fails to induce the downstream expression of p53 mRNA effector proteins and so fails to cause arrest of the cell cycle. Goda et al. have reported that hypoxic induction of cell arrest requires hypoxia-inducing factor-1 (HIF-1α). (Hypoxia-Inducible Factor 1α Is Essential for Cell Cycle Arrest during Hypoxia. Molecular And Cellular Biology, January 2003, p. 359-369.) Britta et al. have reported that NO is one of the main stimuli for HIF-1α. (Accumulation of HIF-1α under the influence of nitric oxide. Blood, 15 Feb. 2001, Volume 97, Number 4.) In contrast, NO does cause the accumulation of transcriptionally active p53 and does cause arrest of the cell cycle and does cause apoptosis. Wang et al., P53 Activation By Nitric Oxide Involves Down-Regulation Of Mdm2. THE JOURNAL OF BIOLOGICAL CHEMISTRY Vol. 277, No. 18, Issue Of May 3, Pp. 15697-15702, 2002.

In certain aspect of the invention, it is appreciated that preventing the necrotic death of cells by preventing the capillary rarefaction that leads to their hypoxic death may prevent autoimmune disorders. When cells are exposed to chronic hypoxia, the production of reactive oxygen species (ROS) is increased, and there is increased damage to the cells metabolic machinery and ultimately to the cells' DNA. Decreased metabolic capacity will decrease capacity for repair of damage due to ROS and due to exogenous carcinogen exposure. Over time, the damage accumulates and increases the chance of three events: the cell will undergo deletion of cancer-preventing genes and the cell will become cancerous, the cell will die through necrosis, or the cell will die through apoptosis. When cells die, either through necrosis or apoptosis, the cell debris must be cleared from the site. Dead cells are phagocytosed by immune cells, including dendritic cells and macrophages. When these cells phagocytose a body, it is digested by various proteolytic enzymes into antigenic fragments, and then these antigens are attached to the major histocompatibility complex (MHC1, MHC2) and the antigen-MHC complex is moved to the surface of the cell where it can interact with T cells and activate the T cells in various ways. Any cell injury releases adjuvants which stimulate the immune system in various ways. In general, cells that undergo necrosis stimulate a greater immune response than cells that undergo apoptosis. Chronic exposure of immune cells to dead and dying cells is therefore likely to lead to autoimmune disorders.

In certain aspects, it is appreciated that low basal NO leads to fibrotic hypertrophy. Once a dead cell has been cleared, a new cell cannot easily take its place, because there is insufficient O2 to support it. Any such new cell would suffer the same fate. The space can remain empty, in which case the organ shrinks, the capillaries draw closer together, new cells are now deprived of the VEGF formerly produced by the now-missing cell, so capillaries ablate and the hypoxic zone reforms. This could result in a general shrinkage of the affected tissues. In tissues that support fibrosis, relatively inert collagen fibers can fill the space. Since the metabolic requirements of the body for the particular organ in question are not reduced, the organ may attempt to grow larger, but now with a significant fibrous content. This may result in fibrotic hypertrophy, such as of the heart and liver. Some organs, such as the brain, cannot grow larger or smaller because the three-dimensional connectivity of nerves and blood vessels are important, and cannot be continuously and simultaneously mapped onto an asymmetrically shrinking brain. The space must be filled with something, and β-amyloid might be the (not so inert) space filler. The kidney cannot grow larger because of the renal capsule, so the number of living cells becomes smaller and they are replaced with fibrotic tissue. If the dead cells are cleared, the tissue shrinks, and the ratio of NO/O2 goes down again, and the capillaries again become sparser. This may set up the vicious circle of end stage renal disease, congestive heart failure/cardiac hypertrophy, primary biliary cirrhosis, Alzheimer's disease, atherosclerosis, inflammatory bowel disease, hypertrophic scar formation, and the multiple connective tissue diseases starting with Raynaud's phenomena and ending with Systemic Sclerosis and primary Sjogren's syndrome where capillary rarefaction is also observed. Ferrini et al, have shown that a reduction in basal NO levels through chronic inhibition of NOS with L-NAME leads to generalized fibrosis of the heart and kidneys. (Antifibrotic Role of Inducible Nitric Oxide Synthase. Nitric Oxide: Biology and Chemistry Vol. 6, No. 3, pp. 283-294 (2002).) It may be that low basal NO leads to fibrotic hypertrophy.

In certain aspects, it is appreciated that capillary rarefaction affects a subject's ability to control their appetite. Capillary rarefaction is observed in the brains of aged humans and animals. Capillary rarefaction is associated with declines in circulating growth factors including insulin like growth factor-1. Neurogenesis in the adult brain is coordinated with angiogenesis. Since the brain regulates many homeostatic functions, increased diffusion lengths between capillaries to control elements of the brain might be “interpreted” as inadequate blood concentrations of those species. The flux of glucose in the brain is quite close to normal metabolic needs, where glucose flux is only 50 to 75% greater than glucose consumption and the glucose transporters across the blood brain barrier are saturable, stereospecific and independent of energy or ion gradients. A large part of the regulation of appetite is mediated through the brain, and capillary rarefaction may cause an adequate blood concentration of “nutrients” (or marker compounds proportional to “nutrients”) to be interpreted as insufficient. This may be one cause of obesity.

According to certain aspects, it is appreciated that capillary rarefaction may be a cause of non-insulin dependent diabetes. Non-insulin dependent diabetes (NIDDM) is also known as the Metabolic Syndrome or Diabetes type 2, and is characterized by insulin resistance. The sensitivity of the body to insulin is reduced, and insulin levels increase People with NIDDM have high blood glucose, high blood triglycerides, are typically obese, hypertensive, and typically have significant visceral fat.

Other symptoms accompany NIDDM, which may point to capillary rarefaction as the cause. In a study of 40 men, with and without NIDDM, obese (BMI 29) and lean (BMI 24) (10 of each), Konrad et al. report that blood lactate levels at rest were 1.78, 2.26, 2.42, and 2.76 (mM/L) for lean men without, obese men without, lean men with NIDDM, obese men with NIDDM respectively. (A-Lipoic acid treatment decreases serum lactate and pyruvate concentrations and improves glucose effectiveness in lean and obese patients with type 2 diabetes. Diabetes Care 22:280-287, 1999.) Lactate is a measure of anaerobic glycolysis. When O2 is insufficient to generate ATP through oxidative phosphorylation, cells can produce ATP through anaerobic glycolysis. One of the products of anaerobic glycolysis is lactate, which must be exported from the cells, otherwise the pH drops and function is compromised. Blood lactate is commonly measured in exercise studies, where an increase indicates the work load at which maximum oxidative work can be done. Higher levels of lactate at rest would indicate increased anaerobic glycolysis at rest, which is consistent with capillary rarefaction.

Primary biliary cirrhosis is associated with Raynaud's phenomena, pruritus, sicca syndrome, osteoporosis, portal hypertension, neuropathy, and pancreatic insufficiency, and liver abnormalities are associated with rheumatic diseases. Elevated liver enzymes are a symptom of liver inflammation, and elevated liver enzymes are observed as an early symptom of “asymptomatic” primary biliary cirrhosis. Accordingly, the bacteria described herein may be used to treat liver inflammation.

Torre et al have reported that Alzheimer's disease (AD) is a microvascular disorder with neurological degeneration secondary to hypoperfusion, resulting in part from insufficient nitric oxide. (Review: Evidence that Alzheimer's disease is a microvascular disorder: the role of constitutive nitric oxide, Brain Research Reviews 34 (2000) 119-136.) Accordingly, the bacteria described herein may be used to treat AD.

Adverse health effects that are associated with hypertension may also be consequences of low basal NO. The decreased response to vasodilatation is also consistent with low basal NO. NO is a diffusible molecule that diffuses from a source to a sensor site where it has the signaling effect. With low NO levels, every NO source must produce more NO to generate an equivalent NO signal of a certain intensity a certain distance away. NO diffuses in three dimensions and the whole volume within that diffusion range must be raised to the level that will give the proper signal at the sensor location. This may result in higher NO levels at the source and between the source and the sensor. Adverse local effects of elevated NO near a source may then arise from too low a NO background. There is some evidence that this scenario actual occurs. In rat pancreatic islets, Henningsson et al have reported that inhibition of NOS with L-NAME increases total NO production through the induction of iNOS. (Chronic blockade of NO synthase paradoxically increases islet NO production and modulates islet hormone release. Am J Physiol Endocrinol Metab 279: E95-E107, 2000.) Increasing NO by increasing NOS activity will only work up to some limit. When NOS is activated but is not supplied with sufficient tetrahydrobiopterin (BH4) or L-arginine, it becomes “uncoupled” and generates superoxide (O2−) instead of NO. This O2 may then destroy NO. Attempting to produce NO at a rate that exceeds the supply of BH4 or L-arginine may instead decrease NO levels. This may result in positive feedback where low NO levels are made worse by stimulation of NOS, and uncoupled NOS generates significant O2 which causes local reactive oxygen species (ROS) damage such as is observed in atherosclerosis, end stage renal disease, Alzheimer's, and diabetes.

The bacteria described herein may also be used to delay the signs of aging. Caloric restriction extends lifespan, and Holloszy reported that restricting food intake to 70% of ad lib controls, prolongs life in sedentary rats from 858 to 1,051 days, almost 25%. (Mortality rate and longevity of food restricted exercising male rats: a reevaluation. J. Appl. Physiol. 82(2): 399-403, 1997.) The link between calorie restriction and prolonged life is well established, however, the causal mechanism is not. Lopez-Torres et al. reported that the examination of liver mitochondrial enzymes in rats indicates a reduction in H2O2 production due to reduced complex I activity associated with calorie restriction. (Influence Of Aging And Long-Term Caloric Restriction On Oxygen Radical Generation And Oxidative DNA Damage In Rat Liver Mitochondria. Free Radical Biology & Medicine Vol. 32 No 9 pp 882-8899, 2002.) H2O2 is produced by dismutation of O2, which is a major ROS produced by the mitochondria during respiration. The main source of O2 has been suggested by Kushareva et al. and others to be complex I which catalyzes the NAD/NADH redox couple by reverse flow of electrons from complex III, the site of succinate reduction. The free radical theory, proposed by Beckman, of aging postulates, that free radical damage to cellular DNA, antioxidant systems and DNA repair systems accumulates with age and when critical systems are damaged beyond repair, death ensues. (The Free Radical Theory of Aging Matures. Physiol. Rev. 78: 547-581, 1998.)

As an additional mechanism, NO has been demonstrated by Vasa et al. to activate telomerase and to delay senescence of endothelial cells. (Nitric Oxide Activates Telomerase and Delays Endothelial Cell Senescence. Circ Res. 2000; 87:540-542.) Low basal NO will increase basal metabolic rate by disinhibition of cytochrome oxidase. Increased basal metabolism will also increase cell turn-over and growth rate. Capillary rarefaction, by inducing chronic hypoxia may increase free radical damage and may also increase cell turn-over, and so accelerate aging by both mechanisms.

In some aspects, it is appreciated that autotrophic ammonia-oxidizing bacteria may produce protective aspects for allergies and autoimmune disorders. The best known autoimmune disease is perhaps Diabetes Type 1, which results from the destruction of the insulin producing cells in the pancreas by the immune system. Recurrent pregnancy loss is also associated with autoimmune disorders where the number of positive autoimmune antibodies correlated positively with numbers recurrent pregnancy losses. Systemic Sclerosis, Primary Biliary Cirrhosis, autoimmune hepatitis, and the various rheumatic disorders are other examples of autoimmune disorders. Application of AOB was observed to reduce an allergy, hay fever, as described in WO/2005/030147.

One mechanism by which AOB may exert their protective effect on allergies and autoimmune disorders is through the production of nitric oxide, primarily through the regulatory inhibition of NF-κB and the prevention of activation of immune cells and the induction of inflammatory reactions. NF-κB is a transcription factor that up-regulates gene expression and many of these genes are associated with inflammation and the immune response including genes which cause the release of cytokines, chemokines, and various adhesion factors. These various immune factors cause the migration of immune cells to the site of their release resulting in the inflammation response. Constitutive NO production has been shown to inhibit NF-κB by stabilizing IκBα (an inhibitor of NF-κB) by preventing IκBα degradation.

Administration of an NO donor has been shown by Xu et al. to prevent the development of experimental allergic encephalomyelitis in rats. (SIN-1, a Nitric Oxide Donor, Ameliorates Experimental Allergic Encephalomyelitis in Lewis Rats in the Incipient Phase: The Importance of the Time Window. The Journal of Immunology, 2001, 166: 5810-5816.) In this study, it was demonstrated that administering an NO donor, reduced the infiltration of macrophages into the central nervous system, reduced the proliferation of blood mononuclear cells, and increased apoptosis of blood mononuclear cells. All of these results are expected to reduce the extent and severity of the induced autoimmune response.

Low basal NO may lead to autism via the mechanism that new connections in the brain are insufficiently formed as a result of insufficient basal nitric oxide. While not wishing to be bound in theory, in some embodiments, formation of neural connections is modulated by NO. In these cases, any condition that lowers the range of NO diffusion may decrease the volume size of brain elements that can undergo connections. A brain which developed under conditions of low basal NO levels may be arranged in smaller volume elements because the reduced effective range of NO.

Additional symptoms exhibited in autistic individuals may also point to low NO as a cause, including increased pitch discrimination, gut disturbances, immune system dysfunction, reduced cerebral blood flow, increased glucose consumption of the brain, increased plasma lactate, attachment disorders, and humming. Each of these symptoms may be attributed to a low basal NO level.

Takashi Ohnishi et al. have reported that autistic individuals show decreased blood flow. Takashi Ohnishi et al., Abnormal regional cerebral blood flow in childhood autism. Brain (2000), 123, 1838-1844. J. M. Rumsey et al. have reported that autistic individuals have increased glucose consumption. Rumsey J M, Duara R, Grady C, Rapoport J L, Margolin R A, Rapoport S I, Cutler N R. Brain metabolism in autism. Resting cerebral glucose utilization rates as measured with positron emission tomography. Arch Gen Psychiatry, 1985 May; 42(5):448-55 (abstract). D. C. Chugani has reported that autistic individuals have an increased plasma lactate levels. Chugani D C, et al., Evidence of altered energy metabolism in autistic children. Prog Neuropsychopharmacol Biol Psychiatry. 1999 May; 23(4):635-41. The occurrence of these effects may be a result of capillary rarefaction in the brain, which may reduce blood flow and O2 supply, such that some of the metabolic load of the brain may be produced through glycolysis instead of oxidative phosphorylation.

Nitric oxide has been demonstrated by B. A. Klyachko et al. to increase the excitability of neurons by increasing the after hyperpolarization through cGMP modification of ion channels. Vitaly A. Klyachko et al., cGMP-mediated facilitation in nerve terminals by enhancement of the spike after hyperpolarization. Neuron, Vol. 31, 1015-1025, Sep. 27, 2001. C. Sandie et al. have shown that inhibition of NOS reduces startle. Carmen Sandi et al., Decreased spontaneous motor activity and startle response in nitric oxide synthase inhibitor-treated rats. European journal of pharmacology 277 (1995) 89-97. Attention-Deficit Hyperactivity Disorder (ADHD) has been modeled using the spontaneously hypertensive rat (SHR) and the Naples high-excitability (NHE) rat. Both of these models have been shown by Raffaele Aspide et al, to show increased attention deficits during periods of acute NOS inhibition. Raffaele Aspide et al., Non-selective attention and nitric oxide in putative animal models of attention-deficit hyperactivity disorder. Behavioral Brain Research 95 (1998) 123-133. Accordingly, the bacteria herein may be used in the treatment of ADHD.

Inhibition of NOS has also been shown by M. R. Dzoljic to inhibit sleep. M. R. Dzoljic, R. de Vries, R. van Leeuwen. Sleep and nitric oxide: effects of 7-nitro indazole, inhibitor of brain nitric oxide synthase. Brain Research 718 (1996) 145-150. G. Zoccoli has reported that a number of the physiological effects seen during sleep are altered when NOS is inhibited, including rapid eye movement and sleep-wake differences in cerebral circulation. G. Zoccoli, et al., Nitric oxide inhibition abolishes sleep-wake differences in cerebral circulation. Am. J. Physiol. Heart Circ Physiol 280: H2598-2606, 2001. NO donors have been shown by L. Kapas et al. to promote non-REM sleep, however, these increases persisted much longer than the persistence of the NO donor, suggesting perhaps a rebound effect. Levente Kapas et al. Nitric oxide donors SIN-1 and SNAP promote nonrapid-eye-movement sleep in rats. Brain Research Bullitin, vol 41, No 5, pp. 293-298, 1996. M. Rosaria et al., Central NO facilitates both penile erection and yawning. Maria Rosaria Melis and Antonio Argiolas. Role of central nitric oxide in the control of penile erection and yawning. Prog Neuro-Psychopharmacol & Biol. Phychiat. 1997, vol 21, pp 899-922. P. Tani et al, have reported that insomnia is a frequent finding in adults with Asperger's. Pekka Tani et al., Insomnia is a frequent finding in adults with Asperger's syndrome. BMC Psychiatry 2003, 3:12. Y. Hoshino has also observed sleep disturbances in autistic children. Hoshino Y, Watanabe H, Yashima Y, Kaneko M, Kumashiro H. An investigation on sleep disturbance of autistic children. Folia Psychiatr Neurol Jpn. 1984; 38(1):45-51. (abstract) K. A. Schreck et al. has observed that the severity of sleep disturbances correlates with severity of autistic symptoms. Schreck K A, et al., Sleep problems as possible predictors of intensified symptoms of autism. Res Dev Disabil. 2004 Jan.-Feb.; 25(1):57-66. (abstract). Accordingly, the bacteria herein may be used in the treatment of insomnia.

W. D. Ratnasooriya et al reported that inhibition of NOS in male rats reduces pre-coital activity, reduces libido, and reduces fertility. W. D. Ratnasooriya et al., Reduction in libido and fertility of male rats by administration of the nitric oxide (NO) synthase inhibitor N-nitro-L-arginine methyl ester. International journal of andrology, 23: 187-191 (2000).

It may be that a number of seemingly disparate disorders, characterized by ATP depletion and eventual organ failure are actually “caused” by nitropenia, caused by a global deficiency in basal nitric oxide. When this occurs in the heart, the result is dilative cardiomyopathy. When this occurs in the brain, the result is white matter hyperintensity, Alzheimer's, vascular depression, vascular dementia, Parkinson's, and the Lewy body dementias. When this occurs in the kidney, the result is end stage renal disease, when this occurs in the liver, the result is primary biliary cirrhosis. When this occurs in muscle, the consequence is fibromyaligia, Gulf War Syndrome, or chronic fatigue syndrome. When this occurs in the bowel, the consequence is ischemic bowel disease. When this occurs in the pancreas, the consequence is first type 2 diabetes, followed by chronic inflammation of the pancreas, followed by autoimmune attack of the pancreas (or pancreatic cancer), followed by type 1 diabetes. When this occurs in the connective tissue, the consequence is systemic sclerosis.

In the remnant kidney model of end stage renal disease, part of the kidney is removed, (either surgically or with a toxin) which increases the metabolic load on the remainder. Superoxide is generated to decrease NO and increase O2 diffusion to the kidney mitochondria. Chronic overload results in progressive kidney capillary rarefaction and progressive kidney failure. In acute kidney failure, putting people in dialysis can give the kidney a “rest”, and allows it to recover. In acute renal failure induced by rhabdomyolysis (muscle damage which releases myoglobin into the blood stream) kidney damage is characterized by ischemic damage. Myoglobin scavenges NO, just as hemoglobin does, and would cause vasoconstriction in the kidney leading to ischemia. Myoglobin would also induce local nitropenia and the cascade of events leading to further ATP depletion.

In some aspects, low NO levels lead to reduced mitochondrial biogenesis. Producing the same ATP at a reduced mitochondria density will result in an increase in O2 consumption, or an accelerated basal metabolic rate. An accelerated basal metabolic rate is observed in a number of conditions, including: Sickle cell anemia, Congestive heart failure, Diabetes, Liver Cirrhosis, Crohn's disease, Amyotrophic lateral sclerosis, Obesity, End stage renal disease, Alzheimer's, and chronic obstructive pulmonary disease.

While some increased O2 consumption might be productively used, in many of these conditions uncoupling protein is also up-regulated, indicating that at least part of the increased metabolic rate is due to inefficiency. Conditions where uncoupling protein is known to be up-regulated include obesity and diabetes.

With fewer mitochondria consuming O2 to a lower O2 concentration, the O2 gradient driving O2 diffusion is greater, so the O2 diffusion path length can increase resulting in capillary rarefaction, which is observed in dilative cardiomyopathy, hypertension, diabetes type 2, and renal hypertension.

Copper, either as Cu2+ or as ceruloplasmin (CP) (the main Cu containing serum protein which is present at 0.38 g/L in adult sera and which is 0.32% Cu and contains 94% of the serum copper) catalyzes the formation of S—NO-thiols from NO and thiol containing groups (RSH). The Cu content of plasma is variable and is increased under conditions of infection. Berger et al. reported that the Cu and Zn content of burn-wound exudates is considerable with patients with ⅓ of their skin burned, losing 20 to 40% of normal body Cu and 5 to 10% of Zn content in 7 days. (Cutaneous copper and zinc losses in burns. Burns. 1992 October; 18(5):373-80.) If the patients skin were colonized by AOB, wound exudates which contains urea and Fe, Cu, and Zn that AOB need, would be converted into NO and nitrite, greatly supplementing the local production of NO by iNOS, without consuming resources (such as O2 and L-arginine) in the metabolically challenged wound. A high production of NO and nitrite by AOB on the surface of a wound would be expected to inhibit infection, especially by anaerobic bacteria such as the Clostridia which cause tetanus, gas gangrene, and botulism.

The practice of the present invention may employ, unless otherwise indicated, conventional methods of immunology, molecular biology, and recombinant DNA techniques within the skill of the art. Such techniques are explained fully in the literature. See, e.g., Sambrook, et al. Molecular Cloning: A Laboratory Manual (Current Edition); and Current Protocols in Molecular Biology (F. M. Ausubel, et al. eds., current edition).

8. NUCLEIC ACIDS AND PROTEINS FROM N. EUTROPHA

This disclosure provides, among other things, proteins and nucleic acids (optionally, isolated proteins and nucleic acids) that are identical to or similar to those found in strain D23. While not wishing to be bound by theory, it is believed that the sequenced strain of D23 has non-naturally occurring protein and nucleic acid sequences due to an extended period of culture and selection in the laboratory.

These nucleic acids and proteins have numerous uses. For instance, the proteins may be used to generate antibodies or other binding molecules that detect strain D23 or related strains. The proteins may also be used to carry out reactions under high-NH4+ conditions, because D23 is adapted for growth and metabolism under these conditions. As another example, the nucleic acids may be used to produce proteins for generating antibodies or carrying out reactions as described above. The nucleic acids may also be used to detect strain D23 or related strains, e.g., using a microarray or another hybridization-based assay.

The genome of strain D23 is provided as SEQ ID NO: 1. The genome annotation (including the position and orientation of genes within SEQ ID NO: 1) is provided as Supplementary Table 1. Accordingly, this disclosure provides genes and proteins identical or similar to the genes listed in Supplementary Table 1.

Accordingly, this disclosure provides a nucleic acid (e.g., an isolated nucleic acid) comprising a sequence of a gene of Supplementary Table 1, as well as a protein encoded by said gene. In certain embodiments, the nucleic acid comprises a sequence that is similar (e.g., at least 70%, 80%, 85%, 90%, 95%, 97%, 98%, 99%, or 99.5% identical) to a gene of Supplementary Table 1, or a protein encoded by said gene. The disclosure also provides a composition comprising a nucleic acid that is at least 1, 2, 3, 4, 5, 10, 15, 20, 50, 100, 200, 500, 1,000, 1,500, 2,000, 2,500, or all of the sequences of Supplementary Table 1, or a sequence that is similar thereto (e.g., at least 70%, 80%, 85%, 90%, 95%, 97%, 98%, 99%, or 99.5% identical), or one or more proteins encoded by said nucleic acids. Also provided are fragments of said nucleic acids and proteins.

The present disclosure also provides, inter alia, one or more genes or proteins that are present in strain D23 and absent from strain C91, or a gene or protein similar to one of said genes or proteins. Examples of these genes are set out in FIGS. 6-8 and are described in more detail in Example 4 herein. Examples of these genes and proteins, as well as genes and proteins similar thereto, are described below.

Accordingly, with respect to FIG. 6, this application discloses nucleic acids that are identical or similar (e.g., at least 70%, 80%, 85%, 90%, 95%, 97%, 98%, 99%, or 99.5% identical) to 1, 2, 3, 4, 5, 10, 15, 20, 30, 40, 50, 60, 70, 80, 90, 100, 110, 120, 130, 140, 150, 160, or all of the sequences in FIG. 6. This application also discloses proteins that are identical or similar (e.g., at least 70%, 80%, 85%, 90%, 95%, 97%, 98%, 99%, or 99.5% identical) to 1, 2, 3, 4, 5, 10, 15, 20, 30, 40, 50, 60, 70, 80, 90, 100, 110, 120, 130, 140, 150, 160, or all of the proteins encoded by the genes listed in FIG. 6. Furthermore, the application discloses fragments of these genes and proteins, e.g., fragments of 0-20, 20-50, 50-100, 100-200, 200-500, 500-1000, or greater than 1000 nucleotides or amino acids. In some embodiments, a plurality of the above-mentioned genes or proteins are affixed to a solid support, e.g., to form a microarray.

With respect to FIG. 7, this application discloses nucleic acids that are identical or similar (e.g., at least 70%, 80%, 85%, 90%, 95%, 97%, 98%, 99%, or 99.5% identical) to 1, 2, 3, 4, 5, 10, 15, 20, 30, 40, 50, 60, 70, 80, 90, 100, 110, 120, 130, 140, 150, 160, or all of the sequences in FIG. 7. This application also discloses proteins that are identical or similar (e.g., at least 70%, 80%, 85%, 90%, 95%, 97%, 98%, 99%, or 99.5% identical) to 1, 2, 3, 4, 5, 10, 15, 20, 30, 40, 50, 60, 70, 80, 90, 100, 110, 120, 130, 140, 150, 160, or all of the proteins encoded by the genes listed in FIG. 7. Furthermore, the application discloses fragments of these genes and proteins, e.g., fragments of 0-20, 20-50, 50-100, 100-200, 200-500, 500-1000, or greater than 1000 nucleotides or amino acids. In some embodiments, a plurality of the above-mentioned genes or proteins are affixed to a solid support, e.g., to form a microarray.

With respect to FIG. 8, this application discloses nucleic acids that are identical or similar (e.g., at least 70%, 80%, 85%, 90%, 95%, 97%, 98%, 99%, or 99.5% identical) to 1, 2, 3, 4, 5, 10, 15, 20, 30, 40, 50, 60, 70, 80, 90, 100, 110, 120, 130, 140, 150, 200, or all of the sequences in FIG. 8. This application also discloses proteins that are identical or similar (e.g., at least 70%, 80%, 85%, 90%, 95%, 97%, 98%, 99%, or 99.5% identical) to 1, 2, 3, 4, 5, 10, 15, 20, 30, 40, 50, 60, 70, 80, 90, 100, 110, 120, 130, 140, 150, 200, or all of the proteins encoded by the genes listed in FIG. 8. Furthermore, the application discloses fragments of these genes and proteins, e.g., fragments of 0-20, 20-50, 50-100, 100-200, 200-500, 500-1000, or greater than 1000 nucleotides or amino acids. In some embodiments, a plurality of the above-mentioned genes or proteins are affixed to a solid support, e.g., to form a microarray.

With respect to FIGS. 6-8 collectively, this application discloses nucleic acids that are identical or similar (e.g., at least 70%, 80%, 85%, 90%, 95%, 97%, 98%, 99%, or 99.5% identical) to 1, 2, 3, 4, 5, 10, 20, 40, 60, 80, 100, 150, 200, 250, 300, 350, 400, 450, 500, or all of the sequences in FIGS. 6-8. This application discloses proteins that are identical or similar (e.g., at least 70%, 80%, 85%, 90%, 95%, 97%, 98%, 99%, or 99.5% identical) to 1, 2, 3, 4, 5, 10, 20, 40, 60, 80, 100, 150, 200, 250, 300, 350, 400, 450, 500, or all of the proteins encoded by genes listed in FIGS. 6-8. Furthermore, the application discloses fragments of these genes and proteins, e.g., fragments of 1-20, 20-50, 50-100, 100-200, 200-500, 500-1000, or greater than 1000 nucleotides or amino acids. In some embodiments, a plurality of the above-mentioned genes or proteins are affixed to a solid support, e.g., to form a microarray.

This disclosure also provides nucleic acid sequences that are fragments of SEQ ID NO: 1. The fragments may be, e.g., 1-20, 20-50, 50-100, 100-200, 200-500, 500-1000, 1,000-2,000, 2,000-5,000, or 10,000 or more nucleotides in length. The fragments may also be at least about 80%, 85%, 90%, 95%, 97%, 98%, 99%, or 99.5% identity to the corresponding portion of SEQ ID NO: 1 or its complement. The fragment may also be a fragment that hybridizes to SEQ ID NO: 1, or to the genome of the D23 strain deposited with the ATCC patent depository on Apr. 8, 2014, designated AOB D23-100 with the ATCC under accession number PTA-121157, or their complements, under low stringency, medium stringency, high stringency, or very high stringency, or other hybridization condition described herein.

The disclosure also provides nucleic acid sequences set out in Table 1 (which describes genes involved in ammonia metabolism). Accordingly, in some aspects, this application discloses genes that are identical or similar (e.g., at least 70%, 80%, 85%, 90%, 95%, 96%, 97%, 97.5%, 98%, 98.2%, 98.4%, 98.6%, 98.8%, 99%, 99.1%, 99.2%, 99.3%, 99.4%, 99.5%, 99.6%, 99.7%, 99.8%, 99.9%, or 100% identical) to 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, or all of the genes in Table 1. In embodiments, this application discloses proteins that are identical or similar (e.g., at least 70%, 80%, 85%, 90%, 95%, 96%, 97%, 97.5%, 98%, 98.2%, 98.4%, 98.6%, 98.8%, 99%, 99.1%, 99.2%, 99.3%, 99.4%, 99.5%, 99.6%, 99.7%, 99.8%, 99.9%, or 100% identical) to 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, or all of the proteins in Table 1.

Alignment of the nucleic acid sequences of Table 1 shows the percent identity between homologs in C91 and D23. The following paragraphs discuss this percent identity and describe various nucleic acids having homology to the D23 genes of Table 1.

More specifically, the amoA1 genes are about 98.8% identical (i.e., at 821/831 positions). Accordingly, in some embodiments, the amoA1 nucleic acid comprises D23 nucleotides at at least 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, or all of the positions that differ in this gene between strains C91 and D23. In embodiments, the amoA1 nucleic acid comprise D23 nucleotides at at most 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, or all of the positions that differ in this gene between strains C91 and D23. In embodiments, the amoA1 nucleic acid comprises a sequence at least about 98.8%, 98.9%, 99.0%, 99.2%, 99.4%, 99.6%, 99.8%, or 100% identical to the D23 amoA1 gene.

The amoA2 genes are about 98.8% identical (i.e., at 821/831 positions). Accordingly, in some embodiments, the amoA2 nucleic acid comprises D23 nucleotides at at least 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, or all of the positions that differ in this gene between strains C91 and D23. In embodiments, the amoA2 nucleic acid comprises D23 nucleotides at at most 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, or all of the positions that differ in this gene between strains C91 and D23. In embodiments, the amoA2 nucleic acid comprises a sequence at least about 98.8%, 98.9%, 99.0%, 99.2%, 99.4%, 99.6%, 99.8%, or 100% identical to the D23 amoA2 gene.

The amoB1 genes are about 99.1% identical (i.e., at 1255/1266 positions). Accordingly, in some embodiments, the amoB1 nucleic acid comprises D23 nucleotides at at least 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, or all of the positions that differ in this gene between strains C91 and D23. In embodiments, the amoB1 nucleic acid comprises D23 nucleotides at at most 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, or all of the positions that differ in this gene between strains C91 and D23. In embodiments, the amoB1 nucleic acid comprises a sequence at least about 99.1%, 99.2%, 99.4%, 99.6%, 99.8%, or 100% identical to the D23 amoB1 gene.

The amoB2 genes are about 99.1% identical (i.e., at 1254/1266 positions). Accordingly, in some embodiments, the amoB2 nucleic acid comprises D23 nucleotides at at least 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12 or all of the positions that differ in this gene between strains C91 and D23. In embodiments, the amoB2 nucleic acid comprises D23 nucleotides at at most 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12 or all of the positions that differ in this gene between strains C91 and D23. In embodiments, the amoB2 nucleic acid comprises a sequence at least about 99.1%, 99.2%, 99.4%, 99.6%, 99.8%, or 100% identical to the D23 amoB2 gene.

The amoC1 genes are about 99.8% identical (i.e., at 814/816 positions). Accordingly, in some embodiments, the amoC1 nucleic acid comprises D23 nucleotides at at least 1, 2, or all of the positions that differ in this gene between strains C91 and D23. In embodiments, the amoC1 nucleic acid comprises D23 nucleotides at at most 1, 2, or all of the positions that differ in this gene between strains C91 and D23. In embodiments, the amoC1 nucleic acid comprises a sequence at least about 99.8%, 99.9%, or 100% identical to the D23 amoC1 gene.

The amoC2 genes are about 99.8% identical (i.e., at 814/816 positions). Accordingly, in some embodiments, the amoC2 nucleic acid comprises D23 nucleotides at at least 1, 2, or all of the positions that differ in this gene between strains C91 and D23. In embodiments, the amoC2 nucleic acid comprises D23 nucleotides at at most 1, 2, or all of the positions that differ in this gene between strains C91 and D23. In embodiments, the amoC2 nucleic acid comprises a sequence at least about 99.8%, 99.9%, or 100% identical to the D23 amoC2 gene.

The amoC3 genes are about 98.9% identical (i.e., at 816/825 positions). Accordingly, in some embodiments, the amoC3 nucleic acid comprises D23 nucleotides at at least 1, 2, 3, 4, 5, 6, 7, 8, 9, or all of the positions that differ in this gene between strains C91 and D23. In embodiments, the amoC3 nucleic acid comprises D23 nucleotides at at most 1, 2, 3, 4, 5, 6, 7, 8, 9, or all of the positions that differ in this gene between strains C91 and D23. In embodiments, the amoC3 nucleic acid comprises a sequence at least about 98.9%, 99.0%, 99.2%, 99.4%, 99.6%, 99.8%, or 100% identical to the D23 amoC3 gene.

The hao1 genes are about 99.0% identical (i.e., at 1696/1713 positions). Accordingly, in some embodiments, the hao1 nucleic acid comprises D23 nucleotides at at least 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, or all of the positions that differ in this gene between strains C91 and D23. In embodiments, the hao1 nucleic acid comprises D23 nucleotides at at most 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, or all of the positions that differ in this gene between strains C91 and D23. In embodiments, the hao1 nucleic acid comprises a sequence at least about 99.0%, 99.2%, 99.4%, 99.6%, 99.8%, or 100% identical to the D23 hao1 gene.

The hao2 genes are about 99.4% identical (i.e., at 1702/1713 positions). Accordingly, in some embodiments, the hao2 nucleic acid comprises D23 nucleotides at at least 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, or all of the positions that differ in this gene between strains C91 and D23. In embodiments, the hao2 nucleic acid comprises D23 nucleotides at at most 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, or all of the positions that differ in this gene between strains C91 and D23. In embodiments, the hao2 nucleic acid comprises a sequence at least about 99.4%, 99.6%, 99.8%, or 100% identical to the D23 hao2 gene.

The hao3 genes are about 99.2% identical (i.e., at 1700/1713 positions). Accordingly, in some embodiments, the hao3 nucleic acid comprises D23 nucleotides at at least 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, or all of the positions that differ in this gene between strains C91 and D23. In embodiments, the hao3 nucleic acid comprises D23 nucleotides at at most 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, or all of the positions that differ in this gene between strains C91 and D23. In embodiments, the hao3 nucleic acid comprises a sequence at least about 99.2%, 99.4%, 99.6%, 99.8%, or 100% identical to the D23 hao3 gene.

The cycA1 genes are about 98.0% identical (i.e., at 694/708 positions). Accordingly, in some embodiments, the cycA1 nucleic acid comprises D23 nucleotides at at least 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, or all of the positions that differ in this gene between strains C91 and D23. In embodiments, the cycA1 nucleic acid comprises D23 nucleotides at at most 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, or all of the positions that differ in this gene between strains C91 and D23. In embodiments, the cycA1 nucleic acid comprises a sequence at least about 98.0%, 98.2%, 98.4%, 98.6%, 98.8%, 99.0%, 99.2%, 99.4%, 99.6%, 99.8%, or 100% identical to the D23 cycA1 gene.

The cycA2 genes are about 98.7% identical (i.e., at 699/708 positions). Accordingly, in some embodiments, the cycA2 nucleic acid comprises D23 nucleotides at at least 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, or all of the positions that differ in this gene between strains C91 and D23. In embodiments, the cycA2 nucleic acid comprises D23 nucleotides at at most 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, or all of the positions that differ in this gene between strains C91 and D23. In embodiments, the cycA2 nucleic acid comprises a sequence at least about 98.7%, 98.8%, 99.0%, 99.2%, 99.4%, 99.6%, 99.8%, or 100% identical to the D23 cycA2 gene.

The cycA3 genes are about 99.3% identical (i.e., at 703/708 positions). Accordingly, in some embodiments, the cycA3 nucleic acid comprises D23 nucleotides at at least 1, 2, 3, 4, 5, or all of the positions that differ in this gene between strains C91 and D23. In embodiments, the cycA3 nucleic acid comprises D23 nucleotides at at most 1, 2, 3, 4, 5, or all of the positions that differ in this gene between strains C91 and D23. In embodiments, the cycA3 nucleic acid comprises a sequence at least about 99.3%, 99.4%, 99.6%, 99.8%, or 100% identical to the D23 cycA3 gene.

The cycB1 genes are about 96.7% identical (i.e., at 696/720 positions). Accordingly, in some embodiments, the cycB1 nucleic acid comprises D23 nucleotides at at least 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, or all of the positions that differ in this gene between strains C91 and D23. In embodiments, the cycB1 nucleic acid comprises D23 nucleotides at at most 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, or all of the positions that differ in this gene between strains C91 and D23. In embodiments, the cycB1 nucleic acid comprises a sequence at least about 96.7%, 96.8%, 97.0%, 97.2%, 97.4%, 97.6%, 97.8%, 98.0%, 98.2%, 98.4%, 98.4%, 98.6%, 98.8%, 99.0%, 99.2%, 99.4%, 99.6%, 99.8%, or 100% identical to the D23 cycB1 gene.

The cycB2 genes are about 97.1% identical (i.e., at 702/723 positions). Accordingly, in some embodiments, the cycB2 nucleic acid comprises D23 nucleotides at at least 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, or all of the positions that differ in this gene between strains C91 and D23. In embodiments, the cycB2 nucleic acid comprises D23 nucleotides at at most 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, or all of the positions that differ in this gene between strains C91 and D23. In embodiments, the cycB2 nucleic acid comprises a sequence at least about 97.1%, 97.2%, 97.4%, 97.6%, 97.8%, 98.0%, 98.2%, 98.4%, 98.4%, 98.6%, 98.8%, 99.0%, 99.2%, 99.4%, 99.6%, 99.8%, or 100% identical to the D23 cycB2 gene.

Further provided herein are vectors comprising nucleotide sequences described herein. In some embodiments, the vectors comprise nucleotides encoding a protein described herein. The vectors include, but are not limited to, a virus, plasmid, cosmid, lambda phage or a yeast artificial chromosome (YAC). Such vectors may include a promoter, an open reading frame with or without introns, and a termination signal.

The present disclosure also provides host cells comprising a nucleic acid as described herein, or a nucleic acid encoding a protein as described herein.

In certain embodiments, the host cells are genetically engineered by using an expression cassette. The phrase “expression cassette,” refers to nucleotide sequences, which are capable of affecting expression of a gene in hosts compatible with such sequences. Such cassettes may include a promoter, an open reading frame with or without introns, and a termination signal. Additional factors necessary or helpful in effecting expression may also be used, such as, for example, an inducible promoter.

The disclosure also provides host cells comprising the vectors described herein.

The cell can be, but is not limited to, a eukaryotic cell, a bacterial cell, an insect cell, or a human cell. If the cell is a bacterial cell, it may be, e.g., E. coli or an ammonia-oxidizing bacterium such as Nitrosomonas (e.g., N. eutropha or N. europaea), Nitrosococcus, Nitrosospira, Nitrosocystis, Nitrosolobus, and Nitrosovibrio.

9. ADJUSTING THE SKIN MICROBIOME WITH AMMONIA OXIDIZING BACTERIA

The present disclosure provides for systems and methods for changing the skin microbiome, e.g., the human skin microbiome. The systems and methods may provide treatment of infections or conditions, e.g., related to the skin, e.g., skin infections and/or skin conditions.

Ammonia-oxidizing bacteria (AOB) of the genus Nitrosomonas are Gram-negative obligate autotrophic bacteria with a unique capacity to generate nitrite and nitric oxide exclusively from ammonia as an energy source. They are widely present both in soil and water environments and are essential components of environmental nitrification processes. Due to the roles of nitrite and nitric oxide on human skin as important components of several physiological functions, such as vasodilation, skin inflammation and wound healing, these bacteria may have beneficial properties for both healthy and immunopathological skin conditions. These bacteria may be safe for use in humans because they are slow-growing, cannot grow on organic carbon sources, may be sensitive to soaps and antibiotics, and have never been associated with any disease or infection in animals or humans.

Topical application of ammonia oxidizing bacteria to a subject, e.g., a human subject may lead to unexpected changes in the skin microbiome, and more specifically it may lead to increases in the proportion of normal commensal non-pathogenic species and reductions in the proportion of potentially pathogenic, pathogenic, or disease causing organisms.

EXAMPLES

Example 1

Initial Culturing of N. eutropha

A soil-derived culture enriched in various ammonia oxidizing bacteria was applied to the skin of an adult male subject as described in WO/2003/057380. The period of growth on the human body selected for a strain with the capacity to colonize human skin for an extended period of time. After several months, the strain was re-isolated from the skin of the individual and cultured in laboratory conditions for a sustained period as described in the subsequent examples. While not wishing to be bound by theory, it is believed that the sustained laboratory culture selected for new mutations improving the strain properties, e.g., improved tolerance for high-ammonia conditions.

Example 2

Growing and Monitoring D23 or Mixtures of Strains that Comprise D23 Culture Conditions

D23 can be grown in batches or by continuous cultivation in a bioreactor. Batch preparation uses the medium of Table 3.

TABLE 3
Growth Medium for Batch culturing:
Weight/Volume Final Concentration
(in~1.5 L) (in~1.5 L)
(NH4)2SO4 4.95 g 50 mM NH4+
(MW 132.14)
KH2PO4 (MW 136.1) 0.616 g 3.0 mM
1M MgSO4 1.137 ml 0.76 mM
1M CaCl2 0.3 ml 0.2 mM
30 mM FeCl3/50 mM 0.5 ml 10 μM/16.7 μM
EDTA
50 mM CuSO4 30 μl 1.0 μM
Add 1400 ml ddH2O to flask. Autoclave. Store at room temperature.
After autoclaving add:
Phosphate Buffer 100 ml 32 mM KH2PO4/
2.7 mM NaH2PO4•H2O
5% Na2CO3 12 ml 0.04%

The medium of Table 3 is inoculated with ˜15 ml of a 3 day old culture of D23 (i.e. 1% volume). The cultures are incubated in the dark at 30° C. by shaking at 200 rpm.

Often, a N. eutropha D23 mixed culture is grown on complete N. europaea media. The culture medium is described below, and additional details on culturing ammonia-oxidizing bacteria are available on the World Wide Web at nitrificationnetwork.org/Nerecipe.php, Ensign et al., 1993, and Stein & Arp, 1998.

Step 1.

Add 900 ml of deionized water to a 2-liter Erlenmeyer flask.

Add in sequence:

3.3 g (NH4+)2SO4 (50 mM);

0.41 g KH2PO4

0.75 ml 1 M MgSO4 stock solution

0.2 ml 1 M CaCl2 stock solution

0.33 ml 30 mM FeSO4/50 mM EDTA stock solution

0.01 ml 50 mM CuSO4 stock solution

Sterilize the solution by autoclaving.

Step 2.

Add 400 ml of deionized water to a beaker. Add:

27.22 g KH2PO4

2.4 g NaH2PO4

Adjust the pH to 8.0 with 10 N NaOH, and bring the final volume to 500 ml with deionized water.

Sterilize 100 ml fractions of the solution by autoclaving in 250-500 ml Erlenmeyer flasks.

Step 3

Prepare 500 ml of 5% (w/v) Na2CO3 (anhydrous)

Sterilize the solution by autoclaving.

Step 4

Add 1×100 ml aliquot of solution prepared in Step 2 to the flask prepared in Step 1.

Step 5

Add 8 ml of the solution prepared in Step 3 to the flask prepared in Step 1.

The D23 can also be cultured continuously in a bioreactor. Table 4 describes the appropriate media.

TABLE 4
Growth Medium for continuous culture:
Batch medium Feeding solution
Weight/Volume (1 L) Weight/Volume (1 L)
(Final concentration) (Final concentration)
(NH4)2SO4 (MW 132.14) 3.3 g 13.2 g
(50 mM NH4+) (200 mM NH4+)
KH2PO4 (MW 136.1) 1.23 g 0.41 g
(9.0 mM) (3.0 mM)
1M MgSO4 0.758 ml 0.758 ml
(0.76 mM) (0.76 mM)
1M CaCl2 0.2 ml 0.2 ml
(0.2 mM) (0.2 mM)
30 mM FeCl3/50 mM EDTA 0.333 ml 0.333 ml
(10 μM/16.7 μM) (10 μM/16.7 μM)
50 mM CuSO4 20 μl 20 μl
(1.0 μM) (1.0 μM)
ddH2O 1000 ml 1000 ml
Autoclave each solution and store at room temperature.

The batch media, in a bioreactor vessel, is inoculated with ˜10 ml of a 3 day old N. eutropha D23 culture (i.e. 1% volume). The pH is adjusted to 7.6 using 7.5% Na2CO3 The bioreactor is run in batch mode with below parameters: pH: 7.6 (lower limit: 7.45 & upper limit: 7.8), Temperature: 28° C. (lower limit: 25° C. & upper limit: 32° C.), DO (dissolved oxygen): 45% (lower limit: 10%, upper limit: 100%), Stirrer: 550 rpm.

The OD600 nm of the culture in the bioreactor reaches 0.15 to 0.18 in 3-4 days. At this point, the culture will consume most of the 50 mM NH4+ present in the AOB growth media, and a user should start feeding the bioreactor with feeding solution at 0.59 ml/min (˜10%). The outflow pump should also be turned on at 0.59 ml/min (˜10%). The OD600 nm of the bioreactor reaches 0.5-0.6 in 1-2 days of continuous culture. The culture in the bioreactor is tested for heterotrophic contaminants by plating 1 ml of the bioreactor outflow on an LB plate.

Monitoring Growth of N. eutropha D23

Growth of N. eutropha D23 cells is monitored by measuring the OD600 nm of the culture. Typical growth in a batch culture as measured by OD600 nm is between 0.06 to 0.08.

The AOB growth medium contains NH4+ that is stoichiometrically converted to NO2− by N. eutropha D23. Another way to monitor the growth of N. eutropha is to follow the release of nitrite (NO2−) in the growth medium. NO2− concentration is determined with Griess reagents, sulfanilamide and N-naphthylethylenediamine (also called NNEQ). Briefly, sulfanilamide and NNEQ are added to a sample and to known concentrations of sodium nitrite that make up a standard curve. Samples are incubated in the dark for 30 minutes. The absorbance is read at 540 nm.

Another way to follow nitrite production is by using a spectrophotometer by monitoring the optical density (OD) difference between 352 nm and 400 nm. The nitrite concentration is determined using a millimolar extinction coefficient of 0.0225 mM−1. This assay can be performed directly by sampling the medium with the cells.


NO2− concentration (mM)=(OD352−OD400)/0.0225

The growth of a mixed culture comprising D23 was monitored by measuring optical density at 600 nm (OD600 nm) and by measuring Nitrite (NO2), and the growth rate is shown in FIGS. 1 and 2. FIG. 1 shows that the optical density at a 600 nm wavelength plateaus slightly below 0.1, after 3 to 4 days. FIG. 2A shows that the amount of nitrite produced plateaus slightly below 25 mM after 3 to 4 days. NO2 concentrations in the cultures were determined colorimetrically by the Griess reagent (Hageman & Hucklesby, 1971), and is used as a second indicator for the growth rates and growth phases since the accumulation of NO2 is consistently proportional to the increase in cell mass during growth.

In FIG. 2B-I, increasing densities of D23 harvested from continuous culture were suspended in medium supplemented with 50 mM NH4+ and grown shaking at 30° C. for 48 hours. Nitrite production was measured in supernatant samples using the Griess assay at the time points indicated. Results shown are mean values±SD from three independent experiments.

In FIG. 2B-II. Nitrite production by N. eutropha D23 in vitro is shown. Increasing densities of D23 were suspended in mineral salt medium supplemented with 50 mM NH4+ and grown shaking at 30° C. for 24 hr. Nitrite production was measured in supernatant samples using the Griess assay at the time points indicated.

Storage Conditions

N. eutropha suspensions obtained from the continuous culture system showed remarkable stability upon storage at 4° C. for several months, as indicated by the highly consistent nitrite concentrations generated upon subculture under batch growth conditions. Protocols for storing and recovering N. eutropha are set out below.

Obtain 500 ml of a N. eutropha D23 culture grown to late-exponential phase (OD600=0.5-0.6 in continuous culture). Centrifuge at 10,000×g for 15 min at 20° C. Remove supernatant and resuspend the pellet in 50 ml of AOB storage buffer. Spin as above. Remove supernatant and resuspend thoroughly in a total of 50 ml storage buffer. This would be the 10× AOB stock. Store upright at 4° C. in 50 ml polypropylene tubes.

AOB Storage Buffer (for AOB storage at 4° C.): 50 mM Na2HPO4-2 mM MgCl2 (pH 7.6) can be made as follows.

In 1 Liter ddH2O: Na2HPO4-7.098 g

MgCl2-0.1904 g

Adjust pH to 7.6. Filter-sterilize.

N. eutropha may be cryopreserved as follows. Transfer 1.25 ml of N. eutropha D23 mid-log culture to a 2 ml cryotube and 0.75 ml of sterile 80% glycerol. Shake tubes gently, incubate at room temperature for 15 min to enable uptake of the cryoprotective agents by the cells. Then, put tubes directly in a −80oC freezer for freezing and storage. For resuscitation of cultures, thaw frozen stocks on ice for 10-20 minutes. Centrifuge, at 8,000×g for 3 minutes at 4° C. Discard supernatant and wash the pellet by suspending it in 2 ml AOB medium followed by another centrifugation at 8,000×g for 3 minutes at 4° C. to reduce potential toxicity of the cryoprotective agents in subsequent growth experiments. Discard the supernatant and resuspend the pellet in 2 ml of AOB medium, inoculate into 50 ml of AOB medium containing 50 mM NH4+, and incubate in dark at 30° C. by shaking at 200 rpm.

In FIG. 2C, stability upon storage at 4° C. was studied. N. eutropha D23 previously harvested from continuous culture and stored at 4° C. was inoculated at 109 CFU/ml in mineral salt medium supplemented with 50 mM NH4+ and grown shaking at 30° C. Nitrite production was determined at 24 and 48 hours post-incubation (left and right panel, respectively). Data shown are representative of a D23 suspension sampled repeatedly over a 6-month period.

Example 3

Creation of an Axenic D23 Culture

To isolate N. eutropha D23 in pure culture, four types of media (described below) were made, autoclaved and poured in plates. Sterile nylon membranes were placed on the plates.

N. europaea media+1.2% R2A agar
N. europaea media+1.2% agar
N. europaea media+1.2% agarose
N. europaea media+1.2% agarose+0.3 g/L pyruvate

3 day old N. eutropha D23 culture was streaked onto the nylon membranes and the plates were incubated at 30° C. The plates were monitored daily for growth of red colored N. eutropha cells. Nylon membranes were transferred to fresh plates once a week.

Reddish colored colonies appeared on plates with R2A agar or agar by end of 1 week. Single colonies were picked from plates with R2A agar and grown in N. europaea media. The cultures grew well in 6 days to 0.08 OD600 nm. Heterotrophic colonies appeared when the culture was plated on LB-Agar plates.

Reddish colored colonies on plates with R2A agar, agar, agarose, or agarose+pyruvate appeared by end of 2 weeks. Single colonies were picked from plates with agar or agarose and grown in N. europaea media. The cultures grew well in 6-8 days to 0.08 OD600 nm. Heterotrophic colonies appeared when the culture was plated on LB-Agar plates.

Bright reddish colonies on plates with R2A agar, agar, agarose, or agarose+pyruvate appeared by end of 4 weeks. Single colonies were picked from plates with agarose and grown in N. europaea media. The cultures grew well in 6-8 days to 0.08 OD600 nm. White colonies appeared when the culture was plated on LB-Agar plates.

Contaminating bacteria (e.g., non-N. eutropha bacteria present in the mixed culture) were identified by culturing, amplifying 16S rRNA by PCR, and sequencing of the PCR products. Contaminants were identified as Microbacterium sp. and Alcaligenaceae bacterium.

To create an axenic culture of D23 (i.e., free of contaminating bacteria) serial dilution was used. Eight single colonies (designated A-H) were picked, and each was placed into a 10 ml culture of N. europae medium. For each culture, five sequential 1:10 dilutions were created. For each culture A-H, growth was observed in the two or three most concentrated of the dilutions.

A second serial dilution was carried out. 50 ml of media was inoculated with approximately 2×108 N. eutropha cells, and sequential dilutions of 1:50 were made, such that after the fifth dilution, a flask was expected to have approximately one cell. Flasks that exhibited bacterial growth were plated on LB-agar to assay for contaminating bacteria, and no contaminating bacteria were observed. In addition, no contaminating gram positive cells were observed under the microscope.

Accordingly, the serial dilution process yielded an axenic or substantially axenic culture of N. eutropha.

Example 4

Sequencing of the D23 Genome

Strain D23 was obtained as described in Example 1, and was made axenic as described in Example 3.

A 10 ml aliquot the bacterial sample was inoculated into approximately 1 L of N. europaea growth medium described in Example 2. The culture grew well to optical density of 0.08 at 600 nm in a batch culture in 3 days.

Total DNA of the culture was prepared and sequenced using Illumina® technology and/or SMRT® DNA Sequencing System technology, Pacific Biosciences. The strain was identified as Nitrosomonas eutropha and was designated D23.

The genome sequence of D23 was compared to that of N. eutropha C91, which is believed to be the only other sequenced strain of N. eutropha.

The length of the D23 chromosome is 2,537,572 base pairs, which is shorter than the 2,661,057 base pair chromosome of N. eutropha strain C91 chromosome. Based on the 16S-23S operon, strain D23 has 99.46% identity to C91 and 95.38% identity to N. europaea. DNA sequencing of N. eutropha D23 indicated that this strain lacks plasmids. This contrasts with the sequence of strain C91, which has two plasmids.

Protein-encoding regions and RNA-encoding sequences were identified by sequence analysis. Supplementary Table 1 is a table of annotations that lists the positions of 2,777 genes in the D23 genome (SEQ ID NO: 1).

On the level of individual genes, several genes are present in D23 that are absent in C91. These genes are summarized in FIGS. 6-8. FIG. 6 is a table displaying unique D23 genes with an assigned ORF number and a function based on sequence analysis, or a hypothetical gene above 200 base pairs in length. There are 162 genes in this category. FIG. 7 is a table displaying unique D23 genes below 200 base pairs that have an assigned ORF number. There are 164 of these genes. FIG. 8 is a table displaying unique D23 genes with no assigned ORF number. There are 219 of these genes (of which 180 are below 200 bp in length).

Strain D23 also lacks a number of genes that are present (or lack close homologs) in strain C91. These genes are sometimes referred to as unique C91 genes. These genes include the about 300 genes listed in FIG. 9.

D23 contains several ammonia metabolism genes that differ from their homologs in C91. Certain of these genes are enumerated in Table 1 of the Detailed Description. Sequence alignments were performed between the D23 proteins and their homologs in strain C91. The sequence alignments are shown in FIGS. 10-16 and sequence differences between the two strains are shown in Table 2 of the Detailed Description.

The sequence comparisons revealed the percent sequence identities between the C91 and D23 homologs of each protein. More specifically, FIG. 10 is an alignment between AmoA1 and AmoA2 of strains C91 and D23. Each protein is identical at 273/276 residues, and so each is about 98.9% identical between strains. FIG. 11 is an alignment between AmoB1 and AmoB2 of strains C91 and D23. Both proteins are identical at 419/421 positions, and so are about 99.5% identical between strains. FIG. 12 is an alignment between AmoC1 and AmoC2 of strains C91 and D23. Both proteins are identical throughout. FIG. 13 is an alignment between AmoC3 of strains C91 and D23. This protein is identical at 272/274 positions, and so are about 99.3% identical between strains.

As to the Hao proteins, FIG. 14 (A and B) is an alignment between Hao1, Hao2, and Hao3 of strains C91 and D23. Hao1 is identical at 567/570 positions, and so each is about 99.5% identical between strains. Hao2 and Hao3 are each identical at 568/570 positions, and so are about 99.6% identical between strains.

Turning now to cytochrome c554 proteins, FIG. 15 is an alignment between CycA1, CycA2, and CycA3 of strains C91 and D23. CycA1 is identical at 233/235 positions, and so is about 99.1% identical between strains. CycA2 and CycA3 are each identical at 234/235 positions, and so each is about 99.6% identical between strains.

As to the cytochrome cM552 proteins, FIG. 16 is an alignment between CycB1 and CycB2 of strains C91 and D23. CycB1 is identical at 232/239 positions, and so is about 97.1% identical between strains. CycB2 is identical at 236/239 positions, and so is about 98.7% identical between strains. Here, the length of the protein is considered 239 amino acids because that is its length in strain D23.

Alignment of the nucleic acid sequences of Table 1 shows the percent identity between homologs in C91 and D23. The amoA1 genes are about 98.8% identical (i.e., at 821/831 positions), the amoA2 genes are about 98.8% identical (i.e., at 821/831 positions), the amoB1 genes are about 99.1% identical (i.e., at 1255/1266 positions), the amoB2 genes are about 99.1% identical (i.e., at 1254/1266 positions), the amoC1 genes are about 99.8% identical (i.e., at 814/816 positions), the amoC2 genes are about 99.8% identical (i.e., at 814/816 positions), and the amoC3 genes are about 98.9% identical (i.e., at 816/825 positions). The hao1 genes are about 99.0% identical (i.e., at 1696/1713 positions), the hao2 genes are about 99.4% identical (i.e., at 1702/1713 positions), and the hao3 genes are about 99.2% identical (i.e., at 1700/1713 positions). Of the cytochrome c554 genes, the cycA1 genes are about 98.0% identical (i.e., at 694/708 positions), the cycA2 genes are about 98.7% identical (i.e., at 699/708 positions), and the cycA3 genes are about 99.3% identical (i.e., at 703/708 positions). Of the cytochrome cM552 genes, the cycB1 genes are about 96.7% identical (i.e., at 696/720 positions) and the cycB2 genes are about 97.1% identical (i.e., at 702/723 positions).

Example 5

Competitive Growth Studies

A study was designed to determine whether N. eutropha strain D23 could inhibit the growth of undesirable bacteria such as Pseudomonas aeruginosa (P. aeruginosa or PA), Staphylococcus aureus (S. aureus or SA), Streptococcus pyogenes (S. pyogenes or SP), Acinetobacter baumannii (A. baumannii or AB), and Propionibacterium acnes, all of which are important pathogenic agents frequently isolated from either one or both of infected skin and wound sites. This protocol may also be used to test other N. eutropha strains for the ability to inhibit the growth of undesirable bacteria.

Briefly, a suitable protocol can comprise the following steps. At t=0, a culture is inoculated with N. eutropha, and then the N. eutropha is incubated for 24 hours. Culture characteristics (e.g., pH and nitrite levels) are assayed. At t=24 hours, the undesirable bacterium is added to the culture. Immediately upon addition, samples are obtained for determining CFU/ml of the undesirable bacteria and optionally CFU/ml of N. eutropha, pH, and nitrite levels. Incubation is allowed to proceed for an additional 24 hours. At subsequent timepoints, e.g., t=30 and t=48, one can take the same measurements as at t=24. To determine CFU/ml, one can plate neat/−1/−2/−3/−4/−5 (or higher) to obtain accurate counts.

A more detailed protocol is set out below.

Day 1

  • 1. Mix the 10×AOB stock suspension stored at 4° C. by inverting several times until a homogenous suspension is obtained.
  • 2. Aliquot 10 ml of the suspension in 8×1.5 ml polypropylene tubes.
  • 3. Centrifuge at 17,000×g for 3 min at room temperature.
  • 4. Remove supernatant and any residual buffer from each pellet and resuspend all pellets thoroughly into a total of 10 ml complete AOB medium in a 50 ml polypropylene tube.
  • 5. Pipet 5 ml of 10×AOB suspension in each of two 50 ml polypropylene tubes (Tube 1-2).
  • 6. Prepare five additional tubes (Tube 4-8) containing 10×AOB suspensions in complete AOB medium/0.5× Phosphate Buffer. Aliquot 26 ml of the 10×AOB stock suspension in 16×1.5 ml polypropylene tubes. Obtain pellets as above and resuspend in a total of 26 ml complete AOB medium/0.5× Phosphate Buffer in a 50 ml polypropylene tube.
  • 7. Pipet 5 ml of the 10×AOB suspension in each of five 50 ml polypropylene tubes (Tube 4-8).
  • 8. Also, prepare two tubes with 10× Heat-killed AOB suspensions in either complete AOB medium (Tube 3) or complete AOB medium/0.5× Phosphate Buffer (Tube 9). Aliquot 10 ml of the Heat-killed suspension stored at 4° C. in 8×1.5 ml polypropylene tubes. Centrifuge at 17,000×g for 3 min at room temperature and remove supernatant, as described above for live AOB. Resuspend four pellets in a total of 5 ml complete AOB medium in one 50 ml polypropylene tube (Tube 3) and the remaining four pellets in a total of 5 ml complete AOB medium/0.5× Phosphate Buffer in a second 50 ml polypropylene tube (Tube 9).
  • 9. Add 141 μl of 1 M ammonium sulfate to obtain 25 mM final concentration (Tube 1, 3, 4, 5, 9). Add an equal volume of dH2O to corresponding control tubes (Tube 2, 6, 7).
  • 10. To Tube 8, add 141 μl of fresh 1 M NaNO2.
  • 11. Swirl all tubes gently, but thoroughly, to mix.
  • 12. Immediately after mixing each suspension, remove 0.5 ml from each tube and centrifuge all samples at 17,000×g, 3 min, RT. Transfer supernatants into fresh tubes after completing step 13, and measure both pH and nitrite levels using Griess Reagent to obtain TO values.
  • 13. Incubate all 50 ml tubes at 30° C. with mixing on an orbital shaker at 150 rpm (upright position) for 24 hr.

TABLE 5
T0
10x T24
10x Killed 1M 1M SA/PA
AOB AOB (NH4)2SO4 H2O NaNO2 in saline
SAMPLE Tube (ml) (ml) (μl) (μl) (μl) (ml)
Complete AOB medium
10x AOB + NH4+ 1 5 141 0.5
10x AOB 2 5 141 0.5
10x Killed AOB + 3 5 141 0.5
NH4+
Complete AOB medium/0.5x Phosphate Buffer
10x AOB + NH4+ 4 5 141 0.5
10x AOB + NH4+ 5 5 141 0.5
10x AOB 6 5 141 0.5
10x AOB 7 5 141 0.5
10x AOB + NaNO2 8 5 141 0.5
10x Killed AOB + 9 5 141 0.5
NH4+

Day 2

  • 14. At 24 hr, prepare SA, PA, SP or AB inocula to add to the suspensions.
  • 15. From an overnight (20-24 hr) SA or PA culture grown on Tryptic Soy Agar (TSA), or a SP or AB culture prepared on Brain Heart Infusion (BHI) Agar, prepare bacterial suspension in Tryptic Soy Broth (TSB) or BHI broth (BHIB) at ˜2×108 CFU/ml.
  • 16. Pipet 50 μl of the SA/PA/SP/AB suspension in 9.95 ml saline to obtain ˜106 CFU/ml. Keep on ice, as needed.
  • 17. Vortex SA/PA/SP/AB suspension and add 0.5 ml to Tube 1-9.
  • 18. Swirl all tubes gently, but thoroughly, to mix.
  • 19. Immediately after mixing each suspension, transfer 100 μl from each tube into 0.9 ml TSB or BHIB (10−1 dilution) to neutralize samples for CFU determination. In addition, remove 0.5 ml from each tube and centrifuge at 17,000×g, 3 min, RT. Recover supernatants in fresh tubes after completing Step 20 and measure both pH and nitrite levels using Griess Reagent after Step 21 to obtain T24 values.
  • 20. Incubate all 50 ml tubes at 30° C. with mixing on an orbital shaker (150 rpm) for an additional 24 hr.
  • 21. Dilute T24 samples further in TSB or BHIB and plate −2/−3/−4 dilutions on TSA or BHI agar. Incubate plates at 37° C. for 24 hr to obtain SA, PA, SP, or AB viable counts.
  • 22. At 6 and 24 hr post-mixing of SA/PA/SP/AB with AOB, vortex tubes and pipet 100 μl samples into 0.9 ml TSB. Dilute further in TSB or BHIB and plate neat through −5 dilutions on TSA or BHI agar. At each time point, also remove 0.5 ml from each tube and measure both pH and nitrite levels in each supernatant sample, as described above.
  • 23. Incubate TSA or BHI agar plates at 37° C. for 24 hr to obtain T30 (6 hr) and T48 (24 hr) viable counts.
  • 24. Count CFU to determine % killing rates for each time point

Griess Reagent Assay for Nitrite Quantification

1. Use the 0.5 ml supernatant samples obtained for pH determination at 0, 2, 6, and 24 hr.
2. Serially dilute 56 μl of the supernatant in 0.5 ml dH2O to obtain 10-100- and 1000-fold dilutions, as needed. For TO samples, use 1/10 for Tube 1-6, 8, 9, and 1/1000 for Tube 7. For T24/T30/T48 samples, use 1/10, 1/100, 1/1000 for all tubes,
3. To prepare sodium nitrite standards, dilute 10 μl of a fresh 1 M stock in 990 μl complete AOB medium-10% saline to obtain a 10 mM solution.
4. Dilute 10 μl of the 10 mM stock in 990 μl dH2O to obtain a 100 μM working solution.
5. Prepare standards in dH2O as shown below. Run standards only with TO samples.

TABLE 6
100 μM Nitrite
sodium nitrite dH2O conc A540nm
(μl) (μl) (μM) (indicative values)
0 (blank) 500 0 0
62.5 437.5 12.5 0.307
125 375 25 0.607
250 250 50 1.164
500 0 100 2.35

6. To each 0.5 ml sample (or sodium nitrite standard), add 0.25 ml each of Reagent A (58 mM sulfanilamide in 1.5 N HCl) and Reagent B (0.77 mM n-(1-napthyl) ethylene diamine-2HCl in H2O (light-sensitive; store in dark).
7. Mix and let stand at room temperature for 30 min in the dark (or cover with foil). The color should change to a vivid pink/violet.
8. Read absorbance at 540 nm and determine nitrite concentrations from standard curve.

This protocol was used to test N. eutropha D23's ability to inhibit the growth of P. aeruginosa (PA), S. aureus (SA), S. pyogenes (SP), A. baumannii (AB), or P. acnes. The results of this experiment are shown in FIGS. 3A, 3B, and 3C.

The left panel of FIG. 3A plots CFU/ml of PA versus time, when PA is co-cultured with live N. eutropha and ammonium (squares), live N. eutropha without ammonium (circles), killed N. eutropha and ammonium (triangles), or live N. eutropha with NaNO2 (inverted triangles). The right panel of FIG. 3A plots CFU/ml of SA versus time, under the same conditions. The left panel of FIG. 3B plots CFU/ml of SP versus time, under the same conditions. The right panel of FIG. 3B plots CFU/ml AB versus time, under the same conditions. FIG. 3C plots CFU/ml of P. acnes versus time, when P. acnes is co-cultured with live N. eutropha and ammonium (squares), live N. eutropha without ammonium (circles), killed N. eutropha and ammonium (triangles), or live N. eutropha with NaNO2 (inverted triangles). In all cases, live N. eutropha with ammonium results in declining numbers of PA, SA, SP, AB, or P. acnes whereas the other culture conditions allow the undesirable bacteria to grow. Without being bound by theory, these experiments suggest that nitrite generation from ammonia concurrently with medium acidification by D23 led to strong antibacterial effects, e.g., an approximately 100-fold reduction in viable counts of methicillin-resistant Staphylococcus aureus, Pseudomonas aeruginosa, Streptococcus pyogenes, Acinetobacter baumannii, or P. acnes. By contrast, control co-cultures of pathogenic bacteria either with heat-killed D23 supplemented with ammonia, or with live D23 without ammonia, did not produce comparable antibacterial effects. The control comprising live N. eutropha culture without ammonium is consistent with the model that N. eutropha's ammonia oxidation activity contributes to its antibacterial effects. The control comprising killed N. eutropha and ammonium indicates that some biological activity of the N. eutropha (e.g., its ammonia oxidation activity) contributes to antibacterial activity. The control comprising live N. eutropha with NaNO2 indicates that comparable nitrite levels at neutral pH (versus low pH when the bacteria use ammonia) do not have a strong antimicrobial effect, and is consistent with the model that N. eutropha's oxidation of ammonia, rather than nitrite alone, contributes to the antibacterial activity.

The top panel of FIG. 4A plots the NO2 concentration over time in the co-cultures described in the paragraph above. NO2 concentration is an indication of the rate of NH3 metabolism in the cultures. As above, PA is co-cultured with N. eutropha and ammonium (squares), N. eutropha without ammonium (circles), or killed N. eutropha and ammonium (triangles). Live N. eutropha with ammonium produces dramatically higher NO2 levels than the two control cultures, indicating that the live N. eutropha converts ammonium into NO2 under the culture conditions.

The bottom panel of FIG. 4A plots pH over time in the same co-culturing conditions. pH indicates the metabolic activity of the N. eutropha because the conversion of ammonia to nitrite produces hydrogen ions. PA is co-cultured with N. eutropha and ammonium (squares), N. eutropha without ammonium (circles), killed N. eutropha and ammonium (triangles), or live N. eutropha with NaNO2 (inverted triangles). Live N. eutropha with ammonium acidifies the medium, in contrast to the three control cultures, indicating that the live N. eutropha metabolizes ammonium under the culture conditions.

The top panels of FIG. 4B plot the NO2 concentration over time in the co-cultures described above. NO2 concentration is an indication of the rate of NH3 metabolism in the cultures. As above, S. pyogenes (SP) and A. baumannii (AB) are co-cultured with N. eutropha and ammonium (squares), N. eutropha without ammonium (circles), or killed N. eutropha and ammonium (triangles). Live N. eutropha with ammonium produces dramatically higher NO2 levels than the two control cultures, indicating that the live N. eutropha converts ammonium into NO2 under the culture conditions.

The bottom panels of FIG. 4B plot pH over time in the same co-culturing conditions. pH indicates the metabolic activity of the N. eutropha because the conversion of ammonia to nitrite produces hydrogen ions. SP and AB are co-cultured with N. eutropha and ammonium (squares), N. eutropha without ammonium (circles), killed N. eutropha and ammonium (triangles), or live N. eutropha with NaNO2 (inverted triangles). Live N. eutropha with ammonium acidifies the medium, in contrast to the three control cultures, indicating that the live N. eutropha metabolizes ammonium under the culture conditions.

FIG. 4E shows an alternative visualization the data of FIGS. 4A and 4B.

The capacity of Nitrosomonas eutropha D23 to inhibit proliferation of pathogenic bacteria due to nitrite production concurrent with acidification (acidified nitrite) was assessed by testing the survival of 5 strains of pathogenic bacteria in co-culture studies with D23 in vitro. The five strains of pathogenic bacteria included Propionibacterium acnes, Streptococcus pyogenes, methicillin-resistant Staphylococcus aureus (MRSA), Pseudomonas aeruginosa, and multidrug-resistant Acinetobacter baumannii. Incubation of N. eutropha D23 (1010 cells/ml) in the presence of ammonium led to nitrite concentrations of 10 mM or higher and acidification to pH 6 or lower (FIG. 4B). The combination of increased nitrite concentration and lowering of pH led to bactericidal or bacteriostatic effects and a marked reduction (up to 965-fold) in viable counts of the pathogenic bacterial species tested. The results of these studies are summarized in FIG. 4D and Table 7, below. In contrast to the D23 co-cultures incubated in the presence of ammonium, control co-cultures of the five pathogenic agents with D23 without ammonium, or with heat-killed D23 (B244) supplemented with ammonium, did not lead to any inhibitory or antimicrobial effects.

TABLE 7
Effect of N. eutropha D23 (D23) on relative survival of pathogenic
bacteria in vitro
Relative Survival (Fold Change)
Heat-Killed
Pathogen Tested AOB + NH3 AOB − NH3 AOB + NH3
Priopionibacterium acnes −114 −19,067 −1.05
ATCC 6919
Staphylococcus aureus (MRSA) −117.6 8.2 2.03
ATCC BAA-1717
Pseudomonas aeruginosa −84.3 2.65 379
ATCC 15442
Streptococcus pyogenes −965 −2.88 −3.81
ATCC 19615
Acinetobacter baumannii (MDR) −5.43 92.4 89.8
ATCC BAA-1605

Example 6

Wound Healing

The effect of Nitrosomonas eutropha D23 (sometimes also called B244) on wound closure in diabetic mice was evaluated in two separate studies. In Study 1, db/db mice (8 mice/group) were pre-treated by body immersion daily for one week with 3 concentrations of D23 (107, 108 or 109 cells/ml) supplemented with ammonium chloride, or with vehicle control suspension only. Subsequently, full-thickness wounds generated on the back of each animal were treated topically once daily for 14 days with vehicle alone or equal volumes of 3 concentrations of D23 (107, 108 or 109 cells/ml) in PBS supplemented ammonium chloride. Of the three D23-treated groups, the group receiving the highest dose showed significant improvement in wound closure from day 5 to day 15, with the most pronounced improvement of 83% observed on day 9 post-wounding. The median time to 50% wound closure was significantly reduced (P<0.05) for the animals treated with 109 cells/ml of D23, as compared to the animal group receiving vehicle treatment alone.

Initial histopathology analyses of wound tissue samples collected on Day 15 upon study completion did not reveal any gross differences between vehicle- and D23-treated animals. Subsequently, a more in-depth examination of the tissue sections was performed according to the scoring system and parameters adapted and modified form Altavilla, et al (2001). This analysis suggested a trend of increased levels of angiogenesis and maturity of granulation tissue with decreased levels of dermal inflammation in animals treated with 109 cells/ml of D23 versus the vehicle control group, which was consistent with the observed improvement in wound healing rates of the D23-treated animals

N. eutropha strain D23 was tested for its ability to accelerate wound healing in a diabetic mouse model, using C57BLKS/J Iar−+Leprdb/+Leprdb male mice (non-GLP). A detailed protocol is set out below.

Day −6 to Day 1: Whole-Body Immersion Pre-Treatment of Mice with Test Organism

    • 1. Mix the 10×D23 stock suspension stored at 4° C. by inverting several times until a homogenous suspension is obtained.
    • 2. Pipet 2×29 ml of the 10× stock suspension into two 50 ml polypropylene centrifuge tubes.
    • 3. Centrifuge at 8,000×g for 15 min at 20° C.
    • 4. Remove supernatant and any residual buffer from the pellets and resuspend the two pellets gently but thoroughly into a total of 58 ml room-temperature Phosphate Buffered Saline, pH 7.4 (PBS). This is the 10×D23 (Test Organism) suspension to use for the following steps.
    • 5. Prepare 500 ml baths containing the Test Organism at 1×, 0.1× and 0.01× strength in pre-warmed PBS at 30° C. supplemented with 2 mM NH4Cl, or a Vehicle control bath, as shown below. Prepare and use one bath at a time from the 10×D23 suspension kept at room temperature before continuing with the next bath. This will prevent keeping the Test Substance at 30° C. for long time periods without ammonium. To prevent contamination of the Vehicle control group with the Test Substance, begin with the Vehicle control group before proceeding with the D23 baths.
    • 6. Immerse each group of mice in corresponding baths for 60 sec daily for seven days.
    • 7. Use a fresh 500 ml baths for each daily immersion into the Test Organism or Vehicle control.

TABLE 8
10× D23 1M
(room PBS NH4/
BATH/ temp.) pH 7.4 Cl CFU/
GROUP (ml) (ml) (ml) ml
Vehicle 500 1.0 0
(control)
  1× D23 50 450 1.0 109
 0.1× D23 5 495 1.0 108
0.01× D23 0.5 499 1.0 107

Day 1: Wounding of Mice by Skin Puncture

    • 1. Generate skin wounds on the back of each mouse by skin puncture after shaving of the back and shoulders.
    • 2. House each mouse separately for the remainder of the study.
      Day 1 to Day 15: Topical Treatment of Skin Wounds with Test Organism
    • 1. Mix the 10×D23 stock suspension stored at 4° C. by inverting several times until a homogenous suspension is obtained.
    • 2. Pipet 1 ml of the 10× stock suspension into a 1.5 ml polypropylene tube.
    • 3. Centrifuge at 17,000×g for 3 min at room temperature.
    • 4. Remove supernatant and any residual buffer from the pellet and resuspend pellet gently but thoroughly into a total of 10 ml pre-warmed Phosphate Buffered Saline, pH 7.4 (PBS) at 30° C. This is the 1×D23 (Test Organism) suspension to use for the following steps.
    • 5. Prepare 1×, 0.1× and 0.01× suspensions of the Test Organism in pre-warmed PBS supplemented with 2 mM NH4Cl, or a Vehicle control solution, in 50 ml polypropylene tubes as shown below.
    • 6. Draw 2.0 ml of each suspension using a repetitive pipet.
    • 7. Drip slowly 0.2 ml of the Test Organism (1×, 0.1×, 0.01× groups), or an equal volume of Vehicle control, onto each wound and surrounding shaved skin area. Gently spread applied suspension onto the wound and the entire shaved skin area using a pipet tip.
    • 8. Repeat application of Test Organism or Vehicle control daily for a total of 14 days.
    • 9. Measure wound size by wound planimetry and obtain photo images of each wound on Day 1, 3, 5, 7, 9, 11, 13 and 15 using Image Analyzer (Image-pro plus version 4.5, Media Cybernetics Inc).
    • 10. Calculate % wound closure and wound half-closure time (CT50) for each group.

TABLE 9
PBS 1M
1× D23 pH 7.4 NH4Cl CFU/ CFU/
GROUP (ml) (ml) (μl) ml wound
Vehicle 5.0 10 0 0
(control)
  1× D23 5.0 0 10 109 2 × 108
 0.1× D23 0.5 4.5 10 108 2 × 107
0.01× D23 0.05 4.95 10 107 2 × 106

Day 15 (Upon Study Completion): Collection of Wound Tissues Samples and Histopathology Analyses

    • 1. Obtain half-wound tissue samples from four mice per group using aseptic technique to avoid cross-contamination of tissues.
    • 2. Proceed with histopathology analyses.
    • 3. Store temporarily at −70° C. the remainder half-wound samples and the additional four full-size wound tissues from each group for further evaluation.

As shown in FIG. 5A, topical application of 109 CFU/ml of strain D23 significantly (*p<0.05) accelerated wound healing. The sample size was N=8 animals/gp. The group receiving the highest doses showed significant improvement in would closure from day 5 to day 15, with the most pronounced improvement of 83% observed on day 9, post-wounding. This study demonstrates the potential therapeutic benefit of ammonia oxidizing bacteria, e.g., D23, to diabetic foot ulcers, chronic wounds, and other related indications.

FIG. 5B is a plot showing CT50 versus control (vehicle) and 109 CFU/ml D23. CT50 is the time required to achieve a 50% wound closure. As shown in the plot, those wounds having application of D23 provided for lower CT50 values.

FIG. 5C is a plot of another experiment in which the protocol above was carried out to obtain wound closure measurements versus time. Control (vehicle) wounds were tested and compared to D23 at 109 CFU/ml wounds. This plot shows the effects of D23 when immersion pre-treatment and topical application was carried out.

FIG. 5D is a plot of another experiment in which the protocol above was carried out, without immersion pre-treatment, to obtain wound closure measurements versus time. Control (vehicle) wounds were tested and compared to applications of D23 at 109 CFU/ml and 1010 CFU/ml to wounds. This plot shows the effects of D23 when topical application was carried out.

FIG. 5E is a plot showing CT50 versus control (vehicle) and 109 CFU/ml D23, with and without immersion pre-treatment, and 109 CFU/ml D23 without pre-treatment. As shown in the plot, those wounds having application of D23 provided for lower CT50 values.

FIG. 5F are images of the wound healing experiments, at Day 1, Day 11, and Day 15. AOB represents D23.

Possible modulation of inflammatory responses coupled with ant-infective action of D23 could prove an effective topical treatment against diabetic and other chronic wounds.

FIG. 5G are plots of blood glucose levels in the mice tested for the control (vehicle) and various concentrations of D23. “IM” shown in the x-axis of the right-hand panel plot represents those tests down with an immersion pre-treatment of D23. FIG. 5H is a plot of body weight of the animals used in testing for the study including immersion pre-treatment, over the time of the study. FIG. 5I are plots of body weight of the animals used in testing for the study, including the immersion pre-treatment study, and the study done without immersion pre-treatment, over the time of the studies.

In Study 2, the effect of pretreatment of db/db mice with 109 cells/ml of B244 on wound closure was examined. Groups of seven mice were treated topically with 109 cells/ml of B244 with and without prior body immersion. One additional group of seven mice was treated topically with 1010 cells/ml of D23 (B244). Corresponding vehicle groups (seven mice) were run in parallel with and without body immersion as negative controls. Wound surface area and photo images of each wound were obtained as before. These studies reproduced the findings of Study 1 suggesting improvement of wound closure with a B244 dose of approximately 109 cells/ml. Moreover, topical treatment alone with 109 cells/ml improved wound closure rates similar to the animals receiving topical treatments with immersion. Additional histopathology analyses by of H & E—stained wound tissue sections recovered on Day 5 did not reveal any differences between vehicle and D23 (B244)-treated wounds.

Cytokine and growth factor expression in D23-treated diabetic animals was investigated using Luminex technology. Specifically, expression of growth-regulated oncogene/keratinocyte chemoattractant (Gro/KC), interleukin-1 (IL-1), interleukin-6 (IL-6), macrophage inflammatory protein-2 (MIP-2), tumor necrosis factor (TNF), and vascular endothelial growth factor (VEGF) was compared between D23-treated and control diabetic animals in serum samples obtained on Day 5 and Day 15 from four mice per group treated with or without prior body immersion. In similar Luminex analyses, lysates of tissues from D23-treated or Vehicle control animals obtained upon completion of the study (Day 15) were also analyzed. Abnormally high and sustained expression of inflammation markers, including MIP-2, TNFα and IL-1β, has been previously associated with a dysregulated inflammatory response and impaired wound healing processes in db/db mice (Wetzler, 2000). Analyses of Day 5 and Day 15 serum samples yielded very low signal for all six cytokines in both D23-treated and vehicle control animals, a result indicating the lack of systemic effects following wound treatment with high D23 doses. In wound tissue lysates obtained on Day 15, MIP-2 levels (1155-1516 pg/100 g total protein) were significantly higher than the remaining five cytokines, with IL-6 and Gro/KC measured at much lower levels (44-48 pg/100 g total protein) and both IL-1 and VEGF being close to undetectable (≦3.8 pg/100 g total protein). Overall, no difference was observed between D23-treated animals and vehicle control animals with or without full-body immersion in D23 suspensions. The levels of all six cytokines or growth factors measured in tissue lysates of all four groups of mice examined are summarized in Table 10 below.

TABLE 10
Cytokine levels measured in wound tissue lysates of D23-treated and vehicle
control-treated db/db mice
MIP-2
Gro/KC IL-1β IL-6 (pg/ TNFα VEGF
(pg/100 g (pg/100 g (pg/100 g 100 g (pg/100 g (pg/100 g
Treatment Animal protein) protein) protein) protein) protein) protein)
Vehicle 1-1 49 2.4 78 1089 28.7 5.8
(with prior 1-3 66 2.4 134 1335 31.2 4.5
immersion) 1-5 59 2.7 128 1112 25.7 4.2
1-7 76 1.2 148 1013 9.4 4.1
MEAN 62 2.2 122 1137 23.7 4.7
D23 3-1 49 2.1 66 1830 24.7 4.1
109 cells/ml 3-3 75 1.8 162 1615 32.3 3.6
(with prior 3-5 50 2.4 132 1896 23.9 4.3
immersion) 3-7 17 1.5 28 720 9.0 3.4
MEAN 48 1.9 97 1516 22.5 3.8
Vehicle 5-1 43 1.5 90 833 13.2 3.6
(topical 5-3 55 2.2 104 1312 18.6 3.6
only) 5-5 44 1.4 59 644 17.6 3.2
5-7 100 3.8 168 1308 48.6 4.0
MEAN 60 2.2 105 1024 24.5 3.6
D23 6-1 82 2.2 105 1573 28.5 2.9
109 cells/ml 6-3 18 0.8 36 943 8.0 2.5
(topical 6-5 25 1.2 45 1027 9.5 2.2
only) 6-7 49 1.5 92 1077 18.5 2.9
MEAN 44 1.4 69 1155 16.1 2.6

Pharmacokinetic evaluation of D23 (B244) in rodents was conducted during a 28-day repeat dose toxicology study as described in the section below. No separate single dose pharmacokinetic studies were run for D23 (B244).

Example 7

Toxicology

28-Day Safety Study of Nitrosomonas eutropha D23 (B244) Application on Full-Thickness Wounds of Streptozotocin-Induced Diabetic Sprague-Dawley Rats

The objectives of this study were to determine the potential toxicity of Nitrosomonas eutropha D23 (B244) in rats when given dermally on wounded skin for a minimum of 28 days, and to evaluate the potential reversibility of any findings. In addition, the toxicokinetic characteristics of D23 (B244) were determined.

Study Design and Methods

The design was based on the study objectives, the overall product development strategy for the test article, and the following study design guidelines: OECD Guidelines 407 and 417, Committee for Human Medicinal Products (CHMP), and ICH Harmonised Tripartite Guidelines M3 (R2), S3a, and S6 (R1). The study design is outlined herein and results are shown in Table 11.

TABLE 11
28-Day Safety Study design
Dose
Volume Dose No. of Animals
Group Test Dose Level (mL/kg) Conc. Main Study Recovery
No. Material (CFU/kg/day) Split (CFU/mL) M F M F
1 Control 0 0.8 0 10 10 5 5
Article
2 AOB-D23- 6 × 107 0.8 8 × 107 10 10 0 0
100
3 AOB-D23- 6 × 108 0.8 8 × 108 10 10 0 0
100
4 AOB-D23- 6 × 109 0.8 8 × 109 10 10 5 5
100
M = Male,
F = Female,
Conc. = Concentration,
CFU = Colony Forming Unit.
Control Article = 99.998% Phosphate Buffered Saline, pH 7.4 (PBS), 0.002% 1M NH4Cl

For induction of diabetes, Streptozotocin was administered to Sprague Dawley rats via intraperitoneal injection on Day −4. Animals with blood glucose levels of >200 mg/dL were considered as responders to the Streptozotocin treatment and were used for the dosing phase of the study. Two full-thickness skin wounds were created per animal (1 on each side of the back of each anesthetized animal) using an 8-mm skin biopsy punch. The wounds were left uncovered during administration of the control and test article and also for the duration of the study. The test and control articles were administered to the appropriate animals dermally once daily (for 24 hours±1 hour) from Days 1 to 28. The end points evaluated in this study were the following: clinical signs, dermal findings, body weights, body weight changes, food consumption, ophthalmology, glucose analysis, clinical pathology parameters (hematology, coagulation, clinical chemistry, urinalysis, hemoglobin A1c, and methemoglobulin), C-reactive protein and serum ferritin analysis, toxicokinetic parameters, gross necropsy findings, organ weights, and wound histopathology.

Results

The results for the endpoints evaluated in the 28-day GLP toxicology study are outlined below in Table 12.

TABLE 12
28-Day Safety Study-Results
End points Observations Comments
Mortality No unscheduled deaths during the course of
the study were attributed to D23 (B244).
One control male was found dead on Day
41; the cause of death due to necrosis in the
kidney, liver, pancreas, and spleen
Clinical No test article D23 (B244)-related clinical Similar clinical signs
Observations signs were observed during the study. have been previously
Clinical signs including abdominal associated with an
distension, prominent backbone, fur uncontrolled diabetic
staining, soft stools and ungroomed state in rats and other
appearance were related to the diabetic state animal models
of the animals
Skin discoloration (red/black) was present
in both control and treated animals
Dermal Scores No dermal irritation occurred during the
study
No erythema or edema was observed
following dermal administration of the test
article
Body Weights and No D23 (B244)-related effects on body
Body Weight weight or body weight change were noted
Changes during the study.
Mean weight gain was observed throughout
the study interval, with isolated instances of
slight loss in individual animals across the
dose groups which did not follow specific
dose-related trends
Food Consumption There were no test article-related effects on
food consumption.
Ophthalmic There were no D23 (B244)-related The appearance of
Examinations ophthalmologic changes during the study. The cataracts is a known
majority of the animals on study developed complication of
cataracts and there were no differences among diabetes
dose groups.
Hematology, No test article-related changes were noted in
Coagulation, hematology, coagulation, hemoglobin A1c,
Hemoglobin A1c, and methemoglobin parameters on
and Methemoglobin Day 29 or 43.
Isolated statistically significant differences
were noted during the study; however, the
values were within the historical control
ranges and were not considered meaningful
Clinical Chemistry No test article-related changes were noted on
Days 29 or 43.
Isolated statistically significant differences
were noted during the study; however, the
values were within the historical control
ranges and not considered meaningful
Urinalysis No test article-related effects
C-reactive Protein No test article-related effects
and Serum Ferritin
Analysis
Gross Pathology No test article-related gross findings were Any gross findings
noted on Day 29 or Day 43 observed were
considered to be related
to the diabetic
condition of the rats
and incidental in nature
Organ Weights There was an increase in adrenal weight in
females at ≧6 × 108 CFU/kg/day on Day 29,
whereas adrenal weight was decreased in
males and there were no associated gross
pathology findings making the association
of this finding to D23 (B244) administration
equivocal
Potential D23 (B244)-related organ weight
changes noted at the terminal euthanasia
(Day 29) were not observed at the end of the
recovery period (Day 43)
Histopathology No D23 (B244)-related microscopic findings
Terminal on Day 29.
Euthanasia (Day 29) Changes observed in the kidneys, large and
small intestine, and urinary bladder were
related to the diabetic state of the animals.
The incidence and severity of these
findings were similar in all study groups
including controls.
Changes at the administration/wound sites
included epidermal regeneration, fibrosis,
and granulomatous inflammation. The
incidence and severity of these findings
were similar in all groups including
controls
Histopathology Changes observed on Day 43 were similar
Recovery to those reported on Day 29
Euthanasia (Day 43)

Conclusions

    • Once daily application of D23 (B244) on rat wounds was well tolerated at levels of 6×107, 6×108, and 6×109 CFU/kg/day.
    • No D23 (B244)-related mortality observed during the study
    • Healing of full tissue thickness excisions was similar in all groups
    • No D23 (B244)-related clinical signs or dermal irritation were observed
    • No effects observed during the study on body weight, food consumption, clinical pathology parameters, c-reactive protein, or serum ferritin
    • No test article-related gross necropsy findings or histopathologic findings
    • The no-observed-adverse-effect level (NOAEL) was determined to be 6×109 CFU/kg/day (8×109 cells/ml)
    • No specific target organs were identified

No D23 related mortality occurred during the study. There were no D23-related clinical signs or dermal irritation, and there were no effects on body weight, body weight changes, food consumption, clinical pathology parameters, C-reactive protein, or serum ferritin during the study. There were no test article-related gross necropsy findings or histopathologic findings. Increases in adrenal weights were noted in the >6×108 CFU/kg/day females on Day 29; however, association with D23 was considered equivocal based on the lack of a similar effect in the males, the lack of corresponding gross findings, and the lack of microscopic evaluation of this tissue.

All wound sites were completely covered by epidermis and appeared to be in the remodeling/resolution phase, which was characterized by stratification of the epidermis with keratinization and refinement of the dermal collagen (synthesis, bundling, and degradation) and capillaries to restore the normal architecture of the epidermis and dermis. The incidence and severity were similar in all groups, including controls.

Example 8

Antibiotic Susceptibility

The activities of five antibiotics, each representing a different antibiotic class, were tested against Nitrosomonas eutropha D23. The antibiotics tested included clindamycin, erythromycin, gentamicin, piperacillin with or without the β-lactamase inhibitor Tazobactam, and tetracycline. These were chosen based on the Clinical and Laboratory Standards Institute (CLSI) recommendations for routine testing and reporting of phylogenetically-related proteobacteria (Pseudomonas aeruginosa) listed under Non-fastidious organisms and Non-Enterobacteriaceae in the CLSI 24th Informational Supplement (M100-524), and also included topical or systemic antimicrobial agents commonly used against acne, such as clindamycin or tetracycline. Studies with clindamycin were included even though this antibiotic was not expected to be very effective at inhibiting Nitrosomonas, as is the case for other aerobic Gram-negative bacteria.

Minimal Inhibitory Concentrations (MICs) were determined by culturing N. eutropha D23 in decreasing concentrations of each of the five antibiotics. Bacterial growth at 30° C. was monitored for 48-72 hr by determining optical density (OD600) values in samples collected at 24 hr intervals. MIC values were identified as the lowest antibiotic concentration from a two-fold dilution series leading to no increase in OD600 measurements for the 2 or 3-day incubation period. The N. eutropha D23 phenotype in each antibiotic test was determined as Susceptible, Intermediate, or Resistant according to the MIC Interpretive Criteria provided by the CLSI. As summarized in Table 13, these studies demonstrated susceptibility of N. eutropha D23 to erythromycin and gentamicin and intermediate resistance to tetracycline and piperacillin suggesting the lack of strong antibiotic-resistance potential by the Drug Substance. Clindamycin resistance observed for N. eutropha D23 is in agreement with previous reports for natural resistance of aerobic Gram-negative bacteria to this antibiotic. In addition to testing the β-lactam antibiotic piperacillin alone, the broad range β-lactamase inhibitor Tazobactam was also tested in combination with piperacillin to assess the possible expression of β-lactamase(s) by N. eutropha D23. The results from this comparison showed no increase in N. eutropha D23 susceptibility, indicating the absence of β-lactamase expression by N. eutropha D23, at least under the conditions tested.

TABLE 13
MIC values for five antibiotics tested against N. eutropha
D23 cultures in vitro
MIC MIC Interpretive
Antibiotic Antibiotic Class (μg/ml) Criteria*
Clindamycin Lincosamide >16 Resistant (≧4 μg/ml)
Erythromycin Macrolide 0.16 Susceptible (≦0.5 μg/ml)
Gentamicin Aminoglycoside 0.25 Susceptible (≦4 μg/ml)
Piperacillin β-lactam 64 Intermediate
(32-64 μg/ml)
Piperacillin/ β-lactam/ 64/4 Intermediate
Tazobactam β-lactamase (32/4-64/4 μg/ml)
inhibitor
Tetracycline Tetracycline 8 Intermediate (8 μg/ml)
*as recommended by the Clinical and Laboratory Standards Institute (values in parentheses represent MIC levels for corresponding Susceptible, Intermediate or Resistant outcomes)

Conclusions

These studies demonstrate susceptibility of D23 (B244) to macrolide and aminoglycoside antibiotics and resistance to lincosamides, results that indicate the lack of strong antibiotic-resistance potential by the Drug Substance.

Example 9

Elucidation of Structure of N. eutropha

N. eutropha was defined at the species and the strain level using PCR and gene sequencing methodologies. The species level was defined as N. eutropha by sequencing of the V1-V5 variable regions of the 16S rRNA gene. N. eutropha was defined as a novel N. eutropha strain D23 by identification of a unique gene from whole genome sequence analysis. N. eutropha was defined at the species level as N. eutropha by 16S rRNA gene sequencing using the MicroSeq 500 rDNA Bacterial Identification PCL and sequencing kit.

Strain identity may be determined using custom primers, which correspond to the underlined portions of the following sequence and the D23 1c1355 sequence & primers Table 14 below. While not wishing to be bound by theory, it is believed that gene D23 1c1355 is unique to N. eutropha D23, and thus performing a PCR amplification reaction within gene D23 1c1355 will indicate whether N. eutropha D23 is present in a given sample.

TABLE 14
D23_1c1355 sequence & primers
Product
Tm Posi- size
Primer Sequence (5′-3′) (° C.) tion (bp)
D23_ AATCTGTCTCCACAGGCAGC 54 287-305 595
1c1355-F (SEQ ID NO: 64)
D23_ TATACCCACCACCCACGCTA 54 881-862
1c1355-R (SEQ ID NO: 65)

D23_1c1355 outer membrane autotransporter
barrel domain-containing protein
(SEQ ID NO: 66)
TTGGTTGGTTTGAAACAGGTAAGGGAGAAGGAGGAAAATCGCCAGAATAT
        10        20        30        40        50
CGTCGCCAAAGGTTATCGGATCACCATAGCTTATCCACTCAAAGGGGAGA
        60        70        80        90       100
TTATCATGAGCAAGGTTCGTCGATTAAAAAAGAGTTTATATACGGTTACT
       110       120       130       140       150
GCACTAACTCTCGGTTTCGGACCATTTGTGACAGCGAGTGGACAATCATT
       160       170       180       190       200
CGAAGAAACACCCGTACAAACACCCGGACGAGCTTTTGCAGTGGACAATT
       210       220       230       240       250
TAAAGGGTATCTGTGTACAAAACACAAGTGAAGACCCCTCATTAGCAATA
       260       270       280       290       300
GCTTGCACCTTCGCACTGGGCGGGATAAATGATATTACCGCGCAGAATCT
       310       320       330       340       350
GTCTCCACAGGCAGCGATTCAGGCCGAGTCGATCGCGATTACTTCTCCCT
       360       370       380       390       400
ATCAGTTTATTCGCAGCACGAATGAAAGCATACAGCGGCTAACAGGTCGC
       410       420       430       440       450
TCTGCTGAGAAACGTCAGCAACAATCCTCTTTTTTACTACAAAGCTCAGC
       460       470       480       490       500
GTCGGTAGCAGGCACGCCATCATTTGGCACTTCTGGTTTTATAGGGCCTG
       510       520       530       540       550
TAGGGGTTTCGCTGAGCGGTGGCGGGAGCTTTGGTGAACGCAATACCGCT
       560       570       580       590       600
GAAGGGCAGACCGGTTTTCAATTGAATACCCGGCAAACCAGCCTGATGAT
       610       620       630       640       650
CGATTATTCATTTAATCAAAAATTGATTGGCGGCTTTTCCTTTAATTATC
       660       670       680       690       700
TGGGGACAGATCGTAATTTGAGATTGGCGAGTGGGGACTTGAATTCCGAT
       710       720       730       740       750
AGCTATCGGTTTGCACCCTTTGTGCTTTTCAGACCAACTACCAATAGCTA
       760       770       780       790       800
CTTAACTCTGATGGGAGGGTATGCTTTGGTTAATTATCGTTCCACGCGCA
       810       820       830       840       850
GCGTTTCGAGTCAAAATGACATCACGTTTGATAACGCCACAGCCAACTAT
       860       870       880       890       900
GATGCTAATCAGTTTTTTGCTAGCGTGGGTGGTGGGTATACCTTTACTTT
       910       920       930       940       950
AATGGATGGATGGAATCTGCGAGGATATGGTCGCGGGGACTTTAGTGATA
       960       970       980       990      1000
TTAGTATCCAGAGCTTTCAGGAAAAAGGTGGCGTTGCTCATAGTGGGAAC
      1010      1020      1030      1040      1050
GATAGTTTATCTCTTGCTATGTCTGTGAATAAACAAACCATACGCTCGGT
      1060      1070      1080      1090      1100
TACCAGTACATTAGGCGTTGAACTTAGTCATGCAATTAGCACCAGAACTT
      1110      1120      1130      1140      1150
TTATTCCCGTCATTATCCCGAGACTGCGTGCAGAATGGGTGCATGAATTT
      1160      1170      1180      1190      1200
GAAAACAATGCCAGAACTATCACGGCCGGTTTCACTGGCCAGAACTATAG
      1210      1220      1230      1240      1250
TCCCACTTCTGCATCAATGGCAGTTGCAAGCTCAGTGCGTAATTGGGCAA
      1260      1270      1280      1290      1300
ACCTGGGGGTTGGAGTGCAAATGCTGTTTGCCCGCTCGATTATCGGGTAC
      1310      1320      1330      1340      1350
ATTAATTACGACAGATTAATTATCAAGCACGCGGAGAACAATATCATTTC
      1360      1370      1380
TGGTGGGATTCGTATGAATTTCTAA

Example 10

Administering Ammonia Oxidizing Bacteria to the Back of the Head to Change the Skin Microbiome

Ammonia oxidizing bacteria (N. eutropha D23) was applied topically to the back of the head of a subject for over 2 weeks. The dose was 3×1010 CFU applied per day. The product concentration was 1×109 CFU/ml (15 ml, two times a day) in a phosphate buffer with magnesium chloride. On each day a skin swab was taken to isolate and sequence all the bacterial DNA that was present, using isolation and sequencing protocols known in the art.

Ammonia oxidizing bacteria of the genus Nitrosomonas was not present in the Day 0 sample, and was detected and present in the Day 7, 14, and 16 skin swabs.

As shown in FIGS. 17 and 18, which plots the proportion versus bacterial genus for Day 0, 1, 8, 14, and 16, the application of ammonia oxidizing bacteria led to proportional increases in commensal non-pathogenic Staphylococcus (which was at least 98% Staphylococcus epidermidis) from close to 0% on day 0 to approximately 50% on day 16. Additionally, application of ammonia oxidizing bacteria led to a proportional reduction in potentially pathogenic or disease associated Propionibacteria over the time period tested (from over 75% on day 0 to less than 50% on day 16). Application of ammonia oxidizing bacteria also led to reductions in potentially pathogenic or disease associated Stenotrophomonas over the time period tested (from 0.1% on day 0 to less than 0.01% on day 16.)

Some of the data shown in FIGS. 1 and 2 is also presented below in Table 15.

TABLE 15
Genera by Day
Proportion Proportion Proportion
by genus: by genus: by genus:
Day Propionibacteria Staphylococci Stenotrophomonas
0 0.78 0.01 0.13
1 0.79 0.1 0
8 0.8 0.15 0
14 0.55 0.45 0.001
16 0.48 0.49 0

As shown in Table 15, the proportion of Propionibacteria was reduced after about 14 days (compare data for Day 0, 1, and 8 with Day 14 and 16 in Table 15). The proportion of Staphylococci increased after about two weeks (compare data for Day 0, 1, and 8 with Day 14 and 16 in Table 15). The proportion of Stenotrophomonas decreased after about 1 day (compare data for Day 0 with Day 1, 8, 14, and 16 in Table 15).

These changes in the skin microbiome composition to a less pathogenic state indicate that application of ammonia oxidizing bacteria would be useful in treatment of dermatologic diseases including but not limited to acne, eczema, skin infections, and rosacea.

Example 11

Studies with Ammonia-Oxidizing Bacteria for the Human Skin: Cosmetic Effects, Safety, Detection and Skin Metagenomics

A blinded, placebo-controlled 24 human volunteer study randomized 4:1 AOB to placebo control was performed. Subjects applied a Nitrosomonas suspension (109 CFU/ml, 2 times per day, for a total of 3×1010 CFU per day) to their face and scalp twice daily for one week and were followed for two additional weeks post-application. Volunteers were instructed to refrain from using hair products during the one-week AOB application as well as the week following application, then returned to regular shampoo use for the third week. Scalp swabs were obtained on Day 0 as baseline controls and on Day 1, 3, 8, 14 and 21 to assess presence/absence of AOB by PCR and 16S rRNA sequencing analyses.

No serious adverse events were associated with AOB application for one week and the product was deemed safe. AOB users reported a clear improvement in skin condition and quality, as indicated by self-assessment reports completed after the seven-day application period. Using AOB-specific PCR analyses of the skin samples, we could demonstrate presence of the bacteria in 83-100% of AOB users during the application period, whereas no AOB were detected in the placebo control samples. All subjects lacked AOB from baseline swabs obtained prior to study initiation, consistent with the predicted sensitivity of these bacteria to soaps and other commercial products. Amplification of the 16S rRNA gene and sequencing of a subset of samples confirmed presence of AOB in corresponding samples and suggested potential trends in modulating the skin microbiome by topical AOB application. In summary, live AOB-based products are safe and could hold great promise as novel self-regulating topical delivery agents of nitrite and nitric oxide to the human skin.

As shown in Table 16, below, the proportion of Nitrosomonas (AOB) went up when comparing Day 0 versus Day 8. The proportion of other bacteria, Propionibacterium, Enterobacter, and Citrobacter went down, when comparing Day 0 versus Day 8. The p-values indicated in Table 16 demonstrate that the most significant change between Day 0 and Day 8 was observed with Nitrosomonas (AOB) followed by Propionibacterium. Enterobacter and Citrobacter also showed changes between Day 0 and Day 8 to a lesser degree.

TABLE 16
Trends in microbiome composition following AOB application
(Day 0 versus Day 8)
Genus P-value (unadjusted) Trend
Nitrosomonas (AOB) 0.0039 Up
Propionibacterium 0.0078 Down
Enterobacter 0.0346 Down
Citrobacter 0.036 Down

Because nitrite and nitric oxide have been implicated in critical physiological functions, such as vasodilation, skin inflammation and wound healing, we have hypothesized that AOB may have beneficial effects on both healthy and immunopathological skin conditions by metabolizing ammonia from sweat while concurrently driving skin acidification. We reasoned that Nitrosomonas would be safe for human use because they are slow-growing and incapable of utilizing organic carbon sources, they are sensitive to antibiotics, and they have never been linked to animal or human disease. Here we describe a blinded, placebo-controlled 24 human volunteer study where subjects applied a live Nitrosomonas suspension to their face and scalp twice daily for one week and were subsequently followed for two additional weeks. Volunteers did not use hair products during the first and second week, then they returned to their regular routine for the third week. Scalp swabs were obtained on Day 0 as baseline controls and on Day 1, 3, 8, 14 and 21 to assess presence/absence of Nitrosomonas and to examine microbial diversity. Importantly, no adverse events were associated with topical application. PCR analyses demonstrated presence of the bacteria in 83%-100% of skin swabs obtained from AOB users during or immediately after completion of the one-week application period (Day 1, 3 or 8) and in 60% of the users on Day 14, but not in any of the placebo control samples. All subjects lacked AOB from baseline swabs obtained prior to study initiation. Increased levels of AOB during the one-week application period correlated with a qualitative improvement in skin condition, in contrast to no improvement reported by placebo control subjects. Sequencing of the 16S rRNA gene amplification product obtained from a subset of subjects verified the presence of AOB in corresponding samples and suggested potential modulation of the skin microbiome composition. In summary, live Nitrosomonas are well tolerated and may hold promise as novel self-regulating topical delivery agents of nitrite and nitric oxide to the human skin.

Here, we present the results from preliminary studies in humans where we have begun evaluating topical application of a Nitrosomonas suspension to the human skin and the potential of using AOB as natural delivery systems of NO/NO2 in vivo. We have explored methodologies for AOB detection in skin specimens and the possible effects of AOB in skin microbial communities, as well as collected important user feedback from the early adopters of our topical cosmetic.

Methods

Culture Conditions.

N. eutropha D23 was propagated in batch culture at 28-30° C. in mineral salt medium supplemented with 20-50 mM NH4+ and sodium carbonate as the carbon source [Ensign et al, 1993]. For continuous culture, D23 was grown at ˜109 cells/ml in a 1 liter mini-Bioreactor (Applikon Biotechnology) at 28° C. using sodium carbonate for both pH neutralization and the carbon source.

Nitrite Quantification.

Nitrite concentrations in culture supernatants were determined using the Griess colorimetric assay [Hageman and Kucklesby, 1971] and sodium nitrite as standards.

DNA Extraction from Skin Swabs.

Samples were maintained in 1 ml of 10% AssayAssure Bioservative (Thermo Scientific) diluted in PBS. Biomass was centrifuged and cells were lysed using a method developed for skin specimens [Grice, 2009] with modifications to the buffer designed to maintain long DNA integrity. DNA was then purified using the PowerLyzer UltraClean microbial DNA isolation kit (Mo Bio Laboratories). N. eutropha D23 was identified using a 3-gene PCR signature amplifying the ammonia monooxygenase encoding locus amoCAB.

PCR and Library Preparation.

Full-length 16S rRNA genes were amplified in duplicate reactions using a cocktail of primers and AccuPrime DNA polymerase SuperMix kit (Life Technologies). All PCR products were directly treated with the SMRTbell Template Prep Kit followed by the DNA/Polymerase Binding Kit P4 (Pacific Biosciences).

16S rDNA Sequencing and Analysis.

PCR products were sequenced using the Pacific Biosciences RS instrument [Eid, 2009]. Raw base calls were transformed to consensus DNA sequences using the Pacific Biosciences Consensus Tools package and then processed with the Whole Biome Microbiome Profiling Platform to obtain phylum-genus and strain-level frequency measures for each sample.

Human Volunteer Study.

A total of 24 male volunteers were included in a blinded, placebo-controlled, study each for a total of three weeks according to a protocol for topical AOB-001 use approved by the Allendale Institutional Review Board (Old Lyme, Conn.). Written informed consent was obtained from each study participant. Subjects applied 15 ml of an aqueous suspension of N. eutropha (AOB-001), or placebo (vehicle), twice daily containing ˜109 cells/ml.

The human volunteer study design for the preliminary evaluation of a Nitrosomonas-containing topical suspension (AOB-001) is shown in FIG. 5K. Detection of AOB was performed by PCR in scalp swab samples. FIG. 5L shows PCR analyses of scalp swabs collected during the study. The left panel indicates the percent-positive samples for AOB-specific three-gene signature (amoA, amoB, amoC). The right panel indicates the Composite PCR scores for a total of six samples collected from each of 23 volunteers. The scoring scheme used for the positive samples collected at each of six sampling points is indicated.

Skin microbiome composition prior and during AOB-001 application were obtained by 16S rDNA sequencing. FIG. 5M indicates that genus-level bacterial diversity as determined by 16S rDNA sequencing in skin swab samples collected before and after topical application of AOB-001.

The percentage of the total sequence reads representing each of twelve bacterial genera in samples collected at baseline prior to application (Day 0) and immediately after the one week application (Day 8), or one week after stopping topical application (Day 14), are shown.

FIG. 5N indicates changes in abundance of Nitrosomonas and other species in skin samples collected before and after AOB-001 application. Panel A shows percentages of the total 16S rDNA sequence reads representing Nitrosomonas prior to application (Day 0), immediately after the one-week application (Day 8), or one week after terminating application (Day 14) are shown. Panel B shows a change in patterns in abundance of species detected by 16S rDNA sequencing in Day 0 versus Day 8 samples collected from AOB users.

AOB-001 users report an improvement in skin condition. FIG. 5O shows a user evaluation of AOB-001. Assessment of AOB-001 cosmetic effects was provided by 23 volunteers upon completion of the one week application to their scalp and face. Subjects were plotted in order of increasing composite PCR scores. (The responses were categorized as 2=agree strongly; 0=no change; −2=disagree strongly). In summary, AOB-001 is well-tolerated. The user responses in a blind study indicate improved skin/scalp condition. AOB (Nitrosomonas) are readily detectable in skin microbiome samples by PCR and 16S rRNA gene sequencing. Preliminary microbiome analyses indicate modulation of skin microbiota by AOB.

SUPPLEMENTARY TABLE 1
Annotation of genes in SEQ ID NO: 1.
Feature Length D23 C91
ID Type Start Stop Frame Strand (bp) Function Subsystem Gbkld Alias
fig|6666666.60966.peg.1 CDS 35 1414 2 + 1380 Chromosomal Cell Division Subsystem D23_1c0001 Neut_0001
replication initiator including YidCD;
protein DnaA <br>DNA replication
cluster 1
fig|6666666.60966.peg.2 CDS 1619 2740 2 + 1122 DNA polymerase III beta Cell Division Subsystem D23_1c0002 Neut_0002
subunit (EC 2.7.7.7) including YidCD;
<br>DNA replication
cluster 1
fig|6666666.60966.peg.3 CDS 2798 5227 2 + 2430 DNA gyrase subunit B Cell Division Subsystem D23_1c0003 Neut_0003
(EC 5.99.1.3) including YidCD;
<br>DNA gyrase
subunits; <br>DNA
replication cluster 1;
<br>DNA
topoisomerases, Type II,
ATP-dependent;
<br>Resistance to
fluoroquinolones
fig|6666666.60966.peg.4 CDS 5248 5691 1 + 444 FIG039061: -none- D23_1c0004 Neut_0004
hypothetical protein
related to heme
utilization
fig|6666666.60966.peg.5 CDS 5748 6479 3 + 732 tRNA pseudouridine Colicin V and Bacteriocin D23_1c0005 Neut_0005
synthase A (EC 4.2.1.70) Production Cluster;
<br>RNA pseudouridine
syntheses; <br>tRNA
modification Bacteria;
<br>tRNA processing
fig|6666666.60966.peg.6 CDS 7261 7518 1 + 258 4Fe—4S ferredoxin, iron- Inorganic Sulfur D23_1c0009 Neut_0127
sulfur binding Assimilation
fig|6666666.60966.peg.7 CDS 7584 7946 3 + 363 FIG00858425: -none- D23_1c0010 Neut_0128
hypothetical protein
fig|6666666.60966.peg.8 CDS 11430 7966 −3 3465 Transcription-repair Transcription factors D23_1c0011 Neut_0129
coupling factor bacterial;
<br>Transcription repair
cluster
fig|6666666.60966.peg.9 CDS 12737 11457 −2 1281 InterPro IPR003416 -none- D23_1c0012 Neut_0130
COGs COG3174
fig|6666666.60966.peg.10 CDS 14499 12730 −3 1770 Single-stranded-DNA- DNA Repair Base D23_1c0013 Neut_0131
specific exonuclease Excision
RecJ (EC 3.1.—.—)
fig|6666666.60966.peg.11 CDS 15277 14681 −1 597 InterPro IPR000345 -none- D23_1c0014 Neut_0132
fig|6666666.60966.peg.12 CDS 16285 15365 −1 921 Indole-3-glycerol Chorismate: D23_1c0015 Neut_0133
phosphate synthase (EC Intermediate for
4.1.1.48) synthesis of Tryptophan,
PAPA antibiotics, PABA,
3-hydroxyanthranilate
and more.;
<br>Tryptophan
synthesis
fig|6666666.60966.peg.13 CDS 17321 16296 −2 1026 Anthranilate Auxin biosynthesis; D23_1c0016 Neut_0134
phosphoribosyltransferase <br>Chorismate:
(EC 2.4.2.18) Intermediate for
synthesis of Tryptophan,
PAPA antibiotics, PABA,
3-hydroxyanthranilate
and more.;
<br>Tryptophan
synthesis
fig|6666666.60966.peg.14 CDS 17920 17318 −1 603 Anthranilate synthase, Chorismate: D23_1c0017 Neut_0135
amidotransferase Intermediate for
component (EC synthesis of Tryptophan,
4.1.3.27) PAPA antibiotics, PABA,
3-hydroxyanthranilate
and more.;
<br>Tryptophan
synthesis
fig|6666666.60966.peg.15 CDS 18046 19545 1 + 1500 Putative sensor-like -none- D23_1c0018 Neut_0136
histidine kinase YfhK
fig|6666666.60966.peg.16 CDS 19644 20081 3 + 438 FIG00858754: -none- D23_1c0019 Neut_0137
hypothetical protein
fig|6666666.60966.peg.17 CDS 20101 21465 1 + 1365 Putative sensory -none- D23_1c0020 Neut_0138
histidine kinase YfhA
fig|6666666.60966.peg.18 CDS 22742 21474 −2 1269 PDZ/DHR/GLGF domain -none- D23_1c0021 Neut_0139
protein
fig|6666666.60966.peg.19 CDS 26700 22798 −3 3903 Phosphoribosylformylglycinamidine De Novo Purine D23_1c0022 Neut_0140
synthase, Biosynthesis; <br>De
synthetase subunit (EC Novo Purine
6.3.5.3)/ Biosynthesis
Phosphoribosylformylglycinamidine
synthase,
glutamine
amidotransferase
subunit (EC 6.3.5.3)
fig|6666666.60966.peg.20 CDS 26942 28510 2 + 1569 hypothetical protein -none- D23_1c0023 Neut_0141
fig|6666666.60966.peg.22 CDS 28682 28867 2 + 186 hypothetical protein -none- D23_1c0024 NA
fig|6666666.60966.peg.23 CDS 29060 28851 −2 210 Death on curing Phd-Doc, YdcE-YdcD D23_1c0025 NA
protein, Doc toxin toxin-antitoxin
(programmed cell death)
systems
fig|6666666.60966.peg.24 CDS 29367 29227 −3 141 Prevent host death Phd-Doc, YdcE-YdcD D23_1c0026 Neut_0143
protein, Phd antitoxin toxin-antitoxin
(programmed cell death)
systems
fig|6666666.60966.peg.25 CDS 29726 30082 2 + 357 blr1219; hypothetical -none- D23_1c0028 Neut_0144
protein
fig|6666666.60966.peg.26 CDS 30113 31672 2 + 1560 NAD(P)HX epimerase/ YjeE; <br>YjeE D23_1c0029 Neut_0145
NAD(P)HX dehydratase
fig|6666666.60966.peg.29 CDS 31959 32078 3 + 120 hypothetical protein -none- D23_1c0030 NA
fig|6666666.60966.peg.30 CDS 32096 32914 2 + 819 O-antigen export -none- D23_1c0031 Neut_0146
system permease
protein RfbD
fig|6666666.60966.peg.31 CDS 33063 33266 3 + 204 hypothetical protein -none- D23_1c0032 Neut_0147
fig|6666666.60966.peg.32 CDS 33441 33995 3 + 555 hypothetical protein -none- D23_1c0033 Neut_0148
fig|6666666.60966.peg.33 CDS 34044 34424 3 + 381 hypothetical protein -none- D23_1c0034 NA
fig|6666666.60966.peg.34 CDS 34530 35588 3 + 1059 putative transposase -none- D23_1c0035 Neut_0149
fig|6666666.60966.peg.36 CDS 36348 36064 −3 285 HigA protein (antitoxin Toxin-antitoxin replicon D23_1c0037 Neut_0150
to HigB) stabilization systems
fig|6666666.60966.peg.37 CDS 36621 36379 −3 243 HigB toxin protein Toxin-antitoxin replicon D23_1c0038 Neut_0151
stabilization systems
fig|6666666.60966.peg.38 CDS 36580 36750 1 + 171 hypothetical protein -none- D23_1c0039 NA
fig|6666666.60966.peg.39 CDS 36747 38108 3 + 1362 Teichoic acid export Rhamnose containing D23_1c0040 Neut_0152
ATP-binding protein glycans
TagH (EC 3.6.3.40)
fig|6666666.60966.peg.40 CDS 38105 42433 2 + 4329 Glycosyl transferase, -none- D23_1c0041 Neut_0153
group 2 family protein
fig|6666666.60966.peg.41 CDS 42537 43733 3 + 1197 glycosyl transferase, -none- D23_1c0042 NA
group 1/2 family
protein
fig|6666666.60966.peg.42 CDS 43945 44838 1 + 894 Alpha-L-Rha alpha-1,3- Rhamnose containing D23_1c0043 Neut_0166
L-rhamnosyltransferase glycans
(EC 2.4.1.—)
fig|6666666.60966.peg.43 CDS 45457 45140 −1 318 HigA protein (antitoxin Toxin-antitoxin replicon D23_1c0044 Neut_0167
to HigB) stabilization systems
fig|6666666.60966.peg.44 CDS 45610 45470 −1 141 HigB toxin protein Toxin-antitoxin replicon D23_1c0045 Neut_0168
stabilization systems
fig|6666666.60966.peg.45 CDS 45950 46279 2 + 330 Glycosyl transferase, -none- D23_1c0046 Neut_0169
group 2 family protein
fig|6666666.60966.peg.47 CDS 47082 46804 −3 279 hypothetical protein -none- D23_1c0047 NA
fig|6666666.60966.peg.49 CDS 48719 47757 −2 963 Mobile element protein -none- D23_1c0049 Neut_0978
fig|6666666.60966.peg.50 CDS 48899 48777 −2 123 Mobile element protein -none- D23_1c0050 Neut_0357
fig|6666666.60966.peg.51 CDS 49218 48970 −3 249 Mobile element protein -none- D23_1c0051 Neut_2405
fig|6666666.60966.peg.52 CDS 49615 49502 −1 114 hypothetical protein -none- D23_1c0052 NA
fig|6666666.60966.peg.53 CDS 49842 50255 3 + 414 Nucleotidyltransferase -none- D23_1c0053 Neut_0172
(EC 2.7.7.—)
fig|6666666.60966.peg.54 CDS 50257 50622 1 + 366 Nucleotidyltransferase -none- D23_1c0054 Neut_0173
(EC 2.7.7.—)
fig|6666666.60966.peg.55 CDS 51293 50880 −2 414 Mobile element protein -none- D23_1c0056 NA
fig|6666666.60966.peg.56 CDS 51432 51253 −3 180 hypothetical protein -none- D23_1c0057 Neut_0176
fig|6666666.60966.peg.57 CDS 51530 52492 2 + 963 Mobile element protein -none- D23_1c0058 Neut_1746
fig|6666666.60966.peg.58 CDS 52657 52908 1 + 252 Mobile element protein -none- D23_1c0059 Neut_0884
fig|6666666.60966.peg.59 CDS 52964 53326 2 + 363 Mobile element protein -none- D23_1c0060 Neut_2499
fig|6666666.60966.peg.60 CDS 54452 53361 −2 1092 putative transposase -none- D23_1c0061 Neut_0177
fig|6666666.60966.peg.61 CDS 54765 54430 −3 336 FIG00859125: -none- D23_1c0062 Neut_0178
hypothetical protein
fig|6666666.60966.peg.62 CDS 55016 55774 2 + 759 dTDP-Rha:A-D-GlcNAc- dTDP-rhamnose D23_1c0063 Neut_0179
diphosphoryl synthesis
polyprenol, A-3-L-
rhamnosyl transferase
WbbL
fig|6666666.60966.peg.63 CDS 56735 55788 −2 948 UDP-glucose 4- CBSS- D23_1c0064 Neut_0180
epimerase (EC 5.1.3.2) 296591.1.peg.2330;
<br>N-linked
Glycosylation in
Bacteria; <br>Rhamnose
containing glycans
fig|6666666.60966.peg.64 CDS 56874 56746 −3 129 hypothetical protein -none- D23_1c0065 NA
fig|6666666.60966.peg.65 CDS 60470 57075 −2 3396 Adenylate cyclase (EC cAMP signaling in D23_1c0066 Neut_0181
4.6.1.1)/Guanylate bacteria
cyclase (EC 4.6.1.2)
fig|6666666.60966.peg.66 CDS 60633 60755 3 + 123 hypothetical protein -none- D23_1c0067 NA
fig|6666666.60966.peg.67 CDS 62853 60769 −3 2085 Ubiquinone Ubiquinone D23_1c0068 Neut_0182
biosynthesis Biosynthesis;
monooxygenase UbiB <br>Ubiquinone
Biosynthesis-gjo
fig|6666666.60966.peg.68 CDS 63084 63821 3 + 738 hypothetical protein -none- D23_1c0069 Neut_0183
fig|6666666.60966.peg.69 CDS 64515 66023 3 + 1509 CBSS- -none- D23_1c0070 NA
498211.3.peg.1514:
hypothetical protein
fig|6666666.60966.peg.70 CDS 66074 66751 2 + 678 FIG039767: -none- D23_1c0071 NA
hypothetical protein
fig|6666666.60966.peg.71 CDS 66741 70157 3 + 3417 FIG007317: -none- D23_1c0072 NA
hypothetical protein
fig|6666666.60966.peg.72 CDS 70190 71326 2 + 1137 FIG005429: -none- D23_1c0073 Neut_0184
hypothetical protein
fig|6666666.60966.peg.73 CDS 71379 71939 3 + 561 Lipid carrier: UDP-N- CBSS- D23_1c0074 Neut_0185
acetylgalactosaminyltransferase 296591.1.peg.2330;
(EC 2.4.1.—) <br>N-linked
Glycosylation in Bacteria
fig|6666666.60966.peg.74 CDS 71949 73931 3 + 1983 Nucleoside-diphosphate CBSS-296591.1.peg.2330 D23_1c0075 Neut_0186
sugar
epimerase/dehydratase
fig|6666666.60966.peg.75 CDS 74467 73949 −1 519 cytidine and -none- D23_1c0076 Neut_0187
deoxycytidylate
deaminase family
protein
fig|6666666.60966.peg.76 CDS 74956 74594 −1 363 Mobile element protein -none- D23_1c0077 Neut_2499
fig|6666666.60966.peg.77 CDS 75263 75012 −2 252 Mobile element protein -none- D23_1c0078 Neut_0884
fig|6666666.60966.peg.78 CDS 75586 76446 1 + 861 Flagellar motor rotation Flagellar motility; D23_1c0079 Neut_0188
protein MotA <br>Flagellum
fig|6666666.60966.peg.79 CDS 76489 77433 1 + 945 Flagellar motor rotation Flagellar motility; D23_1c0080 Neut_0189
protein MotB <br>Flagellum
fig|6666666.60966.peg.80 CDS 77408 78205 2 + 798 FIG00858624: -none- D23_1c0081 Neut_0190
hypothetical protein
fig|6666666.60966.peg.81 CDS 79621 78218 −1 1404 Cysteinyl-tRNA Zinc regulated enzymes; D23_1c0082 Neut_0191
synthetase (EC 6.1.1.16) <br>tRNA
aminoacylation, Cys
fig|6666666.60966.peg.83 CDS 79830 80384 3 + 555 Peptidyl-prolyl cis-trans Peptidyl-prolyl cis-trans D23_1c0083 Neut_0192
isomerase PpiB (EC isomerase;
5.2.1.8) <br>Queuosine-
Archaeosine
Biosynthesis
fig|6666666.60966.peg.84 CDS 80403 80894 3 + 492 Peptidyl-prolyl cis-trans Peptidyl-prolyl cis-trans D23_1c0084 Neut_0193
isomerase PpiB (EC isomerase;
5.2.1.8) <br>Queuosine-
Archaeosine
Biosynthesis
fig|6666666.60966.peg.85 CDS 80972 81424 2 + 453 Rhodanese-related -none- D23_1c0085 Neut_0194
sulfurtransferase
fig|6666666.60966.peg.86 CDS 82260 81439 −3 822 Undecaprenyl- -none- D23_1c0086 Neut_0195
diphosphatase (EC
3.6.1.27)
fig|6666666.60966.peg.87 CDS 84206 82308 −2 1899 Thiamin biosynthesis Thiamin biosynthesis D23_1c0087 Neut_0196
protein ThiC
fig|6666666.60966.peg.88 CDS 84412 85068 1 + 657 Protein-L-isoaspartate Protein-L-isoaspartate O- D23_1c0088 Neut_0197
O-methyltransferase methyltransferase;
(EC 2.1.1.77) <br>Stationary phase
repair cluster; <br>Ton
and Tol transport
systems
fig|6666666.60966.peg.90 CDS 85216 86493 1 + 1278 Type I secretion outer Multidrug Resistance D23_1c0089 Neut_0198
membrane protein, Efflux Pumps; <br>Ton
TolC precursor and Tol transport
systems
fig|6666666.60966.peg.91 CDS 89009 86556 −2 2454 ATP-dependent Proteasome bacterial; D23_1c0090 Neut_0199
protease La (EC <br>Proteolysis in
3.4.21.53) Type II bacteria, ATP-dependent
fig|6666666.60966.peg.92 CDS 89253 89375 3 + 123 hypothetical protein -none- D23_1c0091 NA
fig|6666666.60966.peg.93 CDS 89433 89579 3 + 147 hypothetical protein -none- D23_1c0092 NA
fig|6666666.60966.peg.94 CDS 90769 89555 −1 1215 Serine--pyruvate Photorespiration D23_1c0093 Neut_0200
aminotransferase (EC (oxidative C2 cycle);
2.6.1.51)/L- <br>Pyruvate Alanine
alanine:glyoxylate Serine Interconversions
aminotransferase (EC
2.6.1.44)
fig|6666666.60966.peg.95 CDS 93514 91088 −1 2427 ATP-dependent Proteasome bacterial; D23_1c0095 Neut_0201
protease La (EC <br>Proteolysis in
3.4.21.53) Type I bacteria, ATP-dependent
fig|6666666.60966.peg.96 CDS 94903 93620 −1 1284 ATP-dependent Clp Proteasome bacterial; D23_1c0096 Neut_0202
protease ATP-binding <br>Proteolysis in
subunit ClpX bacteria, ATP-dependent
fig|6666666.60966.peg.97 CDS 95607 94963 −3 645 ATP-dependent Clp Proteasome bacterial; D23_1c0097 Neut_0203
protease proteolytic <br>Proteolysis in
subunit (EC 3.4.21.92) bacteria, ATP-
dependent; <br>cAMP
signaling in bacteria
fig|6666666.60966.peg.98 CDS 96907 95591 −1 1317 Cell division trigger Bacterial Cell Division D23_1c0098 Neut_0204
factor (EC 5.2.1.8)
fig|6666666.60966.peg.99 CDS 97996 97241 −1 756 Short-chain Transcription repair D23_1c0100 Neut_0205
dehydrogenase/reductase cluster
SDR
fig|6666666.60966.peg.100 CDS 99750 98107 −3 1644 Heat shock protein 60 GroEL GroES D23_1c0101 Neut_0206
family chaperone GroEL
fig|6666666.60966.peg.101 CDS 100080 99790 −3 291 Heat shock protein 60 GroEL GroES D23_1c0102 Neut_0207
family co-chaperone
GroES
fig|6666666.60966.peg.102 CDS 100244 101554 2 + 1311 Adenosylmethionine-8- Biotin biosynthesis; D23_1c0103 Neut_0208
amino-7-oxononanoate <br>Biotin biosynthesis
aminotransferase (EC Experimental; <br>Biotin
2.6.1.62) synthesis cluster
fig|6666666.60966.peg.103 CDS 101561 102967 2 + 1407 Metallo-beta-lactamase Bacterial RNA- D23_1c0104 Neut_0209
family protein, RNA- metabolizing Zn-
specific dependent hydrolases;
<br>Ribonucleases in
Bacillus
fig|6666666.60966.peg.104 CDS 103374 103066 −3 309 Cytochrome c, class I -none- D23_1c0105 Neut_0210
fig|6666666.60966.peg.105 CDS 103536 104300 3 + 765 Exodeoxyribonuclease DNA repair, bacterial D23_1c0106 Neut_0211
III (EC 3.1.11.2)
fig|6666666.60966.peg.106 CDS 104347 105459 1 + 1113 Alanine dehydrogenase Pyruvate Alanine Serine D23_1c0107 Neut_0212
(EC 1.4.1.1) Interconversions
fig|6666666.60966.peg.107 CDS 106118 105597 −2 522 Conserved Tolerance to colicin E2 D23_1c0108 Neut_0213
uncharacterized protein
CreA
fig|6666666.60966.peg.109 CDS 107425 106253 −1 1173 Permeases of the major -none- D23_1c0109 Neut_0214
facilitator superfamily
fig|6666666.60966.peg.110 CDS 108032 107454 −2 579 Uncharacterized protein -none- D23_1c0110 Neut_0215
family UPF0016
fig|6666666.60966.peg.112 CDS 108821 109603 2 + 783 Ribulose-5-phosphate -none- D23_1c0113 Neut_0218
4-epimerase and
related epimerases and
aldolases
fig|6666666.60966.peg.113 CDS 109609 113274 1 + 3666 InterPro -none- D23_1c0114 Neut_0219
IPR000014:IPR001789:IPR002106:
IPR002570:IPR003594:
IPR003660:
IPR003661:IPR004358:IPR005467
COGs
COG0642
fig|6666666.60966.peg.114 CDS 113292 114485 3 + 1194 Succinyl-CoA ligase TCA Cycle D23_1c0115 Neut_0220
[ADP-forming] beta
chain (EC 6.2.1.5)
fig|6666666.60966.peg.115 CDS 114489 115364 3 + 876 Succinyl-CoA ligase TCA Cycle D23_1c0116 Neut_0221
[ADP-forming] alpha
chain (EC 6.2.1.5)
fig|6666666.60966.peg.116 CDS 115402 115722 1 + 321 FIG00858523: -none- D23_1c0117 Neut_0222
hypothetical protein
fig|6666666.60966.peg.117 CDS 115750 117177 1 + 1428 D-alanyl-D-alanine CBSS-84588.1.peg.1247; D23_1c0118 Neut_0223
carboxypeptidase (EC <br>Metallocarboxypeptidases
3.4.16.4) (EC 3.4.17.—);
<br>Murein Hydrolases;
<br>Peptidoglycan
Biosynthesis
fig|6666666.60966.peg.118 CDS 117265 118227 1 + 963 Mobile element protein -none- D23_1c0119 Neut_1278
fig|6666666.60966.peg.119 CDS 120193 120056 −1 138 hypothetical protein -none- D23_1c0120 NA
fig|6666666.60966.rna.5 RNA 118725 120255 3 + 1531 Small Subunit
Ribosomal RNA; -none- D23_1c0120
ssuRNA; SSU rRNA
fig|6666666.60966.peg.121 CDS 122376 122495 3 + 120 hypothetical protein -none- D23_1c0124 NA
fig|6666666.60966.peg.120 CDS 121863 121994 3 + 132 hypothetical protein -none- D23_1c0124 NA
fig|6666666.60966.rna.8 RNA 120652 123535 1 + 2884 Large Subunit -none- D23_1c0124
Ribosomal RNA;
IsuRNA; LSU rRNA
fig|6666666.60966.rna.9 RNA 123600 123716 3 + 117 5S RNA -none- D23_1c0126
fig|6666666.60966.peg.123 CDS 124878 124708 −3 171 hypothetical protein -none- D23_1c0127 NA
fig|6666666.60966.peg.124 CDS 125317 125496 1 + 180 hypothetical protein -none- D23_1c0129 Neut_0547
fig|6666666.60966.peg.125 CDS 125792 126799 2 + 1008 NAD-dependent CBSS-296591.1.peg.2330 D23_1c0130 Neut_0225
epimerase/dehydratase
fig|6666666.60966.peg.126 CDS 126808 128082 1 + 1275 UDP-glucose -none- D23_1c0131 Neut_0226
dehydrogenase (EC
1.1.1.22)
fig|6666666.60966.peg.127 CDS 128985 128089 −3 897 Permeases of the -none- D23_1c0132 Neut_0227
drug/metabolite
transporter (DMT)
superfamily
fig|6666666.60966.peg.128 CDS 129078 130283 3 + 1206 N-succinyl-L,L- Lysine Biosynthesis DAP D23_1c0133 Neut_0228
diaminopimelate Pathway, GJO scratch
aminotransferase
alternative (EC 2.6.1.17)
fig|6666666.60966.peg.129 CDS 130311 131132 3 + 822 2,3,4,5- Lysine Biosynthesis DAP D23_1c0134 Neut_0229
tetrahydropyridine-2,6- Pathway, GJO scratch
dicarboxylate N-
succinyltransferase (EC
2.3.1.117)
fig|6666666.60966.peg.130 CDS 131322 131693 3 + 372 FIG00858507: -none- D23_1c0135 Neut_0230
hypothetical protein
fig|6666666.60966.peg.131 CDS 131801 132127 2 + 327 FIG00858507: -none- D23_1c0136 Neut_0231
hypothetical protein
fig|6666666.60966.peg.132 CDS 132190 132312 1 + 123 hypothetical protein -none- D23_1c0137 NA
fig|6666666.60966.peg.133 CDS 132314 133303 2 + 990 Biotin operon repressor/ Biotin biosynthesis; D23_1c0138 Neut_0232
Biotin-protein ligase <br>Biotin biosynthesis;
(EC 6.3.4.15) <br>Biotin synthesis
cluster; <br>Biotin
synthesis cluster
fig|6666666.60966.peg.134 CDS 133331 134104 2 + 774 Pantothenate kinase Coenzyme A D23_1c0139 Neut_0233
type III, CoaX-like (EC Biosynthesis;
2.7.1.33) <br>Coenzyme A
Biosynthesis cluster
fig|6666666.60966.peg.135 CDS 134123 134794 2 + 672 GTP-binding protein Universal GTPases D23_1c0140 Neut_0234
EngB
fig|6666666.60966.peg.136 CDS 134938 135945 1 + 1008 Porphobilinogen Heme and Siroheme D23_1c0141 Neut_0235
synthase (EC 4.2.1.24) Biosynthesis; <br>Zinc
regulated enzymes
fig|6666666.60966.peg.137 CDS 136861 136064 −1 798 Phosphate transport High affinity phosphate D23_1c0142 Neut_0236
ATP-binding protein transporter and control
PstB (TC 3.A.1.7.1) of PHO regulon;
<br>Phosphate
metabolism
fig|6666666.60966.peg.138 CDS 137797 136871 −1 927 Phosphate transport High affinity phosphate D23_1c0143 Neut_0237
system permease transporter and control
protein PstA (TC of PHO regulon;
3.A.1.7.1) <br>Phosphate
metabolism
fig|6666666.60966.peg.139 CDS 138817 137876 −1 942 Phosphate transport High affinity phosphate D23_1c0144 Neut_0238
system permease transporter and control
protein PstC (TC of PHO regulon;
3.A.1.7.1) <br>Phosphate
metabolism
fig|6666666.60966.peg.140 CDS 139048 139299 1 + 252 FIG00858998: -none- D23_1c0146 Neut_0239
hypothetical protein
fig|6666666.60966.peg.141 CDS 140580 139432 −3 1149 Cell division protein Bacterial Cell Division; D23_1c0147 Neut_0240
FtsZ (EC 3.4.24.—) <br>Bacterial
Cytoskeleton; <br>cell
division cluster
containing FtsQ; <br>cell
division core of larger
cluster
fig|6666666.60966.peg.142 CDS 141909 140650 −3 1260 Cell division protein Bacterial Cell Division; D23_1c0149 Neut_0241
FtsA <br>Bacterial
Cytoskeleton; <br>cell
division cluster
containing FtsQ; <br>cell
division core of larger
cluster
fig|6666666.60966.peg.143 CDS 142678 141950 −1 729 Cell division protein Bacterial Cell Division; D23_1c0150 Neut_0242
FtsQ <br>Bacterial
Cytoskeleton; <br>cell
division cluster
containing FtsQ; <br>cell
division core of larger
cluster
fig|6666666.60966.peg.144 CDS 143654 142734 −2 921 D-alanine--D-alanine Peptidoglycan D23_1c0152 Neut_0243
ligase (EC 6.3.2.4) Biosynthesis;
<br>Peptidoglycan
biosynthesis--gjo;
<br>cell division cluster
containing FtsQ
fig|6666666.60966.peg.145 CDS 144649 143651 −1 999 UDP-N- Peptidoglycan D23_1c0153 Neut_0244
acetylenolpyruvoylglucosamine Biosynthesis; <br>UDP-
reductase (EC N-acetylmuramate from
1.1.1.158) Fructose-6-phosphate
Biosynthesis
fig|6666666.60966.peg.146 CDS 146080 144659 −1 1422 UDP-N- Peptidoglycan D23_1c0154 Neut_0245
acetylmuramate-- Biosynthesis;
alanine ligase (EC <br>Peptidoglycan
6.3.2.8) biosynthesis--gjo;
<br>cell division cluster
containing FtsQ
fig|6666666.60966.peg.147 CDS 147159 146077 −3 1083 UDP-N- Peptidoglycan D23_1c0155 Neut_0246
acetylglucosamine--N- Biosynthesis; <br>cell
acetylmuramyl- division core of larger
(pentapeptide) cluster
pyrophosphoryl-
undecaprenol N-
acetylglucosamine
transferase (EC
2.4.1.227)
fig|6666666.60966.peg.148 CDS 148372 147212 −1 1161 Cell division protein Bacterial Cell Division; D23_1c0156 Neut_0247
FtsW <br>Bacterial
Cytoskeleton; <br>cell
division cluster
containing FtsQ
fig|6666666.60966.peg.149 CDS 149789 148377 −2 1413 UDP-N- Peptidoglycan D23_1c0157 Neut_0248
acetylmuramoylalanine-- Biosynthesis;
D-glutamate ligase (EC <br>Peptidoglycan
6.3.2.9) biosynthesis--gjo
fig|6666666.60966.peg.150 CDS 150871 149786 −1 1086 Phospho-N- Peptidoglycan D23_1c0158 Neut_0249
acetylmuramoyl- Biosynthesis
pentapeptide-
transferase (EC
2.7.8.13)
fig|6666666.60966.peg.151 CDS 152316 150943 −3 1374 UDP-N- Peptidoglycan D23_1c0159 Neut_0250
acetylmuramoylalanyl- Biosynthesis;
D-glutamyl-2,6- <br>Peptidoglycan
diaminopimelate--D- biosynthesis--gjo
alanyl-D-alanine ligase
(EC 6.3.2.10)
fig|6666666.60966.peg.152 CDS 153875 152313 −2 1563 UDP-N- Peptidoglycan D23_1c0160 Neut_0251
acetylmuramoylalanyl- Biosynthesis;
D-glutamate--2,6- <br>Peptidoglycan
diaminopimelate ligase biosynthesis--gjo
(EC 6.3.2.13)
fig|6666666.60966.peg.153 CDS 155545 153872 −1 1674 Cell division protein Ftsl 16S rRNA modification D23_1c0161 Neut_0252
[Peptidoglycan within P site of
synthetase] (EC ribosome; <br>Bacterial
2.4.1.129) Cell Division;
<br>Bacterial
Cytoskeleton; <br>CBSS-
83331.1.peg.3039;
<br>Flagellum in
Campylobacter;
<br>Peptidoglycan
Biosynthesis
fig|6666666.60966.peg.155 CDS 155895 155608 −3 288 Cell division protein FtsL 16S rRNA modification D23_1c0162 Neut_0253
within P site of
ribosome; <br>Bacterial
Cell Division;
<br>Bacterial
Cytoskeleton;
<br>Stationary phase
repair cluster
fig|6666666.60966.peg.156 CDS 156845 155892 −2 954 rRNA small subunit 16S rRNA modification D23_1c0163 Neut_0254
methyltransferase H within P site of
ribosome; <br>Bacterial
Cell Division
fig|6666666.60966.peg.157 CDS 157094 156861 −2 234 Cell division protein 16S rRNA modification D23_1c0164 Neut_0255
MraZ within P site of
ribosome; <br>Bacterial
Cell Division;
<br>Bacterial
Cytoskeleton
fig|6666666.60966.peg.158 CDS 157584 157859 3 + 276 DNA-3-methyladenine DNA Repair Base D23_1c0165 NA
glycosylase II (EC Excision
3.2.2.21)
fig|6666666.60966.peg.159 CDS 158202 158420 3 + 219 Rho-specific inhibitor of Transcription factors D23_1c0166 Neut_0257
transcription bacterial
termination (YaeO)
fig|6666666.60966.peg.160 CDS 159328 158561 −1 768 InterPro IPR001173 -none- D23_1c0167 Neut_0258
COGs COG0463
fig|6666666.60966.peg.161 CDS 159475 159924 1 + 450 InterPro IPR000086 -none- D23_1c0168 Neut_0259
COGs COG0494
fig|6666666.60966.peg.162 CDS 160257 160814 3 + 558 possible (U92432) ORF4 -none- D23_1c0169 Neut_0260
[Nitrosospira sp. NpAV]
fig|6666666.60966.peg.164 CDS 160969 161451 1 + 483 FIG00859298: -none- D23_1c0170 Neut_0261
hypothetical protein
fig|6666666.60966.peg.165 CDS 161593 162063 1 + 471 Adenine Purine conversions; D23_1c0171 Neut_0262
phosphoribosyltransferase <br>cAMP signaling in
(EC 2.4.2.7) bacteria
fig|6666666.60966.peg.166 CDS 162260 163573 2 + 1314 Seryl-tRNA synthetase CBSS- D23_1c0172 Neut_0263
(EC 6.1.1.11) 326442.4.peg.1852;
<br>Glycine and Serine
Utilization; <br>tRNA
aminoacylation, Ser
fig|6666666.60966.peg.167 CDS 163620 164306 3 + 687 FIG00858527: -none- D23_1c0173 Neut_0264
hypothetical protein
fig|6666666.60966.peg.168 CDS 165061 164351 −1 711 Phosphoglycerate Glycolysis and D23_1c0174 Neut_0265
mutase (EC 5.4.2.1) Gluconeogenesis;
<br>Phosphoglycerate
mutase protein family
fig|6666666.60966.peg.169 CDS 166178 165111 −2 1068 InterPro IPR001225 -none- D23_1c0175 Neut_0266
fig|6666666.60966.peg.170 CDS 166643 166200 −2 444 FIG00858776: -none- D23_1c0176 Neut_0267
hypothetical protein
fig|6666666.60966.peg.171 CDS 167465 166659 −2 807 CTP:Inositol-1- -none- D23_1c0177 Neut_0268
phosphate
cytidylyltransferase
(2.7.7.—)
fig|6666666.60966.peg.172 CDS 168669 167509 −3 1161 Cysteine desulfurase Alanine biosynthesis; D23_1c0178 Neut_0269
(EC 2.8.1.7) <br>CBSS-
84588.1.peg.1247;
<br>mnm5U34
biosynthesis bacteria;
<br>tRNA modification
Bacteria
fig|6666666.60966.peg.174 CDS 169251 169631 3 + 381 FIG048548: ATP -none- D23_1c0180 Neut_0270
synthase protein I2
fig|6666666.60966.peg.175 CDS 169720 170472 1 + 753 ATP synthase A chain -none- D23_1c0181 Neut_0271
(EC 3.6.3.14)
fig|6666666.60966.peg.176 CDS 170516 170788 2 + 273 ATP synthase C chain -none- D23_1c0182 Neut_0272
(EC 3.6.3.14)
fig|6666666.60966.peg.177 CDS 170900 171301 2 + 402 ATP synthase B chain -none- D23_1c0183 Neut_0273
(EC 3.6.3.14)
fig|6666666.60966.peg.178 CDS 171302 171838 2 + 537 ATP synthase delta -none- D23_1c0184 Neut_0274
chain (EC 3.6.3.14)
fig|6666666.60966.peg.179 CDS 171851 173392 2 + 1542 ATP synthase alpha -none- D23_1c0185 Neut_0275
chain (EC 3.6.3.14)
fig|6666666.60966.peg.180 CDS 173396 174280 2 + 885 ATP synthase gamma -none- D23_1c0186 Neut_0276
chain (EC 3.6.3.14)
fig|6666666.60966.peg.181 CDS 174311 175693 2 + 1383 ATP synthase beta chain -none- D23_1c0187 Neut_0277
(EC 3.6.3.14)
fig|6666666.60966.peg.182 CDS 175842 176141 3 + 300 ATP synthase epsilon -none- D23_1c0188 Neut_0278
chain (EC 3.6.3.14)
fig|6666666.60966.peg.183 CDS 176389 177765 1 + 1377 N-acetylglucosamine-1- Peptidoglycan D23_1c0189 Neut_0279
phosphate Biosynthesis;
uridyltransferase (EC <br>Peptidoglycan
2.7.7.23)/ Biosynthesis; <br>Sialic
Glucosamine-1- Acid Metabolism;
phosphate N- <br>Sialic Acid
acetyltransferase (EC Metabolism;
2.3.1.157) <br>Transcription repair
cluster;
<br>Transcription repair
cluster; <br>UDP-N-
acetylmuramate from
Fructose-6-phosphate
Biosynthesis; <br>UDP-
N-acetylmuramate from
Fructose-6-phosphate
Biosynthesis
fig|6666666.60966.peg.184 CDS 177805 179652 1 + 1848 Glucosamine-fructose- Sialic Acid Metabolism; D23_1c0190 Neut_0280
6-phosphate <br>UDP-N-
aminotransferase acetylmuramate from
[isomerizing] (EC Fructose-6-phosphate
2.6.1.16) Biosynthesis
fig|6666666.60966.peg.185 CDS 179795 180520 2 + 726 FIG000859: Riboflavin, FMN and FAD D23_1c0191 Neut_0281
hypothetical protein metabolism in plants;
YebC <br>RuvABC plus a
hypothetical
fig|6666666.60966.peg.186 CDS 180523 181059 1 + 537 Crossover junction RuvABC plus a D23_1c0192 Neut_0282
endodeoxyribonuclease hypothetical
RuvC (EC 3.1.22.4)
fig|6666666.60966.peg.187 CDS 181056 181640 3 + 585 Holliday junction DNA RuvABC plus a D23_1c0193 Neut_0283
helicase RuvA hypothetical
fig|6666666.60966.peg.188 CDS 181659 182699 3 + 1041 Holliday junction DNA RuvABC plus a D23_1c0194 Neut_0284
helicase RuvB hypothetical
fig|6666666.60966.peg.189 CDS 182760 183173 3 + 414 4-hydroxybenzoyl-CoA Ton and Tol transport D23_1c0195 Neut_0285
thioesterase family systems
active site
fig|6666666.60966.peg.190 CDS 183166 183870 1 + 705 MotA/TolQ/ExbB Ton and Tol transport D23_1c0196 Neut_0286
proton channel family systems
protein
fig|6666666.60966.peg.191 CDS 183867 184283 3 + 417 Tol biopolymer Ton and Tol transport D23_1c0197 Neut_0287
transport system, TolR systems
protein
fig|6666666.60966.peg.192 CDS 184304 185200 2 + 897 TolA protein Ton and Tol transport D23_1c0198 Neut_0288
systems
fig|6666666.60966.peg.193 CDS 185239 186510 1 + 1272 tolB protein precursor, Ton and Tol transport D23_1c0199 Neut_0289
periplasmic protein systems
involved in the tonb-
independent uptake of
group A colicins
fig|6666666.60966.peg.194 CDS 186565 187086 1 + 522 18K peptidoglycan- Ton and Tol transport D23_1c0200 Neut_0290
associated outer systems
membrane lipoprotein;
Peptidoglycan-
associated lipoprotein
precursor; Outer
membrane protein P6;
OmpA/MotB precursor
fig|6666666.60966.peg.195 CDS 187086 187907 3 + 822 TPR repeat containing Ton and Tol transport D23_1c0201 Neut_0291
exported protein; systems
Putative periplasmic
protein contains a
protein
prenylyltransferase
domain
fig|6666666.60966.peg.196 CDS 188060 188644 2 + 585 Queuosine Biosynthesis Queuosine-Archaeosine D23_1c0202 Neut_0292
QueE Radical SAM Biosynthesis; <br>tRNA
modification Bacteria
fig|6666666.60966.peg.197 CDS 188666 189346 2 + 681 Queuosine Biosynthesis Queuosine-Archaeosine D23_1c0203 Neut_0293
QueC ATPase Biosynthesis; <br>tRNA
modification Bacteria
fig|6666666.60966.peg.198 CDS 189700 189347 −1 354 Dihydroneopterin Folate Biosynthesis D23_1c0204 Neut_0294
aldolase (EC 4.1.2.25)
fig|6666666.60966.peg.199 CDS 189786 190388 3 + 603 Acyl- Glycerolipid and D23_1c0205 Neut_0295
phosphate:glycerol-3- Glycerophospholipid
phosphate O- Metabolism in Bacteria
acyltransferase PlsY
fig|6666666.60966.peg.200 CDS 191422 190406 −1 1017 TsaD/Kae1/Qri7 Bacterial RNA- D23_1c0206 Neut_0296
protein, required for metabolizing Zn-
threonylcarbamoyladenosine dependent hydrolases;
t(6)A37 formation <br>Macromolecular
in tRNA synthesis operon;
<br>YgjD and YeaZ
fig|6666666.60966.peg.201 CDS 191698 191910 1 + 213 SSU ribosomal protein Macromolecular D23_1c0207 Neut_0297
S21p synthesis operon
fig|6666666.60966.peg.202 CDS 191984 192391 2 + 408 Transamidase GatB Macromolecular D23_1c0208 Neut_0298
domain protein synthesis operon
fig|6666666.60966.peg.203 CDS 192486 194279 3 + 1794 DNA primase (EC 2.7.7.—) CBSS- D23_1c0209 Neut_0299
349161.4.peg.2417;
<br>Macromolecular
synthesis operon
fig|6666666.60966.peg.204 CDS 194461 196710 1 + 2250 RNA polymerase sigma CBSS- D23_1c0210 Neut_0300
factor RpoD 349161.4.peg.2417;
<br>Flagellum;
<br>Macromolecular
synthesis operon;
<br>Transcription
initiation, bacterial
sigma factors
fig|6666666.60966.peg.206 CDS 197605 197180 −1 426 Mobile element protein -none- D23_1c0212 Neut_0357
fig|6666666.60966.peg.207 CDS 198088 198819 1 + 732 Mobile element protein -none- D23_1c0213 NA
fig|6666666.60966.peg.209 CDS 200235 199564 −3 672 transposase and -none- D23_1c0214 Neut_2192
inactivated derivatives
fig|6666666.60966.peg.210 CDS 200398 200210 −1 189 hypothetical protein -none- D23_1c0215 NA
fig|6666666.60966.peg.211 CDS 200852 200995 2 + 144 Mobile element protein -none- D23_1c0216 Neut_0978
fig|6666666.60966.peg.212 CDS 201848 200970 −2 879 Mobile element protein -none- D23_1c0217 Neut_1720
fig|6666666.60966.peg.213 CDS 202240 201947 −1 294 Mobile element protein -none- D23_1c0218 Neut_1719
fig|6666666.60966.peg.214 CDS 202367 203209 2 + 843 Mobile element protein -none- D23_1c0219 Neut_1524
fig|6666666.60966.peg.215 CDS 203592 203461 −3 132 Phage Rha protein -none- D23_1c0220 NA
fig|6666666.60966.peg.216 CDS 203906 203571 −2 336 Mobile element protein -none- D23_1c0221 Neut_2450
fig|6666666.60966.peg.218 CDS 204442 204113 −1 330 hypothetical protein -none- D23_1c0222 Neut_2449
fig|6666666.60966.peg.219 CDS 205381 204746 −1 636 Cytochrome c4 Soluble cytochromes D23_1c0223 Neut_0305
and functionally related
electron carriers
fig|6666666.60966.peg.220 CDS 205494 206096 3 + 603 FIG00859469: -none- D23_1c0224 Neut_0306
hypothetical protein
fig|6666666.60966.peg.221 CDS 206204 207016 2 + 813 Methionine CBSS- D23_1c0225 Neut_0307
aminopeptidase (EC 312309.3.peg.1965;
3.4.11.18) <br>Translation
termination factors
bacterial
fig|6666666.60966.peg.222 CDS 207076 207840 1 + 765 Ribonuclease PH (EC Heat shock dnaK gene D23_1c0226 Neut_0308
2.7.7.56) cluster extended;
<br>tRNA processing
fig|6666666.60966.peg.223 CDS 207825 208439 3 + 615 Xanthosine/inosine CBSS-630.2.peg.3360; D23_1c0227 Neut_0309
triphosphate <br>Heat shock dnaK
pyrophosphatase; gene cluster extended
HAM1-like protein
fig|6666666.60966.peg.224 CDS 208474 209709 1 + 1236 Radical SAM family CBSS-630.2.peg.3360; D23_1c0228 Neut_0310
enzyme, similar to <br>Heat shock dnaK
coproporphyrinogen III gene cluster extended;
oxidase, oxygen- <br>Heme and Siroheme
independent, clustered Biosynthesis;
with nucleoside- <br>Queuosine-
triphosphatase RdgB Archaeosine
Biosynthesis
fig|6666666.60966.peg.225 CDS 209741 211540 2 + 1800 Multicopper oxidase Copper homeostasis D23_1c0229 Neut_0311
fig|6666666.60966.peg.226 CDS 211537 212352 1 + 816 Copper resistance Copper homeostasis D23_1c0230 Neut_0312
protein B
fig|6666666.60966.peg.227 CDS 213327 212398 −3 930 hypothetical protein -none- D23_1c0231 Neut_0313
fig|6666666.60966.peg.228 CDS 213918 213340 −3 579 LemA PROTEIN -none- D23_1c0232 Neut_1392
fig|6666666.60966.peg.229 CDS 214368 214553 3 + 186 Mobile element protein -none- D23_1c0233 Neut_2500
fig|6666666.60966.peg.230 CDS 214610 215206 2 + 597 Mobile element protein -none- D23_1c0234 Neut_1375
fig|6666666.60966.peg.231 CDS 215510 215623 2 + 114 hypothetical protein -none- D23_1c0235 NA
fig|6666666.60966.peg.232 CDS 215668 215847 1 + 180 hypothetical protein -none- D23_1c0236 Neut_0314
fig|6666666.60966.peg.233 CDS 217943 216069 −2 1875 Glutathione-regulated Glutathione-regulated D23_1c0237 Neut_0315
potassium-efflux system potassium-efflux system
ATP-binding protein and associated
functions;
<br>Potassium
homeostasis
fig|6666666.60966.peg.234 CDS 218233 219195 1 + 963 Mobile element protein -none- D23_1c0238 Neut_1862
fig|6666666.60966.peg.235 CDS 219960 219271 −3 690 InterPro IPR001687 -none- D23_1c0239 NA
fig|6666666.60966.peg.236 CDS 220560 222266 3 + 1707 Glutathione-regulated Glutathione-regulated D23_1c0241 Neut_0318
potassium-efflux system potassium-efflux system
protein KefB and associated functions
fig|6666666.60966.peg.237 CDS 222848 223903 2 + 1056 SAM-dependent -none- D23_1c0242 Neut_0320
methyltransferase
SCO3452 (UbiE paralog)
fig|6666666.60966.peg.238 CDS 223971 224243 3 + 273 Phosphate transport High affinity phosphate D23_1c0244 Neut_0321
system permease transporter and control
protein PstA (TC of PHO regulon;
3.A.1.7.1) <br>Phosphate
metabolism
fig|6666666.60966.peg.239 CDS 225095 224421 −2 675 tRNA (guanine46-N7-)- RNA methylation; D23_1c0245 Neut_0322
methyltransferase (EC <br>tRNA modification
2.1.1.33) Bacteria
fig|6666666.60966.peg.240 CDS 225934 225128 −1 807 Thiazole biosynthesis Thiamin biosynthesis D23_1c0246 Neut_0323
protein ThiG
fig|6666666.60966.peg.241 CDS 226194 225994 −3 201 Sulfur carrier protein Thiamin biosynthesis D23_1c0247 Neut_0324
ThiS
fig|6666666.60966.peg.242 CDS 226421 227008 2 + 588 FIG008443: CBSS-208964.1.peg.1768 D23_1c0249 Neut_0325
hypothetical protein
fig|6666666.60966.peg.243 CDS 227005 228537 1 + 1533 FIG139976: CBSS-208964.1.peg.1768 D23_1c0250 Neut_0326
hypothetical protein
fig|6666666.60966.peg.244 CDS 228587 229492 2 + 906 FIG002781: Alpha-L- CBSS-208964.1.peg.1768 D23_1c0251 Neut_0327
glutamate ligase family
protein
fig|6666666.60966.peg.245 CDS 231155 229677 −2 1479 Cardiolipin synthetase Cardiolipin synthesis; D23_1c0252 Neut_0328
(EC 2.7.8.—) <br>Glycerolipid and
Glycerophospholipid
Metabolism in Bacteria
fig|6666666.60966.peg.246 CDS 231229 231411 1 + 183 hypothetical protein -none- D23_1c0253 NA
fig|6666666.60966.peg.248 CDS 232352 231813 −2 540 Urea channel Urel Urea decomposition D23_1c0255 Neut_0329
fig|6666666.60966.peg.249 CDS 232767 232585 −3 183 hypothetical protein -none- D23_1c0256 NA
fig|6666666.60966.peg.251 CDS 233588 234748 2 + 1161 FIG00855934: -none- D23_1c0259 Neut_0331
hypothetical protein
fig|6666666.60966.peg.252 CDS 235271 234831 −2 441 Mobile element protein -none- D23_1c0260 Neut_0332
fig|6666666.60966.peg.253 CDS 235792 235397 −1 396 NAD-dependent Calvin-Benson cycle; D23_1c0261 Neut_0333
glyceraldehyde-3- <br>Glycolysis and
phosphate Gluconeogenesis;
dehydrogenase (EC <br>Pyridoxin (Vitamin
1.2.1.12) B6) Biosynthesis
fig|6666666.60966.peg.254 CDS 235832 236260 2 + 429 hypothetical protein -none- D23_1c0261 Neut_0333
fig|6666666.60966.peg.255 CDS 237167 236592 −2 576 Flagellar basal-body P- Flagellum D23_1c0262 Neut_0334
ring formation protein
FlgA
fig|6666666.60966.peg.256 CDS 237299 237415 2 + 117 hypothetical protein -none- D23_1c0264 NA
fig|6666666.60966.peg.257 CDS 237436 237924 1 + 489 Flagellar basal-body rod Flagellum; <br>Flagellum D23_1c0265 Neut_0335
protein FlgB in Campylobacter
fig|6666666.60966.peg.258 CDS 237930 238334 3 + 405 Flagellar basal-body rod Flagellum; <br>Flagellum D23_1c0266 Neut_0336
protein FlgC in Campylobacter
fig|6666666.60966.peg.259 CDS 238347 239021 3 + 675 Flagellar basal-body rod Flagellar motility; D23_1c0267 Neut_0337
modification protein <br>Flagellum
FlgD
fig|6666666.60966.peg.260 CDS 239037 240296 3 + 1260 Flagellar hook protein Flagellum D23_1c0268 Neut_0338
FlgE
fig|6666666.60966.peg.261 CDS 240337 241080 1 + 744 Flagellar basal-body rod Flagellum D23_1c0269 Neut_0339
protein FlgF
fig|6666666.60966.peg.262 CDS 241119 241901 3 + 783 Flagellar basal-body rod Flagellum D23_1c0270 Neut_0340
protein FlgG
fig|6666666.60966.peg.263 CDS 242034 242828 3 + 795 Flagellar L-ring protein Flagellar motility; D23_1c0271 Neut_0341
FlgH <br>Flagellum
fig|6666666.60966.peg.264 CDS 242850 243977 3 + 1128 Flagellar P-ring protein Flagellum D23_1c0272 Neut_0342
FlgI
fig|6666666.60966.peg.265 CDS 243991 244998 1 + 1008 Flagellar protein FlgJ Flagellum D23_1c0273 Neut_0343
[peptidoglycan
hydrolase] (EC 3.2.1.—)
fig|6666666.60966.peg.266 CDS 245257 246660 1 + 1404 Flagellar hook- Flagellum D23_1c0274 Neut_0344
associated protein FlgK
fig|6666666.60966.peg.267 CDS 246638 247588 2 + 951 Flagellar hook- Flagellum D23_1c0275 Neut_0345
associated protein FlgL
fig|6666666.60966.peg.268 CDS 247665 248210 3 + 546 FIG00859049: -none- D23_1c0276 Neut_0346
hypothetical protein
fig|6666666.60966.peg.269 CDS 249330 248200 −3 1131 FIG00859091: -none- D23_1c0277 Neut_0347
hypothetical protein
fig|6666666.60966.peg.270 CDS 249439 249960 1 + 522 FIG00859511: -none- D23_1c0278 Neut_0348
hypothetical protein
fig|6666666.60966.peg.271 CDS 249932 250513 2 + 582 GCN5-related N- -none- D23_1c0279 Neut_0349
acetyltransferase
fig|6666666.60966.peg.272 CDS 250589 250861 2 + 273 FIG001341: Probable Heat shock dnaK gene D23_1c0280 Neut_0350
Fe(2+)-trafficking cluster extended
protein YggX
fig|6666666.60966.peg.273 CDS 250912 253038 1 + 2127 Polyphosphate kinase High affinity phosphate D23_1c0281 Neut_0351
(EC 2.7.4.1) transporter and control
of PHO regulon;
<br>Phosphate
metabolism;
<br>Polyphosphate;
<br>Purine conversions
fig|6666666.60966.peg.274 CDS 254786 253059 −2 1728 Sulfate permease Cysteine Biosynthesis D23_1c0282 Neut_0352
fig|6666666.60966.peg.275 CDS 255133 254783 −1 351 Transcriptional -none- D23_1c0283 Neut_0353
regulator, ArsR family
fig|6666666.60966.peg.277 CDS 256153 255827 −1 327 hypothetical protein -none- D23_1c0285 Neut_0355
fig|6666666.60966.peg.278 CDS 256608 257603 3 + 996 hypothetical protein -none- D23_1c0286 Neut_0356
fig|6666666.60966.peg.279 CDS 258986 257739 −2 1248 Mobile element protein -none- D23_1c0287 Neut_0357
fig|6666666.60966.peg.280 CDS 259004 259126 2 + 123 patatin family protein -none- D23_1c0288 Neut_1317
fig|6666666.60966.peg.281 CDS 259254 259123 −3 132 cAMP-binding proteins- cAMP signaling in D23_1c0289 NA
catabolite gene bacteria
activator and regulatory
subunit of cAMP-
dependent protein
kinases
fig|6666666.60966.peg.282 CDS 259543 260031 1 + 489 Cytochrome c&#39; -none- D23_1c0291 NA
fig|6666666.60966.peg.283 CDS 260060 260947 2 + 888 Putative diheme Soluble cytochromes D23_1c0292 Neut_1381
cytochrome c-553 and functionally related
electron carriers
fig|6666666.60966.peg.285 CDS 261917 261708 −2 210 hypothetical protein -none- D23_1c0294 Neut_0363
fig|6666666.60966.peg.288 CDS 262640 262440 −2 201 Mobile element protein -none- D23_1c0296 Neut_1696
fig|6666666.60966.peg.289 CDS 263106 264041 3 + 936 hypothetical protein -none- D23_1c0297 NA
fig|6666666.60966.peg.290 CDS 264137 265633 2 + 1497 SII1503 protein -none- D23_1c0298 NA
fig|6666666.60966.peg.294 CDS 266897 266760 −2 138 hypothetical protein -none- D23_1c0300 NA
fig|6666666.60966.peg.295 CDS 267026 267370 2 + 345 COGs COG3339 -none- D23_1c0301 Neut_0371
fig|6666666.60966.peg.297 CDS 268862 267765 −2 1098 L-lactate Lactate utilization; D23_1c0302 Neut_0372
dehydrogenase (EC <br>Respiratory
1.1.2.3) dehydrogenases 1
fig|6666666.60966.peg.298 CDS 269655 268972 −3 684 Iron-uptake factor PiuC -none- D23_1c0303 Neut_0373
fig|6666666.60966.peg.299 CDS 271893 269683 −3 2211 TonB-dependent Ton and Tol transport D23_1c0304 Neut_0374
siderophore receptor systems
fig|6666666.60966.peg.301 CDS 272682 273740 3 + 1059 protein of unknown -none- D23_1c0306 Neut_0377
function DUF81
fig|6666666.60966.peg.302 CDS 273758 274108 2 + 351 hypothetical protein -none- D23_1c0307 NA
fig|6666666.60966.peg.303 CDS 274775 274182 −2 594 InterPro IPR001226 -none- D23_1c0308 Neut_0379
COGs COG0790
fig|6666666.60966.peg.304 CDS 274944 274792 −3 153 hypothetical protein -none- D23_1c0309 NA
fig|6666666.60966.peg.305 CDS 276110 274986 −2 1125 dNTP Purine conversions; D23_1c0310 Neut_0380
triphosphohydrolase, <br>dNTP
broad substrate triphosphohydrolase
specificity, subgroup 2 protein family
fig|6666666.60966.peg.306 CDS 277212 276103 −3 1110 3-dehydroquinate Chorismate Synthesis; D23_1c0311 Neut_0381
synthase (EC 4.2.3.4) <br>Common Pathway
For Synthesis of
Aromatic Compounds
(DAHP synthase to
chorismate)
fig|6666666.60966.peg.308 CDS 277726 277896 1 + 171 hypothetical protein -none- D23_1c0312 Neut_0382
fig|6666666.60966.peg.307 CDS 277692 277261 −3 432 Shikimate kinase I (EC Chorismate Synthesis; D23_1c0312 Neut_0382
2.7.1.71) <br>Common Pathway
For Synthesis of
Aromatic Compounds
(DAHP synthase to
chorismate)
fig|6666666.60966.peg.309 CDS 279343 277982 −1 1362 Putative protease -none- D23_1c0313 Neut_0383
fig|6666666.60966.peg.310 CDS 279362 282934 2 + 3573 DNA polymerase III Phage replication D23_1c0314 Neut_0384
alpha subunit (EC
2.7.7.7)
fig|6666666.60966.peg.311 CDS 283139 282948 −2 192 putative -none- D23_1c0315 Neut_0385
transmembrane protein
fig|6666666.60966.peg.312 CDS 283290 284243 3 + 954 tRNA tRNA modification D23_1c0316 Neut_0386
dimethylallyltransferase Bacteria; <br>tRNA
(EC 2.5.1.75) processing
fig|6666666.60966.peg.313 CDS 284258 284401 2 + 144 hypothetical protein -none- D23_1c0317 NA
fig|6666666.60966.peg.314 CDS 286041 284776 −3 1266 Two component, -none- D23_1c0320 Neut_0387
sigma54 specific,
transcriptional
regulator, Fis family
fig|6666666.60966.peg.315 CDS 286328 286191 −2 138 hypothetical protein -none- D23_1c0321 NA
fig|6666666.60966.peg.316 CDS 288462 286330 −3 2133 Nitrogen regulation Possible RNA D23_1c0322 Neut_0388
protein NtrY (EC 2.7.3.—) degradation cluster
fig|6666666.60966.peg.317 CDS 289077 288514 −3 564 Probable proline rich -none- D23_1c0323 Neut_0389
signal peptide protein
fig|6666666.60966.peg.318 CDS 290401 289121 −1 1281 16S rRNA RNA methylation D23_1c0324 Neut_0390
(cytosine(967)-C(5))-
methyltransferase (EC
2.1.1.176) ## SSU rRNA
m5C967
fig|6666666.60966.peg.319 CDS 291388 290414 −1 975 Methionyl-tRNA Translation initiation D23_1c0325 Neut_0391
formyltransferase (EC factors bacterial
2.1.2.9)
fig|6666666.60966.peg.320 CDS 291933 291427 −3 507 Peptide deformylase Bacterial RNA- D23_1c0326 Neut_0392
(EC 3.5.1.88) metabolizing Zn-
dependent hydrolases;
<br>Translation
termination factors
bacterial
fig|6666666.60966.peg.321 CDS 292108 293136 1 + 1029 Uncharacterized protein -none- D23_1c0327 Neut_0393
with LysM domain,
COG1652
fig|6666666.60966.peg.322 CDS 293235 294356 3 + 1122 Rossmann fold -none- D23_1c0328 Neut_0394
nucleotide-binding
protein Smf possibly
involved in DNA uptake
fig|6666666.60966.peg.323 CDS 294438 294896 3 + 459 Protein of unknown -none- D23_1c0329 Neut_0395
function Smg
fig|6666666.60966.peg.324 CDS 295024 297522 1 + 2499 DNA topoisomerase III, DNA topoisomerases, D23_1c0330 Neut_0396
Burkholderia type (EC Type I, ATP-independent
5.99.1.2)
fig|6666666.60966.peg.325 CDS 297826 297575 −1 252 FIG00858730: -none- D23_1c0331 Neut_0397
hypothetical protein
fig|6666666.60966.peg.326 CDS 298176 299477 3 + 1302 5-Enolpyruvylshikimate- Chorismate Synthesis; D23_1c0333 Neut_0398
3-phosphate synthase <br>Common Pathway
(EC 2.5.1.19) For Synthesis of
Aromatic Compounds
(DAHP synthase to
chorismate)
fig|6666666.60966.peg.327 CDS 299557 300228 1 + 672 Cytidylate kinase (EC -none- D23_1c0335 Neut_0399
2.7.4.14)
fig|6666666.60966.peg.328 CDS 300339 302051 3 + 1713 SSU ribosomal protein -none- D23_1c0336 Neut_0400
S1p
fig|6666666.60966.peg.329 CDS 302061 302378 3 + 318 Integration host factor DNA structural proteins, D23_1c0337 Neut_0401
beta subunit bacterial
fig|6666666.60966.peg.330 CDS 302493 302368 −3 126 hypothetical protein -none- D23_1c0338 NA
fig|6666666.60966.peg.33 1 CDS 302902 303597 1 + 696 Orotidine 5&#39;- De Novo Pyrimidine D23_1c0339 Neut_0402
phosphate Synthesis; <br>Riboflavin
decarboxylase (EC synthesis cluster
4.1.1.23)
fig|6666666.60966.peg.332 CDS 304632 303592 −3 1041 Squalene synthase (EC Hopanes D23_1c0340 Neut_0403
2.5.1.21)
fig|6666666.60966.peg.333 CDS 305907 304654 −3 1254 Diaminopimelate Lysine Biosynthesis DAP D23_1c0341 Neut_0404
decarboxylase (EC Pathway, GJO scratch
4.1.1.20)
fig|6666666.60966.peg.334 CDS 306026 305904 −2 123 hypothetical protein -none- D23_1c0342 NA
fig|6666666.60966.peg.335 CDS 306654 306052 −3 603 Probable lipoprotein -none- D23_1c0343 Neut_0405
fig|6666666.60966.peg.336 CDS 307556 306651 −2 906 ABC-type transport -none- D23_1c0344 Neut_0406
system involved in
resistance to organic
solvents, periplasmic
component
fig|6666666.60966.peg.337 CDS 308341 307583 −1 759 Inositol-1- -none- D23_1c0345 Neut_0407
monophosphatase (EC
3.1.3.25)
fig|6666666.60966.peg.339 CDS 308500 309207 1 + 708 tRNA:Cm32/Um32 RNA methylation; D23_1c0346 Neut_0408
methyltransferase <br>tRNA modification
Bacteria
fig|6666666.60966.peg.340 CDS 309905 309291 −2 615 Glutathione S- Glutathione: Non-redox D23_1c0347 Neut_0409
transferase family reactions; <br>Scaffold
protein proteins for [4Fe-4S]
cluster assembly (MRP
family)
fig|6666666.60966.peg.341 CDS 310042 311418 1 + 1377 Adenylosuccinate lyase De Novo Purine D23_1c0348 Neut_0410
(EC 4.3.2.2) Biosynthesis; <br>Purine
conversions
fig|6666666.60966.peg.342 CDS 311556 312146 3 + 591 Heat shock protein GroEL GroES; <br>Heat D23_1c0349 Neut_0411
GrpE shock dnaK gene cluster
extended; <br>Protein
chaperones
fig|6666666.60966.peg.343 CDS 312210 314153 3 + 1944 Chaperone protein GroEL GroES; <br>Heat D23_1c0350 Neut_0412
DnaK shock dnaK gene cluster
extended; <br>Protein
chaperones
fig|6666666.60966.peg.344 CDS 314344 315453 1 + 1110 Chaperone protein DnaJ GroEL GroES; <br>Heat D23_1c0351 Neut_0413
shock dnaK gene cluster
extended; <br>Protein
chaperones
fig|6666666.60966.peg.345 CDS 318894 315550 −3 3345 Potassium efflux system Potassium homeostasis D23_1c0352 Neut_0414
KefA protein/Small-
conductance
mechanosensitive
channel
fig|6666666.60966.peg.346 CDS 319923 319357 −3 567 Transcriptional -none- D23_1c0353 Neut_0415
regulator, TetR family
fig|6666666.60966.peg.347 CDS 321174 319990 −3 1185 InterPro IPR001327 -none- D23_1c0354 Neut_0416
COGs COG2072
fig|6666666.60966.peg.348 CDS 321778 321236 −1 543 hypothetical protein -none- D23_1c0355 Neut_0417
fig|6666666.60966.peg.349 CDS 322196 322363 2 + 168 hypothetical protein -none- D23_1c0356 NA
fig|6666666.60966.peg.350 CDS 325140 322522 −3 2619 Membrane alanine Aminopeptidases (EC D23_1c0357 Neut_0418
aminopeptidase N (EC 3.4.11.—)
3.4.11.2)
fig|6666666.60966.peg.351 CDS 325139 325255 2 + 117 hypothetical protein -none- D23_1c0358 NA
fig|6666666.60966.peg.352 CDS 326547 325213 −3 1335 Peptide methionine Peptide methionine D23_1c0359 Neut_0419
sulfoxide reductase sulfoxide reductase;
MsrA (EC 1.8.4.11)/ <br>Peptide methionine
Thiol:disulfide sulfoxide reductase;
oxidoreductase <br>Peptide methionine
associated with MetSO sulfoxide reductase
reductase/Peptide
Methionine sulfoxide
reductase MsrB (EC
1.8.4.12)
fig|6666666.60966.peg.354 CDS 326909 329791 2 + 2883 Diguanylate -none- D23_1c0360 Neut_0422
cyclase/phosphodiesterase
domain 2 (EAL)
fig|6666666.60966.peg.355 CDS 331130 329874 −2 1257 FIG00858721: -none- D23_1c0361 Neut_0423
hypothetical protein
fig|6666666.60966.peg.356 CDS 331369 332730 1 + 1362 O-acetylhomoserine Methionine D23_1c0363 Neut_0424
sulfhydrylase (EC Biosynthesis;
2.5.1.49)/O- <br>Methionine
succinylhomoserine Biosynthesis
sulfhydrylase (EC
2.5.1.48)
fig|6666666.60966.peg.357 CDS 334115 332718 −2 1398 NnrS protein involved in Denitrification; D23_1c0364 Neut_0425
response to NO <br>Nitrosative stress;
<br>Oxidative stress
fig|6666666.60966.peg.358 CDS 334992 334066 −3 927 Serine acetyltransferase Cysteine Biosynthesis; D23_1c0365 Neut_0426
(EC 2.3.1.30) <br>Methionine
Biosynthesis
fig|6666666.60966.peg.360 CDS 335392 336399 1 + 1008 Glucokinase (EC 2.7.1.2) Glycolysis and D23_1c0367 Neut_0427
Gluconeogenesis
fig|6666666.60966.peg.361 CDS 336414 337073 3 + 660 Probable -none- D23_1c0368 Neut_0428
transmembrane protein
fig|6666666.60966.peg.362 CDS 337412 337101 −2 312 FIG00858769: -none- D23_1c0369 Neut_0429
hypothetical protein
fig|6666666.60966.peg.363 CDS 338169 337483 −3 687 6- Pentose phosphate D23_1c0370 Neut_0430
phosphogluconolactonase pathway
(EC 3.1.1.31),
eukaryotic type
fig|6666666.60966.peg.364 CDS 338807 338151 −2 657 hydrolase, haloacid -none- D23_1c0371 Neut_0431
dehalogenase-like
family
fig|6666666.60966.peg.365 CDS 339746 338814 −2 933 NAD-dependent CBSS-296591.1.peg.2330 D23_1c0372 Neut_0432
epimerase/dehydratase
fig|6666666.60966.peg.366 CDS 340674 339739 −3 936 D-3-phosphoglycerate Glycine and Serine D23_1c0373 Neut_0433
dehydrogenase (EC Utilization;
1.1.1.95) <br>Pyridoxin (Vitamin
B6) Biosynthesis;
<br>Serine Biosynthesis
fig|6666666.60966.peg.367 CDS 341432 340671 −2 762 2,4-dihydroxyhept-2- -none- D23_1c0374 Neut_0434
ene-1,7-dioic acid
aldolase (EC 4.1.2.—)
fig|6666666.60966.peg.368 CDS 342202 341444 −1 759 3-deoxy-manno- KDO2-Lipid A D23_1c0375 Neut_0435
octulosonate biosynthesis cluster 2
cytidylyltransferase (EC
2.7.7.38)
fig|6666666.60966.peg.370 CDS 342384 342509 3 + 126 hypothetical protein -none- D23_1c0376 NA
fig|6666666.60966.peg.371 CDS 342506 343585 2 + 1080 Glycosyl transferase, -none- D23_1c0377 Neut_0436
group 2 family protein
fig|6666666.60966.peg.372 CDS 343660 344931 1 + 1272 O-antigen ligase -none- D23_1c0378 Neut_0437
fig|6666666.60966.peg.373 CDS 344931 345620 3 + 690 O-methyltransferase -none- D23_1c0379 Neut_0438
family protein [C1]
fig|6666666.60966.peg.374 CDS 345673 345930 1 + 258 FIG00859064: -none- D23_1c0380 Neut_0439
hypothetical protein
fig|6666666.60966.peg.375 CDS 345980 346498 2 + 519 Mlr4354 like protein -none- D23_1c0381 Neut_0440
fig|6666666.60966.peg.376 CDS 346511 346858 2 + 348 Arsenate reductase (EC Anaerobic respiratory D23_1c0382 Neut_0441
1.20.4.1) reductases;
<br>Transcription repair
cluster
fig|6666666.60966.peg.377 CDS 347305 346916 −1 390 LSU ribosomal protein -none- D23_1c0383 Neut_0442
L19p
fig|6666666.60966.peg.378 CDS 348122 347277 −2 846 tRNA (Guanine37-N1)- RNA methylation; D23_1c0384 Neut_0443
methyltransferase (EC <br>Ribosome
2.1.1.31) biogenesis bacterial;
<br>tRNA modification
Bacteria
fig|6666666.60966.peg.379 CDS 348636 348130 −3 507 16S rRNA processing Ribosome biogenesis D23_1c0385 Neut_0444
protein RimM bacterial
fig|6666666.60966.peg.381 CDS 349157 350437 2 + 1281 Glycolate Glycolate, glyoxylate D23_1c0386 Neut_0446
dehydrogenase (EC interconversions;
1.1.99.14), iron-sulfur <br>Photorespiration
subunit GlcF (oxidative C2 cycle)
fig|6666666.60966.peg.382 CDS 350492 351118 2 + 627 Uncharacterized Ubiquinone Biosynthesis- D23_1c0387 Neut_0447
hydroxylase PA0655 gjo
fig|6666666.60966.peg.383 CDS 351152 351712 2 + 561 UPF0301 protein YqgE -none- D23_1c0388 Neut_0448
fig|6666666.60966.peg.384 CDS 351705 352178 3 + 474 Putative Holliday -none- D23_1c0389 Neut_0449
junction resolvase (EC
3.1.—.—)
fig|6666666.60966.peg.385 CDS 352165 352668 1 + 504 Uracil De Novo Pyrimidine D23_1c0390 Neut_0450
phosphoribosyltransferase Synthesis; <br>De Novo
(EC 2.4.2.9)/ Pyrimidine Synthesis;
Pyrimidine operon <br>pyrimidine
regulatory protein PyrR conversions
fig|6666666.60966.peg.386 CDS 352856 353806 2 + 951 Aspartate De Novo Pyrimidine D23_1c0391 Neut_0451
carbamoyltransferase Synthesis
(EC 2.1.3.2)
fig|6666666.60966.peg.387 CDS 353822 355093 2 + 1272 Dihydroorotase (EC De Novo Pyrimidine D23_1c0392 Neut_0452
3.5.2.3) Synthesis; <br>Zinc
regulated enzymes
fig|6666666.60966.peg.388 CDS 355217 357322 2 + 2106 Oligopeptidase A (EC Protein degradation D23_1c0393 Neut_0453
3.4.24.70)
fig|6666666.60966.peg.389 CDS 357558 358709 3 + 1152 Carbamoyl-phosphate De Novo Pyrimidine D23_1c0394 Neut_0454
synthase small chain Synthesis;
(EC 6.3.5.5) <br>Macromolecular
synthesis operon
fig|6666666.60966.peg.390 CDS 358735 361932 1 + 3198 Carbamoyl-phosphate De Novo Pyrimidine D23_1c0395 Neut_0455
synthase large chain (EC Synthesis;
6.3.5.5) <br>Macromolecular
synthesis operon
fig|6666666.60966.peg.391 CDS 362117 362593 2 + 477 Transcription Transcription factors D23_1c0396 Neut_0456
elongation factor GreA bacterial
fig|6666666.60966.peg.392 CDS 363579 362608 −3 972 ErfK/YbiS/YcfS/YnhG -none- D23_1c0397 Neut_0457
family protein
fig|6666666.60966.peg.393 CDS 364226 366052 2 + 1827 Long-chain-fatty-acid-- Biotin biosynthesis; D23_1c0398 Neut_0458
CoA ligase (EC 6.2.1.3) <br>Biotin synthesis
cluster; <br>Fatty acid
metabolism cluster
fig|6666666.60966.peg.394 CDS 366141 367064 3 + 924 FIG010773: NAD- -none- D23_1c0399 Neut_0459
dependent
epimerase/dehydratase
fig|6666666.60966.peg.395 CDS 367176 367430 3 + 255 phosphopantetheine- -none- D23_1c0400 Neut_0460
binding
fig|6666666.60966.peg.396 CDS 367430 368617 2 + 1188 Aminotransferase class -none- D23_1c0401 Neut_0461
II, serine
palmitoyltransferase
like (EC 2.3.1.50)
fig|6666666.60966.peg.397 CDS 368669 369427 2 + 759 COG1496: -none- D23_1c0402 Neut_0462
Uncharacterized
conserved protein
fig|6666666.60966.peg.398 CDS 369615 370427 3 + 813 Zinc transporter, ZIP -none- D23_1c0403 Neut_0463
family
fig|6666666.60966.peg.399 CDS 373049 370434 −2 2616 Dolichyl-phosphate -none- D23_1c0404 Neut_0464
beta-D-
mannosyltransferase
(EC: 2.4.1.83)
fig|6666666.60966.peg.400 CDS 374173 373157 −1 1017 FIG004453: protein CBSS- D23_1c0405 Neut_0465
YceG like 323097.3.peg.2594;
<br>Cluster containing
Alanyl-tRNA synthetase;
<br>tRNA modification
Bacteria
fig|6666666.60966.peg.401 CDS 374277 374140 −3 138 hypothetical protein -none- D23_1c0406 NA
fig|6666666.60966.peg.402 CDS 375542 374301 −2 1242 3-oxoacyl-[acyl-carrier- Fatty Acid Biosynthesis D23_1c0407 Neut_0466
protein] synthase, KASII FASII
(EC 2.3.1.41)
fig|6666666.60966.peg.403 CDS 375822 375577 −3 246 Acyl carrier protein Fatty Acid Biosynthesis D23_1c0408 Neut_0467
FASII; <br>Glycerolipid
and Glycerophospholipid
Metabolism in Bacteria
fig|6666666.60966.peg.405 CDS 376731 375988 −3 744 3-oxoacyl-[acyl-carrier Fatty Acid Biosynthesis D23_1c0409 Neut_0468
protein] reductase (EC FASII
1.1.1.100)
fig|6666666.60966.peg.406 CDS 377726 376788 −2 939 Malonyl CoA-acyl Fatty Acid Biosynthesis D23_1c0410 Neut_0469
carrier protein FASII
transacylase (EC
2.3.1.39)
fig|6666666.60966.peg.407 CDS 378692 377730 −2 963 3-oxoacyl-[acyl-carrier- Fatty Acid Biosynthesis D23_1c0411 Neut_0470
protein] synthase, FASII
KASIII (EC 2.3.1.41)
fig|6666666.60966.peg.408 CDS 379722 378703 −3 1020 Phosphate:acyl-ACP Glycerolipid and D23_1c0412 Neut_0471
acyltransferase PlsX Glycerophospholipid
Metabolism in Bacteria
fig|6666666.60966.peg.409 CDS 379982 379800 −2 183 LSU ribosomal protein -none- D23_1c0414 Neut_0472
L32p
fig|6666666.60966.peg.410 CDS 380510 380007 −2 504 COG1399 protein, -none- D23_1c0415 Neut_0473
clustered with
ribosomal protein L32p
fig|6666666.60966.peg.411 CDS 380534 381175 2 + 642 FIG146278: -none- D23_1c0416 Neut_0474
Maf/YceF/YhdE family
protein
fig|6666666.60966.peg.412 CDS 381292 381684 1 + 393 FIG00858587: -none- D23_1c0417 Neut_0475
hypothetical protein
fig|6666666.60966.peg.413 CDS 381793 383217 1 + 1425 Heavy metal RND efflux Cobalt-zinc-cadmium D23_1c0418 Neut_0476
outer membrane resistance
protein, CzcC family
fig|6666666.60966.peg.414 CDS 383214 384710 3 + 1497 Cobalt/zinc/cadmium Cobalt-zinc-cadmium D23_1c0419 Neut_0477
efflux RND transporter, resistance
membrane fusion
protein, CzcB family
fig|6666666.60966.peg.415 CDS 384811 388020 1 + 3210 Cobalt-zinc-cadmium Cobalt-zinc-cadmium D23_1c0421 Neut_0478
resistance protein CzcA; resistance; <br>Cobalt-
Cation efflux system zinc-cadmium resistance
protein CusA
fig|6666666.60966.peg.416 CDS 388294 388731 1 + 438 FIG00858457: -none- D23_1c0423 Neut_0479
hypothetical protein
fig|6666666.60966.peg.417 CDS 388756 389043 1 + 288 FIG00858508: -none- D23_1c0424 Neut_0480
hypothetical protein
fig|6666666.60966.peg.418 CDS 389040 389948 3 + 909 FIG00858931: -none- D23_1c0425 Neut_0481
hypothetical protein
fig|6666666.60966.peg.419 CDS 389941 391068 1 + 1128 hypothetical protein -none- D23_1c0426 Neut_0482
fig|6666666.60966.peg.420 CDS 392521 391079 −1 1443 Mg/Co/Ni transporter Magnesium transport D23_1c0427 Neut_0483
MgtE/CBS domain
fig|6666666.60966.peg.424 CDS 394723 393761 −1 963 Mobile element protein -none- D23_1c0430 Neut_1746
fig|6666666.60966.peg.425 CDS 394947 394834 −3 114 hypothetical protein -none- D23_1c0431 NA
fig|6666666.60966.peg.426 CDS 394946 395251 2 + 306 hypothetical protein -none- D23_1c0432 Neut_0486
fig|6666666.60966.peg.427 CDS 395968 395309 −1 660 COG1272: Predicted -none- D23_1c0433 Neut_0487
membrane protein
hemolysin III homolog
fig|6666666.60966.peg.428 CDS 396481 396179 −1 303 hypothetical protein -none- D23_1c0434 Neut_0488
fig|6666666.60966.peg.430 CDS 397189 396863 −1 327 hypothetical protein -none- D23_1c0435 Neut_0490
fig|6666666.60966.peg.433 CDS 397653 398393 3 + 741 cAMP-binding proteins- cAMP signaling in D23_1c0436 Neut_0491
catabolite gene bacteria
activator and regulatory
subunit of cAMP-
dependent protein
kinases
fig|6666666.60966.peg.434 CDS 398690 398424 −2 267 Putative lipoprotein -none- D23_1c0437 Neut_0492
fig|6666666.60966.peg.435 CDS 399146 398973 −2 174 hypothetical protein -none- D23_1c0438 NA
fig|6666666.60966.peg.436 CDS 399498 399373 −3 126 hypothetical protein -none- D23_1c0439 NA
fig|6666666.60966.peg.437 CDS 400841 399609 −2 1233 hypothetical protein -none- D23_1c0440 Neut_0494
fig|6666666.60966.peg.438 CDS 401592 400858 −3 735 Monofunctional Peptidoglycan D23_1c0441 Neut_0495
biosynthetic Biosynthesis
peptidoglycan
transglycosylase (EC
2.4.2.—)
fig|6666666.60966.peg.439 CDS 402422 401589 −2 834 Shikimate 5- Chorismate Synthesis; D23_1c0442 Neut_0496
dehydrogenase I alpha <br>Cluster containing
(EC 1.1.1.25) Alanyl-tRNA synthetase;
<br>Common Pathway
For Synthesis of
Aromatic Compounds
(DAHP synthase to
chorismate)
fig|6666666.60966.peg.440 CDS 403340 402456 −2 885 TonB protein -none- D23_1c0443 Neut_0497
fig|6666666.60966.peg.441 CDS 405237 403378 −3 1860 Exoribonuclease II (EC RNA processing and D23_1c0444 Neut_0498
3.1.13.1) degradation, bacterial
fig|6666666.60966.peg.443 CDS 405594 406985 3 + 1392 Glutamyl-tRNA Heme and Siroheme D23_1c0445 Neut_0499
synthetase (EC 6.1.1.17) Biosynthesis; <br>tRNA
aminoacylation, Glu and
Gln
fig|6666666.60966.peg.444 CDS 407045 410752 2 + 3708 5- Methionine Biosynthesis D23_1c0446 Neut_0500
methyltetrahydrofolate--
homocysteine
methyltransferase (EC
2.1.1.13)
fig|6666666.60966.peg.445 CDS 410924 412267 2 + 1344 NADP-specific Arginine and Ornithine D23_1c0447 Neut_0501
glutamate Degradation;
dehydrogenase (EC <br>Glutamate
1.4.1.4) dehydrogenases;
<br>Glutamine,
Glutamate, Aspartate
and Asparagine
Biosynthesis;
<br>Proline Synthesis
fig|6666666.60966.peg.446 CDS 412461 414368 3 + 1908 Soluble lytic murein Murein Hydrolases D23_1c0449 Neut_0502
transglycosylase
precursor (EC 3.2.1.—)
fig|6666666.60966.peg.447 CDS 414379 415617 1 + 1239 tRNA A cluster relating to D23_1c0450 Neut_0503
nucleotidyltransferase Tryptophanyl-tRNA
(EC 2.7.7.21) (EC synthetase;
2.7.7.25) <br>Polyadenylation
bacterial; <br>tRNA
nucleotidyltransferase
fig|6666666.60966.peg.448 CDS 417316 415592 −1 1725 Phospholipid- N-linked Glycosylation in D23_1c0451 Neut_0504
lipopolysaccharide ABC Bacteria
transporter
fig|6666666.60966.peg.449 CDS 418171 417335 −1 837 Diaminopimelate CBSS-84588.1.peg.1247; D23_1c0452 Neut_0505
epimerase (EC 5.1.1.7) <br>Lysine Biosynthesis
DAP Pathway, GJO
scratch
fig|6666666.60966.peg.450 CDS 418345 418193 −1 153 hypothetical protein -none- D23_1c0453 NA
fig|6666666.60966.peg.451 CDS 418574 419011 2 + 438 Predicted secretion Predicted secretion D23_1c0454 Neut_0506
system X protein GspG- system X
like 3
fig|6666666.60966.peg.452 CDS 419030 420214 2 + 1185 Predicted secretion Predicted secretion D23_1c0455 Neut_0507
system X protein GspF- system X
like
fig|6666666.60966.peg.453 CDS 420211 421905 1 + 1695 Predicted secretion Predicted secretion D23_1c0456 Neut_0508
system X protein GspE- system X
like
fig|6666666.60966.peg.454 CDS 421910 422731 2 + 822 Predicted secretion Predicted secretion D23_1c0457 Neut_0509
system X FIG084745: system X
hypothetical protein
fig|6666666.60966.peg.455 CDS 422772 423260 3 + 489 Predicted secretion Predicted secretion D23_1c0458 Neut_0510
system X system X
transmembrane protein 1
fig|6666666.60966.peg.472 CDS 440367 440753 3 + 387 Mobile element protein -none- D23_1c0476 Neut_0884
fig|6666666.60966.peg.473 CDS 440716 441171 1 + 456 Mobile element protein -none- D23_1c0477 Neut_2502
fig|6666666.60966.peg.474 CDS 441829 441158 −1 672 Gluconate 2- D-gluconate and D23_1c0478 NA
dehydrogenase (EC ketogluconates
1.1.99.3), membrane- metabolism
bound, gamma subunit
fig|6666666.60966.peg.475 CDS 444093 441973 −3 2121 diguanylate -none- D23_1c0479 Neut_0525
cyclase/phosphodiesterase
(GGDEF & EAL
domains) with PAS/PAC
sensor(s)
fig|6666666.60966.peg.476 CDS 444457 444311 −1 147 hypothetical protein -none- D23_1c0480 NA
fig|6666666.60966.peg.478 CDS 444629 445810 2 + 1182 NAD(FAD)-utilizing -none- D23_1c0481 Neut_0526
dehydrogenases
fig|6666666.60966.peg.479 CDS 446569 445952 −1 618 Methionine -none- D23_1c0482 Neut_0527
biosynthesis protein
MetW
fig|6666666.60966.peg.480 CDS 447733 446600 −1 1134 Homoserine O- Methionine Biosynthesis D23_1c0483 Neut_0528
acetyltransferase (EC
2.3.1.31)
fig|6666666.60966.peg.481 CDS 449559 447832 −3 1728 Phosphoenolpyruvate- -none- D23_1c0484 Neut_0529
protein
phosphotransferase of
PTS system (EC 2.7.3.9)
fig|6666666.60966.peg.482 CDS 449825 449556 −2 270 Phosphocarrier protein, -none- D23_1c0485 Neut_0530
nitrogen regulation
associated
fig|6666666.60966.peg.483 CDS 450219 449815 −3 405 Sugar transport PTS -none- D23_1c0486 Neut_0531
system IIa component
fig|6666666.60966.peg.484 CDS 450568 451605 1 + 1038 Phosphatidylglycerophosphatase Glycerolipid and D23_1c0488 Neut_0532
B (EC 3.1.3.27) Glycerophospholipid
Metabolism in Bacteria
fig|6666666.60966.peg.485 CDS 451971 451705 −3 267 HrgA protein -none- D23_1c0489 Neut_2454
fig|6666666.60966.peg.486 CDS 452384 453631 2 + 1248 Mobile element protein -none- D23_1c0490 Neut_0357
fig|6666666.60966.peg.487 CDS 455203 454049 −1 1155 hypothetical protein -none- D23_1c0491 NA
fig|6666666.60966.peg.488 CDS 455538 455371 −3 168 hypothetical protein -none- D23_1c0492 NA
fig|6666666.60966.peg.489 CDS 455581 456603 1 + 1023 Lipolytic enzyme, G-D-S-L -none- D23_1c0493 Neut_0534
fig|6666666.60966.peg.490 CDS 457214 456669 −2 546 N-acetylmuramoyl-L- Recycling of D23_1c0494 Neut_0535
alanine amidase (EC Peptidoglycan Amino
3.5.1.28) AmpD Acids
fig|6666666.60966.peg.491 CDS 457304 457951 2 + 648 Thymidylate kinase (EC pyrimidine conversions D23_1c0495 Neut_0536
2.7.4.9)
fig|6666666.60966.peg.492 CDS 461332 458087 −1 3246 Type I restriction- Restriction-Modification D23_1c0496 Neut_0537
modification system, System; <br>Type I
restriction subunit R (EC Restriction-Modification
3.1.21.3)
fig|6666666.60966.peg.493 CDS 462292 461345 −1 948 Putative DNA-binding Restriction-Modification D23_1c0497 NA
protein in cluster with System
Type I restriction-
modification system
fig|6666666.60966.peg.494 CDS 462416 462285 −2 132 hypothetical protein -none- D23_1c0498 NA
fig|6666666.60966.peg.495 CDS 463405 462413 −1 993 hypothetical protein -none- D23_1c0499 NA
fig|6666666.60966.peg.496 CDS 464694 463405 −3 1290 Type I restriction- Restriction-Modification D23_1c0500 Neut_0540
modification system, System; <br>Type I
specificity subunit S (EC Restriction-Modification
3.1.21.3)
fig|6666666.60966.peg.497 CDS 466246 464684 −1 1563 Type I restriction- Restriction-Modification D23_1c0501 Neut_0541
modification system, System; <br>Type I
DNA-methyltransferase Restriction-Modification
subunit M (EC 2.1.1.72)
fig|6666666.60966.peg.498 CDS 467880 466453 −3 1428 Na+/H+ antiporter -none- D23_1c0502 Neut_0542
NhaC
fig|6666666.60966.peg.499 CDS 468057 467896 −3 162 hypothetical protein -none- D23_1c0503 NA
fig|6666666.60966.peg.500 CDS 468126 469190 3 + 1065 DNA polymerase III -none- D23_1c0504 Neut_0543
delta prime subunit (EC
2.7.7.7)
fig|6666666.60966.peg.501 CDS 469691 469194 −2 498 hypothetical protein -none- D23_1c0505 Neut_0544
fig|6666666.60966.peg.502 CDS 469703 469870 2 + 168 hypothetical protein -none- D23_1c0506 NA
fig|6666666.60966.peg.503 CDS 470025 471155 3 + 1131 Magnesium and cobalt Magnesium transport D23_1c0508 Neut_0545
transport protein CorA
fig|6666666.60966.peg.504 CDS 471202 471447 1 + 246 Mobile element protein -none- D23_1c0509 Neut_0884
fig|6666666.60966.peg.505 CDS 471504 471617 3 + 114 hypothetical protein -none- D23_1c0510 Neut_0547
fig|6666666.60966.peg.506 CDS 471862 473013 1 + 1152 conserved hypothetical -none- D23_1c0511 Neut_0548
protein
fig|6666666.60966.peg.507 CDS 473412 473957 3 + 546 Uncharacterized protein -none- D23_1c0512 Neut_0550
conserved in bacteria
fig|6666666.60966.peg.508 CDS 474111 474269 3 + 159 Mobile element protein -none- D23_1c0513 NA
fig|6666666.60966.peg.510 CDS 474450 474653 3 + 204 hypothetical protein -none- D23_1c0514 NA
fig|6666666.60966.peg.512 CDS 475553 476005 2 + 453 SSU ribosomal protein Mycobacterium D23_1c0515 Neut_0554
S7p (S5e) virulence operon
involved in protein
synthesis (SSU ribosomal
proteins)
fig|6666666.60966.peg.513 CDS 476121 478166 3 + 2046 Translation elongation Mycobacterium D23_1c0516 Neut_0555
factor G virulence operon
involved in protein
synthesis (SSU ribosomal
proteins);
<br>Translation
elongation factor G
family; <br>Translation
elongation factors
bacterial; <br>Universal
GTPases
fig|6666666.60966.peg.514 CDS 478196 479386 2 + 1191 Translation elongation Mycobacterium D23_1c0517 Neut_0556
factor Tu virulence operon
involved in protein
synthesis (SSU ribosomal
proteins);
<br>Translation
elongation factors
bacterial; <br>Universal
GTPases
fig|6666666.60966.peg.515 CDS 479569 479775 1 + 207 SSU ribosomal protein -none- D23_1c0518 Neut_0557
S10p (S20e)
fig|6666666.60966.peg.516 CDS 479823 480476 3 + 654 LSU ribosomal protein -none- D23_1c0519 Neut_0558
L3p (L3e)
fig|6666666.60966.peg.517 CDS 480494 481114 2 + 621 LSU ribosomal protein -none- D23_1c0520 Neut_0559
L4p (L1e)
fig|6666666.60966.peg.518 CDS 481111 481446 1 + 336 LSU ribosomal protein -none- D23_1c0521 Neut_0560
L23p (L23Ae)
fig|6666666.60966.peg.519 CDS 481446 482279 3 + 834 LSU ribosomal protein -none- D23_1c0522 Neut_0561
L2p (L8e)
fig|6666666.60966.peg.520 CDS 482948 483595 2 + 648 SSU ribosomal protein -none- D23_1c0523 Neut_0564
S3p (S3e)
fig|6666666.60966.peg.521 CDS 483680 484096 2 + 417 LSU ribosomal protein -none- D23_1c0524 Neut_0565
L16p (L10e)
fig|6666666.60966.peg.524 CDS 485008 485331 1 + 324 LSU ribosomal protein -none- D23_1c0525 Neut_0569
L24p (L26e)
fig|6666666.60966.peg.525 CDS 485458 485886 1 + 429 LSU ribosomal protein -none- D23_1c0526 Neut_0570
L5p (L11e)
fig|6666666.60966.peg.526 CDS 486881 487222 2 + 342 LSU ribosomal protein -none- D23_1c0527 Neut_0573
L6p (L9e)
fig|6666666.60966.peg.527 CDS 487678 488151 1 + 474 SSU ribosomal protein -none- D23_1c0528 Neut_0575
S5p (S2e)
fig|6666666.60966.peg.528 CDS 488796 490118 3 + 1323 Preprotein translocase -none- D23_1c0530 Neut_0578
secY subunit (TC
3.A.5.1.1)
fig|6666666.60966.peg.530 CDS 491337 491963 3 + 627 SSU ribosomal protein -none- D23_1c0531 Neut_0582
S4p (S9e)
fig|6666666.60966.peg.531 CDS 492065 492997 2 + 933 DNA-directed RNA RNA polymerase D23_1c0532 Neut_0583
polymerase alpha bacterial
subunit (EC 2.7.7.6)
fig|6666666.60966.peg.532 CDS 494213 493998 −2 216 Putative oligoketide Possible RNA D23_1c0534 Neut_0586
cyclase/dehydratase or degradation cluster
lipid transport protein
YfjG
fig|6666666.60966.peg.533 CDS 494546 494995 2 + 450 tmRNA-binding protein Heat shock dnaK gene D23_1c0535 Neut_0587
SmpB cluster extended;
<br>Translation
termination factors
bacterial
fig|6666666.60966.peg.534 CDS 495005 496075 2 + 1071 Heme A synthase, Biogenesis of D23_1c0536 Neut_0588
cytochrome oxidase cytochrome c oxidases
biogenesis protein
Cox15-CtaA
fig|6666666.60966.peg.535 CDS 496163 496582 2 + 420 Probable -none- D23_1c0537 Neut_0589
transmembrane protein
fig|6666666.60966.peg.537 CDS 496945 498528 1 + 1584 DNA polymerase III DNA processing cluster D23_1c0538 Neut_0590
subunits gamma and
tau (EC 2.7.7.7)
fig|6666666.60966.peg.538 CDS 498545 498868 2 + 324 FIG000557: DNA processing cluster D23_1c0539 Neut_0591
hypothetical protein co-
occurring with RecR
fig|6666666.60966.peg.539 CDS 498922 499740 1 + 819 Pseudouridine synthase -none- D23_1c0540 Neut_0592
family protein
fig|6666666.60966.peg.540 CDS 500690 499770 −2 921 Protein-N(5)-glutamine -none- D23_1c0541 Neut_0593
methyltransferase
PrmB, methylates LSU
ribosomal protein L3p
fig|6666666.60966.peg.541 CDS 500738 501241 2 + 504 tRNA-specific tRNA modification D23_1c0542 Neut_0594
adenosine-34 Bacteria; <br>tRNA
deaminase (EC 3.5.4.—) processing
fig|6666666.60966.peg.542 CDS 501238 501717 1 + 480 Conserved domain -none- D23_1c0543 Neut_0595
protein
fig|6666666.60966.peg.543 CDS 501779 503389 2 + 1611 NAD-dependent malic Pyruvate metabolism I: D23_1c0544 Neut_0596
enzyme (EC 1.1.1.38) anaplerotic reactions,
PEP
fig|6666666.60966.peg.544 CDS 504268 503438 −1 831 Phosphoserine Glycine and Serine D23_1c0545 Neut_0597
phosphatase (EC Utilization; <br>Serine
3.1.3.3) Biosynthesis; <br>Serine
Biosynthesis
fig|6666666.60966.peg.545 CDS 505831 504356 −1 1476 FIG00858790: -none- D23_1c0546 Neut_0598
hypothetical protein
fig|6666666.60966.peg.547 CDS 506088 507581 3 + 1494 Cytosol aminopeptidase Aminopeptidases (EC D23_1c0547 Neut_0599
PepA (EC 3.4.11.1) 3.4.11.—);
<br>Dehydrogenase
complexes
fig|6666666.60966.peg.548 CDS 507615 508043 3 + 429 DNA polymerase III chi -none- D23_1c0548 Neut_0600
subunit (EC 2.7.7.7)
fig|6666666.60966.peg.549 CDS 508116 508517 3 + 402 FIG00859089: -none- D23_1c0549 Neut_0601
hypothetical protein
fig|6666666.60966.peg.550 CDS 508581 511334 3 + 2754 Valyl-tRNA synthetase tRNA aminoacylation, D23_1c0550 Neut_0602
(EC 6.1.1.9) Val
fig|6666666.60966.peg.551 CDS 511430 512500 2 + 1071 Uroporphyrinogen III Heme and Siroheme D23_1c0551 Neut_0603
decarboxylase (EC Biosynthesis
4.1.1.37)
fig|6666666.60966.peg.552 CDS 513466 512660 −1 807 Maebl -none- D23_1c0552 Neut_0604
fig|6666666.60966.peg.553 CDS 514503 513616 −3 888 Succinyl-CoA ligase TCA Cycle D23_1c0553 Neut_0605
[ADP-forming] alpha
chain (EC 6.2.1.5)
fig|6666666.60966.peg.554 CDS 515705 514533 −2 1173 Succinyl-CoA ligase TCA Cycle D23_1c0554 Neut_0606
[ADP-forming] beta
chain (EC 6.2.1.5)
fig|6666666.60966.peg.555 CDS 516828 515878 −3 951 Malyl-CoA lyase (EC Photorespiration D23_1c0555 Neut_0607
4.1.3.24) (oxidative C2 cycle)
fig|6666666.60966.peg.557 CDS 518554 517079 −1 1476 Glycogen synthase, Glycogen metabolism D23_1c0557 Neut_0608
ADP-glucose
transglucosylase (EC
2.4.1.21)
fig|6666666.60966.peg.558 CDS 520242 518608 −3 1635 Glucose-6-phosphate Glycolysis and D23_1c0558 Neut_0609
isomerase (EC 5.3.1.9) Gluconeogenesis
fig|6666666.60966.peg.559 CDS 521449 520271 −1 1179 3-ketoacyl-CoA thiolase Acetyl-CoA fermentation D23_1c0559 Neut_0610
(EC 2.3.1.16) @ Acetyl- to Butyrate; <br>Biotin
CoA acetyltransferase biosynthesis; <br>Biotin
(EC 2.3.1.9) synthesis cluster;
<br>Butanol
Biosynthesis;
<br>Butyrate
metabolism cluster;
<br>Fatty acid
metabolism cluster;
<br>Isoprenoid
Biosynthesis;
<br>Polyhydroxybutyrate
metabolism;
<br>Polyhydroxybutyrate
metabolism
fig|6666666.60966.peg.560 CDS 522790 521459 −1 1332 ATP-dependent hsl Proteasome bacterial; D23_1c0560 Neut_0611
protease ATP-binding <br>Proteolysis in
subunit HslU bacteria, ATP-dependent
fig|6666666.60966.peg.561 CDS 523346 522825 −2 522 ATP-dependent Proteasome bacterial; D23_1c0561 Neut_0612
protease HslV (EC <br>Proteolysis in
3.4.25.—) bacteria, ATP-dependent
fig|6666666.60966.peg.563 CDS 523758 523555 −3 204 DNA-directed RNA RNA polymerase D23_1c0562 Neut_0613
polymerase omega bacterial
subunit (EC 2.7.7.6)
fig|6666666.60966.peg.564 CDS 524414 523809 −2 606 Guanylate kinase (EC CBSS- D23_1c0563 Neut_0614
2.7.4.8) 323097.3.peg.2594;
<br>Purine conversions
fig|6666666.60966.peg.565 CDS 525166 524684 −1 483 Dihydroneopterin Folate Biosynthesis D23_1c0565 Neut_0615
triphosphate
pyrophosphohydrolase
type 2 (nudB)
fig|6666666.60966.peg.566 CDS 526961 525180 −2 1782 Aspartyl-tRNA tRNA aminoacylation, D23_1c0566 Neut_0616
synthetase (EC 6.1.1.12) Asp and Asn; <br>tRNA
@ Aspartyl-tRNA(Asn) aminoacylation, Asp and
synthetase (EC 6.1.1.23) Asn
fig|6666666.60966.peg.567 CDS 527054 527206 2 + 153 hypothetical protein -none- D23_1c0567 NA
fig|6666666.60966.peg.568 CDS 528907 527456 −1 1452 Mannose-1-phosphate Mannose Metabolism; D23_1c0569 Neut_0618
guanylyltransferase <br>Mannose
(GDP) (EC 2.7.7.22)/ Metabolism
Mannose-6-phosphate
isomerase (EC 5.3.1.8)
fig|6666666.60966.peg.569 CDS 530083 528971 −1 1113 UDP-N- CMP-N- D23_1c0570 Neut_0619
acetylglucosamine 2- acetylneuraminate
epimerase (EC 5.1.3.14) Biosynthesis; <br>Sialic
Acid Metabolism
fig|6666666.60966.peg.570 CDS 530171 530284 2 + 114 hypothetical protein -none- D23_1c0571 NA
fig|6666666.60966.peg.571 CDS 530407 530535 1 + 129 hypothetical protein -none- D23_1c0572 NA
fig|6666666.60966.peg.572 CDS 530637 531041 3 + 405 Truncated hemoglobins -none- D23_1c0573 Neut_0620
fig|6666666.60966.peg.573 CDS 531034 532257 1 + 1224 NnrS protein involved in Denitrification; D23_1c0574 Neut_0621
response to NO <br>Nitrosative stress;
<br>Oxidative stress
fig|6666666.60966.peg.574 CDS 532298 532738 2 + 441 putative membrane -none- D23_1c0575 Neut_0622
protein
fig|6666666.60966.peg.575 CDS 532841 533326 2 + 486 FIG001943: Broadly distributed D23_1c0576 Neut_0623
hypothetical protein proteins not in
YajQ subsystems
fig|6666666.60966.peg.576 CDS 534972 533485 −3 1488 FIG00859034: -none- D23_1c0577 Neut_0624
hypothetical protein
fig|6666666.60966.peg.577 CDS 535028 535240 2 + 213 hypothetical protein -none- D23_1c0578 NA
fig|6666666.60966.peg.578 CDS 536092 535289 −1 804 FIG00858513: -none- D23_1c0579 Neut_0626
hypothetical protein
fig|6666666.60966.peg.579 CDS 537497 536616 −2 882 hypothetical protein -none- D23_1c0581 NA
fig|6666666.60966.peg.580 CDS 538547 537726 −2 822 hypothetical protein -none- D23_1c0582 NA
fig|6666666.60966.peg.581 CDS 539856 538789 −3 1068 Conserved domain -none- D23_1c0583 NA
protein
fig|6666666.60966.peg.582 CDS 540712 539849 −1 864 Conserved domain -none- D23_1c0584 NA
protein
fig|6666666.60966.peg.583 CDS 541704 540841 −3 864 possible long-chain N- -none- D23_1c0585 Neut_0638
acyl amino acid
synthase
fig|6666666.60966.peg.584 CDS 541934 541812 −2 123 hypothetical protein -none- D23_1c0586 NA
fig|6666666.60966.peg.586 CDS 542270 542467 2 + 198 conserved hypothetical -none- D23_1c0587 Neut_0639
protein
fig|6666666.60966.peg.587 CDS 542451 542618 3 + 168 hypothetical protein -none- D23_1c0588 Neut_0640
fig|6666666.60966.peg.588 CDS 542602 542724 1 + 123 hypothetical protein -none- D23_1c0589 Neut_0641
fig|6666666.60966.peg.590 CDS 543111 544673 3 + 1563 Putative inner -none- D23_1c0590 Neut_0642
membrane protein
fig|6666666.60966.peg.591 CDS 544721 544834 2 + 114 hypothetical protein -none- D23_1c0591 NA
fig|6666666.60966.peg.592 CDS 545193 546098 3 + 906 Membrane-bound lytic CBSS-228410.1.peg.134; D23_1c0592 Neut_0643
murein transglycosylase <br>CBSS-
D precursor (EC 3.2.1.—) 342610.3.peg.1536;
<br>Murein Hydrolases
fig|6666666.60966.peg.593 CDS 546933 546274 −3 660 Endonuclease III (EC DNA Repair Base D23_1c0593 Neut_0644
4.2.99.18) Excision
fig|6666666.60966.peg.594 CDS 547586 546930 −2 657 Electron transport -none- D23_1c0594 Neut_0645
complex protein RnfB
fig|6666666.60966.peg.595 CDS 548604 547576 −3 1029 Dihydroorotate De Novo Pyrimidine D23_1c0595 Neut_0646
dehydrogenase (EC Synthesis
1.3.3.1)
fig|6666666.60966.peg.596 CDS 549246 548605 −3 642 Arginine-tRNA-protein Protein degradation D23_1c0596 Neut_0647
transferase (EC 2.3.2.8)
fig|6666666.60966.peg.597 CDS 550041 549343 −3 699 Leucyl/phenylalanyl- Protein degradation D23_1c0597 Neut_0648
tRNA-protein
transferase (EC 2.3.2.6)
fig|6666666.60966.peg.598 CDS 550783 550328 −1 456 Mobile element protein -none- D23_1c0598 Neut_2502
fig|6666666.60966.peg.599 CDS 551132 550746 −2 387 Mobile element protein -none- D23_1c0599 Neut_0884
fig|6666666.60966.peg.600 CDS 551404 551517 1 + 114 hypothetical protein -none- D23_1c0600 NA
fig|6666666.60966.peg.601 CDS 551625 552500 3 + 876 FIG00859053: -none- D23_1c0601 Neut_0650
hypothetical protein
fig|6666666.60966.peg.602 CDS 554066 552684 −2 1383 UDP-N- Peptidoglycan D23_1c0602 Neut_0651
acetylmuramate:L- biosynthesis--gjo;
alanyl-gamma-D- <br>Recycling of
glutamyl-meso- Peptidoglycan Amino
diaminopimelate ligase Acids
(EC 6.3.2.—)
fig|6666666.60966.peg.603 CDS 554191 555363 1 + 1173 NADH dehydrogenase Respiratory D23_1c0603 Neut_0652
(EC 1.6.99.3) dehydrogenases 1;
<br>Riboflavin synthesis
cluster
fig|6666666.60966.peg.604 CDS 556325 555387 −2 939 Mutator mutT protein Nudix proteins D23_1c0604 Neut_0653
(7,8-dihydro-8- (nucleoside triphosphate
oxoguanine- hydrolases); <br>Nudix
triphosphatase) (EC proteins (nucleoside
3.6.1.—)/Thiamin- triphosphate hydrolases)
phosphate
pyrophosphorylase-like
protein
fig|6666666.60966.peg.605 CDS 557210 556338 −2 873 putative ATP/GTP- -none- D23_1c0605 Neut_0654
binding protein
fig|6666666.60966.peg.606 CDS 558441 557212 −3 1230 Glutamate N- Arginine Biosynthesis-- D23_1c0607 Neut_0655
acetyltransferase (EC gjo; <br>Arginine
2.3.1.35)/N- Biosynthesis--gjo;
acetylglutamate <br>Arginine
synthase (EC 2.3.1.1) Biosynthesis extended;
<br>Arginine
Biosynthesis extended
fig|6666666.60966.peg.607 CDS 558602 559015 2 + 414 FIG136845: Rhodanese- Glutaredoxin 3 D23_1c0608 Neut_0656
related containing cluster
sulfurtransferase
fig|6666666.60966.peg.608 CDS 559045 559302 1 + 258 Glutaredoxin 3 (Grx3) Glutaredoxin 3 D23_1c0609 Neut_0657
containing cluster;
<br>Glutaredoxins;
<br>Glutathione: Redox
cycle
fig|6666666.60966.peg.609 CDS 559377 559862 3 + 486 Protein export Glutaredoxin 3 D23_1c0610 Neut_0658
cytoplasm chaperone containing cluster
protein (SecB,
maintains protein to be
exported in unfolded
state)
fig|6666666.60966.peg.610 CDS 559866 560345 3 + 480 FIG00859406: -none- D23_1c0611 Neut_0659
hypothetical protein
fig|6666666.60966.peg.611 CDS 560342 561331 2 + 990 Glycerol-3-phosphate Glutaredoxin 3 D23_1c0612 Neut_0660
dehydrogenase containing cluster;
[NAD(P)+] (EC 1.1.1.94) <br>Glycerol and
Glycerol-3-phosphate
Uptake and Utilization;
<br>Glycerolipid and
Glycerophospholipid
Metabolism in Bacteria
fig|6666666.60966.peg.612 CDS 561519 561791 3 + 273 DNA-binding protein DNA structural proteins, D23_1c0613 Neut_0661
HU-beta bacterial
fig|6666666.60966.peg.614 CDS 562230 564023 3 + 1794 Peptidyl-prolyl cis-trans Peptidyl-prolyl cis-trans D23_1c0616 Neut_0662
isomerase PpiD (EC isomerase
5.2.1.8)
fig|6666666.60966.peg.615 CDS 564844 564050 −1 795 Enoyl-[acyl-carrier- Fatty Acid Biosynthesis D23_1c0617 Neut_0663
protein] reductase FASII
[NADH] (EC 1.3.1.9)
fig|6666666.60966.peg.616 CDS 565168 564959 −1 210 hypothetical protein -none- D23_1c0618 NA
fig|6666666.60966.peg.617 CDS 565170 567587 3 + 2418 Transcription accessory CBSS-243265.1.peg.198; D23_1c0619 Neut_0664
protein (S1 RNA-binding <br>Transcription
domain) factors bacterial
fig|6666666.60966.peg.618 CDS 567598 567975 1 + 378 hypothetical protein -none- D23_1c0620 Neut_0682
fig|6666666.60966.peg.619 CDS 567977 568255 2 + 279 hypothetical protein -none- D23_1c0621 Neut_0682
fig|6666666.60966.peg.621 CDS 568500 568871 3 + 372 hypothetical protein -none- D23_1c0622 Neut_0683
fig|6666666.60966.peg.622 CDS 569150 568989 −2 162 hypothetical protein -none- D23_1c0623 Neut_0684
fig|6666666.60966.peg.623 CDS 570485 569238 −2 1248 Mobile element protein -none- D23_1c0624 Neut_0357
fig|6666666.60966.peg.624 CDS 571236 570577 −3 660 N-hydroxyarylamine O- -none- D23_1c0626 Neut_0684
acetyltransferase (EC
2.3.1.118)
fig|6666666.60966.peg.625 CDS 572209 571295 −1 915 Permease of the Queuosine-Archaeosine D23_1c0627 Neut_0685
drug/metabolite Biosynthesis
transporter (DMT)
superfamily
fig|6666666.60966.peg.626 CDS 573622 572339 −1 1284 TRAP dicarboxylate TRAP Transporter D23_1c0628 Neut_0686
transporter, DctM unknown substrate 6
subunit, unknown
substrate 6
fig|6666666.60966.peg.627 CDS 574259 573705 −2 555 TRAP dicarboxylate TRAP Transporter D23_1c0629 Neut_0687
transporter, DctQ unknown substrate 6
subunit, unknown
substrate 6
fig|6666666.60966.peg.628 CDS 575698 574334 −1 1365 TldE protein, part of Putative TldE-TldD D23_1c0630 Neut_0688
TldE/TldD proteolytic proteolytic complex
complex
fig|6666666.60966.peg.629 CDS 575950 576474 1 + 525 FIG138315: Putative Putative TldE-TldD D23_1c0632 Neut_0689
alpha helix protein proteolytic complex
fig|6666666.60966.peg.630 CDS 576475 576609 1 + 135 hypothetical protein -none- D23_1c0633 NA
fig|6666666.60966.peg.631 CDS 576740 577006 2 + 267 FIG00859002: -none- D23_1c0635 Neut_0690
hypothetical protein
fig|6666666.60966.peg.632 CDS 577046 577804 2 + 759 Exodeoxyribonuclease DNA repair, bacterial D23_1c0636 Neut_0691
III (EC 3.1.11.2)
fig|6666666.60966.peg.633 CDS 577801 579195 1 + 1395 AmpG permease Recycling of D23_1c0637 Neut_0692
Peptidoglycan Amino
Acids
fig|6666666.60966.peg.636 CDS 580217 579867 −2 351 Cytochrome O Terminal cytochrome O D23_1c0638 Neut_0694
ubiquinol oxidase ubiquinol oxidase;
subunit IV (EC 1.10.3.—) <br>Terminal
cytochrome oxidases
fig|6666666.60966.peg.637 CDS 580885 580214 −1 672 Cytochrome O Terminal cytochrome O D23_1c0639 Neut_0695
ubiquinol oxidase ubiquinol oxidase;
subunit III (EC 1.10.3.—) <br>Terminal
cytochrome oxidases
fig|6666666.60966.peg.638 CDS 582993 580882 −3 2112 Cytochrome O Terminal cytochrome O D23_1c0640 Neut_0696
ubiquinol oxidase ubiquinol oxidase;
subunit 1 (EC 1.10.3.—) <br>Terminal
cytochrome oxidases
fig|6666666.60966.peg.639 CDS 583998 582997 −3 1002 Cytochrome O Terminal cytochrome O D23_1c0641 Neut_0697
ubiquinol oxidase ubiquinol oxidase;
subunit II (EC 1.10.3.—) <br>Terminal
cytochrome oxidases
fig|6666666.60966.peg.640 CDS 585484 584237 −1 1248 Mobile element protein -none- D23_1c0642 Neut_0357
fig|6666666.60966.peg.641 CDS 585502 585633 1 + 132 patatin family protein -none- D23_1c0643 Neut_1317
fig|6666666.60966.peg.642 CDS 585643 586530 1 + 888 UTP--glucose-1- -none- D23_1c0644 Neut_0698
phosphate
uridylyltransferase (EC
2.7.7.9)
fig|6666666.60966.peg.643 CDS 586705 587817 1 + 1113 FIG00859666: -none- D23_1c0645 Neut_0699
hypothetical protein
fig|6666666.60966.peg.644 CDS 587837 589201 2 + 1365 Succinate-semialdehyde -none- D23_1c0646 Neut_0700
dehydrogenase [NAD]
(EC 1.2.1.24); Succinate-
semialdehyde
dehydrogenase
[NADP+] (EC 1.2.1.16)
fig|6666666.60966.peg.645 CDS 589224 590942 3 + 1719 InterPro IPR001440 -none- D23_1c0647 Neut_0701
COGs COG0457
fig|6666666.60966.peg.646 CDS 592871 591033 −2 1839 Long-chain-fatty-acid-- Biotin biosynthesis; D23_1c0648 Neut_0702
CoA ligase (EC 6.2.1.3) <br>Biotin synthesis
cluster; <br>Fatty acid
metabolism cluster
fig|6666666.60966.peg.647 CDS 595204 592868 −1 2337 Butyryl-CoA -none- D23_1c0649 Neut_0703
dehydrogenase (EC
1.3.99.2)
fig|6666666.60966.peg.648 CDS 595489 595223 −1 267 hypothetical protein -none- D23_1c0650 Neut_0704
fig|6666666.60966.peg.649 CDS 596053 595673 −1 381 Putative membrane -none- D23_1c0651 Neut_0705
protein
fig|6666666.60966.peg.650 CDS 596962 596099 −1 864 Pirin -none- D23_1c0652 Neut_0706
fig|6666666.60966.peg.651 CDS 597098 598030 2 + 933 Transcriptional -none- D23_1c0653 Neut_0707
regulator, LysR family
fig|6666666.60966.peg.652 CDS 598202 599338 2 + 1137 hypothetical protein -none- D23_1c0655 Neut_0708
fig|6666666.60966.peg.653 CDS 599418 599657 3 + 240 Flavodoxin reductases Anaerobic respiratory D23_1c0656 Neut_0709
(ferredoxin-NADPH reductases
reductases) family 1
fig|6666666.60966.peg.654 CDS 599689 600114 1 + 426 Flavodoxin reductases Anaerobic respiratory D23_1c0657 Neut_0709
(ferredoxin-NADPH reductases
reductases) family 1
fig|6666666.60966.peg.655 CDS 601243 600251 −1 993 Multicopper oxidase Copper homeostasis D23_1c0658 Neut_0710
fig|6666666.60966.peg.656 CDS 602188 601454 −1 735 FIG00859807: -none- D23_1c0659 Neut_0711
hypothetical protein
fig|6666666.60966.peg.657 CDS 602534 602346 −2 189 hypothetical protein -none- D23_1c0660 Neut_0712
fig|6666666.60966.peg.658 CDS 602837 602700 −2 138 Putative NAD(P)- -none- D23_1c0661 Neut_0990
dependent
oxidoreductase EC-
YbbO
fig|6666666.60966.peg.659 CDS 603148 602882 −1 267 ABC-type multidrug CBSS-196164.1.peg.1690 D23_1c0662 Neut_0713
transport system,
permease component
fig|6666666.60966.peg.660 CDS 603362 605239 2 + 1878 1,4-alpha-glucan -none- D23_1c0663 Neut_0714
branching enzyme (EC
2.4.1.18)
fig|6666666.60966.peg.661 CDS 605497 605619 1 + 123 Glutathione peroxidase Glutathione: Redox cycle D23_1c0664 Neut_0715
(EC 1.11.1.9)
fig|6666666.60966.peg.662 CDS 607768 605882 −1 1887 TonB-dependent hemin, Ton and Tol transport D23_1c0665 Neut_0716
ferrichrome receptor systems
fig|6666666.60966.peg.663 CDS 609583 607862 −1 1722 hypothetical protein -none- D23_1c0666 Neut_0717
fig|6666666.60966.peg.664 CDS 610957 609656 −1 1302 Membrane protein -none- D23_1c0667 Neut_0718
involved in colicin
uptake
fig|6666666.60966.peg.665 CDS 611184 612413 3 + 1230 FIG00858430: -none- D23_1c0668 Neut_0719
hypothetical protein
fig|6666666.60966.peg.666 CDS 612533 615022 2 + 2490 TonB-dependent Ton and Tol transport D23_1c0669 Neut_0720
receptor systems
fig|6666666.60966.peg.667 CDS 615143 615012 −2 132 hypothetical protein -none- D23_1c0670 NA
fig|6666666.60966.peg.668 CDS 615337 617457 1 + 2121 TonB-dependent Ton and Tol transport D23_1c0672 Neut_0721
receptor systems
fig|6666666.60966.peg.669 CDS 617524 618762 1 + 1239 putative signal peptide -none- D23_1c0673 Neut_0722
protein
fig|6666666.60966.peg.670 CDS 618762 619262 3 + 501 InterPro IPR000063 -none- D23_1c0674 Neut_0723
COGs COG0526
fig|6666666.60966.peg.671 CDS 619459 621978 1 + 2520 Enoyl-CoA hydratase Acetyl-CoA fermentation D23_1c0675 Neut_0724
(EC 4.2.1.17)/3,2- to Butyrate; <br>Acetyl-
trans-enoyl-CoA CoA fermentation to
isomerase (EC 5.3.3.8)/ Butyrate; <br>Butanol
3-hydroxyacyl-CoA Biosynthesis;
dehydrogenase (EC <br<Butyrate
1.1.1.35) metabolism cluster;
<br>Butyrate
metabolism cluster;
<br>Fatty acid
metabolism cluster;
<br>Fatty acid
metabolism cluster;
<br>Polyhydroxybutyrate
metabolism;
<br>Polyhydroxybutyrate
metabolism
fig|6666666.60966.peg.672 CDS 622043 623245 2 + 1203 3-ketoacyl-CoA thiolase Acetyl-CoA fermentation D23_1c0676 Neut_0725
(EC 2.3.1.16) @ Acetyl- to Butyrate; <br>Biotin
CoA acetyltransferase biosynthesis; <br>Biotin
(EC 2.3.1.9) synthesis cluster;
<br>Butanol
Biosynthesis;
<br>Butyrate
metabolism cluster;
<br>Fatty acid
metabolism cluster;
<br>Isoprenoid
Biosynthesis;
<br>Polyhydroxybutyrate
metabolism;
<br>Polyhydroxybutyrate
metabolism
fig|6666666.60966.peg.673 CDS 623639 623301 −2 339 FIG00859796: -none- D23_1c0677 Neut_0726
hypothetical protein
fig|6666666.60966.peg.674 CDS 623711 623827 2 + 117 hypothetical protein -none- D23_1c0678 NA
fig|6666666.60966.peg.675 CDS 624186 624479 3 + 294 Mobile element protein -none- D23_1c0680 Neut_1719
fig|6666666.60966.peg.676 CDS 624578 625456 2 + 879 Mobile element protein -none- D23_1c0681 Neut_1720
fig|6666666.60966.peg.677 CDS 626009 625605 −2 405 hypothetical protein -none- D23_1c0682 NA
fig|6666666.60966.peg.678 CDS 626270 628669 2 + 2400 Predicted hydrolase of -none- D23_1c0684 Neut_0728
the metallo-beta-
lactamase superfamily,
clustered with KDO2-
Lipid A biosynthesis
genes
fig|6666666.60966.peg.679 CDS 628866 629183 3 + 318 Flagellar transcriptional Flagellum D23_1c0685 Neut_0729
activator FlhD
fig|6666666.60966.peg.680 CDS 629210 629785 2 + 576 Flagellar transcriptional Flagellum D23_1c0686 Neut_0730
activator FlhC
fig|6666666.60966.peg.681 CDS 630020 631549 2 + 1530 Proposed peptidoglycan Peptidoglycan lipid II D23_1c0687 Neut_0731
lipid II flippase MurJ flippase
fig|6666666.60966.peg.683 CDS 633437 632277 −2 1161 Outer membrane Lipopolysaccharide D23_1c0688 Neut_0732
protein NlpB, assembly
lipoprotein component
of the protein assembly
complex (forms a
complex with YaeT,
YfiO, and YfgL);
Lipoprotein-34
precursor
fig|6666666.60966.peg.684 CDS 634289 633447 −2 843 Dihydrodipicolinate -none- D23_1c0689 Neut_0733
synthase (EC 4.2.1.52)
fig|6666666.60966.peg.685 CDS 637007 634416 −2 2592 ClpB protein Protein chaperones; D23_1c0690 Neut_0734
<br>Proteolysis in
bacteria, ATP-dependent
fig|6666666.60966.peg.686 CDS 637484 637326 −2 159 hypothetical protein -none- D23_1c0693 NA
fig|6666666.60966.peg.687 CDS 638994 637501 −3 1494 Ferredoxin-dependent Ammonia assimilation; D23_1c0694 Neut_0735
glutamate synthase (EC <br>Glutamine,
1.4.7.1) Glutamate, Aspartate
and Asparagine
Biosynthesis
fig|6666666.60966.peg.688 CDS 639034 639930 1 + 897 Quinolinate Mycobacterium D23_1c0695 NA
phosphoribosyltransferase virulence operon
[decarboxylating] possibly involved in
(EC 2.4.2.19) quinolinate biosynthesis;
<br>NAD and NADP
cofactor biosynthesis
global
fig|6666666.60966.peg.689 CDS 641903 640635 −2 1269 Flagellar hook-length Flagellum D23_1c0696 Neut_0740
control protein FliK
fig|6666666.60966.peg.690 CDS 642413 641961 −2 453 Flagellar protein FliJ Flagellum D23_1c0697 Neut_0741
fig|6666666.60966.peg.691 CDS 643836 642430 −3 1407 Flagellum-specific ATP Flagellar motility; D23_1c0698 Neut_0742
synthase Flil <br>Flagellum
fig|6666666.60966.peg.692 CDS 644577 643858 −3 720 Flagellar assembly Flagellum D23_1c0699 Neut_0743
protein FliH
fig|6666666.60966.peg.693 CDS 645764 644769 −2 996 Flagellar motor switch Flagellum D23_1c0700 Neut_0744
protein FliG
fig|6666666.60966.peg.694 CDS 647397 645754 −3 1644 Flagellar M-ring protein Flagellum D23_1C0701 Neut_0745
FliF
fig|6666666.60966.peg.695 CDS 647548 647402 −1 147 hypothetical protein -none- D23_1c0702 NA
fig|6666666.60966.peg.696 CDS 647628 648872 3 + 1245 Flagellar sensor Flagellum D23_1c0703 Neut_0746
histidine kinase FleS
fig|6666666.60966.peg.697 CDS 648876 650189 3 + 1314 InterPro -none- D23_1c0704 Neut_0747
IPR001789:IPR002078:IPR002197:
IPR003593
COGs COG2204
fig|6666666.60966.peg.698 CDS 650217 650546 3 + 330 Flagellar hook-basal Flagellum; <br>Flagellum D23_1c0705 Neut_0748
body complex protein in Campylobacter
FliE
fig|6666666.60966.peg.699 CDS 650581 651390 1 + 810 FIG00858443: -none- D23_1c0706 Neut_0749
hypothetical protein
fig|6666666.60966.peg.700 CDS 651752 651411 −2 342 Flagellar biosynthesis Flagellar motility; D23_1c0707 Neut_0750
protein FlhB <br>Flagellum
fig|6666666.60966.peg.701 CDS 652764 651739 −3 1026 FIG00726091: -none- D23_1c0708 Neut_0751
hypothetical protein
fig|6666666.60966.peg.702 CDS 652766 652948 2 + 183 hypothetical protein -none- D23_1c0709 NA
fig|6666666.60966.peg.703 CDS 653125 653517 1 + 393 hypothetical protein -none- D23_1c0710 Neut_2449
fig|6666666.60966.peg.704 CDS 653664 653810 3 + 147 Mobile element protein -none- D23_1c0711 Neut_1756
fig|6666666.60966.peg.705 CDS 654316 653858 −1 459 Cytochrome c family -none- D23_1c0712 Neut_0754
protein
fig|6666666.60966.peg.706 CDS 654869 654345 −2 525 CopG protein Copper homeostasis D23_1c0713 Neut_0755
fig|6666666.60966.peg.707 CDS 655268 656209 2 + 942 tRNA(Cytosine32)-2- CBSS- D23_1c0714 Neut_0756
thiocytidine synthetase 326442.4.peg.1852;
<br>tRNA modification
Bacteria
fig|6666666.60966.peg.708 CDS 657180 656236 −3 945 Lipoate synthase Lipoic acid metabolism; D23_1c0715 Neut_0757
<br>Lipoic acid synthesis
cluster; <br>Possible
RNA degradation cluster
fig|6666666.60966.peg.709 CDS 657847 657170 −1 678 Octanoate-[acyl-carrier- Lipoic acid metabolism; D23_1c0716 Neut_0758
protein]-protein-N- <br>Lipoic acid synthesis
octanoyltransferase cluster
fig|6666666.60966.peg.710 CDS 658198 657935 −1 264 Proposed lipoate Lipoicacid metabolism; D23_1c0717 Neut_0759
regulatory protein YbeD <br>Lipoic acid synthesis
cluster
fig|6666666.60966.peg.711 CDS 659068 658208 −1 861 D-alanine Pyruvate Alanine Serine D23_1c0718 Neut_0760
aminotransferase (EC Interconversions
2.6.1.21)
fig|6666666.60966.peg.712 CDS 660251 659088 −2 1164 D-alanyl-D-alanine CBSS-84588.1.peg.1247; D23_1c0719 Neut_0761
carboxypeptidase (EC <br>Metallocarboxypeptidases
3.4.16.4) (EC 3.4.17.—);
<br>Murein Hydrolases;
<br>Peptidoglycan
Biosynthesis
fig|6666666.60966.peg.713 CDS 660353 660787 2 + 435 LSU ribosomal protein -none- D23_1c0720 Neut_0762
L13p (L13Ae)
fig|6666666.60966.peg.714 CDS 660799 661191 1 + 393 SSU ribosomal protein -none- D23_1c0721 Neut_0763
S9p (S16e)
fig|6666666.60966.peg.715 CDS 661324 662352 1 + 1029 N-acetyl-gamma- Arginine Biosynthesis-- D23_1c0722 Neut_0764
glutamyl-phosphate gjo; <br>Arginine
reductase (EC 1.2.1.38) Biosynthesis extended
fig|6666666.60966.peg.716 CDS 662454 663221 3 + 768 putative integral -none- D23_1c0723 Neut_0765
membrane protein
fig|6666666.60966.peg.717 CDS 663202 663627 1 + 426 Integral membrane -none- D23_1c0724 Neut_0766
protein CcmA involved
in cell shape
determination
fig|6666666.60966.peg.718 CDS 665316 663655 −3 1662 DNA repair protein DNA repair, bacterial D23_1c0725 Neut_0767
RecN
fig|6666666.60966.peg.719 CDS 666357 665326 −3 1032 NAD kinase (EC NAD and NADP cofactor D23_1c0726 Neut_0768
2.7.1.23) biosynthesis global
fig|6666666.60966.peg.720 CDS 666433 667449 1 + 1017 Heat-inducible GroEL GroES; <br>Heat D23_1c0727 Neut_0769
transcription repressor shock dnaK gene cluster
HrcA extended
fig|6666666.60966.peg.721 CDS 667469 668566 2 + 1098 Ferrochelatase, Heme and Siroheme D23_1c0728 Neut_0770
protoheme ferro-lyase Biosynthesis
(EC 4.99.1.1)
fig|6666666.60966.peg.722 CDS 668678 669469 2 + 792 Zn-dependent protease -none- D23_1c0729 Neut_0771
with chaperone
function PA4632
fig|6666666.60966.peg.723 CDS 669589 670461 1 + 873 Phosphoribulokinase Calvin-Benson cycle D23_1c0730 Neut_0772
(EC 2.7.1.19)
fig|6666666.60966.peg.724 CDS 670525 672771 1 + 2247 ATP-dependent DNA DNA repair, bacterial D23_1c0731 Neut_0773
helicase UvrD/PcrA UvrD and related
helicases
fig|6666666.60966.peg.725 CDS 673569 672778 −3 792 Possible -none- D23_1c0732 Neut_0774
transmembrane protein
fig|6666666.60966.peg.726 CDS 674610 673660 −3 951 Homoserine kinase (EC CBSS- D23_1c0733 Neut_0775
2.7.1.39) 269482.1.peg.1294;
<br>Methionine
Biosynthesis;
<br>Threonine and
Homoserine
Biosynthesis
fig|6666666.60966.peg.727 CDS 674585 674716 2 + 132 hypothetical protein -none- D23_1c0734 NA
fig|6666666.60966.peg.728 CDS 675030 674704 −3 327 FIG00858562: -none- D23_1c0735 Neut_0776
hypothetical protein
fig|6666666.60966.peg.729 CDS 675190 674996 −1 195 hypothetical protein -none- D23_1c0736 NA
fig|6666666.60966.peg.730 CDS 675866 675147 −2 720 FIG00859241: -none- D23_1c0737 Neut_0777
hypothetical protein
fig|6666666.60966.peg.731 CDS 675882 678602 3 + 2721 DNA polymerase I (EC DNA Repair Base D23_1c0738 Neut_0778
2.7.7.7) Excision
fig|6666666.60966.peg.732 CDS 678725 679912 2 + 1188 Fatty acid desaturase -none- D23_1c0739 Neut_0779
(EC 1.14.19.1); Delta-9
fatty acid desaturase
(EC 1.14.19.1)
fig|6666666.60966.peg.733 CDS 680149 679994 −1 156 LSU ribosomal protein -none- D23_1c0740 Neut_0780
L33p @ LSU ribosomal
protein L33p, zinc-
independent
fig|6666666.60966.peg.734 CDS 680390 680190 −2 201 LSU ribosomal protein -none- D23_1c0741 Neut_0781
L28p
fig|6666666.60966.peg.735 CDS 681169 680495 −1 675 DNA repair protein Bacterial cell division D23_1c0742 Neut_0782
RadC cluster; <br>DNA repair,
bacterial
fig|6666666.60966.peg.736 CDS 681339 682508 3 + 1170 Phosphopantothenoylcysteine Coenzyme A D23_1c0743 Neut_0783
decarboxylase Biosynthesis;
(EC 4.1.1.36)/ <br>Coenzyme A
Phosphopantothenoylcysteine Biosynthesis
synthetase (EC
6.3.2.5)
fig|6666666.60966.peg.737 CDS 682518 682967 3 + 450 Deoxyuridine 5&#39;- Housecleaning D23_1c0744 Neut_0784
triphosphate nucleoside triphosphate
nucleotidohydrolase (EC pyrophosphatases;
3.6.1.23) <br>Nudix proteins
(nucleoside triphosphate
hydrolases)
fig|6666666.60966.peg.738 CDS 682961 683386 2 + 426 exported protein -none- D23_1c0745 Neut_0785
fig|6666666.60966.peg.739 CDS 685816 683759 −1 2058 Pyrophosphate- Phosphate metabolism D23_1c0746 Neut_0786
energized proton pump
(EC 3.6.1.1)
fig|6666666.60966.peg.740 CDS 687229 685970 −1 1260 6-phosphofructokinase Glycolysis and D23_1c0747 Neut_0787
(EC 2.7.1.11) Gluconeogenesis
fig|6666666.60966.peg.741 CDS 687933 687400 −3 534 Adenylate kinase (EC Purine conversions D23_1c0748 NA
2.7.4.3)
fig|6666666.60966.peg.742 CDS 688328 689359 2 + 1032 RecA protein DNA repair, bacterial; D23_1c0749 Neut_0789
<br>DNA repair system
including RecA, MutS
and a hypothetical
protein; <br>RecA and
RecX
fig|6666666.60966.peg.743 CDS 689362 689802 1 + 441 Regulatory protein RecX DNA repair system D23_1c0750 Neut_0790
including RecA, MutS
and a hypothetical
protein; <br>RecA and
RecX
fig|6666666.60966.peg.744 CDS 689820 692411 3 + 2592 Alanyl-tRNA synthetase Cluster containing D23_1c0751 Neut_0791
(EC 6.1.1.7) Alanyl-tRNA synthetase;
<br>tRNA
aminoacylation, Ala
fig|6666666.60966.peg.745 CDS 692450 693403 2 + 954 Thioredoxin reductase Thioredoxin-disulfide D23_1c0752 Neut_0792
(EC 1.8.1.9) reductase;
<br>pyrimidine
conversions
fig|6666666.60966.peg.746 CDS 693409 6939991 1 + 591 Smr domain -none- D23_1c0753 Neut_0793
fig|6666666.60966.peg.747 CDS 694203 694349 3 + 147 Carbonic anhydrase (EC Zinc regulated enzymes D23_1c0754 Neut_0794
4.2.1.1)
fig|6666666.60966.peg.750 CDS 695056 695208 1 + 153 hypothetical protein -none- D23_1c0755 Neut_1255
fig|6666666.60966.peg.751 CDS 695216 695383 2 + 168 hypothetical protein -none- D23_1c0756 Neut_2449
fig|6666666.60966.peg.752 CDS 695522 695986 2 + 465 Mobile element protein -none- D23_1c0758 Neut_1256
fig|6666666.60966.peg.753 CDS 696281 696072 −2 210 Chemotaxis regulator- Flagellar motility D23_1c0759 Neut_0796
transmits
chemoreceptor signals
to flagelllar motor
components CheY
fig|6666666.60966.peg.754 CDS 696491 696619 2 + 129 hypothetical protein -none- D23_1c0760 Neut_0797
fig|6666666.60966.peg.755 CDS 696639 696812 3 + 174 Mobile element protein -none- D23_1c0760 Neut_0797
fig|6666666.60966.peg.756 CDS 696806 696934 2 + 129 Mobile element protein -none- D23_1c0761 NA
fig|6666666.60966.peg.757 CDS 697179 698426 3 + 1248 Mobile element protein -none- D23_1c0762 Neut_0357
fig|6666666.60966.peg.758 CDS 698760 700454 3 + 1695 NADH dehydrogenase, Respiratory Complex I D23_1c0763 Neut_0799
subunit 5
fig|6666666.60966.peg.759 CDS 700473 701258 3 + 786 hypothetical protein -none- D23_1c0765 Neut_0800
fig|6666666.60966.peg.760 CDS 701243 704371 2 + 3129 Hypothetical CO2 uptake, D23_1c0766 Neut_0801
transmembrane protein carboxysome;
coupled to NADH- <br>Respiratory
ubiquinone Complex I
oxidoreductase chain 5
homolog
fig|6666666.60966.peg.761 CDS 704368 704694 1 + 327 Nitrogen regulatory Ammonia assimilation D23_1c0767 Neut_0802
protein P-II
fig|6666666.60966.peg.762 CDS 704850 705059 3 + 210 hypothetical protein -none- D23_1c0768 Neut_0800
fig|6666666.60966.peg.763 CDS 705044 708184 2 + 3141 Hypothetical CO2 uptake, D23_1c0769 Neut_0801
transmembrane protein carboxysome;
coupled to NADH- <br>Respiratory
ubiquinone Complex I
oxidoreductase chain 5
homolog
fig|6666666.60966.peg.764 CDS 708181 708507 1 + 327 Nitrogen regulatory Ammonia assimilation D23_1c0770 Neut_0802
protein P-II
fig|6666666.60966.peg.765 CDS 709429 708509 −1 921 RuBisCO operon CO2 uptake, D23_1c0771 Neut_0803
transcriptional carboxysome
regulator CbbR
fig|6666666.60966.peg.766 CDS 709628 711049 2 + 1422 Ribulose bisphosphate CO2 uptake, D23_1c0772 Neut_0804
carboxylase large chain carboxysome;
(EC 4.1.1.39) <br>Calvin-Benson cycle;
<br>Photorespiration
(oxidative C2 cycle)
fig|6666666.60966.peg.767 CDS 711134 711460 2 + 327 Ribulose bisphosphate CO2 uptake, D23_1c0773 Neut_0805
carboxylase small chain carboxysome;
(EC 4.1.1.39) <br>Calvin-Benson cycle;
<br>Photorespiration
(oxidative C2 cycle)
fig|6666666.60966.peg.768 CDS 711860 711645 −2 216 hypothetical protein -none- D23_1c0774 Neut_0806
fig|6666666.60966.peg.769 CDS 711868 714264 1 + 2397 carboxysome shell CO2 uptake, D23_1c0774 Neut_0806
protein CsoS2 carboxysome
fig|6666666.60966.peg.770 CDS 714275 715804 2 + 1530 carboxysome shell CO2 uptake, D23_1c0775 Neut_0807
protein CsoS3 carboxysome
fig|6666666.60966.peg.771 CDS 715825 716082 1 + 258 putative carboxysome CO2 uptake, D23_1c0776 Neut_0808
peptide A carboxysome
fig|6666666.60966.peg.772 CDS 716082 716330 3 + 249 putative carboxysome CO2 uptake, D23_1c0777 Neut_0809
peptide B carboxysome
fig|6666666.60966.peg.773 CDS 716439 716735 3 + 297 carboxysome shell CO2 uptake, D23_1c0778 Neut_0810
protein CsoS1 carboxysome
fig|6666666.60966.peg.774 CDS 716777 717124 2 + 348 carboxysome shell CO2 uptake, D23_1c0779 Neut_0811
protein CsoS1 carboxysome
fig|6666666.60966.peg.775 CDS 717145 717567 1 + 423 bacterioferritin possible -none- D23_1c0780 Neut_0812
associated with
carboxysome
fig|6666666.60966.peg.776 CDS 717576 717842 3 + 267 Possible pterin-4 alpha- CO2 uptake, D23_1c0781 Neut_0813
carbinolamine carboxysome
dehydratase-like
protein
fig|6666666.60966.peg.777 CDS 717911 718483 2 + 573 Chromosome (plasmid) Bacterial Cell Division; D23_1c0782 Neut_0814
partitioning protein <br>Bacterial
ParA Cytoskeleton; <br>Cell
Division Subsystem
including YidCD;
<br>RNA modification
and chromosome
partitioning cluster
fig|6666666.60966.peg.778 CDS 718480 718674 1 + 195 hypothetical protein -none- D23_1c0783 NA
fig|6666666.60966.peg.779 CDS 718681 719631 1 + 951 Rubisco activation CO2 uptake, D23_1c0784 Neut_0815
protein CbbQ carboxysome
fig|6666666.60966.peg.780 CDS 719654 722014 2 + 2361 Rubisco activation CO2 uptake, D23_1c0785 Neut_0816
protein CbbO carboxysome
fig|6666666.60966.peg.781 CDS 722027 722659 2 + 633 FIG00852745: -none- D23_1c0786 Neut_0817
hypothetical protein
fig|6666666.60966.peg.782 CDS 722704 723528 1 + 825 FIG00853400: -none- D23_1c0787 Neut_0818
hypothetical protein
fig|6666666.60966.peg.783 CDS 723822 723676 −3 147 Mobile element protein -none- D23_1c0788 NA
fig|6666666.60966.peg.784 CDS 723900 724055 3 + 156 hypothetical protein -none- D23_1c0790 NA
fig|6666666.60966.peg.785 CDS 724125 724304 3 + 180 Rubisco activation CO2 uptake, D23_1c0791 NA
protein CbbO carboxysome
fig|6666666.60966.peg.786 CDS 724415 724621 2 + 207 Rubisco activation CO2 uptake, D23_1c0792 Neut_0816
protein CbbO carboxysome
fig|6666666.60966.peg.787 CDS 724700 724975 2 + 276 Nitric oxide reductase Denitrification; D23_1c0793 Neut_0816
activation protein NorD <br>Denitrifying
reductase gene clusters
fig|6666666.60966.peg.788 CDS 724985 725104 2 + 120 hypothetical protein -none- D23_1c0794 Neut_0816
fig|6666666.60966.peg.789 CDS 725079 725336 3 + 258 Nitric oxide reductase Denitrification; D23_1c0794 Neut_0816
activation protein NorD <br>Denitrifying
reductase gene clusters
fig|6666666.60966.peg.790 CDS 725493 725657 3 + 165 hypothetical protein -none- D23_1c0795 Neut_0821
fig|6666666.60966.peg.791 CDS 727182 725782 −3 1401 FIG00861154: -none- D23_1c0796 Neut_1550
hypothetical protein
fig|6666666.60966.peg.792 CDS 727830 727411 −3 420 FIG00859219: -none- D23_1c0797 Neut_0823
hypothetical protein
fig|6666666.60966.peg.793 CDS 729449 728481 −2 969 Octaprenyl diphosphate Isoprenoid Biosynthesis; D23_1c0800 Neut_0825
synthase (EC 2.5.1.90)/ <br>Isoprenoid
Dimethylallyltransferase Biosynthesis;
(EC 2.5.1.1)/(2E,6E)- <br>Isoprenoid
farnesyl diphosphate Biosynthesis:
synthase (EC 2.5.1.10)/ Interconversions;
Geranylgeranyl <br>Isoprenoinds for
diphosphate synthase Quinones;
(EC 2.5.1.29) <br>Isoprenoinds for
Quinones;
<br>Isoprenoinds for
Quinones;
<br>Isoprenoinds for
Quinones;
<br>Polyprenyl
Diphosphate
Biosynthesis;
<br>Polyprenyl
Diphosphate
Biosynthesis;
<br>Polyprenyl
Diphosphate
Biosynthesis
fig|6666666.60966.peg.795 CDS 729633 730886 3 + 1254 Glutamyl-tRNA A Gammaproteobacteria D23_1c0801 Neut_0826
reductase (EC 1.2.1.70) Cluster Relating to
Translation; <br>Heme
and Siroheme
Biosynthesis
fig|6666666.60966.peg.796 CDS 730883 731962 2 + 1080 Peptide chain release A Gammaproteobacteria D23_1c0802 Neut_0827
factor 1 Cluster Relating to
Translation; <br>CBSS-
216600.3.peg.802;
<br>Translation
termination factors
bacterial
fig|6666666.60966.peg.797 CDS 731959 732840 1 + 882 Protein-N(5)-glutamine A Gammaproteobacteria D23_1c0803 Neut_0828
methyltransferase Cluster Relating to
PrmC, methylates Translation; <br>CBSS-
polypeptide chain 216600.3.peg.802;
release factors RF1 and <br>Translation
RF2 termination factors
bacterial
fig|6666666.60966.peg.798 CDS 732995 733303 2 + 309 Glutaredoxin-related Glutaredoxins D23_1c0805 Neut_0829
protein
fig|6666666.60966.peg.799 CDS 733743 733324 −3 420 Putative membrane -none- D23_1c0806 Neut_0830
protein
fig|6666666.60966.peg.800 CDS 734018 734161 2 + 144 hypothetical protein -none- D23_1c0807 NA
fig|6666666.60966.peg.801 CDS 734194 734826 1 + 633 Glutathione S- Glutathione: Non-redox D23_1c0808 Neut_0831
transferase (EC reactions
2.5.1.18)
fig|6666666.60966.peg.802 CDS 735097 735381 1 + 285 conserved hypothetical -none- D23_1c0809 Neut_0832
protein
fig|6666666.60966.peg.803 CDS 735730 736488 1 + 759 hypothetical protein -none- D23_1c0810 Neut_0833
fig|6666666.60966.peg.804 CDS 737600 736485 −2 1116 COGs COG1502 -none- D23_1c0811 Neut_0834
fig|6666666.60966.peg.805 CDS 738943 737585 −1 1359 hypothetical protein -none- D23_1c0812 Neut_0835
fig|6666666.60966.peg.806 CDS 739386 739240 −3 147 hypothetical protein -none- D23_1c0813 NA
fig|6666666.60966.peg.807 CDS 740790 739585 −3 1206 DnaJ domain protein -none- D23_1c0814 Neut_0836
fig|6666666.60966.peg.809 CDS 742340 741159 −2 1182 Putative -none- D23_1c0815 Neut_0837
aminotransferase
fig|6666666.60966.peg.810 CDS 744454 742337 −1 2118 Conserved domain -none- D23_1c0816 Neut_0838
protein
fig|6666666.60966.peg.811 CDS 744823 744647 −1 177 hypothetical protein -none- D23_1c0817 NA
fig|6666666.60966.peg.812 CDS 745953 745228 −3 726 hypothetical protein -none- D23_1c0818 Neut_0840
fig|6666666.60966.peg.814 CDS 748473 746350 −3 2124 InterPro IPR000209 -none- D23_1c0820 Neut_0841
COGs COG1404
fig|6666666.60966.peg.815 CDS 748862 749245 2 + 384 ApaG protein EC49-61 D23_1c0822 Neut_0842
fig|6666666.60966.peg.816 CDS 749258 749992 2 + 735 Tetrapyrrole methylase -none- D23_1c0823 Neut_0843
family protein
fig|6666666.60966.peg.817 CDS 751297 750077 −1 1221 Proton/glutamate Glutamate and D23_1c0824 Neut_0844
symport protein @ Aspartate uptake in
Sodium/glutamate Bacteria
symport protein
fig|6666666.60966.peg.818 CDS 752156 751611 −2 546 Cytochrome c-type Biogenesis of c-type D23_1c0825 Neut_0845
biogenesis protein ResA cytochromes
fig|6666666.60966.peg.819 CDS 754247 752304 −2 1944 Cytochrome c-type Biogenesis of c-type D23_1c0826 Neut_0846
biogenesis protein cytochromes;
DsbD, protein-disulfide <br>Periplasmic disulfide
reductase (EC 1.8.1.8) interchange
fig|6666666.60966.peg.820 CDS 754631 754260 −2 372 Periplasmic divalent Copper homeostasis: D23_1c0827 Neut_0847
cation tolerance protein copper tolerance
CutA
fig|6666666.60966.peg.821 CDS 754715 754909 2 + 195 FIG00859483: -none- D23_1c0828 Neut_0848
hypothetical protein
fig|6666666.60966.peg.822 CDS 754952 755695 2 + 744 FIG00859295: -none- D23_1c0829 Neut_0849
hypothetical protein
fig|6666666.60966.peg.823 CDS 756608 755733 −2 876 Staphylococcus -none- D23_1c0830 Neut_0850
nuclease (SNase)
domain
fig|6666666.60966.peg.824 CDS 756650 757549 2 + 900 Methionine ABC Methionine D23_1c0831 Neut_0851
transporter ATP-binding Biosynthesis;
protein <br>Methionine
Degradation
fig|6666666.60966.peg.825 CDS 757674 758384 3 + 711 Uncharacterized ABC Lipopolysaccharide D23_1c0832 Neut_0852
transporter, permease assembly
component YrbE
fig|6666666.60966.peg.826 CDS 758396 758863 2 + 468 Uncharacterized ABC Lipopolysaccharide D23_1c0833 Neut_0853
transporter, periplasmic assembly
component YrbD
fig|6666666.60966.peg.827 CDS 758879 759496 2 + 618 Uncharacterized ABC Lipopolysaccharide D23_1c0834 Neut_0854
transporter, auxiliary assembly
component YrbC
fig|6666666.60966.peg.828 CDS 759503 759817 2 + 315 STAS domain -none- D23_1c0835 Neut_0855
fig|6666666.60966.peg.829 CDS 759879 760793 3 + 915 ABC-type multidrug CBSS-196164.1.peg.1690 D23_1c0836 Neut_0856
transport system,
ATPase component
fig|6666666.60966.peg.830 CDS 760790 761545 2 + 756 ABC-type multidrug CBSS-196164.1.peg.1690 D23_1c0837 Neut_0857
transport system,
permease component
fig|6666666.60966.peg.831 CDS 761590 761844 1 + 255 YrbA protein Broadly distributed D23_1c0838 Neut_0858
proteins not in
subsystems
fig|6666666.60966.peg.832 CDS 763192 761900 −1 1293 Dihydrolipoamide Dehydrogenase D23_1c0839 Neut_0859
succinyltransferase complexes; <br>TCA
component (E2) of 2- Cycle
oxoglutarate
dehydrogenase
complex (EC 2.3.1.61)
fig|6666666.60966.peg.833 CDS 766072 763214 −1 2859 2-oxoglutarate Dehydrogenase D23_1c0840 Neut_0860
dehydrogenase E1 complexes; <br>TCA
component (EC 1.2.4.2) Cycle
fig|6666666.60966.peg.834 CDS 767529 766234 −3 1296 Citrate synthase (si) (EC TCA Cycle D23_1c0841 Neut_0861
2.3.3.1)
fig|6666666.60966.peg.835 CDS 767808 767575 −3 234 YgfY COG2938 -none- D23_1c0842 Neut_0862
fig|6666666.60966.peg.836 CDS 768500 767805 −2 696 Succinate 5-FCL-like protein; D23_1c0843 Neut_0863
dehydrogenase iron- <br>Succinate
sulfur protein (EC dehydrogenase;
1.3.99.1) <br>TCA Cycle
fig|6666666.60966.peg.837 CDS 770059 768629 −1 1431 Threonine synthase (EC Threonine and D23_1c0844 Neut_0864
4.2.3.1) Homoserine
Biosynthesis
fig|6666666.60966.peg.839 CDS 771500 770184 −2 1317 Homoserine Methionine D23_1c0845 Neut_0865
dehydrogenase (EC Biosynthesis;
1.1.1.3) <br>Threonine and
Homoserine
Biosynthesis
fig|6666666.60966.peg.840 CDS 772833 771607 −3 1227 Aspartate CBSS-216591.1.peg.168; D23_1c0846 Neut_0866
aminotransferase (EC <br>Glutamine,
2.6.1.1) Glutamate, Aspartate
and Asparagine
Biosynthesis;
<br>Threonine and
Homoserine
Biosynthesis
fig|6666666.60966.peg.841 CDS 773025 773147 3 + 123 hypothetical protein -none- D23_1c0847 NA
fig|6666666.60966.peg.842 CDS 773125 773508 1 + 384 Membrane protein -none- D23_1c0848 Neut_0867
fig|6666666.60966.peg.843 CDS 773605 775980 1 + 2376 Phosphoenolpyruvate A Hypothetical that D23_1c0849 Neut_0868
synthase (EC 2.7.9.2) Clusters with PEP
Synthase; <br>Glycolysis
and Gluconeogenesis;
<br>Pyruvate
metabolism I:
anaplerotic reactions,
PEP
fig|6666666.60966.peg.844 CDS 775985 776812 2 + 828 FIG137360: A Hypothetical that D23_1c0850 Neut_0869
hypothetical protein Clusters with PEP
Synthase
fig|6666666.60966.peg.845 CDS 777372 776854 −3 519 NLP/P60 -none- D23_1c0851 Neut_0870
fig|6666666.60966.peg.846 CDS 779204 777507 −2 1698 Glutaminyl-tRNA tRNA aminoacylation, D23_1c0852 Neut_0871
synthetase (EC 6.1.1.18) Glu and Gln
fig|6666666.60966.peg.847 CDS 779394 779245 −3 150 hypothetical protein -none- D23_1c0853 NA
fig|6666666.60966.peg.848 CDS 779393 780991 2 + 1599 Lysyl-tRNA synthetase tRNA aminoacylation, D23_1c0854 Neut_0872
(class II) (EC 6.1.1.6) Lys
fig|6666666.60966.peg.849 CDS 781093 781749 1 + 657 FIG00858849: -none- D23_1c0855 Neut_0873
hypothetical protein
fig|6666666.60966.peg.850 CDS 781999 782385 1 + 387 hypothetical protein -none- D23_1c0856 NA
fig|6666666.60966.peg.851 CDS 782415 782747 3 + 333 Mobile element protein -none- D23_1c0857 NA
fig|6666666.60966.peg.852 CDS 782952 783485 3 + 534 hypothetical protein -none- D23_1c0858 Neut_0875
fig|6666666.60966.peg.853 CDS 783597 783767 3 + 171 hypothetical protein -none- D23_1c0859 NA
fig|6666666.60966.peg.854 CDS 784671 784048 −3 624 Trp repressor binding -none- D23_1c0860 Neut_0876
protein
fig|6666666.60966.peg.855 CDS 785041 784757 −1 285 Mobile element protein -none- D23_1c0861 NA
fig|6666666.60966.peg.857 CDS 787300 785558 −1 1743 Beta-glucosidase (EC -none- D23_1c0862 Neut_0879
3.2.1.21)
fig|6666666.60966.peg.858 CDS 788430 787327 −3 1104 Mobile element protein -none- D23_1c0863 Neut_1278
fig|6666666.60966.peg.859 CDS 789557 789045 −2 513 Mobile element protein -none- D23_1c0864 Neut_1624
fig|6666666.60966.peg.860 CDS 789894 789589 −3 306 Mobile element protein -none- D23_1c0865 Neut_1371
fig|6666666.60966.peg.861 CDS 790136 789951 −2 186 Mobile element protein -none- D23_1c0866 Neut_2500
fig|6666666.60966.peg.863 CDS 792236 790869 −2 1368 ATP-dependent RNA ATP-dependent RNA D23_1c0869 Neut_0889
helicase RhlE helicases, bacterial
fig|6666666.60966.peg.865 CDS 794169 792502 −3 1668 ATPase components of -none- D23_1c0871 Neut_0890
ABC transporters with
duplicated ATPase
domains
fig|6666666.60966.peg.867 CDS 794389 794568 1 + 180 hypothetical protein -none- D23_1c0872 NA
fig|6666666.60966.peg.868 CDS 795019 795636 1 + 618 FIG123464: Cell wall related cluster D23_1c0873 Neut_0891
Polysaccharide export
protein
fig|6666666.60966.peg.869 CDS 795679 797223 1 + 1545 Lipopolysaccharide Cell wall related cluster D23_1c0874 Neut_0892
biosynthesis chain
length determinant
protein
fig|6666666.60966.peg.870 CDS 797305 798243 1 + 939 Protein-tyrosine kinase Cell wall related cluster D23_1c0875 Neut_0893
(EC 2.7.1.112)
fig|6666666.60966.peg.871 CDS 798243 799823 3 + 1581 Glycine-rich cell wall Cell wall related cluster D23_1c0876 Neut_0894
structural protein
precursor
fig|6666666.60966.peg.872 CDS 799837 800670 1 + 834 FIG022606: AAA ATPase Cell wall related cluster D23_1c0877 Neut_0895
fig|6666666.60966.peg.873 CDS 800676 801515 3 + 840 FIG004655: Cell wall related cluster D23_1c0878 Neut_0896
Polysaccharide
deacetylase
fig|6666666.60966.peg.875 CDS 801827 802591 2 + 765 FIG070318: Cell wall related cluster D23_1c0879 Neut_0897
hypothetical protein
fig|6666666.60966.peg.876 CDS 802597 803808 1 + 1212 FIG137776: Cell wall related cluster D23_1c0880 Neut_0898
Glycosyltransferase
fig|6666666.60966.peg.877 CDS 803877 805457 3 + 1581 Eight transmembrane Cell wall related cluster; D23_1c0881 Neut_0899
protein EpsH/EpsI <br>Cell wall related
protein cluster
fig|6666666.60966.peg.878 CDS 805493 806635 2 + 1143 FIG040338: Glycosyl Cell wall related cluster D23_1c0882 Neut_0900
transferase
fig|6666666.60966.peg.879 CDS 806677 808611 1 + 1935 Asparagine synthetase Cell wall related cluster; D23_1c0884 Neut_0901
[glutamine-hydrolyzing] <br>Glutamine,
(EC 6.3.5.4) AsnH Glutamate, Aspartate
and Asparagine
Biosynthesis
fig|6666666.60966.peg.880 CDS 808662 809654 3 + 993 FIG00859061: -none- D23_1c0885 Neut_0902
hypothetical protein
fig|6666666.60966.peg.881 CDS 809654 810592 2 + 939 FIG00859041: -none- D23_1c0886 Neut_0903
hypothetical protein
fig|6666666.60966.peg.882 CDS 810623 811849 2 + 1227 hypothetical protein -none- D23_1c0887 Neut_0903
fig|6666666.60966.peg.883 CDS 812814 811852 −3 963 Mobile element protein -none- D23_1c0888 Neut_1746
fig|6666666.60966.peg.884 CDS 813957 813094 −3 864 Mobile element protein -none- D23_1c0889 Neut_2192
fig|6666666.60966.peg.885 CDS 814250 813954 −2 297 hypothetical protein -none- D23_1c0890 Neut_2193
fig|6666666.60966.peg.887 CDS 814624 815706 1 + 1083 glycosyltransferase -none- D23_1c0891 NA
fig|6666666.60966.peg.888 CDS 817016 816339 −2 678 hypothetical protein -none- D23_1c0892 NA
fig|6666666.60966.peg.889 CDS 818253 817114 −3 1140 hypothetical protein -none- D23_1c0893 Neut_0906
fig|6666666.60966.peg.890 CDS 819313 818282 −1 1032 hypothetical protein -none- D23_1c0894 Neut_2116
fig|6666666.60966.peg.891 CDS 820446 819313 −3 1134 hypothetical protein -none- D23_1c0895 Neut_0905
fig|6666666.60966.peg.892 CDS 821935 820481 −1 1455 hypothetical protein -none- D23_1c0896 Neut_0909
fig|6666666.60966.peg.893 CDS 823840 822074 −1 1767 Asparagine synthetase Cyanophycin D23_1c0897 Neut_0910
[glutamine-hydrolyzing] Metabolism;
(EC 6.3.5.4) <br>Glutamate and
Aspartate uptake in
Bacteria; <br>Glutamine,
Glutamate, Aspartate
and Asparagine
Biosynthesis
fig|6666666.60966.peg.895 CDS 824361 825170 3 + 810 hypothetical protein -none- D23_1c0898 Neut_0911
fig|6666666.60966.peg.896 CDS 825186 826454 3 + 1269 hypothetical protein -none- D23_1c0899 Neut_0912
fig|6666666.60966.peg.897 CDS 827356 826457 −1 900 hypothetical protein -none- D23_1c0900 Neut_0913
fig|6666666.60966.peg.898 CDS 827907 827404 −3 504 Low molecular weight LMPTP YfkJ cluster; D23_1c0901 Neut_0914
protein tyrosine <br>Protein deglycation
phosphatase (EC
3.1.3.48)
fig|6666666.60966.peg.899 CDS 828032 829777 2 + 1746 ABC transporter, fused -none- D23_1c0902 Neut_0915
permease and ATPase
domains
fig|6666666.60966.peg.900 CDS 830559 829798 −3 762 Sulfur carrier protein Thiamin biosynthesis D23_1c0903 Neut_0916
adenylyltransferase
ThiF
fig|6666666.60966.peg.901 CDS 832018 830588 −1 1431 Carboxyl-terminal Phosphoglycerate D23_1c0904 Neut_0917
protease (EC mutase protein family
3.4.21.102)
fig|6666666.60966.peg.902 CDS 833380 832100 −1 1281 Lipoprotein NlpD Stationary phase repair D23_1c0905 Neut_0918
cluster
fig|6666666.60966.peg.903 CDS 834129 833380 −3 750 Phosphoglycerate Glycolysis and D23_1c0906 Neut_0919
mutase (EC 5.4.2.1) Gluconeogenesis;
<br>Phosphoglycerate
mutase protein family
fig|6666666.60966.peg.904 CDS 834328 835086 1 + 759 Triosephosphate CBSS- D23_1c0907 Neut_0920
isomerase (EC 5.3.1.1) 331978.3.peg.2915;
<br>Calvin-Benson cycle;
<br>Glycolysis and
Gluconeogenesis
fig|6666666.60966.peg.905 CDS 835105 835470 1 + 366 Preprotein translocase CBSS-331978.3.peg.2915 D23_1c0908 Neut_0921
subunit SecG (TC
3.A.5.1.1)
fig|6666666.60966.peg.906 CDS 835677 836045 3 + 369 NADH ubiquinone NADH ubiquinone D23_1c0910 Neut_0922
oxidoreductase chain A oxidoreductase;
(EC 1.6.5.3) <br>Respiratory
Complex I
fig|6666666.60966.peg.907 CDS 836049 836525 3 + 477 NADH-ubiquinone NADH ubiquinone D23_1c0911 Neut_0923
oxidoreductase chain B oxidoreductase;
(EC 1.6.5.3) <br>Respiratory
Complex I
fig|6666666.60966.peg.908 CDS 836535 837155 3 + 621 NADH-ubiquinone NADH ubiquinone D23_1c0912 Neut_0924
oxidoreductase chain C oxidoreductase;
(EC 1.6.5.3) <br>Respiratory
Complex I
fig|6666666.60966.peg.909 CDS 837213 838466 3 + 1254 NADH-ubiquinone NADH ubiquinone D23_1c0913 Neut_0925
oxidoreductase chain D oxidoreductase;
(EC 1.6.5.3) <br>Respiratory
Complex I
fig|6666666.60966.peg.910 CDS 838475 838951 2 + 477 NADH-ubiquinone NADH ubiquinone D23_1c0914 Neut_0926
oxidoreductase chain E oxidoreductase;
(EC 1.6.5.3) <br>Respiratory
Complex I
fig|6666666.60966.peg.911 CDS 838948 840225 1 + 1278 NADH-ubiquinone NADH ubiquinone D23_1c0915 Neut_0927
oxidoreductase chain F oxidoreductase;
(EC 1.6.5.3) <br>Respiratory
Complex I
fig|6666666.60966.peg.912 CDS 840287 842692 2 + 2406 NADH-ubiquinone NADH ubiquinone D23_1c0917 Neut_0928
oxidoreductase chain G oxidoreductase;
(EC 1.6.5.3) <br>Respiratory
Complex I
fig|6666666.60966.peg.913 CDS 842717 843814 2 + 1098 NADH-ubiquinone NADH ubiquinone D23_1c0918 Neut_0929
oxidoreductase chain H oxidoreductase;
(EC 1.6.5.3) <br>Respiratory
Complex I
fig|6666666.60966.peg.914 CDS 843832 844320 1 + 489 NADH-ubiquinone NADH ubiquinone D23_1c0919 Neut_0930
oxidoreductase chain I oxidoreductase;
(EC 1.6.5.3) <br>Respiratory
Complex I
fig|6666666.60966.peg.915 CDS 844339 844944 1 + 606 NADH-ubiquinone NADH ubiquinone D23_1c0920 Neut_0931
oxidoreductase chain J oxidoreductase;
(EC 1.6.5.3) <br>Respiratory
Complex I
fig|6666666.60966.peg.916 CDS 845000 845305 2 + 306 NADH-ubiquinone NADH ubiquinone D23_1c0921 Neut_0932
oxidoreductase chain K oxidoreductase;
(EC 1.6.5.3) <br>Respiratory
Complex I
fig|6666666.60966.peg.917 CDS 845366 847312 2 + 1947 NADH-ubiquinone NADH ubiquinone D23_1c0922 Neut_0933
oxidoreductase chain L oxidoreductase;
(EC 1.6.5.3) <br>Respiratory
Complex I
fig|6666666.60966.peg.918 CDS 847401 848882 3 + 1482 NADH-ubiquinone NADH ubiquinone D23_1c0923 Neut_0934
oxidoreductase chain M oxidoreductase;
(EC 1.6.5.3) <br>Respiratory
Complex I
fig|6666666.60966.peg.919 CDS 848945 850390 2 + 1446 NADH-ubiquinone NADH ubiquinone D23_1c0924 Neut_0935
oxidoreductase chain N oxidoreductase;
(EC 1.6.5.3) <br>Respiratory
Complex I
fig|6666666.60966.peg.920 CDS 851362 850412 −1 951 L-sorbosone -none- D23_1c0925 Neut_0936
dehydrogenase
fig|6666666.60966.peg.921 CDS 851619 853541 3 + 1923 Chaperone protein Protein chaperones D23_1c0926 Neut_0937
HtpG
fig|6666666.60966.peg.922 CDS 853878 854918 3 + 1041 WD40 domain protein -none- D23_1c0927 Neut_0938
beta Propeller
fig|6666666.60966.peg.924 CDS 855176 855598 2 + 423 Mobile element protein -none- D23_1c0929 Neut_0939
fig|6666666.60966.peg.925 CDS 855805 858447 1 + 2643 Hopanoid-associated Hopanes D23_1c0930 Neut_0940
RND transporter, HpnN
fig|6666666.60966.peg.926 CDS 859079 858483 −2 597 DedA protein Colicin V and Bacteriocin D23_1c0931 Neut_0941
Production Cluster;
<br>DedA family of inner
membrane proteins;
<br>Uptake of selenate
and selenite
fig|6666666.60966.peg.928 CDS 861652 859424 −1 2229 Probable -none- D23_1c0933 Neut_0942
transmembrane protein
fig|6666666.60966.peg.929 CDS 861629 861754 2 + 126 hypothetical protein -none- D23_1c0934 NA
fig|6666666.60966.peg.930 CDS 861857 861720 −2 138 hypothetical protein -none- D23_1c0935 NA
fig|6666666.60966.peg.931 CDS 861928 862341 1 + 414 Protoporphyrinogen IX Heme and Siroheme D23_1c0936 Neut_0943
oxidase, novel form, Biosynthesis
HemJ (EC 1.3.—.—)
fig|6666666.60966.peg.932 CDS 862893 862363 −3 531 Peptide deformylase Bacterial RNA- D23_1c0937 Neut_0944
(EC 3.5.1.88) metabolizing Zn-
dependent hydrolases;
<br>Translation
termination factors
bacterial
fig|6666666.60966.peg.933 CDS 863632 862886 −1 747 5&#39;- -none- D23_1c0938 Neut_0945
methylthioadenosine
phosphorylase (EC
2.4.2.28)
fig|6666666.60966.peg.934 CDS 865800 863752 −3 2049 DNA ligase (EC 6.5.1.2) DNA Repair Base D23_1c0939 Neut_0946
Excision
fig|6666666.60966.peg.935 CDS 865959 866654 3 + 696 hypothetical protein -none- D23_1c0940 Neut_0947
fig|6666666.60966.peg.936 CDS 867392 867021 −2 372 Flagellar biosynthesis Flagellum D23_1c0941 Neut_0948
protein FliT
fig|6666666.60966.peg.937 CDS 867859 867389 −1 471 Flagellar biosynthesis Flagellum D23_1c0942 Neut_0949
protein FliS
fig|6666666.60966.peg.938 CDS 869359 867917 −1 1443 Flagellar hook- Flagellum D23_1c0943 Neut_0950
associated protein FliD
fig|6666666.60966.peg.939 CDS 870186 869716 −3 471 hypothetical protein -none- D23_1c0944 Neut_0951
fig|6666666.60966.peg.940 CDS 870616 870891 1 + 276 hypothetical protein -none- D23_1c0945 Neut_0952
fig|6666666.60966.peg.941 CDS 871905 870955 −3 951 Glutathione synthetase Glutathione: D23_1c0946 Neut_0953
(EC 6.3.2.3) Biosynthesis and
gamma-glutamyl cycle;
<br>Heat shock dnaK
gene cluster extended
fig|6666666.60966.peg.942 CDS 873212 871902 −2 1311 Glutamate--cysteine Glutathione: D23_1c0947 Neut_0954
ligase (EC 6.3.2.2), Biosynthesis and
divergent, of Alpha- and gamma-glutamyl cycle
Beta-proteobacteria
type
fig|6666666.60966.peg.944 CDS 873411 873722 3 + 312 LSU ribosomal protein CBSS-176279.3.peg.868 D23_1c0949 Neut_0955
L21p
fig|6666666.60966.peg.945 CDS 873734 873991 2 + 258 LSU ribosomal protein CBSS-176279.3.peg.868 D23_1c0950 Neut_0956
L27p
fig|6666666.60966.peg.946 CDS 873991 874104 1 + 114 hypothetical protein -none- D23_1c0951 NA
fig|6666666.60966.peg.947 CDS 874121 875152 2 + 1032 GTP-binding protein CBSS-176279.3.peg.868; D23_1c0952 Neut_0957
Obg <br>Universal GTPases
fig|6666666.60966.peg.948 CDS 875158 876279 1 + 1122 Glutamate 5-kinase (EC Proline Synthesis; D23_1c0953 Neut_0958
2.7.2.11)/RNA-binding <br>Proline Synthesis
C-terminal domain PUA
fig|6666666.60966.peg.949 CDS 876330 877331 3 + 1002 InterPro IPR000379 -none- D23_1c0954 Neut_0959
COGs COG0429
fig|6666666.60966.peg.950 CDS 877428 878744 3 + 1317 Phosphate regulon High affinity phosphate D23_1c0955 Neut_0960
sensor protein PhoR transporter and control
(SphS) (EC 2.7.13.3) of PHO regulon;
<br>PhoR-PhoB two-
component regulatory
system; <br>Phosphate
metabolism
fig|6666666.60966.peg.951 CDS 879101 879343 2 + 243 RNA-binding protein Hfl operon; D23_1c0957 Neut_0961
Hfq <br>Polyadenylation
bacterial; <br>Possible
RNA degradation cluster
fig|6666666.60966.peg.952 CDS 879345 880478 3 + 1134 GTP-binding protein Hfl operon; <br>Possible D23_1c0958 Neut_0962
HflX RNA degradation cluster;
<br>Universal GTPases
fig|6666666.60966.peg.953 CDS 880535 881725 2 + 1191 HflK protein Hfl operon; <br>Scaffold D23_1c0959 Neut_0963
proteins for [4Fe—4S]
cluster assembly (MRP
family)
fig|6666666.60966.peg.954 CDS 881725 882603 1 + 879 HflC protein Hfl operon; <br>Scaffold D23_1c0960 Neut_0964
proteins for [4Fe—4S]
cluster assembly (MRP
family)
fig|6666666.60966.peg.955 CDS 882732 882917 3 + 186 Putative inner Hfl operon D23_1c0961 Neut_0965
membrane protein YjeT
(clustered with HflC)
fig|6666666.60966.peg.956 CDS 882992 884164 2 + 1173 ATP Histidine Biosynthesis D23_1c0962 Neut_0966
phosphoribosyltransferase
regulatory subunit
(EC 2.4.2.17)
fig|6666666.60966.peg.957 CDS 884298 885596 3 + 1299 Adenylosuccinate Purine conversions D23_1c0963 Neut_0967
synthetase (EC 6.3.4.4)
fig|6666666.60966.peg.958 CDS 885982 885665 −1 318 FIG00858510: -none- D23_1c0964 Neut_0968
hypothetical protein
fig|6666666.60966.peg.959 CDS 886361 886164 −2 198 FIG00859475: -none- D23_1c0966 Neut_0969
hypothetical protein
fig|6666666.60966.peg.961 CDS 889010 886635 −2 2376 ATP-dependent Proteasome bacterial; D23_1c0967 Neut_0970
protease La (EC <br>Proteolysis in
3.4.21.53) Type I bacteria, ATP-dependent
fig|6666666.60966.peg.962 CDS 889609 889160 −1 450 CBS domain protein -none- D23_1c0968 Neut_0971
fig|6666666.60966.peg.963 CDS 890160 889657 −3 504 hypothetical protein -none- D23_1c0969 Neut_0972
fig|6666666.60966.peg.964 CDS 890193 890345 3 + 153 hypothetical protein -none- D23_1c0970 NA
fig|6666666.60966.peg.965 CDS 890326 890442 1 + 117 hypothetical protein -none- D23_1c0971 NA
fig|6666666.60966.peg.966 CDS 890503 891663 1 + 1161 ABC-transporter -none- D23_1c0972 Neut_0973
permease protein
fig|6666666.60966.peg.967 CDS 891663 892352 3 + 690 ABC transporter, ATP- -none- D23_1c0973 Neut_0974
binding protein
fig|6666666.60966.peg.968 CDS 892533 893492 3 + 960 Membrane protein -none- D23_1c0974 Neut_0975
fig|6666666.60966.peg.969 CDS 895517 893706 −2 1812 Sodium/hydrogen -none- D23_1c0976 Neut_0976
exchanger family
protein
fig|6666666.60966.peg.970 CDS 895888 896574 1 + 687 FIG00859851: -none- D23_1c0978 Neut_0977
hypothetical protein
fig|6666666.60966.peg.971 CDS 897991 897029 −1 963 Mobile element protein -none- D23_1c0979 Neut_0978
fig|6666666.60966.peg.972 CDS 899539 898112 −1 1428 Pyruvate kinase (EC Glycerate metabolism; D23_1c0980 Neut_0979
2.7.1.40) <br>Glycolysis and
Gluconeogenesis;
<br>Pyruvate
metabolism I:
anaplerotic reactions,
PEP
fig|6666666.60966.peg.973 CDS 899838 899563 −3 276 hypothetical protein -none- D23_1c0981 Neut_0980
fig|6666666.60966.peg.974 CDS 900234 900398 3 + 165 hypothetical protein -none- D23_1c0982 NA
fig|6666666.60966.peg.975 CDS 903871 900686 −1 3186 TonB-dependent Ton and Tol transport D23_1c0983 Neut_1076
receptor systems
fig|6666666.60966.peg.976 CDS 904856 903873 −2 984 hypothetical protein -none- D23_1c0984 Neut_1077
fig|6666666.60966.peg.977 CDS 906168 904861 −3 1308 putative helicase -none- D23_1c0985 Neut_1078
fig|6666666.60966.peg.978 CDS 908497 906392 −1 2106 sucrose synthase -none- D23_1c0988 Neut_1079
fig|6666666.60966.peg.979 CDS 910925 908787 −2 2139 Sucrose phosphate -none- D23_1c0989 Neut_1080
synthase
fig|6666666.60966.peg.980 CDS 911865 910936 −3 930 Fructokinase (EC -none- D23_1c0990 Neut_1081
2.7.1.4)
fig|6666666.60966.peg.981 CDS 914147 912060 −2 2088 Excinuclease ABC DNA repair, UvrABC D23_1c0991 Neut_1082
subunit B system
fig|6666666.60966.peg.982 CDS 914226 915419 3 + 1194 Aspartate CBSS-216591.1.peg.168; D23_1c0992 Neut_1083
aminotransferase (EC <br>Glutamine,
2.6.1.1) Glutamate, Aspartate
and Asparagine
Biosynthesis;
<br>Threonine and
Homoserine
Biosynthesis
fig|6666666.60966.peg.983 CDS 915551 915688 2 + 138 hypothetical protein -none- D23_1c0993 NA
fig|6666666.60966.peg.984 CDS 915891 916277 3 + 387 Mobile element protein -none- D23_1c0994 Neut_0884
fig|6666666.60966.peg.985 CDS 916240 916695 1 + 456 Mobile element protein -none- D23_1c0995 Neut_2502
fig|6666666.60966.peg.986 CDS 916764 917726 3 + 963 Mobile element protein -none- D23_1c0996 Neut_1862
fig|6666666.60966.peg.987 CDS 918535 918419 −1 117 hypothetical protein -none- D23_1c0997 NA
fig|6666666.60966.peg.988 CDS 919358 918504 −2 855 DNA-directed RNA RNA polymerase D23_1c0998 NA
polymerase alpha bacterial
subunit (EC 2.7.7.6)
fig|6666666.60966.peg.989 CDS 919525 919409 −1 117 hypothetical protein -none- D23_1c0999 Neut_1085
fig|6666666.60966.peg.990 CDS 919587 919787 3 + 201 Glutathione synthetase Glutathione: D23_1c0999 Neut_1085
(EC 6.3.2.3) Biosynthesis and
gamma-glutamyl cycle;
<br>Heat shock dnaK
gene cluster extended
fig|6666666.60966.peg.991 CDS 919919 920287 2 + 369 FIG00858546: -none- D23_1c1000 Neut_1086
hypothetical protein
fig|6666666.60966.peg.992 CDS 920496 921119 3 + 624 bacteriocin resistance -none- D23_1c1001 Neut_1087
protein, putative
fig|6666666.60966.peg.993 CDS 921168 921644 3 + 477 FIG00859915: -none- D23_1c1002 Neut_1088
hypothetical protein
fig|6666666.60966.peg.994 CDS 921659 923050 2 + 1392 FIG00858837: -none- D23_1c1003 Neut_1089
hypothetical protein
fig|6666666.60966.peg.995 CDS 923533 923105 −1 429 Zn-dependent -none- D23_1c1004 Neut_1090
hydrolases, including
glyoxylases
fig|6666666.60966.peg.996 CDS 923845 924936 1 + 1092 Diaminohydroxyphosphoribosylaminopyrimidine Riboflavin, FMN and FAD D23_1c1005 Neut_1091
deaminase (EC metabolism;
3.5.4.26)/5-amino-6- <br>Riboflavin, FMN and
(5- FAD metabolism;
phosphoribosylamino)uracil <br>Riboflavin, FMN and
reductase (EC FAD metabolism in
1.1.1.193) plants; <br>Riboflavin,
FMN and FAD
metabolism in plants;
<br>Riboflavin synthesis
cluster; <br>Riboflavin
synthesis cluster
fig|6666666.60966.peg.997 CDS 925042 926262 1 + 1221 Glycosyl transferase, -none- D23_1c1006 Neut_1092
group 1
fig|6666666.60966.peg.998 CDS 926363 927685 2 + 1323 UDP-glucose -none- D23_1c1007 Neut_1093
dehydrogenase (EC
1.1.1.22)
fig|6666666.60966.peg.999 CDS 928127 928318 2 + 192 hypothetical protein -none- D23_1c1009 Neut_1095
fig|6666666.60966.peg.1000 CDS 928500 928315 −3 186 hypothetical protein -none- D23_1c1010 NA
fig|6666666.60966.peg.1002 CDS 929085 930362 3 + 1278 InterPro IPR001296 -none- D23_1c1011 Neut_1096
COGs COG0438
fig|6666666.60966.peg.1003 CDS 930467 931729 2 + 1263 Coenzyme F390 -none- D23_1c1012 Neut_1097
synthetase
fig|6666666.60966.peg.1004 CDS 932351 931731 −2 621 exopolysaccharide -none- D23_1c1013 Neut_1098
synthesis protein ExoD-
related protein
fig|6666666.60966.peg.1005 CDS 932631 933110 3 + 480 FIG00859304: -none- D23_1c1014 Neut_1099
hypothetical protein
fig|6666666.60966.peg.1006 CDS 933200 934357 2 + 1158 FIG010505: -none- D23_1c1015 Neut_1100
hypothetical protein
fig|6666666.60966.peg.1007 CDS 934409 935224 2 + 816 FIG00858774: -none- D23_1c1016 Neut_1101
hypothetical protein
fig|6666666.60966.peg.1008 CDS 935243 936316 2 + 1074 Probable -none- D23_1c1017 Neut_1102
transmembrane protein
fig|6666666.60966.peg.1009 CDS 936361 937383 1 + 1023 FIG000906: Predicted -none- D23_1c1018 Neut_1103
Permease
fig|6666666.60966.peg.1010 CDS 937391 938608 2 + 1218 CDP-alcohol -none- D23_1c1019 Neut_1104
phosphatidyltransferase
fig|6666666.60966.peg.1011 CDS 938637 939593 3 + 957 FIG00480695: -none- D23_1c1020 Neut_1105
hypothetical protein
fig|6666666.60966.peg.1012 CDS 939607 940575 1 + 969 FIG00859274: -none- D23_1c1021 Neut_1106
hypothetical protein
fig|6666666.60966.peg.1013 CDS 940636 941283 1 + 648 FIG00859276: -none- D23_1c1022 Neut_1107
hypothetical protein
fig|6666666.60966.peg.1014 CDS 941749 941294 −1 456 Zn-ribbon-containing, DNA replication cluster 1 D23_1c1023 Neut_1108
possibly RNA-binding
protein and truncated
derivatives
fig|6666666.60966.peg.1016 CDS 942037 942186 1 + 150 hypothetical protein -none- D23_1c1024 NA
fig|6666666.60966.peg.1017 CDS 942242 944971 2 + 2730 Protein export -none- D23_1c1025 Neut_1109
cytoplasm protein SecA
ATPase RNA helicase
(TC 3.A.5.1.1)
fig|6666666.60966.peg.1018 CDS 945151 945756 1 + 606 Ubiquinol-cytochrome C Ubiquinone D23_1c1026 Neut_1110
reductase iron-sulfur Menaquinone-
subunit (EC 1.10.2.2) cytochrome c reductase
complexes
fig|6666666.60966.peg.1019 CDS 945758 947005 2 + 1248 Ubiquinol--cytochrome Ubiquinone D23_1c1027 Neut_1111
c reductase, Menaquinone-
cytochrome B subunit cytochrome c reductase
(EC 1.10.2.2) complexes
fig|6666666.60966.peg.1020 CDS 947002 947706 1 + 705 ubiquinol cytochrome C Ubiquinone D23_1c1028 Neut_1112
oxidoreductase, Menaquinone-
cytochrome C1 subunit cytochrome c reductase
complexes
fig|6666666.60966.peg.1021 CDS 947758 948357 1 + 600 Stringent starvation Carbon Starvation D23_1c1029 Neut_1113
protein A
fig|6666666.60966.peg.1023 CDS 949015 949215 1 + 201 hypothetical protein -none- D23_1c1031 Neut_2449
fig|6666666.60966.peg.1024 CDS 949203 949682 3 + 480 Mobile element protein -none- D23_1c1032 Neut_2417
fig|6666666.60966.peg.1025 CDS 950361 950651 3 + 291 Mobile element protein -none- D23_1c1034 Neut_2190
fig|6666666.60966.peg.1026 CDS 951943 950696 −1 1248 Mobile element protein -none- D23_1c1035 Neut_0357
fig|6666666.60966.peg.1027 CDS 952378 952208 −1 171 hypothetical protein -none- D23_1c1036 NA
fig|6666666.60966.peg.1028 CDS 953114 952689 −2 426 C4-type zinc finger Zinc regulated enzymes D23_1c1037 Neut_1117
protein, DksA/TraR
family
fig|6666666.60966.peg.1029 CDS 955194 953479 −3 1716 Adenylate cyclase (EC cAMP signaling in D23_1c1038 Neut_1118
4.6.1.1) bacteria
fig|6666666.60966.peg.1030 CDS 956008 955157 −1 852 HD domain -none- D23_1c1039 Neut_1119
fig|6666666.60966.peg.1032 CDS 956563 957111 1 + 549 InterPro IPR000345 -none- D23_1c1042 Neut_1126
fig|6666666.60966.peg.1033 CDS 958663 957200 −1 1464 3-polyprenyl-4- Ubiquinone D23_1c1043 Neut_1127
hydroxybenzoate Biosynthesis;
carboxy-lyase (EC <br>Ubiquinone
4.1.1.—) Biosynthesis-gjo
fig|6666666.60966.peg.1034 CDS 959616 958756 −3 861 4-hydroxybenzoate Ubiquinone D23_1c1045 Neut_1128
polyprenyltransferase Biosynthesis;
(EC 2.5.1.39) <br>Ubiquinone
Biosynthesis-gjo
fig|6666666.60966.peg.1035 CDS 960159 959695 −3 465 Chorismate--pyruvate Ubiquinone D23_1c1046 Neut_1129
lyase (EC 4.1.3.40) Biosynthesis;
<br>Ubiquinone
Biosynthesis-gjo
fig|6666666.60966.peg.1036 CDS 960706 960299 −1 408 twitching motility -none- D23_1c1047 Neut_1130
protein PilG
fig|6666666.60966.peg.1037 CDS 962283 960874 −3 1410 Potassium uptake Hyperosmotic potassium D23_1c1048 Neut_1131
protein TrkH uptake; <br>Potassium
homeostasis;
<br>Potassium
homeostasis
fig|6666666.60966.peg.1038 CDS 963803 962355 −2 1449 Trk system potassium Bacterial RNA- D23_1c1049 Neut_1132
uptake protein TrkA metabolizing Zn-
dependent hydrolases;
<br>Hyperosmotic
potassium uptake;
<br>Possible RNA
degradation cluster;
<br>Potassium
homeostasis;
<br>Potassium
homeostasis
fig|6666666.60966.peg.1039 CDS 965344 964070 −1 1275 FIG00858490: -none- D23_1c1050 Neut_1133
hypothetical protein
fig|6666666.60966.peg.1040 CDS 965355 965495 3 + 141 hypothetical protein -none- D23_1c1051 NA
fig|6666666.60966.peg.1041 CDS 965968 965477 −1 492 Starvation lipoprotein Carbon Starvation D23_1c1052 Neut_1134
Slp paralog
fig|6666666.60966.peg.1042 CDS 966371 967021 2 + 651 Septum site- Bacterial Cell Division; D23_1c1054 Neut_1135
determining protein <br>Bacterial
MinC Cytoskeleton;
<br>Bacterial cell
division cluster;
<br>Septum site-
determining cluster Min
fig|6666666.60966.peg.1043 CDS 967047 967856 3 + 810 Septum site- Bacterial Cell Division; D23_1c1055 Neut_1136
determining protein <br>Bacterial
MinD Cytoskeleton;
<br>Bacterial cell
division cluster;
<br>Septum site-
determining cluster Min
fig|6666666.60966.peg.1044 CDS 967856 968152 2 + 297 Cell division topological Bacterial Cell Division; D23_1c1056 Neut_1137
specificity factor MinE <br>Bacterial
Cytoskeleton;
<br>Bacterial cell
division cluster;
<br>Septum site-
determining cluster Min
fig|6666666.60966.peg.1045 CDS 968284 968895 1 + 612 Outer membrane A Gammaproteobacteria D23_1c1057 Neut_1138
lipoprotein LolB Cluster Relating to
Translation;
<br>Lipopolysaccharide
assembly;
<br>Lipoprotein sorting
system
fig|6666666.60966.peg.1046 CDS 968920 969756 1 + 837 4-diphosphocytidyl-2-C- A Gammaproteobacteria D23_1c1058 Neut_1139
methyl-D-erythritol Cluster Relating to
kinase (EC 2.7.1.148) Translation;
<br>Isoprenoid
Biosynthesis;
<br>Nonmevalonate
Branch of Isoprenoid
Biosynthesis
fig|6666666.60966.peg.1047 CDS 969932 970882 2 + 951 Ribose-phosphate A Gammaproteobacteria D23_1c1060 Neut_1140
pyrophosphokinase (EC Cluster Relating to
2.7.6.1) Translation; <br>De
Novo Purine
Biosynthesis;
<br>Pentose phosphate
pathway;
<br>Transcription repair
cluster
fig|6666666.60966.peg.1048 CDS 970936 971544 1 + 609 LSU ribosomal protein Transcription repair D23_1c1061 Neut_1141
L25p cluster
fig|6666666.60966.peg.1049 CDS 971667 972236 3 + 570 Peptidyl-tRNA Sporulation-associated D23_1c1062 Neut_1142
hydrolase (EC 3.1.1.29) proteins with broader
functions;
<br>Transcription repair
cluster; <br>Translation
termination factors
bacterial
fig|6666666.60966.peg.1050 CDS 972291 973382 3 + 1092 GTP-binding and nucleic Universal GTPases D23_1c1063 Neut_1143
acid-binding protein
YchF
fig|6666666.60966.peg.1051 CDS 973589 973461 −2 129 hypothetical protein -none- D23_1c1064 NA
fig|6666666.60966.peg.1052 CDS 973891 975303 1 + 1413 3-isopropylmalate Branched-Chain Amino D23_1c1066 Neut_1144
dehydratase large Acid Biosynthesis;
subunit (EC 4.2.1.33) <br>Leucine
Biosynthesis
fig|6666666.60966.peg.1053 CDS 975336 975464 3 + 129 FIG00858504: -none- D23_1c1067 Neut_1145
hypothetical protein
fig|6666666.60966.peg.1054 CDS 975470 976108 2 + 639 3-isopropylmalate Branched-Chain Amino D23_1c1068 Neut_1146
dehydratase small Acid Biosynthesis;
subunit (EC 4.2.1.33) <br>Leucine
Biosynthesis
fig|6666666.60966.peg.1055 CDS 976133 977203 2 + 1071 3-isopropylmalate Branched-Chain Amino D23_1c1069 Neut_1147
dehydrogenase (EC Acid Biosynthesis;
1.1.1.85) <br>Leucine
Biosynthesis
fig|6666666.60966.peg.1056 CDS 977333 978457 2 + 1125 Aspartate- Lysine Biosynthesis DAP D23_1c1070 Neut_1148
semialdehyde Pathway, GJO scratch;
dehydrogenase (EC <br>Threonine and
1.2.1.11) Homoserine
Biosynthesis
fig|6666666.60966.peg.1057 CDS 978574 980970 1 + 2397 hypothetical protein -none- D23_1c1071 Neut_1149
fig|6666666.60966.peg.1058 CDS 981084 981917 3 + 834 tRNA pseudouridine Colicin V and Bacteriocin D23_1c1072 Neut_1150
synthase A (EC 4.2.1.70) Production Cluster;
<br>RNA pseudouridine
syntheses; <br>tRNA
modification Bacteria;
<br>tRNA processing
fig|6666666.60966.peg.1059 CDS 981929 982555 2 + 627 Phosphoribosylanthranilate Auxin biosynthesis; D23_1c1073 Neut_1151
isomerase (EC <br>Chorismate:
5.3.1.24) Intermediate for
synthesis of Tryptophan,
PAPA antibiotics, PABA,
3-hydroxyanthranilate
and more.;
<br>Tryptophan
synthesis
fig|6666666.60966.peg.1060 CDS 982542 983741 3 + 1200 Tryptophan synthase Auxin biosynthesis; D23_1c1074 Neut_1152
beta chain (EC 4.2.1.20) <br>Chorismate:
Intermediate for
synthesis of Tryptophan,
PAPA antibiotics, PABA,
3-hydroxyanthranilate
and more.;
<br>Tryptophan
synthesis
fig|6666666.60966.peg.1061 CDS 983794 984618 1 + 825 Tryptophan synthase Auxin biosynthesis; D23_1c1075 Neut_1153
alpha chain (EC <br>Chorismate:
4.2.1.20) Intermediate for
synthesis of Tryptophan,
PAPA antibiotics, PABA,
3-hydroxyanthranilate
and more.;
<br>Tryptophan
synthesis
fig|6666666.60966.peg.1062 CDS 984623 985513 2 + 891 Acetyl-coenzyme A Colicin V and Bacteriocin D23_1c1076 Neut_1154
carboxyl transferase Production Cluster;
beta chain (EC 6.4.1.2) <br>Fatty Acid
Biosynthesis FASII
fig|6666666.60966.peg.1063 CDS 985642 986925 1 + 1284 Dihydrofolate synthase Colicin V and Bacteriocin D23_1c1077 Neut_1155
(EC 6.3.2.12)/ Production Cluster;
Folylpolyglutamate <br>Colicin V and
synthase (EC 6.3.2.17) Bacteriocin Production
Cluster; <br>Folate
Biosynthesis; <br>Folate
Biosynthesis
fig|6666666.60966.peg.1064 CDS 986945 987616 2 + 672 DedD protein Colicin V and Bacteriocin D23_1c1078 Neut_1156
Production Cluster
fig|6666666.60966.peg.1065 CDS 987613 988107 1 + 495 Colicin V production Colicin V and Bacteriocin D23_1c1079 Neut_1157
protein Production Cluster
fig|6666666.60966.peg.1066 CDS 988214 989731 2 + 1518 Amidophosphoribosyltransferase Colicin V and Bacteriocin D23_1c1080 Neut_1158
(EC 2.4.2.14) Production Cluster;
<br>De Novo Purine
Biosynthesis
fig|6666666.60966.peg.1067 CDS 989748 990923 3 + 1176 O-acetylhomoserine Methionine D23_1c1081 Neut_1159
sulfhydrylase (EC Biosynthesis;
2.5.1.49)/O- <br>Methionine
succinylhomoserine Biosynthesis
sulfhydrylase (EC
2.5.1.48)
fig|6666666.60966.peg.1068 CDS 991043 992554 2 + 1512 Threonine dehydratase Branched-Chain Amino D23_1c1082 Neut_1160
biosynthetic (EC Acid Biosynthesis
4.3.1.19)
fig|6666666.60966.peg.1069 CDS 992670 992536 −3 135 hypothetical protein -none- D23_1c1083 NA
fig|6666666.60966.peg.1070 CDS 993016 994950 1 + 1935 twitching motility -none- D23_1c1084 Neut_1161
protein PilJ
fig|6666666.60966.peg.1071 CDS 995179 995054 −1 126 hypothetical protein -none- D23_1c1085 Neut_1162
fig|6666666.60966.peg.1072 CDS 995174 1000177 2 + 5004 Signal transduction Flagellar motility D23_1c1085 Neut_1162
histidine kinase CheA
(EC 2.7.3.—)
fig|6666666.60966.peg.1073 CDS 1000248 1002095 3 + 1848 ParB-like nuclease -none- D23_1c1086 Neut_1163
domain
fig|6666666.60966.peg.1074 CDS 1003717 1002203 −1 1515 Ubiquinone Ubiquinone D23_1c1087 Neut_1164
biosynthesis Biosynthesis;
monooxygenase UbiB <br>Ubiquinone
Biosynthesis-gjo
fig|6666666.60966.peg.1075 CDS 1004439 1003807 −3 633 Protein YigP (COG3165) Ubiquinone D23_1c1088 Neut_1165
clustered with Biosynthesis;
ubiquinone biosynthetic <br>Ubiquinone
genes Biosynthesis-gjo
fig|6666666.60966.peg.1076 CDS 1004959 1004528 −1 432 FIG00858586: -none- D23_1c1089 Neut_1166
hypothetical protein
fig|6666666.60966.peg.1077 CDS 1005165 1004962 −3 204 hypothetical protein -none- D23_1c1090 NA
fig|6666666.60966.peg.1078 CDS 1005185 1007323 2 + 2139 Signal transduction Flagellar motility D23_1c1091 Neut_1167
histidine kinase CheA
(EC 2.7.3.—)
fig|6666666.60966.peg.1079 CDS 1007395 1007916 1 + 522 Positive regulator of -none- D23_1c1092 Neut_1168
CheA protein activity
(CheW)
fig|6666666.60966.peg.1080 CDS 1008003 1010258 3 + 2256 Methyl-accepting -none- D23_1c1093 Neut_1169
chemotaxis protein I
(serine chemoreceptor
protein)
fig|6666666.60966.peg.1082 CDS 1010399 1012744 2 + 2346 Methyl-accepting -none- D23_1c1094 Neut_1170
chemotaxis protein I
(serine chemoreceptor
protein)
fig|6666666.60966.peg.1083 CDS 1012932 1013807 3 + 876 Chemotaxis protein -none- D23_1c1095 Neut_1171
methyltransferase CheR
(EC 2.1.1.80)
fig|6666666.60966.peg.1084 CDS 1013887 1014471 1 + 585 Chemotaxis protein -none- D23_1c1096 Neut_1172
CheD
fig|6666666.60966.peg.1085 CDS 1014502 1015569 1 + 1068 Chemotaxis response -none- D23_1c1097 Neut_1173
regulator protein-
glutamate
methylesterase CheB
(EC 3.1.1.61)
fig|6666666.60966.peg.1087 CDS 1017858 1016338 −3 1521 Ferredoxin reductase Anaerobic respiratory D23_1c1099 Neut_1175
reductases
fig|6666666.60966.peg.1088 CDS 1018141 1019145 1 + 1005 Fructose-1,6- Calvin-Benson cycle; D23_1c1100 Neut_1176
bisphosphatase, type I <br>Glycolysis and
(EC 3.1.3.11) Gluconeogenesis
fig|6666666.60966.peg.1089 CDS 1020142 1019183 −1 960 Glutathione S- Glutathione: Non-redox D23_1c1101 Neut_1177
transferase, omega (EC reactions
2.5.1.18)
fig|6666666.60966.peg.1090 CDS 1020604 1020146 −1 459 Membrane protein, -none- D23_1c1102 Neut_1178
distant similarity to
thiosulphate:quinone
oxidoreductase DoxD
fig|6666666.60966.peg.1091 CDS 1020710 1020862 2 + 153 hypothetical protein -none- D23_1c1103 NA
fig|6666666.60966.peg.1092 CDS 1022088 1021138 −3 951 COGs COG0726 -none- D23_1c1104 Neut_1179
fig|6666666.60966.peg.1093 CDS 1022664 1022212 −3 453 Phosphohistidine -none- D23_1c1105 Neut_1180
phosphatase SixA
fig|6666666.60966.peg.1094 CDS 1023442 1022753 −1 690 COGs COG1814 -none- D23_1c1106 Neut_1181
fig|6666666.60966.peg.1095 CDS 1024149 1023445 −3 705 probable -none- D23_1c1107 Neut_1182
carboxylesterase
fig|6666666.60966.peg.1096 CDS 1024228 1025334 1 + 1107 InterPro IPR002931 -none- D23_1c1108 Neut_1183
COGs COG1305
fig|6666666.60966.peg.1097 CDS 1027262 1025541 −2 1722 Sulfite reductase Cysteine Biosynthesis; D23_1c1109 Neut_1184
[NADPH] hemoprotein <br>Inorganic Sulfur
beta-component (EC Assimilation
1.8.1.2)
fig|6666666.60966.peg.1098 CDS 1029106 1027271 −1 1836 Sulfite reductase Cysteine Biosynthesis; D23_1c1110 Neut_1185
[NADPH] flavoprotein <br>Inorganic Sulfur
alpha-component (EC Assimilation
1.8.1.2)
fig|6666666.60966.peg.1100 CDS 1030580 1029651 −2 930 Cys regulon Cysteine Biosynthesis; D23_1c1111 Neut_1186
transcriptional activator <br>LysR-family proteins
CysB in Escherichia coli
fig|6666666.60966.peg.1101 CDS 1030815 1031513 3 + 699 Phosphoadenylyl- Cysteine Biosynthesis; D23_1c1112 Neut_1187
sulfate reductase <br>Inorganic Sulfur
[thioredoxin] (EC Assimilation;
1.8.4.8)/Adenylyl- <br>Inorganic Sulfur
sulfate reductase Assimilation
[thioredoxin] (EC
1.8.4.10)
fig|6666666.60966.peg.1102 CDS 1031599 1032447 1 + 849 Sulfate Cysteine Biosynthesis; D23_1c1113 Neut_1188
adenylyltransferase <br>Inorganic Sulfur
subunit 2 (EC 2.7.7.4) Assimilation
fig|6666666.60966.peg.1103 CDS 1032508 1033791 1 + 1284 Sulfate Cysteine Biosynthesis; D23_1c1114 Neut_1189
adenylyltransferase <br>Inorganic Sulfur
subunit 1 (EC 2.7.7.4) Assimilation
fig|6666666.60966.peg.1105 CDS 1033967 1037446 2 + 3480 Glutamate synthase Ammonia assimilation; D23_1c1115 Neut_1190
[NADPH] small chain <br>Glutamine,
(EC 1.4.1.13) Glutamate, Aspartate
and Asparagine
Biosynthesis
fig|6666666.60966.peg.1106 CDS 1037596 1038723 1 + 1128 NAD(P) Phosphate metabolism D23_1c1116 Neut_1191
transhydrogenase alpha
subunit (EC 1.6.1.2)
fig|6666666.60966.peg.1107 CDS 1038778 1039086 1 + 309 NAD(P) Phosphate metabolism D23_1c1117 Neut_1192
transhydrogenase alpha
subunit (EC 1.6.1.2)
fig|6666666.60966.peg.1108 CDS 1039087 1040466 1 + 1380 NAD(P) Phosphate metabolism D23_1c1118 Neut_1193
transhydrogenase
subunit beta (EC
1.6.1.2)
fig|6666666.60966.peg.1109 CDS 1041147 1040488 −3 660 FIG00858826: -none- D23_1c1119 Neut_1194
hypothetical protein
fig|6666666.60966.peg.1110 CDS 1042046 1041582 −2 465 Bacterioferritin -none- D23_1c1120 Neut_1195
fig|6666666.60966.peg.1112 CDS 1043119 1043253 1 + 135 hypothetical protein -none- D23_1c1121 NA
fig|6666666.60966.peg.1113 CDS 1043368 1043511 1 + 144 hypothetical protein -none- D23_1c1122 NA
fig|6666666.60966.peg.1115 CDS 1043900 1043736 −2 165 hypothetical protein -none- D23_1c1123 NA
fig|6666666.60966.peg.1116 CDS 1043900 1044847 2 + 948 2,3- -none- D23_1c1124 Neut_1198
bisphosphoglycerate-
independent
phosphoglycerate
mutase
fig|6666666.60966.peg.1117 CDS 1044958 1045530 1 + 573 InterPro -none- D23_1c1125 Neut_1199
IPR000014:IPR001633
COGs COG2200
fig|6666666.60966.peg.1118 CDS 1045566 1045859 3 + 294 Mobile element protein -none- D23_1c1126 Neut_1719
fig|6666666.60966.peg.1119 CDS 1045958 1046836 2 + 879 Mobile element protein -none- D23_1c1127 Neut_1720
fig|6666666.60966.peg.1120 CDS 1046891 1047784 2 + 894 InterPro -none- D23_1c1128 Neut_1199
IPR000014:IPR001633
COGs COG2200
fig|6666666.60966.peg.1121 CDS 1048688 1047801 −2 888 Phosphoribosylaminoimidazole- De Novo Purine D23_1c1129 Neut_1200
succinocarboxamide Biosynthesis
synthase (EC 6.3.2.6)
fig|6666666.60966.peg.1122 CDS 1049856 1048726 −3 1131 Phosphoribosylaminoimidazole De Novo Purine D23_1c1130 Neut_1201
carboxylase Biosynthesis
ATPase subunit (EC
4.1.1.21)
fig|6666666.60966.peg.1123 CDS 1050317 1049847 −2 471 Phosphoribosylaminoimidazole De Novo Purine D23_1c1131 Neut_1202
carboxylase Biosynthesis
catalytic subunit (EC
4.1.1.21)
fig|6666666.60966.peg.1124 CDS 1050521 1050955 2 + 435 Biopolymer transport Ton and Tol transport D23_1c1133 Neut_1203
protein ExbD/TolR systems
fig|6666666.60966.peg.1125 CDS 1050942 1051664 3 + 723 Superoxide dismutase Oxidative stress; D23_1c1134 Neut_1204
[Fe] (EC 1.15.1.1) <br>Protection from
Reactive Oxygen Species
fig|6666666.60966.peg.1126 CDS 1051674 1052324 3 + 651 ATP Histidine Biosynthesis; D23_1c1135 Neut_1205
phosphoribosyltransferase <br>Riboflavin synthesis
(EC 2.4.2.17) cluster
fig|6666666.60966.peg.1127 CDS 1052409 1053644 3 + 1236 Histidinol Histidine Biosynthesis D23_1c1136 Neut_1206
dehydrogenase (EC
1.1.1.23)
fig|6666666.60966.peg.1128 CDS 1053708 1054883 3 + 1176 2-octaprenyl-6- CBSS-87626.3.peg.3639; D23_1c1137 Neut_1207
methoxyphenol <br>Ubiquinone
hydroxylase (EC Biosynthesis;
1.14.13.—) <br>Ubiquinone
Biosynthesis-gjo
fig|6666666.60966.peg.1129 CDS 1055047 1056060 1 + 1014 tRNA dihydrouridine Possible RNA D23_1c1138 Neut_1208
synthase B (EC 1.—.—.—) degradation cluster;
<br>tRNA modification
Bacteria
fig|6666666.60966.peg.1130 CDS 1056057 1056299 3 + 243 DNA-binding protein Fis DNA structural proteins, D23_1c1139 Neut_1209
bacterial
fig|6666666.60966.peg.1131 CDS 1056309 1057871 3 + 1563 IMP cyclohydrolase (EC 5-FCL-like protein; D23_1c1140 Neut_1210
3.5.4.10)/ <br>De Novo Purine
Phosphoribosylaminoimidazolecarboxamide Biosynthesis; <br>De
formyltransferase (EC Novo Purine
2.1.2.3) Biosynthesis
fig|6666666.60966.peg.1132 CDS 1057947 1059233 3 + 1287 Phosphoribosylamine- De Novo Purine D23_1c1141 Neut_1211
glycine ligase (EC Biosynthesis
6.3.4.13)
fig|6666666.60966.peg.1133 CDS 1059226 1060497 1 + 1272 FIG00858582: -none- D23_1c1142 Neut_1213
hypothetical protein
fig|6666666.60966.peg.1134 CDS 1061025 1060582 −3 444 TPR repeat precursor -none- D23_1c1143 Neut_1214
fig|6666666.60966.peg.1135 CDS 1061496 1061041 −3 456 Mobile element protein -none- D23_1c1144 Neut_2502
fig|6666666.60966.peg.1136 CDS 1061839 1061459 −1 381 Mobile element protein -none- D23_1c1145 Neut_0884
fig|6666666.60966.peg.1137 CDS 1062885 1061836 −3 1050 TPR repeat precursor -none- D23_1c1146 Neut_0701
fig|6666666.60966.peg.1138 CDS 1064906 1062960 −2 1947 DinG family ATP- DNA repair, bacterial D23_1c1148 Neut_1215
dependent helicase DinG and relatives
YoaA
fig|6666666.60966.peg.1139 CDS 1065051 1064932 −3 120 hypothetical protein -none- D23_1c1149 NA
fig|6666666.60966.peg.1140 CDS 1065126 1067303 3 + 2178 Outer membrane EC49-61; <br>ECSIG4- D23_1c1150 Neut_1216
protein Imp, required SIG7;
for envelope biogenesis/ <br>Lipopolysaccharide
Organic solvent assembly
tolerance protein
precursor
fig|6666666.60966.peg.1141 CDS 1067300 1068643 2 + 1344 Survival protein SurA EC49-61; <br>ECSIG4- D23_1c1151 Neut_1217
precursor (Peptidyl- SIG7;
prolyl cis-trans <br>Lipopolysaccharide
isomerase SurA) (EC assembly; <br>Peptidyl-
5.2.1.8) prolyl cis-trans
isomerase;
<br>Periplasmic Stress
Response
fig|6666666.60966.peg.1142 CDS 1068713 1069750 2 + 1038 4-hydroxythreonine-4- EC49-61; <br>ECSIG4- D23_1c1152 Neut_1218
phosphate SIG7; <br>Pyridoxin
dehydrogenase (EC (Vitamin B6)
1.1.1.262) Biosynthesis
fig|6666666.60966.peg.1143 CDS 1069754 1070524 2 + 771 SSU rRNA EC49-61; <br>ECSIG4- D23_1c1153 Neut_1219
(adenine(1518)- SIG7; <br>RNA
N(6)/adenine(1519)- methylation;
N(6))- <br>Ribosome
dimethyltransferase (EC biogenesis bacterial
2.1.1.182) ## SSU rRNA
m6,m6-A1518-1519
fig|6666666.60966.peg.1144 CDS 1071020 1070517 −2 504 Methylated-DNA-- DNA repair, bacterial D23_1c1154 Neut_1220
protein-cysteine
methyltransferase (EC
2.1.1.63)
fig|6666666.60966.peg.1145 CDS 1071346 1071080 −1 267 ADA regulatory protein/ DNA repair, bacterial; D23_1c1155 Neut_1221
Methylated-DNA-- <br>DNA repair,
protein-cysteine bacterial
methyltransferase (EC
2.1.1.63)
fig|6666666.60966.peg.1146 CDS 1072448 1071324 −2 1125 ADA regulatory protein/ DNA repair, bacterial; D23_1c1156 Neut_1221
Methylated-DNA-- <br>DNA repair,
protein-cysteine bacterial
methyltransferase (EC
2.1.1.63)
fig|6666666.60966.peg.1149 CDS 1073291 1073809 2 + 519 Helix-turn-helix motif -none- D23_1c1157 Neut_1223
fig|6666666.60966.peg.1150 CDS 1075783 1074353 −1 1431 Siroheme synthase/ Heme and Siroheme D23_1c1159 Neut_1002
Precorrin-2 oxidase (EC Biosynthesis; <br>Heme
1.3.1.76)/ and Siroheme
Sirohydrochlorin Biosynthesis; <br>Heme
ferrochelatase (EC and Siroheme
4.99.1.4)/ Biosynthesis
Uroporphyrinogen-III
methyltransferase (EC
2.1.1.107)
fig|6666666.60966.peg.1151 CDS 1076939 1075926 −2 1014 Phosphate ABC High affinity phosphate D23_1c1160 Neut_1001
transporter, periplasmic transporter and control
phosphate-binding of PHO regulon;
protein PstS (TC <br>PhoR-PhoB two-
3.A.1.7.1) component regulatory
system; <br>Phosphate
metabolism
fig|6666666.60966.peg.1152 CDS 1078435 1077059 −1 1377 Phosphoglucosamine Sialic Acid Metabolism; D23_1c1161 Neut_1000
mutase (EC 5.4.2.10) <br>UDP-N-
acetylmuramate from
Fructose-6-phosphate
Biosynthesis
fig|6666666.60966.peg.1153 CDS 1079505 1078603 −3 903 Dihydropteroate Folate Biosynthesis D23_1c1162 Neut_0999
synthase (EC 2.5.1.15)
fig|6666666.60966.peg.1154 CDS 1081457 1079529 −2 1929 Cell division protein Bacterial Cell Division D23_1c1163 Neut_0998
FtsH (EC 3.4.24.—)
fig|6666666.60966.peg.1155 CDS 1082161 1081541 −1 621 Cell division protein FtsJ/ Bacterial Cell Division; D23_1c1164 Neut_0997
Ribosomal RNA large <br>RNA methylation
subunit
methyltransferase E (EC
2.1.1.—) ## LSU rRNA
Um2552
fig|6666666.60966.peg.1156 CDS 1082195 1082575 2 + 381 FIG004454: RNA -none- D23_1c1165 Neut_0996
binding protein
fig|6666666.60966.peg.1157 CDS 1082674 1083084 1 + 411 CBS domain -none- D23_1c1166 Neut_0995
fig|6666666.60966.peg.1158 CDS 1083081 1083464 3 + 384 tRNA A cluster relating to D23_1c1167 Neut_0994
nucleotidyltransferase, Tryptophanyl-tRNA
A-adding (EC 2.7.7.25) synthetase;
<br>Polyadenylation
bacterial; <br>tRNA
nucleotidyltransferase
fig|6666666.60966.peg.1159 CDS 1084218 1083646 −3 573 DNA-3-methyladenine DNA Repair Base D23_1c1168 Neut_0993
glycosylase II (EC Excision
3.2.2.21)
fig|6666666.60966.peg.1160 CDS 1084717 1084241 −1 477 Glutathione peroxidase Glutathione: Redox cycle D23_1c1169 Neut_0992
(EC 1.11.1.9)
fig|6666666.60966.peg.1161 CDS 1084748 1085341 2 + 594 Carbonic anhydrase, Zinc regulated enzymes D23_1c1170 Neut_0991
gamma class (EC
4.2.1.1)
fig|6666666.60966.peg.1162 CDS 1085402 1086241 2 + 840 Putative NAD(P)- -none- D23_1c1171 Neut_0990
dependent
oxidoreductase EC-
YbbO
fig|6666666.60966.peg.1163 CDS 1086401 1087885 2 + 1485 alpha amylase, catalytic -none- D23_1c1172 Neut_0989
region
fig|6666666.60966.peg.1164 CDS 1090985 1087899 −2 3087 RND multidrug efflux Multidrug Resistance D23_1c1173 Neut_0988
transporter; Acriflavin Efflux Pumps
resistance protein
fig|6666666.60966.peg.1165 CDS 1092079 1090982 −1 1098 Membrane fusion Multidrug Resistance D23_1c1174 Neut_0987
protein of RND family Efflux Pumps
multidrug efflux pump
fig|6666666.60966.peg.1168 CDS 1092982 1092851 −1 132 hypothetical protein -none- D23_1c1175 NA
fig|6666666.60966.peg.1169 CDS 1094042 1093413 −2 630 Nicotinamidase family NAD and NADP cofactor D23_1c1176 NA
protein YcaC biosynthesis global
fig|6666666.60966.peg.1170 CDS 1094408 1094223 −2 186 Mobile element protein -none- D23_1c1178 Neut_1984
fig|6666666.60966.peg.1171 CDS 1094750 1094514 −2 237 Mobile element protein -none- D23_1c1179 Neut_1353
fig|6666666.60966.peg.1172 CDS 1095334 1094984 −1 351 hypothetical protein -none- D23_1c1180 NA
fig|6666666.60966.peg.1173 CDS 1095854 1095486 −2 369 Mobile element protein -none- D23_1c1181 Neut_2502
fig|6666666.60966.peg.1175 CDS 1096049 1095933 −2 117 Mobile element protein -none- D23_1c1182 Neut_0884
fig|6666666.60966.peg.1176 CDS 1096623 1096288 −3 336 putative (AJ245540) -none- D23_1c1183 Neut_1054
NrfJ [Wolinella
succinogenes]
fig|6666666.60966.peg.1177 CDS 1098408 1096669 −3 1740 FIG00859793: -none- D23_1c1184 Neut_1053
hypothetical protein
fig|6666666.60966.peg.1178 CDS 1098651 1100255 3 + 1605 Multicopper oxidase Copper homeostasis D23_1c1185 Neut_1052
fig|6666666.60966.peg.1179 CDS 1101152 1100349 −2 804 Inositol-1- -none- D23_1c1186 Neut_1051
monophosphatase (EC
3.1.3.25)
fig|6666666.60966.peg.1180 CDS 1101712 1101155 −1 558 Alkyl hydroperoxide -none- D23_1c1187 Neut_1050
reductase and/or thiol-
specific antioxidant
family (AhpC/TSA)
protein
fig|6666666.60966.peg.1181 CDS 1101810 1102571 3 + 762 Ribosomal RNA small Heat shock dnaK gene D23_1c1188 Neut_1049
subunit cluster extended;
methyltransferase E (EC <br>RNA methylation
2.1.1.—)
fig|6666666.60966.peg.1182 CDS 1102595 1103929 2 + 1335 N-acetylglutamate Arginine Biosynthesis-- D23_1c1189 Neut_1048
synthase (EC 2.3.1.1) gjo; <br>Arginine
Biosynthesis extended
fig|6666666.60966.peg.1183 CDS 1104924 1104208 −3 717 FIG002842: -none- D23_1c1190 Neut_1046
hypothetical protein
fig|6666666.60966.peg.1184 CDS 1105647 1105036 −3 612 Dephospho-CoA kinase Coenzyme A D23_1c1191 Neut_1045
(EC 2.7.1.24) Biosynthesis
fig|6666666.60966.peg.1185 CDS 1106511 1105651 −3 861 Leader peptidase -none- D23_1c1192 Neut_1044
(Prepilin peptidase) (EC
3.4.23.43)/N-
methyltransferase (EC
2.1.1.—)
fig|6666666.60966.peg.1186 CDS 1107775 1106555 −1 1221 Type IV fimbrial -none- D23_1c1193 Neut_1043
assembly protein PilC
fig|6666666.60966.peg.1187 CDS 1108692 1107835 −3 858 Nucleoside- CBSS-296591.1.peg.2330 D23_1c1194 Neut_1042
diphosphate-sugar
epimerases
fig|6666666.60966.peg.1189 CDS 1108961 1109818 2 + 858 2-polyprenylphenol -none- D23_1c1195 Neut_1041
hydroxylase and related
flavodoxin
oxidoreductases/CDP-
6-deoxy-delta-3,4-
glucoseen reductase-
like
fig|6666666.60966.peg.1190 CDS 1111006 1109825 −1 1182 Homolog of E. coli -none- D23_1c1196 Neut_1040
HemY protein
fig|6666666.60966.peg.1191 CDS 1112031 1111003 −3 1029 Uroporphyrinogen-III Heme and Siroheme D23_1c1197 Neut_1039
methyltransferase (EC Biosynthesis
2.1.1.107)
fig|6666666.60966.peg.1192 CDS 1112828 1112046 −2 783 Uroporphyrinogen-III Heme and Siroheme D23_1c1198 Neut_1038
synthase (EC 4.2.1.75) Biosynthesis
fig|6666666.60966.peg.1193 CDS 1113852 1112848 −3 1005 Porphobilinogen Heme and Siroheme D23_1c1199 Neut_1037
deaminase (EC 2.5.1.61) Biosynthesis
fig|6666666.60966.peg.1194 CDS 1113898 1116699 1 + 2802 Phosphoenolpyruvate Pyruvate metabolism I: D23_1c1200 Neut_1036
carboxylase (EC anaplerotic reactions,
4.1.1.31) PEP
fig|6666666.60966.peg.1195 CDS 1116922 1118904 1 + 1983 FIG00858706: -none- D23_1c1201 Neut_1035
hypothetical protein
fig|6666666.60966.peg.1196 CDS 1120329 1118899 −3 1431 probable integral -none- D23_1c1202 Neut_1034
membrane protein
NMA1898
fig|6666666.60966.peg.1197 CDS 1121723 1120329 −2 1395 FIG00859415: -none- D23_1c1203 Neut_1033
hypothetical protein
fig|6666666.60966.peg.1198 CDS 1121909 1121763 −2 147 hypothetical protein -none- D23_1c1204 NA
fig|6666666.60966.peg.1199 CDS 1121985 1122698 3 + 714 COGs COG0518 -none- D23_1c1205 Neut_1032
fig|6666666.60966.peg.1200 CDS 1123590 1122748 −3 843 RNA polymerase sigma Heat shock Cell division D23_1c1206 Neut_1031
factor RpoH Proteases and a
Methyltransferase;
<br>Heat shock dnaK
gene cluster extended;
<br>Transcription
initiation, bacterial
sigma factors
fig|6666666.60966.peg.1201 CDS 1124005 1124823 1 + 819 Cytochrome c family -none- D23_1c1207 NA
protein
fig|6666666.60966.peg.1203 CDS 1125802 1127289 1 + 1488 FIG00858881: -none- D23_1c1209 Neut_1029
hypothetical protein
fig|6666666.60966.peg.1204 CDS 1127318 1128325 2 + 1008 Sulfate-binding protein Inorganic Sulfur D23_1c1210 Neut_1028
Sbp Assimilation
fig|6666666.60966.peg.1205 CDS 1128452 1128580 2 + 129 hypothetical protein -none- D23_1c1211 NA
fig|6666666.60966.peg.1206 CDS 1128661 1129494 1 + 834 Sulfate transport Cysteine Biosynthesis; D23_1c1212 Neut_1026
system permease <br>Inorganic Sulfur
protein CysT Assimilation
fig|6666666.60966.peg.1207 CDS 1129502 1130371 2 + 870 Sulfate transport Cysteine Biosynthesis; D23_1c1213 Neut_1025
system permease <br>Inorganic Sulfur
protein CysW Assimilation
fig|6666666.60966.peg.1208 CDS 1130383 1131471 1 + 1089 Sulfate and thiosulfate Cysteine Biosynthesis; D23_1c1214 Neut_1024
import ATP-binding <br>Inorganic Sulfur
protein CysA (EC Assimilation;
3.6.3.25) <br>Uptake of selenate
and selenite
fig|6666666.60966.peg.1209 CDS 1131827 1131510 −2 318 possible lipase -none- D23_1c1215 Neut_1023
fig|6666666.60966.peg.1210 CDS 1133403 1131859 −3 1545 Aminopeptidase PepA- -none- D23_1c1216 Neut_1022
related protein
fig|6666666.60966.peg.1211 CDS 1133455 1134249 1 + 795 Thymidylate synthase Folate Biosynthesis; D23_1c1217 Neut_1021
(EC 2.1.1.45) <br>pyrimidine
conversions
fig|6666666.60966.peg.1212 CDS 1134246 1134776 3 + 531 Dihydrofolate reductase 5-FCL-like protein; D23_1c1218 Neut_1020
(EC 1.5.1.3) <br>EC49-61; <br>Folate
Biosynthesis
fig|6666666.60966.peg.1213 CDS 1136053 1134809 −1 1245 Response regulator -none- D23_1c1219 Neut_1019
fig|6666666.60966.peg.1215 CDS 1136321 1136785 2 + 465 Mobile element protein -none- D23_1c1220 Neut_0357
fig|6666666.60966.peg.1216 CDS 1136808 1137512 3 + 705 Mobile element protein -none- D23_1c1221 Neut_1318
fig|6666666.60966.peg.1217 CDS 1137576 1138703 3 + 1128 Catalase (EC 1.11.1.6) Oxidative stress; D23_1c1222 NA
<br>Photorespiration
(oxidative C2cycle);
<br>Protection from
Reactive Oxygen Species
fig|6666666.60966.peg.1218 CDS 1139453 1138773 −2 681 Mobile element protein -none- D23_1c1223 Neut_1318
fig|6666666.60966.peg.1219 CDS 1139703 1139837 3 + 135 Mobile element protein -none- D23_1c1224 Neut_2500
fig|6666666.60966.peg.1220 CDS 1139894 1140238 2 + 345 Mobile element protein -none- D23_1c1225 Neut_1375
fig|6666666.60966.peg.1221 CDS 1141157 1140195 −2 963 Mobile element protein -none- D23_1c1226 Neut_1278
fig|6666666.60966.peg.1222 CDS 1141250 1141762 2 + 513 Mobile element protein -none- D23_1c1227 Neut_1624
fig|6666666.60966.peg.1223 CDS 1142310 1141846 −3 465 Mobile element protein -none- D23_1c1228 Neut_0357
fig|6666666.60966.peg.1224 CDS 1142882 1142409 −2 474 Mobile element protein -none- D23_1c1229 Neut_0883
fig|6666666.60966.peg.1225 CDS 1144087 1143419 −1 669 hypothetical protein -none- D23_1c1230 NA
fig|6666666.60966.peg.1226 CDS 1144329 1144078 −3 252 ABC-type antimicrobial -none- D23_1c1231 NA
peptide transport
system, permease
component
fig|6666666.60966.peg.1227 CDS 1144623 1145231 3 + 609 Transcriptional -none- D23_1c1232 Neut_1011
regulator, TetR family
fig|6666666.60966.peg.1228 CDS 1145317 1146351 1 + 1035 Predicted membrane ATP-dependent efflux D23_1c1233 Neut_1010
fusion protein (MFP) pump transporter Ybh
component of efflux
pump, membrane
anchor protein YbhG
fig|6666666.60966.peg.1229 CDS 1146341 1148125 2 + 1785 ABC transporter ATP-dependent efflux D23_1c1234 Neut_1009
multidrug efflux pump, pump transporter Ybh
fused ATP-binding
domains
fig|6666666.60966.peg.1230 CDS 1148122 1149270 1 + 1149 ABC transport system, ATP-dependent efflux D23_1c1235 Neut_1008
permease component pump transporter Ybh
YbhS
fig|6666666.60966.peg.1231 CDS 1149276 1150400 3 + 1125 ABC transport system, ATP-dependent efflux D23_1c1236 Neut_1007
permease component pump transporter Ybh
YbhR
fig|6666666.60966.peg.1232 CDS 1150415 1150546 2 + 132 hypothetical protein -none- D23_1c1237 NA
fig|6666666.60966.peg.1233 CDS 1150719 1150507 −3 213 hypothetical protein -none- D23_1c1238 NA
fig|6666666.60966.peg.1234 CDS 1150690 1150875 1 + 186 hypothetical protein -none- D23_1c1239 Neut_1006
fig|6666666.60966.peg.1235 CDS 1150882 1151043 1 + 162 hypothetical protein -none- D23_1c1240 NA
fig|6666666.60966.peg.1236 CDS 1151054 1151923 2 + 870 hypothetical protein -none- D23_1c1241 Neut_1006
fig|6666666.60966.peg.1237 CDS 1151916 1152278 3 + 363 hypothetical protein -none- D23_1c1242 NA
fig|6666666.60966.peg.1239 CDS 1152362 1152703 2 + 342 hypothetical protein -none- D23_1c1243 Neut_1005
fig|6666666.60966.peg.1240 CDS 1153760 1152756 −2 1005 Mobile element protein -none- D23_1c1244 Neut_1862
fig|6666666.60966.peg.1241 CDS 1153821 1154177 3 + 357 Putative transport -none- D23_1c1245 Neut_1004
system permease
protein
fig|6666666.60966.peg.1242 CDS 1154289 1154441 3 + 153 FIG00626672: -none- D23_1c1246 Neut_1003
hypothetical protein
fig|6666666.60966.peg.1243 CDS 1154607 1154476 −3 132 hypothetical protein -none- D23_1c1247 Neut_1226
fig|6666666.60966.peg.1244 CDS 1156287 1154728 −3 1560 amino acid transporter -none- D23_1c1248 Neut_1227
fig|6666666.60966.peg.1245 CDS 1157495 1156611 −2 885 DNA recombination- DNA repair, bacterial D23_1c1250 Neut_1228
dependent growth
factor C
fig|6666666.60966.peg.1246 CDS 1158541 1157738 −1 804 Probable component of Lipopolysaccharide D23_1c1252 Neut_1229
the lipoprotein assembly
assembly complex
(forms a complex with
YaeT, YfgL, and NlpB)
fig|6666666.60966.peg.1247 CDS 1158543 1159571 3 + 1029 Ribosomal large subunit RNA pseudouridine D23_1c1253 Neut_1230
pseudouridine synthase syntheses;
D (EC 4.2.1.70) <br>Ribosome
biogenesis bacterial
fig|6666666.60966.peg.1248 CDS 1159795 1161201 1 + 1407 Glutamine synthetase Ammonia assimilation; D23_1c1254 Neut_1231
type I (EC 6.3.1.2) <br>Glutamine,
Glutamate, Aspartate
and Asparagine
Biosynthesis;
<br>Glutamine
synthetases;
<br>Peptidoglycan
Biosynthesis
fig|6666666.60966.peg.1249 CDS 1161356 1161826 2 + 471 FIG00858905: -none- D23_1c1256 Neut_1232
hypothetical protein
fig|6666666.60966.peg.1250 CDS 1161926 1161813 −2 114 hypothetical protein -none- D23_1c1257 NA
fig|6666666.60966.peg.1251 CDS 1162096 1162263 1 + 168 hypothetical protein -none- D23_1c1258 NA
fig|6666666.60966.peg.1252 CDS 1162260 1162415 3 + 156 hypothetical protein -none- D23_1c1259 NA
fig|6666666.60966.peg.1253 CDS 1162412 1163191 2 + 780 Putative sulfate Inorganic Sulfur D23_1c1260 Neut_1235
permease Assimilation
fig|6666666.60966.peg.1254 CDS 1163827 1163267 −1 561 Iron-sulfur cluster -none- D23_1c1261 Neut_1236
assembly scaffold
protein IscU/NifU-like
for SUF system, SufE3
fig|6666666.60966.peg.1255 CDS 1164319 1163837 −1 483 Putative iron-sulfur -none- D23_1c1262 Neut_1237
cluster assembly
scaffold protein for SUF
system, SufE2
fig|6666666.60966.peg.1256 CDS 1165584 1164316 −3 1269 Cysteine desulfurase Alanine biosynthesis; D23_1c1263 Neut_1238
(EC 2.8.1.7), SufS <br>mnm5U34
subfamily biosynthesis bacteria;
<br>tRNA modification
Bacteria
fig|6666666.60966.peg.1257 CDS 1166895 1165588 −3 1308 Iron-sulfur cluster CBSS- D23_1c1264 Neut_1239
assembly protein SufD 196164.1.peg.1690;
<br>tRNA modification
Bacteria
fig|6666666.60966.peg.1258 CDS 1167683 1166892 −2 792 Iron-sulfur cluster CBSS- D23_1c1265 Neut_1240
assembly ATPase 196164.1.peg.1690;
protein SufC <br>tRNA modification
Bacteria
fig|6666666.60966.peg.1259 CDS 1169116 1167680 −1 1437 Iron-sulfur cluster CBSS- D23_1c1266 Neut_1241
assembly protein SufB 196164.1.peg.1690;
<br>tRNA modification
Bacteria
fig|6666666.60966.peg.1260 CDS 1169465 1169136 −2 330 Iron binding protein Alanine biosynthesis; D23_1c1267 Neut_1242
IscA for iron-sulfur <br>tRNA modification
cluster assembly Bacteria
fig|6666666.60966.peg.1261 CDS 1169958 1169491 −3 468 Iron-sulfur cluster Alanine biosynthesis; D23_1c1268 Neut_1243
regulator IscR <br>Rrf2 family
transcriptional
regulators
fig|6666666.60966.peg.1262 CDS 1170306 1171838 3 + 1533 2-isopropylmalate Branched-Chain Amino D23_1c1270 Neut_1244
synthase (EC 2.3.3.13) Acid Biosynthesis;
<br>Leucine
Biosynthesis
fig|6666666.60966.peg.1263 CDS 1171964 1172467 2 + 504 Cytochrome c-type Biogenesis of c-type D23_1c1271 Neut_1245
biogenesis protein ResA cytochromes
fig|6666666.60966.peg.1264 CDS 1173081 1172488 −3 594 FIG016425: Soluble lytic -none- D23_1c1272 Neut_1246
murein transglycosylase
and related regulatory
proteins (some contain
LysM/invasin domains)
fig|6666666.60966.peg.1265 CDS 1174775 1173069 −2 1707 Prolyl-tRNA synthetase tRNA aminoacylation, D23_1c1273 Neut_1247
(EC 6.1.1.15), bacterial Pro
type
fig|6666666.60966.peg.1266 CDS 1175004 1175567 3 + 564 Adenosine (5&#39;)- CBSS- D23_1c1274 Neut_1248
pentaphospho- 364106.7.peg.3204;
(5&#39;&#39;)- <br>Nudix proteins
adenosine (nucleoside triphosphate
pyrophosphohydrolase hydrolases);
(EC 3.6.1.—) <br>Phosphoglycerate
mutase protein family
fig|6666666.60966.peg.1267 CDS 1175673 1176677 3 + 1005 Cytochrome c551 Protection from Reactive D23_1c1275 Neut_1249
peroxidase (EC 1.11.1.5) Oxygen Species
fig|6666666.60966.peg.1269 CDS 1176892 1178190 1 + 1299 Sensor histidine kinase Global Two-component D23_1c1276 Neut_1250
PrrB (RegB) (EC 2.7.3.—) Regulator PrrBA in
Proteobacteria
fig|6666666.60966.peg.1270 CDS 1178205 1178750 3 + 546 Dna binding response Global Two-component D23_1c1277 Neut_1251
regulator PrrA (RegA) Regulator PrrBA in
Proteobacteria
fig|6666666.60966.peg.1271 CDS 1181021 1178853 −2 2169 Ferrichrome-iron -none- D23_1c1278 Neut_1252
receptor
fig|6666666.60966.peg.1272 CDS 1181355 1181558 3 + 204 hypothetical protein -none- D23_1c1279 NA
fig|6666666.60966.peg.1273 CDS 1181609 1181776 2 + 168 hypothetical protein -none- D23_1c1280 NA
fig|6666666.60966.peg.1274 CDS 1181748 1181981 3 + 234 Mobile element protein -none- D23_1c1281 NA
fig|6666666.60966.peg.1275 CDS 1182136 1181990 −1 147 hypothetical protein -none- D23_1c1282 NA
fig|6666666.60966.peg.1277 CDS 1182799 1182386 −1 414 hypothetical protein -none- D23_1c1283 Neut_1254
fig|6666666.60966.peg.1278 CDS 1182892 1183920 1 + 1029 Mobile element protein -none- D23_1c1284 Neut_1746
fig|6666666.60966.peg.1280 CDS 1185348 1184569 −3 780 CDP-diacylglycerol-- Glycerolipid and D23_1c1285 Neut_1258
serine O- Glycerophospholipid
phosphatidyltransferase Metabolism in Bacteria
(EC 2.7.8.8)
fig|6666666.60966.peg.1281 CDS 1186028 1185378 −2 651 Phosphatidylserine Glycerolipid and D23_1c1286 Neut_1259
decarboxylase (EC Glycerophospholipid
4.1.1.65) Metabolism in Bacteria
fig|6666666.60966.peg.1282 CDS 1187049 1186033 −3 1017 Ketol-acid Branched-Chain Amino D23_1c1287 Neut_1260
reductoisomerase (EC Acid Biosynthesis;
1.1.1.86) <br>Coenzyme A
Biosynthesis
fig|6666666.60966.peg.1283 CDS 1187629 1187138 −1 492 Acetolactate synthase Acetolactate synthase D23_1c1288 Neut_1261
small subunit (EC subunits; <br>Branched-
2.2.1.6) Chain Amino Acid
Biosynthesis
fig|6666666.60966.peg.1284 CDS 1189337 1187634 −2 1704 Acetolactate synthase Acetolactate synthase D23_1c1289 Neut_1262
large subunit (EC subunits; <br>Branched-
2.2.1.6) Chain Amino Acid
Biosynthesis
fig|6666666.60966.peg.1285 CDS 1189440 1189327 −3 114 hypothetical protein -none- D23_1c1290 NA
fig|6666666.60966.peg.1287 CDS 1191111 1189663 −3 1449 TldD protein, part of CBSS-316057.3.peg.563; D23_1c1292 Neut_1263
TldE/TldD proteolytic <br>CBSS-
complex 354.1.peg.2917;
<br>Putative TldE-TldD
proteolytic complex
fig|6666666.60966.peg.1288 CDS 1192101 1191238 −3 864 FIG003879: Predicted CBSS-354.1.peg.2917 D23_1c1293 Neut_1264
amidohydrolase/
Aliphatic amidase AmiE
(EC 3.5.1.4)
fig|6666666.60966.peg.1289 CDS 1196193 1192303 −3 3891 FIG005080: Possible CBSS-354.1.peg.2917 D23_1c1294 Neut_1265
exported protein
fig|6666666.60966.peg.1290 CDS 1196421 1199210 3 + 2790 Glutamate-ammonia- Ammonia assimilation; D23_1c1295 Neut_1266
ligase <br>CBSS-
adenylyltransferase (EC 316057.3.peg.3521
2.7.7.42)
fig|6666666.60966.peg.1291 CDS 1200720 1200058 −3 663 FIG00859512: -none- D23_1c1300 Neut_1268
hypothetical protein
fig|6666666.60966.peg.1292 CDS 1200901 1200761 −1 141 hypothetical protein -none- D23_1c1301 NA
fig|6666666.60966.peg.1293 CDS 1200921 1202306 3 + 1386 Argininosuccinate lyase Arginine Biosynthesis-- D23_1c1302 Neut_1269
(EC 4.3.2.1) gjo; <br>Arginine
Biosynthesis extended
fig|6666666.60966.peg.1294 CDS 1202336 1203241 2 + 906 Ribulosamine/erythrulosamine Protein deglycation D23_1c1303 Neut_1270
3-kinase
potentially involved in
protein deglycation
fig|6666666.60966.peg.1295 CDS 1203386 1204876 2 + 1491 FIG00807778: -none- D23_1c1304 Neut_1271
hypothetical protein
fig|6666666.60966.peg.1297 CDS 1205984 1205553 −2 432 hypothetical protein -none- D23_1c1305 Neut_1272
fig|6666666.60966.peg.1298 CDS 1206313 1205987 −1 327 hypothetical protein -none- D23_1c1306 Neut_1273
fig|6666666.60966.peg.1299 CDS 1206643 1206329 −1 315 CrcB protein -none- D23_1c1307 Neut_1274
fig|6666666.60966.peg.1300 CDS 1206663 1206902 3 + 240 hypothetical protein -none- D23_1c1308 NA
fig|6666666.60966.peg.1301 CDS 1207586 1206945 −2 642 Chemotaxis response- -none- D23_1c1309 Neut_1275
phosphatase CheZ
fig|6666666.60966.peg.1302 CDS 1208030 1207635 −2 396 Chemotaxis regulator- Flagellar motility D23_1c1310 Neut_1276
transmits
chemoreceptor signals
to flagelllar motor
components CheY
fig|6666666.60966.peg.1303 CDS 1209139 1208375 −1 765 Mobile element protein -none- D23_1c1311 NA
fig|6666666.60966.peg.1305 CDS 1210466 1210134 −2 333 hypothetical protein -none- D23_1c1313 NA
fig|6666666.60966.peg.1306 CDS 1210482 1210661 3 + 180 hypothetical protein -none- D23_1c1314 Neut_1280
fig|6666666.60966.peg.1307 CDS 1212693 1210768 −3 1926 Cytochrome c, class I -none- D23_1c1315 Neut_1281
fig|6666666.60966.peg.1308 CDS 1213523 1213044 −2 480 FIG00858481: -none- D23_1c1317 Neut_1282
hypothetical protein
fig|6666666.60966.peg.1309 CDS 1213544 1214608 2 + 1065 Folate-dependent -none- D23_1c1318 Neut_1283
protein for Fe/S cluster
synthesis/repair in
oxidative stress
fig|6666666.60966.peg.1310 CDS 1215290 1214631 −2 660 FOG: Ankyrin repeat -none- D23_1c1319 Neut_1284
fig|6666666.60966.peg.1311 CDS 1215984 1215292 −3 693 Putative YcfH D23_1c1320 Neut_1285
deoxyribonuclease YcfH
fig|6666666.60966.peg.1313 CDS 1216517 1216125 −2 393 Queuosine biosynthesis Queuosine-Archaeosine D23_1c1321 Neut_1286
QueD, PTPS-I Biosynthesis; <br>Zinc
regulated enzymes;
<br>tRNA modification
Bacteria
fig|6666666.60966.peg.1315 CDS 1216624 1217484 1 + 861 Radical SAM domain -none- D23_1c1322 Neut_1287
protein
fig|6666666.60966.peg.1316 CDS 1217801 1217514 −2 288 FIG00858571: -none- D23_1c1323 Neut_1288
hypothetical protein
fig|6666666.60966.peg.1318 CDS 1219170 1218214 −3 957 Cobalt-zinc-cadmium Cobalt-zinc-cadmium D23_1c1325 Neut_1289
resistance protein CzcD resistance
fig|6666666.60966.peg.1319 CDS 1221684 1219195 −3 2490 Lead, cadmium, zinc Copper Transport D23_1c1326 Neut_1290
and mercury System; <br>Copper
transporting ATPase (EC homeostasis
3.6.3.3) (EC 3.6.3.5);
Copper-translocating P-
type ATPase (EC 3.6.3.4)
fig|6666666.60966.peg.1320 CDS 1223842 1221797 −1 2046 1,4-alpha-glucan Glycogen metabolism D23_1c1327 Neut_1291
(glycogen) branching
enzyme, GH-13-type (EC
2.4.1.18)
fig|6666666.60966.peg.1321 CDS 1223815 1224054 1 + 240 hypothetical protein -none- D23_1c1328 NA
fig|6666666.60966.peg.1322 CDS 1224141 1225418 3 + 1278 Glucose-1-phosphate Glycogen metabolism D23_1c1329 Neut_1292
adenylyltransferase (EC
2.7.7.27)
fig|6666666.60966.peg.1323 CDS 1225484 1227202 2 + 1719 Amylopullulanase (EC -none- D23_1c1330 Neut_1293
3.2.1.1)/(EC 3.2.1.41)
fig|6666666.60966.peg.1324 CDS 1227268 1229292 1 + 2025 Alpha-amylase (EC -none- D23_1c1331 Neut_1294
3.2.1.1)
fig|6666666.60966.peg.1325 CDS 1229324 1232014 2 + 2691 hypothetical protein -none- D23_1c1332 Neut_1295
fig|6666666.60966.peg.1326 CDS 1232973 1232236 −3 738 Uracil-DNA glycosylase, Uracil-DNA glycosylase D23_1c1334 Neut_1296
family 4
fig|6666666.60966.peg.1327 CDS 1233520 1233032 −1 489 Ribosomal-protein- Bacterial RNA- D23_1c1335 Neut_1297
S18p-alanine metabolizing Zn-
acetyltransferase (EC dependent hydrolases;
2.3.1.—) <br>Ribosome
biogenesis bacterial
fig|6666666.60966.peg.1328 CDS 1234194 1233523 −3 672 Inactive homolog of -none- D23_1c1336 Neut_1298
metal-dependent
proteases, putative
molecular chaperone
fig|6666666.60966.peg.1329 CDS 1234742 1234209 −2 534 2&#39;-5&#39; RNA RNA processing orphans D23_1c1337 Neut_1299
ligase
fig|6666666.60966.peg.1330 CDS 1235245 1234742 −1 504 2-C-methyl-D-erythritol Isoprenoid Biosynthesis; D23_1c1338 Neut_1300
2,4-cyclodiphosphate <br>Nonmevalonate
synthase (EC 4.6.1.12) Branch of Isoprenoid
Biosynthesis;
<br>Possible RNA
degradation cluster;
<br>Stationary phase
repair cluster
fig|6666666.60966.peg.1331 CDS 1235544 1235356 −3 189 hypothetical protein -none- D23_1c1339 Neut_0314
fig|6666666.60966.peg.1332 CDS 1235706 1235566 −3 141 hypothetical protein -none- D23_1c1340 Neut_0314
fig|6666666.60966.peg.1335 CDS 1236565 1236008 −1 558 Translation elongation Translation elongation D23_1c1341 Neut_1302
factor P factors bacterial
fig|6666666.60966.peg.1336 CDS 1237794 1236640 −3 1155 hypothetical protein -none- D23_1c1342 Neut_1303
fig|6666666.60966.peg.1337 CDS 1237927 1238928 1 + 1002 D-lactate Fermentations: Lactate D23_1c1343 Neut_1304
dehydrogenase (EC
1.1.1.28)
fig|6666666.60966.peg.1338 CDS 1240296 1239037 −3 1260 putative membrane -none- D23_1c1344 Neut_1315
protein
fig|6666666.60966.peg.1339 CDS 1241400 1240354 −3 1047 Peptide chain release Programmed frameshift; D23_1c1345 Neut_1316
factor 2; programmed <br>Programmed
frameshift-containing frameshift;
<br>Translation
termination factors
bacterial
fig|6666666.60966.peg.1340 CDS 1243378 1241576 −1 1803 patatin family protein -none- D23_1c1346 Neut_1317
fig|6666666.60966.peg.1341 CDS 1244736 1243531 −3 1206 Catalase (EC 1.11.1.6) Oxidative stress; D23_1c1348 NA
<br>Photorespiration
(oxidative C2 cycle);
<br>Protection from
Reactive Oxygen Species
fig|6666666.60966.peg.1342 CDS 1246268 1244739 −2 1530 Peroxidase (EC 1.11.1.7) Oxidative stress; D23_1c1349 NA
<br>Protection from
Reactive Oxygen Species
fig|6666666.60966.peg.1343 CDS 1247585 1246281 −2 1305 Peroxidase (EC 1.11.1.7) Oxidative stress; D23_1c1350 NA
<br>Protection from
Reactive Oxygen Species
fig|6666666.60966.peg.1344 CDS 1248078 1247623 −3 456 hypothetical protein -none- D23_1c1351 NA
fig|6666666.60966.peg.1345 CDS 1248448 1251117 1 + 2670 FIG00860108: -none- D23_1c1352 Neut_0141
hypothetical protein
fig|6666666.60966.peg.1346 CDS 1251218 1253155 2 + 1938 Choline dehydrogenase -none- D23_1c1353 NA
(EC 1.1.99.1)
fig|6666666.60966.peg.1347 CDS 1256051 1253184 −2 2868 Peroxidase (EC 1.11.1.8) -none- D23_1c1354 NA
fig|6666666.60966.peg.1348 CDS 1257505 1256081 −1 1425 Hemagglutinin -none- D23_1c1355 NA
fig|6666666.60966.peg.1349 CDS 1258257 1257547 −3 711 hypothetical protein -none- D23_1c1356 NA
fig|6666666.60966.peg.1350 CDS 1259233 1258262 −1 972 hypothetical protein -none- D23_1c1357 NA
fig|6666666.60966.peg.1351 CDS 1261078 1259246 −1 1833 hypothetical protein -none- D23_1c1358 NA
fig|6666666.60966.peg.1352 CDS 1262776 1261109 −1 1668 Arachidonate 15- -none- D23_1c1359 NA
lipoxygenase (EC
1.13.11.33)
fig|6666666.60966.peg.1353 CDS 1264449 1262845 −3 1605 putative -none- D23_1c1360 NA
cyclooxygenase-2
fig|6666666.60966.peg.1354 CDS 1266134 1264638 −2 1497 hypothetical protein -none- D23_1c1361 NA
fig|6666666.60966.peg.1355 CDS 1266382 1266167 −1 216 hypothetical protein -none- D23_1c1362 NA
fig|6666666.60966.peg.1356 CDS 1266704 1266444 −2 261 hypothetical protein -none- D23_1c1363 NA
fig|6666666.60966.peg.1357 CDS 1267804 1266983 −1 822 Kazal-type serine -none- D23_1c1364 NA
protease inhibitor
domain
fig|6666666.60966.peg.1358 CDS 1268650 1267970 −1 681 Kazal-type serine -none- D23_1c1365 NA
protease inhibitor
domain
fig|6666666.60966.peg.1359 CDS 1268913 1268800 −3 114 hypothetical protein -none- D23_1c1366 NA
fig|6666666.60966.peg.1360 CDS 1269830 1269126 −2 705 Mobile element protein -none- D23_1c1367 Neut_1318
fig|6666666.60966.peg.1361 CDS 1270083 1269853 −3 231 Mobile element protein -none- D23_1c1368 Neut_1318
fig|6666666.60966.peg.1362 CDS 1270317 1270111 −3 207 Mobile element protein -none- D23_1c1369 Neut_2405
fig|6666666.60966.peg.1363 CDS 1271332 1270409 −1 924 alpha/beta hydrolase -none- D23_1c1370 NA
fold
fig|6666666.60966.peg.1364 CDS 1271721 1271329 −3 393 hypothetical protein -none- D23_1c1371 NA
fig|6666666.60966.peg.1365 CDS 1272160 1273251 1 + 1092 Putrescine transport Polyamine Metabolism D23_1c1372 Neut_1328
ATP-binding protein
PotA (TC 3.A.1.11.1)
fig|6666666.60966.peg.1366 CDS 1273248 1274150 3 + 903 Spermidine Putrescine Polyamine Metabolism D23_1c1373 Neut_1329
ABC transporter
permease component
PotB (TC 3.A.1.11.1)
fig|6666666.60966.peg.1367 CDS 1274170 1274955 1 + 786 Spermidine Putrescine Polyamine Metabolism D23_1c1374 Neut_1330
ABC transporter
permease component
potC (TC_3.A.1.11.1)
fig|6666666.60966.peg.1368 CDS 1274952 1276061 3 + 1110 ABC transporter, Polyamine Metabolism D23_1c1375 Neut_1331
periplasmic spermidine
putrescine-binding
protein PotD (TC
3.A.1.11.1)
fig|6666666.60966.peg.1369 CDS 1276066 1276374 1 + 309 Ferredoxin, 2Fe—2S Alanine biosynthesis; D23_1c1376 Neut_1332
<br>Soluble
cytochromes and
functionally related
electron carriers;
<br>tRNA modification
Bacteria
fig|6666666.60966.peg.1370 CDS 1278030 1276423 −3 1608 Type I restriction- Restriction-Modification D23_1c1377 Neut_0541
modification system, System; <br>Type I
DNA-methyltransferase Restriction-Modification
subunit M (EC 2.1.1.72)
fig|6666666.60966.peg.1371 CDS 1279031 1278027 −2 1005 Putative DNA-binding Restriction-Modification D23_1c1378 NA
protein in cluster with System
Type I restriction-
modification system
fig|6666666.60966.peg.1372 CDS 1282963 1279028 −1 3936 Type I restriction- Restriction-Modification D23_1c1379 Neut_0537
modification system, System; <br>Type I
restriction subunit R (EC Restriction-Modification
3.1.21.3)
fig|6666666.60966.peg.1373 CDS 1283272 1282982 −1 291 Type I restriction- Restriction-Modification D23_1c1380 NA
modification system, System; <br>Type I
restriction subunit R (EC Restriction-Modification
3.1.21.3)
fig|6666666.60966.peg.1374 CDS 1287342 1283581 −3 3762 macromolecule -none- D23_1c1381 Neut_1336
metabolism;
macromolecule
synthesis, modification;
dna-replication, repair,
restr./modif.
fig|6666666.60966.peg.1375 CDS 1287828 1287349 −3 480 FIG00858549: -none- D23_1c1382 Neut_1337
hypothetical protein
fig|6666666.60966.peg.1376 CDS 1288968 1287859 −3 1110 2-keto-3-deoxy-D- Chorismate Synthesis; D23_1c1383 Neut_1338
arabino-heptulosonate- <br>Common Pathway
7-phosphate synthase I For Synthesis of
alpha (EC 2.5.1.54) Aromatic Compounds
(DAHP synthase to
chorismate)
fig|6666666.60966.peg.1377 CDS 1290768 1289113 −3 1656 MutS domain protein, DNA repair, bacterial D23_1c1384 Neut_1339
family 6 MutL-MutS system
fig|6666666.60966.peg.1378 CDS 1290915 1291493 3 + 579 FIG00858435: -none- D23_1c1385 Neut_1340
hypothetical protein
fig|6666666.60966.peg.1379 CDS 1291506 1292660 3 + 1155 Probable Co/Zn/Cd Cobalt-zinc-cadmium D23_1c1386 Neut_1341
efflux system resistance
membrane fusion
protein
fig|6666666.60966.peg.1380 CDS 1292693 1293328 2 + 636 ABC transporter ATP- -none- D23_1c1387 Neut_1342
binding protein YvcR
fig|6666666.60966.peg.1381 CDS 1293325 1294527 1 + 1203 ABC transporter -none- D23_1c1388 Neut_1343
permease protein
fig|6666666.60966.peg.1382 CDS 1294533 1295732 3 + 1200 putative ABC -none- D23_1c1389 Neut_1344
transporter protein
fig|6666666.60966.peg.1383 CDS 1296266 1295742 −2 525 FIG00859169: -none- D23_1c1390 Neut_1345
hypothetical protein
fig|6666666.60966.peg.1385 CDS 1296862 1297086 1 + 225 ADA regulatory protein/ DNA repair, bacterial; D23_1c1391 Neut_1346
Methylated-DNA-- <br>DNA repair,
protein-cysteine bacterial
methyltransferase (EC
2.1.1.63)
fig|6666666.60966.peg.1386 CDS 1297089 1297802 3 + 714 hypothetical protein -none- D23_1c1392 Neut_1347
fig|6666666.60966.peg.1387 CDS 1298101 1297967 −1 135 hypothetical protein -none- D23_1c1393 NA
fig|6666666.60966.peg.1389 CDS 1298212 1298838 1 + 627 Alkylated DNA repair -none- D23_1c1395 Neut_1349
protein
fig|6666666.60966.peg.1390 CDS 1300170 1298923 −3 1248 Mobile element protein -none- D23_1c1396 Neut_0357
fig|6666666.60966.peg.1391 CDS 1300681 1300355 −1 327 hypothetical protein -none- D23_1c1397 Neut_1350
fig|6666666.60966.peg.1392 CDS 1301157 1300963 −3 195 Glutaredoxin Glutaredoxins; D23_1c1398 Neut_1351
<br>Glutathione: Redox
cycle; <br>Phage DNA
synthesis
fig|6666666.60966.peg.1393 CDS 1302170 1301697 −2 474 Mobile element protein -none- D23_1c1399 Neut_1353
fig|6666666.60966.peg.1394 CDS 1303008 1302400 −3 609 Glutathione S- Glutathione: Non-redox D23_1c1400 Neut_1354
transferase (EC reactions
2.5.1.18)
fig|6666666.60966.peg.1395 CDS 1303729 1303556 −1 174 hypothetical protein -none- D23_1c1402 NA
fig|6666666.60966.peg.1396 CDS 1303948 1307514 1 + 3567 Exodeoxyribonuclease V DNA repair, bacterial D23_1c1403 Neut_1355
gamma chain (EC RecBCD pathway
3.1.11.5)
fig|6666666.60966.peg.1397 CDS 1307530 1311216 1 + 3687 Exodeoxyribonuclease V DNA repair, bacterial D23_1c1404 Neut_1356
beta chain (EC 3.1.11.5) RecBCD pathway
fig|6666666.60966.peg.1398 CDS 1311213 1313258 3 + 2046 Exodeoxyribonuclease V DNA repair, bacterial D23_1c1405 Neut_1357
alpha chain (EC RecBCD pathway
3.1.11.5)
fig|6666666.60966.peg.1399 CDS 1314581 1313277 −2 1305 Aspartyl -none- D23_1c1406 Neut_1358
aminopeptidase
fig|6666666.60966.peg.1400 CDS 1315032 1314604 −3 429 PIN domain family -none- D23_1c1407 Neut_1359
protein
fig|6666666.60966.peg.1401 CDS 1315334 1315032 −2 303 DNA-binding protein, -none- D23_1c1408 Neut_1360
CopG family
fig|6666666.60966.peg.1402 CDS 1316699 1315362 −2 1338 Sensor protein PhoQ -none- D23_1c1409 Neut_1361
(EC 2.7.13.3)
fig|6666666.60966.peg.1403 CDS 1317382 1316696 −1 687 DNA-binding response -none- D23_1c1410 Neut_1362
regulator
fig|6666666.60966.peg.1404 CDS 1317741 1317451 −3 291 hypothetical protein -none- D23_1c1411 Neut_1363
fig|6666666.60966.peg.1405 CDS 1318192 1317827 −1 366 Putative metal G3E family of P-loop D23_1c1412 NA
chaperone, involved in GTPases (metallocenter
Zn homeostasis, GTPase biosynthesis); <br>Zinc
of COG0523 family regulated enzymes
fig|6666666.60966.peg.1406 CDS 1318485 1319036 3 + 552 Protein of unknown -none- D23_1c1413 Neut_1365
function DUF924
fig|6666666.60966.peg.1407 CDS 1320160 1319171 −1 990 Integron integrase Integrons D23_1c1414 Neut_1366
IntlPac
fig|6666666.60966.peg.1408 CDS 1320314 1321651 2 + 1338 DNA modification -none- D23_1c1415 NA
methyltransferase
fig|6666666.60966.peg.1409 CDS 1321654 1322532 1 + 879 hypothetical protein -none- D23_1c1416 NA
fig|6666666.60966.peg.1410 CDS 1322665 1322880 1 + 216 hypothetical protein -none- D23_1c1417 NA
fig|6666666.60966.peg.1411 CDS 1323474 1324154 3 + 681 ThiJ/Pfpl family protein -none- D23_1c1418 NA
fig|6666666.60966.peg.1412 CDS 1324808 1324990 2 + 183 hypothetical protein -none- D23_1c1419 NA
fig|6666666.60966.peg.1413 CDS 1325941 1324979 −1 963 Mobile element protein -none- D23_1c1420 Neut_1746
fig|6666666.60966.peg.1415 CDS 1326558 1328531 3 + 1974 Monoamine oxidase Auxin biosynthesis; D23_1c1421 NA
(1.4.3.4) <br>Glycine and Serine
Utilization;
<br>Threonine
degradation
fig|6666666.60966.peg.1417 CDS 1328848 1328711 −1 138 Mobile element protein -none- D23_1c1422 Neut_2501
fig|6666666.60966.peg.1418 CDS 1329144 1328821 −3 324 Mobile element protein -none- D23_1c1423 Neut_1624
fig|6666666.60966.peg.1419 CDS 1329566 1329129 −2 438 Mobile element protein -none- D23_1c1424 Neut_1888
fig|6666666.60966.peg.1420 CDS 1330200 1329892 −3 309 Death on curing Phd-Doc, YdcE-YdcD D23_1c1425 NA
protein, Doc toxin toxin-antitoxin
(programmed cell death)
systems
fig|6666666.60966.peg.1421 CDS 1330677 1330231 −3 447 Prevent host death Phd-Doc, YdcE-YdcD D23_1c1426 NA
protein, Phd antitoxin toxin-antitoxin
(programmed cell death)
systems
fig|6666666.60966.peg.1423 CDS 1331253 1331387 3 + 135 Mobile element protein -none- D23_1c1427 Neut_2500
fig|6666666.60966.peg.1424 CDS 1331444 1332292 2 + 849 Mobile element protein -none- D23_1c1428 Neut_1888
fig|6666666.60966.peg.1425 CDS 1332744 1333214 3 + 471 3-demethylubiquinone- -none- D23_1c1429 Neut_1376
9 3-methyltransferase
fig|6666666.60966.peg.1426 CDS 1333410 1335026 3 + 1617 Dihydroxyacetone Dihydroxyacetone D23_1c1431 Neut_1377
kinase, ATP-dependent kinases
(EC 2.7.1.29)
fig|6666666.60966.peg.1427 CDS 1335644 1335210 −2 435 hypothetical protein -none- D23_1c1432 Neut_1378
fig|6666666.60966.peg.1428 CDS 1339065 1335670 −3 3396 PDZ domain -none- D23_1c1433 Neut_1379
fig|6666666.60966.peg.1429 CDS 1339241 1340350 2 + 1110 COGs COG0823 -none- D23_1c1435 Neut_1380
fig|6666666.60966.peg.1430 CDS 1341715 1340438 −1 1278 Putative diheme Soluble cytochromes D23_1c1436 Neut_1381
cytochrome c-553 and functionally related
electron carriers
fig|6666666.60966.peg.1431 CDS 1342431 1341712 −3 720 Probable cytochrome c2 Soluble cytochromes D23_1c1437 Neut_1382
and functionally related
electron carriers
fig|6666666.60966.peg.1432 CDS 1342445 1342963 2 + 519 FIG00859968: -none- D23_1c1438 Neut_1383
hypothetical protein
fig|6666666.60966.peg.1433 CDS 1344805 1342952 −1 1854 Cell division protein Bacterial Cell Division D23_1c1439 Neut_1384
FtsH (EC 3.4.24.—)
fig|6666666.60966.peg.1434 CDS 1345012 1346118 1 + 1107 S- Glutathione-dependent D23_1c1440 Neut_1385
(hydroxymethyl)glutathione pathway of
dehydrogenase (EC formaldehyde
1.1.1.284) detoxification
fig|6666666.60966.peg.1435 CDS 1346131 1347000 1 + 870 S-formylglutathione Glutathione-dependent D23_1c1441 Neut_1386
hydrolase (EC 3.1.2.12) pathway of
formaldehyde
detoxification
fig|6666666.60966.peg.1436 CDS 1348436 1347264 −2 1173 Ornithine Arginine and Ornithine D23_1c1442 Neut_1387
decarboxylase (EC Degradation;
4.1.1.17)/Arginine <br>Arginine and
decarboxylase (EC Ornithine Degradation;
4.1.1.19) <br>Polyamine
Metabolism;
<br>Polyamine
Metabolism
fig|6666666.60966.peg.1437 CDS 1348961 1349230 2 + 270 FIG00858492: -none- D23_1c1443 Neut_1388
hypothetical protein
fig|6666666.60966.peg.1438 CDS 1349336 1349214 −2 123 hypothetical protein -none- D23_1c1444 NA
fig|6666666.60966.peg.1439 CDS 1349660 1350622 2 + 963 Mobile element protein -none- D23_1c1446 Neut_1862
fig|6666666.60966.peg.1440 CDS 1350742 1352079 1 + 1338 Ribosomal protein S12p Methylthiotransferases; D23_1c1447 Neut_1389
Asp88 (E. coli) <br>Ribosomal protein
methylthiotransferase S12p Asp
methylthiotransferase
fig|6666666.60966.peg.1441 CDS 1353046 1352255 −1 792 hypothetical protein -none- D23_1c1448 Neut_1390
fig|6666666.60966.peg.1442 CDS 1353301 1353618 1 + 318 Cell division protein Bacterial Cell Division D23_1c1449 Neut_1391
BolA
fig|6666666.60966.peg.1443 CDS 1353569 1354282 2 + 714 LemA family protein -none- D23_1c1450 Neut_1392
fig|6666666.60966.peg.1444 CDS 1354309 1355193 1 + 885 Beta-propeller domains -none- D23_1c1451 Neut_1393
of methanol
dehydrogenase type
fig|6666666.60966.peg.1445 CDS 1355207 1355710 2 + 504 FIG004694: -none- D23_1c1452 Neut_1394
Hypothetical protein
fig|6666666.60966.peg.1446 CDS 1356010 1356513 1 + 504 DNA-directed RNA -none- D23_1c1454 Neut_1395
polymerase specialized
sigma subunit, sigma24-
like
fig|6666666.60966.peg.1447 CDS 1356510 1357232 3 + 723 FIG00859011: -none- D23_1c1455 Neut_1396
hypothetical protein
fig|6666666.60966.peg.1448 CDS 1357326 1359644 3 + 2319 ABC transporter, -none- D23_1c1456 Neut_1397
transmembrane
region: ABC transporter
related
fig|6666666.60966.peg.1449 CDS 1359641 1360108 2 + 468 DUF1854 domain- -none- D23_1c1457 Neut_1398
containing protein
fig|6666666.60966.peg.1451 CDS 1360927 1362021 1 + 1095 hypothetical protein -none- D23_1c1458 Neut_1860
fig|6666666.60966.peg.1452 CDS 1362049 1362342 1 + 294 Mobile element protein -none- D23_1c1459 Neut_1719
fig|6666666.60966.peg.1453 CDS 1362441 1363319 3 + 879 Mobile element protein -none- D23_1c1460 Neut_1720
fig|6666666.60966.peg.1454 CDS 1363397 1365250 2 + 1854 hypothetical protein -none- D23_1c1461 NA
fig|6666666.60966.peg.1455 CDS 1365453 1365262 −3 192 Mobile element protein -none- D23_1c1462 Neut_2502
fig|6666666.60966.peg.1456 CDS 1365648 1367945 3 + 2298 Cyanophycin synthase Cyanophycin D23_1c1463 Neut_1401
(EC 6.3.2.29)(EC Metabolism
6.3.2.30)
fig|6666666.60966.peg.1457 CDS 1367966 1370572 2 + 2607 Cyanophycin synthase Cyanophycin D23_1c1464 Neut_1402
(EC 6.3.2.29)(EC Metabolism
6.3.2.30)
fig|6666666.60966.peg.1458 CDS 1371664 1370720 −1 945 Copper-containing Denitrification; D23_1c1465 Neut_1403
nitrite reductase (EC <br>Denitrifying
1.7.2.1) reductase gene clusters
fig|6666666.60966.peg.1459 CDS 1372091 1371708 −2 384 cytochrome c, class IC -none- D23_1c1466 Neut_1404
fig|6666666.60966.peg.1460 CDS 1372789 1372091 −1 699 Cytochrome c, class I -none- D23_1c1467 Neut_1405
fig|6666666.60966.peg.1461 CDS 1373888 1372827 −2 1062 Multicopper oxidase Copper homeostasis D23_1c1468 Neut_1406
fig|6666666.60966.peg.1462 CDS 1374021 1374137 3 + 117 hypothetical protein -none- D23_1c1469 NA
fig|6666666.60966.peg.1463 CDS 1374189 1374653 3 + 465 Nitrite-sensitive Nitrosative stress; D23_1c1470 Neut_1407
transcriptional <br>Oxidative stress;
repressor NsrR <br>Rrf2 family
transcriptional
regulators
fig|6666666.60966.peg.1464 CDS 1378537 1374641 −1 3897 FIG00858660: -none- D23_1c1471 Neut_1408
hypothetical protein
fig|6666666.60966.peg.1465 CDS 1380248 1378539 −2 1710 Outer membrane -none- D23_1c1472 Neut_1409
protein
fig|6666666.60966.peg.1466 CDS 1380471 1380340 −3 132 hypothetical protein -none- D23_1c1473 NA
fig|6666666.60966.peg.1467 CDS 1380491 1381141 2 + 651 Uracil-DNA glycosylase, Uracil-DNA glycosylase D23_1c1474 Neut_1410
family 5
fig|6666666.60966.peg.1468 CDS 1381162 1381350 1 + 189 putative isomerase -none- D23_1c1475 Neut_1411
fig|6666666.60966.peg.1469 CDS 1381364 1383178 2 + 1815 Excinuclease ABC DNA repair, UvrABC D23_1c1476 Neut_1412
subunit C system
fig|6666666.60966.peg.1470 CDS 1383321 1384283 3 + 963 Mobile element protein -none- D23_1c1477 Neut_1746
fig|6666666.60966.peg.1471 CDS 1384401 1384814 3 + 414 ABC-type multidrug CBSS-196164.1.peg.1690 D23_1c1478 NA
transport system,
permease component
fig|6666666.60966.peg.1472 CDS 1384811 1385149 2 + 339 ABC-type multidrug CBSS-196164.1.peg.1690 D23_1c1479 NA
transport system,
permease component
fig|6666666.60966.peg.1474 CDS 1385894 1388275 2 + 2382 Penicillin acylase II -none- D23_1c1480 Neut_1415
fig|6666666.60966.peg.1475 CDS 1388559 1388395 −3 165 hypothetical protein -none- D23_1c1481 NA
fig|6666666.60966.peg.1476 CDS 1388615 1389973 2 + 1359 Response regulatory -none- D23_1c1482 Neut_1416
protein
fig|6666666.60966.peg.1477 CDS 1390014 1391603 3 + 1590 Long-chain-fatty-acid-- Biotin biosynthesis; D23_1c1483 Neut_1417
CoAligase (EC 6.2.1.3) <br>Biotin synthesis
cluster; <br>Fatty acid
metabolism cluster
fig|6666666.60966.peg.1478 CDS 1391630 1392835 2 + 1206 Diaminopimelate Lysine Biosynthesis DAP D23_1c1484 Neut_1418
decarboxylase (EC Pathway, GJO scratch
4.1.1.20)
fig|6666666.60966.peg.1479 CDS 1392996 1394843 3 + 1848 Asparagine synthetase Cyanophycin D23_1c1485 Neut_1419
[glutamine-hydrolyzing] Metabolism;
(EC 6.3.5.4) <br>Glutamate and
Aspartate uptake in
Bacteria; <br>Glutamine,
Glutamate, Aspartate
and Asparagine
Biosynthesis
fig|6666666.60966.peg.1480 CDS 1394795 1394911 2 + 117 hypothetical protein -none- D23_1c1486 NA
fig|6666666.60966.peg.1482 CDS 1395163 1395975 1 + 813 FIG00858746: -none- D23_1c1488 Neut_1420
hypothetical protein
fig|6666666.60966.peg.1483 CDS 1397102 1396140 −2 963 Mobile element protein -none- D23_1c1490 Neut_1746
fig|6666666.60966.peg.1484 CDS 1397178 1397462 3 + 285 COGs COG0226 -none- D23_1c1491 Neut_1423
fig|6666666.60966.peg.1485 CDS 1397455 1398681 1 + 1227 FIG00859800: -none- D23_1c1492 Neut_1424
hypothetical protein
fig|6666666.60966.peg.1486 CDS 1398693 1401635 3 + 2943 diguanylate -none- D23_1c1493 Neut_1425
cyclase/phosphodiesterase
(GGDEF & EAL
domains) with PAS/PAC
sensor(s)
fig|6666666.60966.peg.1488 CDS 1402082 1401924 −2 159 hypothetical protein -none- D23_1c1494 NA
fig|6666666.60966.peg.1489 CDS 1402531 1402115 −1 417 OsmC/Ohr family -none- D23_1c1495 Neut_1426
protein
fig|6666666.60966.peg.1490 CDS 1403584 1402532 −1 1053 DNA polymerase III CBSS-208964.1.peg.3988 D23_1c1496 Neut_1427
delta subunit (EC
2.7.7.7)
fig|6666666.60966.peg.1491 CDS 1404106 1403612 −1 495 LPS-assembly CBSS- D23_1c1497 Neut_1428
lipoprotein RlpB 208964.1.peg.3988;
precursor (Rare <br>Lipopolysaccharide
lipoprotein B) assembly
fig|6666666.60966.peg.1492 CDS 1406732 1404126 −2 2607 Leucyl-tRNA synthetase CBSS- D23_1c1498 Neut_1429
(EC 6.1.1.4) 208964.1.peg.3988;
<br>tRNA
aminoacylation, Leu
fig|6666666.60966.peg.1493 CDS 1406756 1407925 2 + 1170 S- CBSS- D23_1c1499 Neut_1430
adenosylmethionine:tRNA 211586.1.peg.2832;
ribosyltransferase- <br>Queuosine-
isomerase (EC 5.—.—.—) Archaeosine
Biosynthesis;
<br>Scaffold proteins for
[4Fe—4S] cluster
assembly (MRP family);
<br>tRNA modification
Bacteria
fig|6666666.60966.peg.1494 CDS 1407922 1409007 1 + 1086 tRNA-guanine CBSS- D23_1c1500 Neut_1431
transglycosylase (EC 211586.1.peg.2832;
2.4.2.29) <br>Queuosine-
Archaeosine
Biosynthesis;
<br>Scaffold proteins for
[4Fe—4S] cluster
assembly (MRP family);
<br>tRNA modification
Bacteria
fig|6666666.60966.peg.1495 CDS 1409072 1409536 2 + 465 Preprotein translocase CBSS-211586.1.peg.2832 D23_1c1501 Neut_1432
subunit YajC (TC
3.A.5.1.1)
fig|6666666.60966.peg.1496 CDS 1409575 1411470 1 + 1896 Protein-export CBSS-211586.1.peg.2832 D23_1c1502 Neut_1433
membrane protein
SecD (TC 3.A.5.1.1)
fig|6666666.60966.peg.1497 CDS 1411495 1412427 1 + 933 Protein-export CBSS-211586.1.peg.2832 D23_1c1503 Neut_1434
membrane protein SecF
(TC 3.A.5.1.1)
fig|6666666.60966.peg.1498 CDS 1412467 1412844 1 + 378 FIG028220: -none- D23_1c1504 Neut_1435
hypothetical protein co-
occurring with HEAT
repeat protein
fig|6666666.60966.peg.1499 CDS 1412897 1413628 2 + 732 Ubiquinone/menaquinone Menaquinone and D23_1c1505 Neut_1436
biosynthesis Phylloquinone
methyltransferase UbiE Biosynthesis;
(EC 2.1.1.—) <br>Ubiquinone
Biosynthesis;
<br>Ubiquinone
Biosynthesis-gjo
fig|6666666.60966.peg.1500 CDS 1413802 1413680 −1 123 Agmatinase (EC Arginine and Ornithine D23_1c1506 Neut_1437
3.5.3.11) Degradation;
<br>Polyamine
Metabolism
fig|6666666.60966.peg.1501 CDS 1414650 1413808 −3 843 Agmatinase (EC Arginine and Ornithine D23_1c1507 Neut_1437
3.5.3.11) Degradation;
<br>Polyamine
Metabolism
fig|6666666.60966.peg.1502 CDS 1415255 1414815 −2 441 Lipoprotein signal Lipoprotein Biosynthesis; D23_1c1509 Neut_1438
peptidase (EC 3.4.23.36) <br>Signal peptidase
fig|6666666.60966.peg.1503 CDS 1415346 1415224 −3 123 hypothetical protein -none- D23_1c1510 NA
fig|6666666.60966.peg.1504 CDS 1418173 1415339 −1 2835 Isoleucyl-tRNA tRNA aminoacylation, Ile D23_1c1511 Neut_1439
synthetase (EC 6.1.1.5)
fig|6666666.60966.peg.1505 CDS 1418945 1418148 −2 798 Riboflavin kinase (EC Riboflavin, FMN and FAD D23_1c1512 Neut_1440
2.7.1.26)/FMN metabolism;
adenylyltransferase (EC <br>Riboflavin, FMN and
2.7.7.2) FAD metabolism;
<br>Riboflavin, FMN and
FAD metabolism in
plants; <br>Riboflavin,
FMN and FAD
metabolism in plants;
<br>riboflavin to FAD;
<br>riboflavin to FAD
fig|6666666.60966.peg.1506 CDS 1419539 1419237 −2 303 possible sec- -none- D23_1c1513 Neut_1441
independent protein
translocase protein
TatC
fig|6666666.60966.peg.1507 CDS 1420011 1419886 −3 126 hypothetical protein -none- D23_1c1514 Neut_1442
fig|6666666.60966.peg.1508 CDS 1420112 1422079 2 + 1968 Dipeptide-binding ABC ABC transporter D23_1c1514 Neut_1442
transporter, periplasmic dipeptide (TC 3.A.1.5.2)
substrate-binding
component (TC
3.A.1.5.2)
fig|6666666.60966.peg.1509 CDS 1422089 1423066 2 + 978 Oligopeptide transport ABC transporter D23_1c1515 Neut_1443
system permease oligopeptide (TC
protein OppB (TC 3.A.1.5.1)
3.A.1.5.1)
fig|6666666.60966.peg.1511 CDS 1423196 1424851 2 + 1656 DnaJ-class molecular Protein chaperones D23_1c1516 Neut_1444
chaperone CbpA
fig|6666666.60966.peg.1512 CDS 1424900 1425844 2 + 945 DnaJ-class molecular Protein chaperones D23_1c1517 Neut_1445
chaperone CbpA
fig|6666666.60966.peg.1513 CDS 1425856 1426152 1 + 297 InterPro IPR000551 -none- D23_1c1518 Neut_1446
fig|6666666.60966.peg.1514 CDS 1426240 1427103 1 + 864 FIG00858431: -none- D23_1c1519 Neut_1447
hypothetical protein
fig|6666666.60966.peg.1515 CDS 1427120 1427659 2 + 540 FAD pyrophosphatase -none- D23_1c1520 Neut_1448
(EC 3.6.1.18), projected
from PMID:18815383
fig|6666666.60966.peg.1516 CDS 1428946 1428491 −1 456 Mobile element protein -none- D23_1c1522 Neut_2502
fig|6666666.60966.peg.1517 CDS 1429295 1428909 −2 387 Mobile element protein -none- D23_1c1523 Neut_0884
fig|6666666.60966.peg.1518 CDS 1430487 1429300 −3 1188 Mobile element protein -none- D23_1c1524 Neut_2405
fig|6666666.60966.peg.1519 CDS 1430505 1430621 3 + 117 patatin family protein -none- D23_1c1525 Neut_1317
fig|6666666.60966.peg.1520 CDS 1430834 1430670 −2 165 hypothetical protein -none- D23_1c1526 NA
fig|6666666.60966.peg.1521 CDS 1431909 1431424 −3 486 hypothetical protein -none- D23_1c1527 Neut_1449
fig|6666666.60966.peg.1522 CDS 1432156 1431899 −1 258 hypothetical protein -none- D23_1c1528 Neut_1450
fig|6666666.60966.peg.1523 CDS 1432650 1432159 −3 492 phage-related -none- D23_1c1529 Neut_1451
hypothetical protein
fig|6666666.60966.peg.1524 CDS 1432970 1432650 −2 321 hypothetical protein -none- D23_1c1530 Neut_1452
fig|6666666.60966.peg.1525 CDS 1433143 1432967 −1 177 hypothetical protein -none- D23_1c1531 Neut_1453
fig|6666666.60966.peg.1526 CDS 1434487 1433552 −1 936 hypothetical protein -none- D23_1c1533 Neut_1454
fig|6666666.60966.peg.1527 CDS 1437226 1434497 −1 2730 hypothetical protein -none- D23_1c1534 Neut_1455
fig|6666666.60966.peg.1528 CDS 1437449 1437267 −2 183 Phage protein -none- D23_1c1535 Neut_1456
fig|6666666.60966.peg.1529 CDS 1437694 1437467 −1 228 hypothetical protein -none- D23_1c1536 Neut_1457
fig|6666666.60966.peg.1530 CDS 1438472 1437702 −2 771 hypothetical protein -none- D23_1c1537 Neut_1458
fig|6666666.60966.peg.1531 CDS 1439638 1438469 −1 1170 hypothetical protein -none- D23_1c1538 Neut_1459
fig|6666666.60966.peg.1532 CDS 1441511 1439631 −2 1881 Phage tail length tape- Phage tail proteins; D23_1c1539 Neut_1460
measure protein <br>Phage tail proteins 2
fig|6666666.60966.peg.1533 CDS 1442755 1441508 −1 1248 Mobile element protein -none- D23_1c1540 Neut_0357
fig|6666666.60966.peg.1534 CDS 1443390 1442854 −3 537 Phage protein -none- D23_1c1541 Neut_1460
fig|6666666.60966.peg.1535 CDS 1443638 1443390 −2 249 hypothetical protein -none- D23_1c1542 Neut_1461
fig|6666666.60966.peg.1536 CDS 1444027 1443677 −1 351 Phage protein -none- D23_1c1543 Neut_1462
fig|6666666.60966.peg.1537 CDS 1444752 1444036 −3 717 major tail protein, -none- D23_1c1544 Neut_1463
putative
fig|6666666.60966.peg.1538 CDS 1445120 1444758 −2 363 hypothetical protein -none- D23_1c1545 Neut_1464
fig|6666666.60966.peg.1539 CDS 1445638 1445117 −1 522 FIG00959132: -none- D23_1c1546 Neut_1465
hypothetical protein
fig|6666666.60966.peg.1540 CDS 1445985 1445650 −3 336 Phage protein -none- D23_1c1547 Neut_1466
fig|6666666.60966.peg.1541 CDS 1446544 1445987 −1 558 Similar to Gene Transfer -none- D23_1c1548 Neut_1467
Agent (GTA) ORFG06
fig|6666666.60966.peg.1542 CDS 1446900 1446601 −3 300 hypothetical protein -none- D23_1c1549 Neut_1468
fig|6666666.60966.peg.1543 CDS 1448136 1446910 −3 1227 Phage major capsid Phage capsid proteins D23_1c1550 Neut_1469
protein
fig|6666666.60966.peg.1544 CDS 1448949 1448218 −3 732 Prophage Clp protease- cAMP signaling in D23_1c1551 Neut_1470
like protein bacteria
fig|6666666.60966.peg.1545 CDS 1450207 1448915 −1 1293 Phage portal protein Phage packaging D23_1c1552 Neut_1471
machinery
fig|6666666.60966.peg.1546 CDS 1451877 1450204 −3 1674 Phage terminase large Phage packaging D23_1c1553 Neut_1472
subunit machinery
fig|6666666.60966.peg.1547 CDS 1452346 1451882 −1 465 Phage terminase, small Phage packaging D23_1c1554 Neut_1473
subunit machinery
fig|6666666.60966.peg.1548 CDS 1452801 1452478 −3 324 Phage holin -none- D23_1c1555 Neut_1474
fig|6666666.60966.peg.1549 CDS 1453267 1452887 −1 381 hypothetical protein -none- D23_1c1556 Neut_1475
fig|6666666.60966.peg.1550 CDS 1453430 1453269 −2 162 hypothetical protein -none- D23_1c1557 NA
fig|6666666.60966.peg.1551 CDS 1453630 1453451 −1 180 hypothetical protein -none- D23_1c1558 NA
fig|6666666.60966.peg.1552 CDS 1453862 1453623 −2 240 hypothetical protein -none- D23_1c1559 Neut_1477
fig|6666666.60966.peg.1553 CDS 1456504 1454171 −1 2334 DNA primase, phage -none- D23_1c1560 Neut_1478
associated # P4-type
fig|6666666.60966.peg.1554 CDS 1456740 1456501 −3 240 hypothetical protein -none- D23_1c1561 NA
fig|6666666.60966.peg.1555 CDS 1456744 1456887 1 + 144 Phage-related protein -none- D23_1c1562 Neut_1480
fig|6666666.60966.peg.1556 CDS 1456894 1457172 1 + 279 Helix-turn-helix motif -none- D23_1c1563 Neut_1481
fig|6666666.60966.peg.1557 CDS 1457678 1457277 −2 402 hypothetical protein -none- D23_1c1564 NA
fig|6666666.60966.peg.1558 CDS 1458137 1458478 2 + 342 hypothetical protein -none- D23_1c1565 NA
fig|6666666.60966.peg.1559 CDS 1458868 1459158 1 + 291 hypothetical protein -none- D23_1c1566 NA
fig|6666666.60966.peg.1561 CDS 1459812 1459672 −3 141 hypothetical protein -none- D23_1c1567 NA
fig|6666666.60966.peg.1563 CDS 1460270 1460563 2 + 294 Mobile element protein -none- D23_1c1568 Neut_1719
fig|6666666.60966.peg.1564 CDS 1460662 1461540 1 + 879 Mobile element protein -none- D23_1c1569 Neut_1720
fig|6666666.60966.peg.1565 CDS 1462142 1461954 −2 189 hypothetical protein -none- D23_1c1570 Neut_1489
fig|6666666.60966.peg.1567 CDS 1462722 1462844 3 + 123 hypothetical protein -none- D23_1c1571 NA
fig|6666666.60966.peg.1568 CDS 1463137 1463829 1 + 693 putative nuclease -none- D23_1c1572 Neut_1491
fig|6666666.60966.peg.1569 CDS 1464806 1463826 −2 981 Abortive infection -none- D23_1c1573 NA
bacteriophage
resistance protein
fig|6666666.60966.peg.1570 CDS 1466353 1465106 −1 1248 Mobile element protein -none- D23_1c1574 Neut_0357
fig|6666666.60966.peg.1573 CDS 1466953 1467108 1 + 156 hypothetical protein -none- D23_1c1575 NA
fig|6666666.60966.peg.1574 CDS 1467105 1467389 3 + 285 hypothetical protein -none- D23_1c1576 Neut_1493
fig|6666666.60966.peg.1575 CDS 1467386 1467868 2 + 483 hypothetical protein -none- D23_1c1577 Neut_1494
fig|6666666.60966.peg.1576 CDS 1467883 1468245 1 + 363 hypothetical protein -none- D23_1c1578 Neut_1495
fig|6666666.60966.peg.1577 CDS 1468255 1468638 1 + 384 hypothetical protein -none- D23_1c1579 Neut_1496
fig|6666666.60966.peg.1580 CDS 1469337 1470362 3 + 1026 Integrase -none- D23_1c1580 Neut_1498
fig|6666666.60966.peg.1581 CDS 1470687 1470989 3 + 303 Exodeoxyribonuclease DNA repair, bacterial; D23_1c1582 Neut_1499
VII small subunit (EC <br>Purine salvage
3.1.11.6) cluster
fig|6666666.60966.peg.1582 CDS 1470979 1471872 1 + 894 Octaprenyl diphosphate Isoprenoid Biosynthesis; D23_1c1583 Neut_1500
synthase (EC 2.5.1.90)/ <br>Isoprenoid
Dimethylallyltransferase Biosynthesis;
(EC 2.5.1.1)/(2E,6E)- <br>Isoprenoid
farnesyl diphosphate Biosynthesis:
synthase (EC 2.5.1.10)/ Interconversions;
Geranylgeranyl <br>Isoprenoinds for
diphosphate synthase Quinones;
(EC 2.5.1.29) <br>Isoprenoinds for
Quinones;
<br>Isoprenoinds for
Quinones;
<br>Isoprenoinds for
Quinones;
<br>Polyprenyl
Diphosphate
Biosynthesis;
<br>Polyprenyl
Diphosphate
Biosynthesis;
<br>Polyprenyl
Diphosphate
Biosynthesis
fig|6666666.60966.peg.1583 CDS 1471935 1473779 3 + 1845 1-deoxy-D-xylulose 5- Isoprenoid Biosynthesis; D23_1c1584 Neut_1501
phosphate synthase (EC <br>Nonmevalonate
2.2.1.7) Branch of Isoprenoid
Biosynthesis;
<br>Pyridoxin (Vitamin
B6) Biosynthesis;
<br>Thiamin
biosynthesis
fig|6666666.60966.peg.1584 CDS 1473895 1474698 1 + 804 GTP cyclohydrolase I Folate Biosynthesis; D23_1c1585 Neut_1502
(EC 3.5.4.16) type 2 <br>Queuosine-
Archaeosine
Biosynthesis; <br>Zinc
regulated enzymes
fig|6666666.60966.peg.1585 CDS 1474865 1475485 2 + 621 InterPro IPR005134 -none- D23_1c1586 Neut_1503
COGs COG2862
fig|6666666.60966.peg.1586 CDS 1476254 1475514 −2 741 FolM Alternative Folate Biosynthesis D23_1c1587 Neut_1504
dihydrofolate reductase 1
fig|6666666.60966.peg.1587 CDS 1476327 1477502 3 + 1176 COG1565: -none- D23_1c1588 Neut_1505
Uncharacterized
conserved protein
fig|6666666.60966.peg.1588 CDS 1478242 1477499 −1 744 5&#39;- Adenosyl nucleosidases; D23_1c1589 Neut_1506
methylthioadenosine <br>Adenosyl
nucleosidase (EC nucleosidases;
3.2.2.16)/S- <br>CBSS-
adenosylhomocysteine 320388.3.peg.3759;
nucleosidase (EC <br>CBSS-
3.2.2.9) 320388.3.peg.3759;
<br>Methionine
Biosynthesis;
<br>Methionine
Degradation;
<br>Polyamine
Metabolism
fig|6666666.60966.peg.1589 CDS 1480269 1478239 −3 2031 Squalene--hopene CBSS- D23_1c1590 Neut_1507
cyclase (EC 5.4.99.17) 320388.3.peg.3759;
<br>Hopanes
fig|6666666.60966.peg.1590 CDS 1481103 1480384 −3 720 Surface lipoprotein -none- D23_1c1591 Neut_1508
fig|6666666.60966.peg.1591 CDS 1481997 1481389 −3 609 Ferric siderophore Ton and Tol transport D23_1c1592 Neut_1509
transport system, systems
biopolymer transport
protein ExbB
fig|6666666.60966.peg.1592 CDS 1482298 1483644 1 + 1347 Exodeoxyribonuclease DNA repair, bacterial; D23_1c1594 Neut_1510
VII large subunit (EC <br>Purine salvage
3.1.11.6) cluster
fig|6666666.60966.peg.1593 CDS 1483709 1484089 2 + 381 COG2363 -none- D23_1c1595 Neut_1511
fig|6666666.60966.peg.1594 CDS 1484150 1485328 2 + 1179 23S rRNA (guanine-N-2-)- RNA methylation D23_1c1596 Neut_1512
methyltransferase
rlmL EC 2.1.1.—)
fig|6666666.60966.peg.1595 CDS 1485345 1485833 3 + 489 Periplasmic Biogenesis of c-type D23_1c1597 Neut_1513
thiol:disulfide cytochromes;
oxidoreductase DsbB, <br>Periplasmic disulfide
required for DsbA interchange
reoxidation
fig|6666666.60966.peg.1596 CDS 1486114 1486503 1 + 390 Endoribonuclease L-PSP CBSS- D23_1c1598 Neut_1514
176299.4.peg.1996A
fig|6666666.60966.peg.1598 CDS 1486998 1486651 −3 348 FIG016027: protein of -none- D23_1c1599 Neut_1515
unknown function YeaO
fig|6666666.60966.peg.1599 CDS 1487053 1487727 1 + 675 AttE component of AttEFGH ABC Transport D23_1c1600 Neut_1516
AttEFGH ABC transport System
system
fig|6666666.60966.peg.1600 CDS 1487724 1490273 3 + 2550 AttF component of AttEFGH ABC Transport D23_1c1601 Neut_1517
AttEFGH ABC transport System; <br>AttEFGH
system/AttG ABC Transport System
component of AttEFGH
ABC transport system
fig|6666666.60966.peg.1601 CDS 1490273 1491343 2 + 1071 AttH component of AttEFGH ABC Transport D23_1c1602 Neut_1518
AttEFGH ABC transport System
system
fig|6666666.60966.peg.1602 CDS 1491424 1491666 1 + 243 Molybdopterin -none- D23_1c1603 Neut_1519
biosynthesis protein B
fig|6666666.60966.peg.1603 CDS 1491738 1491619 −3 120 hypothetical protein -none- D23_1c1604 NA
fig|6666666.60966.peg.1605 CDS 1492158 1492982 3 + 825 Particulate methane Particulate methane D23_1c1605 Neut_1520
monooxygenase C- monooxygenase
subunit (EC 1.14.13.25) (pMMO)
fig|6666666.60966.peg.1607 CDS 1494238 1493309 −1 930 Cytochrome c551 Protection from Reactive D23_1c1607 Neut_1521
peroxidase (EC 1.11.1.5) Oxygen Species
fig|6666666.60966.peg.1609 CDS 1494804 1495091 3 + 288 Mobile element protein -none- D23_1c1608 Neut_2502
fig|6666666.60966.peg.1611 CDS 1495989 1495288 −3 702 2-C-methyl-D-erythritol Isoprenoid Biosynthesis; D23_1c1609 Neut_1525
4-phosphate <br>Nonmevalonate
cytidylyltransferase (EC Branch of Isoprenoid
2.7.7.60) Biosynthesis;
<br>Possible RNA
degradation cluster;
<br>Stationary phase
repair cluster
fig|6666666.60966.peg.1612 CDS 1496057 1496497 2 + 441 Inosine-5&#39;- Purine conversions; D23_1c1610 Neut_1526
monophosphate <br>Purine salvage
dehydrogenase (EC cluster
1.1.1.205)
fig|6666666.60966.peg.1613 CDS 1497472 1496552 −1 921 Cell division protein Bacterial Cell Division; D23_1c1611 Neut_1527
FtsX <br>Heat shock Cell
division Proteases and a
Methyltransferase
fig|6666666.60966.peg.1614 CDS 1498131 1497469 −3 663 Cell division Bacterial Cell Division; D23_1c1612 Neut_1528
transporter, ATP- <br>Heat shock Cell
binding protein FtsE (TC division Proteases and a
3.A.5.1.1) Methyltransferase
fig|6666666.60966.peg.1615 CDS 1499195 1498158 −2 1038 Signal recognition Bacterial Cell Division; D23_1c1613 Neut_1529
particle receptor <br>Bacterial signal
protein FtsY (=alpha recognition particle
subunit) (TC 3.A.5.1.1) (SRP); <br>Heat shock
Cell division Proteases
and a Methyltransferase;
<br>Universal GTPases
fig|6666666.60966.peg.1616 CDS 1499262 1500653 3 + 1392 FIG015547: peptidase, -none- D23_1c1614 Neut_1530
M16 family
fig|6666666.60966.peg.1617 CDS 1500780 1501865 3 + 1086 Alanine racemase (EC Alanine biosynthesis; D23_1c1615 Neut_1531
5.1.1.1) <br>Pyruvate Alanine
Serine Interconversions
fig|6666666.60966.peg.1618 CDS 1502688 1501894 −3 795 Peptidyl-prolyl cis-trans Queuosine-Archaeosine D23_1c1616 Neut_1532
isomerase (EC 5.2.1.8) Biosynthesis
fig|6666666.60966.peg.1619 CDS 1502854 1502738 −1 117 hypothetical protein -none- D23_1c1617 NA
fig|6666666.60966.peg.1620 CDS 1503164 1502862 −2 303 YciL protein Broadly distributed D23_1c1618 Neut_1533
proteins not in
subsystems; <br>CBSS-
211586.9.peg.2729
fig|6666666.60966.peg.1621 CDS 1504431 1503277 −3 1155 Rubredoxin-NAD(+) Rubrerythrin D23_1c1619 Neut_1534
reductase (EC 1.18.1.1)
fig|6666666.60966.peg.1622 CDS 1504748 1505626 2 + 879 Probable protease htpX -none- D23_1c1620 Neut_1535
homolog (EC 3.4.24.—)
fig|6666666.60966.peg.1623 CDS 1505626 1505739 1 + 114 hypothetical protein -none- D23_1c1621 NA
fig|6666666.60966.peg.1624 CDS 1506477 1505698 −3 780 Surface lipoprotein -none- D23_1c1622 Neut_1536
fig|6666666.60966.peg.1625 CDS 1507909 1506626 −1 1284 Glutamate-1- CBSS-196164.1.peg.461; D23_1c1623 Neut_1537
semialdehyde <br>Heme and Siroheme
aminotransferase (EC Biosynthesis
5.4.3.8)
fig|6666666.60966.peg.1626 CDS 1508584 1507946 −1 639 Thiamin-phosphate 5-FCL-like protein; D23_1c1624 Neut_1538
pyrophosphorylase (EC <br>Thiamin
2.5.1.3) biosynthesis
fig|6666666.60966.peg.1627 CDS 1509419 1508577 −2 843 Phosphomethylpyrimidine 5-FCL-like protein; D23_1c1625 Neut_1539
kinase (EC 2.7.4.7) <br>Thiamin
biosynthesis
fig|6666666.60966.peg.1628 CDS 1509508 1509660 1 + 153 Rubredoxin Rubrerythrin D23_1c1626 Neut_1540
fig|6666666.60966.peg.1629 CDS 1509660 1510049 3 + 390 Lactoylglutathione lyase Glutathione: Non-redox D23_1c1627 Neut_1541
(EC 4.4.1.5) reactions;
<br>Methylglyoxal
Metabolism
fig|6666666.60966.peg.1630 CDS 1510238 1510603 2 + 366 probable iron binding -none- D23_1c1628 Neut_1542
protein from the
HesB_IscA_SufA family
fig|6666666.60966.peg.1631 CDS 1511703 1510612 −3 1092 Anhydro-N- Recycling of D23_1c1629 Neut_1543
acetylmuramic acid Peptidoglycan Amino
kinase (EC 2.7.1.—) Sugars
fig|6666666.60966.peg.1632 CDS 1513070 1511739 −2 1332 Peptidase, M23/M37 -none- D23_1c1630 Neut_1544
family
fig|6666666.60966.peg.1633 CDS 1513163 1514383 2 + 1221 Tyrosyl-tRNA tRNA aminoacylation, D23_1c1631 Neut_1545
synthetase (EC 6.1.1.1) Tyr
fig|6666666.60966.peg.1634 CDS 1514577 1515674 3 + 1098 Myo-inositol 2- -none- D23_1c1632 Neut_1547
dehydrogenase (EC
1.1.1.18)
fig|6666666.60966.peg.1635 CDS 1515687 1516748 3 + 1062 N-Acetylneuraminate CMP-N- D23_1c1633 Neut_1548
cytidylyltransferase (EC acetylneuraminate
2.7.7.43) Biosynthesis; <br>Sialic
Acid Metabolism
fig|6666666.60966.peg.1636 CDS 1516926 1518425 3 + 1500 N-acetylneuraminate CMP-N- D23_1c1634 Neut_1549
synthase (EC 2.5.1.56) acetylneuraminate
Biosynthesis; <br>Sialic
Acid Metabolism
fig|6666666.60966.peg.1637 CDS 1518919 1518437 −1 483 Ribonucleotide Ribonucleotide D23_1c1635 Neut_1551
reductase redcution
transcriptional
regulator NrdR
fig|6666666.60966.peg.1638 CDS 1520246 1518996 −2 1251 Serine 5-FCL-like protein; D23_1c1636 Neut_1552
hydroxymethyltransferase <br>Glycine
(EC 2.1.2.1) Biosynthesis;
<br>Glycine and Serine
Utilization;
<br>Photorespiration
(oxidative C2 cycle);
<br>Serine Biosynthesis
fig|6666666.60966.peg.1639 CDS 1520440 1521180 1 + 741 PqqC-like protein Folate Biosynthesis D23_1c1638 Neut_1553
fig|6666666.60966.peg.1640 CDS 1522218 1521283 −3 936 Transcriptional LysR-family proteins in D23_1c1639 Neut_1554
activator MetR Escherichia coli;
<br>LysR-family proteins
in Salmonella enterica
Typhimurium;
<br>Methionine
Biosynthesis
fig|6666666.60966.peg.1641 CDS 1522318 1524594 1 + 2277 5- Methionine Biosynthesis D23_1c1640 Neut_1555
methyltetrahydropteroyltriglutamate--
homocysteine
methyltransferase (EC
2.1.1.14)
fig|6666666.60966.peg.1643 CDS 1526020 1524767 −1 1254 UDP-N- Peptidoglycan D23_1c1641 Neut_1556
acetylglucosamine 1- Biosynthesis; <br>UDP-
carboxyvinyltransferase N-acetylmuramate from
(EC 2.5.1.7) Fructose-6-phosphate
Biosynthesis
fig|6666666.60966.peg.1644 CDS 1526108 1526497 2 + 390 Putative translation -none- D23_1c1642 Neut_1557
initiation inhibitor, yjgF
family
fig|6666666.60966.peg.1645 CDS 1526528 1528585 2 + 2058 ATP-dependent DNA -none- D23_1c1643 Neut_1558
helicase RecG (EC
3.6.1.—)
fig|6666666.60966.peg.1646 CDS 1529436 1528588 −3 849 Hypothetical ATP- -none- D23_1c1644 Neut_1559
binding protein
UPF0042, contains P-
loop
fig|6666666.60966.peg.1647 CDS 1529521 1530072 1 + 552 Transcription CBSS-243265.1.peg.198; D23_1c1645 Neut_1560
elongation factor GreB <br>Transcription
factors bacterial
fig|6666666.60966.peg.1648 CDS 1532787 1530136 −3 2652 Malto-oligosyltrehalose -none- D23_1c1646 NA
synthase (EC 5.4.99.15)
fig|6666666.60966.peg.1649 CDS 1533038 1532850 −2 189 hypothetical protein -none- D23_1c1647 NA
fig|6666666.60966.peg.1650 CDS 1534716 1533031 −3 1686 Malto-oligosyltrehalose -none- D23_1c1648 Neut_1291
trehalohydrolase (EC
3.2.1.141)
fig|6666666.60966.peg.1651 CDS 1535327 1534896 −2 432 Trehalose synthase, -none- D23_1c1649 NA
nucleoside diphosphate
glucose dependent
fig|6666666.60966.peg.1652 CDS 1535502 1535386 −3 117 hypothetical protein -none- D23_1c1650 NA
fig|6666666.60966.peg.1653 CDS 1535501 1536028 2 + 528 Sensory histidine kinase -none- D23_1c1651 Neut_1565
QseC
fig|6666666.60966.peg.1654 CDS 1535992 1536651 1 + 660 Sensory histidine kinase -none- D23_1c1652 Neut_1565
QseC
fig|6666666.60966.peg.1655 CDS 1537148 1537849 2 + 702 Protein of unknown -none- D23_1c1653 Neut_1566
function DUF484
fig|6666666.60966.peg.1656 CDS 1537833 1538798 3 + 966 Tyrosine recombinase -none- D23_1c1654 Neut_1567
XerC
fig|6666666.60966.peg.1657 CDS 1539747 1538845 −3 903 Arogenate Chorismate Synthesis; D23_1c1655 Neut_1568
dehydrogenase (EC <br>Phenylalanine and
1.3.1.43) Tyrosine Branches from
Chorismate
fig|6666666.60966.peg.1658 CDS 1540893 1539775 −3 1119 Biosynthetic Aromatic Phenylalanine and D23_1c1656 Neut_1569
amino acid Tyrosine Branches from
aminotransferase beta Chorismate
(EC 2.6.1.57)
fig|6666666.60966.peg.1659 CDS 1541973 1540915 −3 1059 Chorismate mutase I Chorismate Synthesis; D23_1c1657 Neut_1570
(EC 5.4.99.5)/ <br>Chorismate
Prephenate Synthesis;
dehydratase (EC <br>Phenylalanine and
4.2.1.51) Tyrosine Branches from
Chorismate;
<br>Phenylalanine and
Tyrosine Branches from
Chorismate
fig|6666666.60966.peg.1660 CDS 1543230 1542013 −3 1218 D-3-phosphoglycerate Glycine and Serine D23_1c1658 Neut_1571
dehydrogenase (EC Utilization;
1.1.1.95) <br>Pyridoxin (Vitamin
B6) Biosynthesis;
<br>Serine Biosynthesis
fig|6666666.60966.peg.1661 CDS 1544329 1543223 −1 1107 Phosphoserine Glycine and Serine D23_1c1659 Neut_1572
aminotransferase (EC Utilization;
2.6.1.52) <br>Pyridoxin (Vitamin
B6) Biosynthesis;
<br>Serine Biosynthesis
fig|6666666.60966.peg.1662 CDS 1546893 1544347 −3 2547 DNA gyrase subunit A Cell Division Subsystem D23_1c1660 Neut_1573
(EC 5.99.1.3) including YidCD;
<br>DNA gyrase
subunits; <br>DNA
replication cluster 1;
<br>DNA
topoisomerases, Type II,
ATP-dependent;
<br>Resistance to
fluoroquinolones
fig|6666666.60966.peg.1663 CDS 1547556 1546963 −3 594 COGs COG2854 -none- D23_1c1661 Neut_1574
fig|6666666.60966.peg.1664 CDS 1548691 1547573 −1 1119 Glycosyl transferase, -none- D23_1c1662 Neut_1575
family 2
fig|6666666.60966.peg.1665 CDS 1549918 1548755 −1 1164 Possible Fe—S -none- D23_1c1663 Neut_1576
oxidoreductase
fig|6666666.60966.peg.1666 CDS 1550134 1550247 1 + 114 hypothetical protein -none- D23_1c1664 NA
fig|6666666.60966.peg.1668 CDS 1550439 1552481 3 + 2043 Transketolase (EC Calvin-Benson cycle; D23_1c1666 Neut_1577
2.2.1.1) <br>Pentose phosphate
pathway
fig|6666666.60966.peg.1669 CDS 1552544 1553551 2 + 1008 NADPH-dependent Calvin-Benson cycle; D23_1c1667 Neut_1578
glyceraldehyde-3- <br>Calvin-Benson cycle;
phosphate <br>Glycolysis and
dehydrogenase (EC Gluconeogenesis;
1.2.1.13)/NAD- <br>Glycolysis and
dependent Gluconeogenesis;
glyceraldehyde-3- <br>Pyridoxin (Vitamin
phosphate B6) Biosynthesis
dehydrogenase (EC
1.2.1.12)
fig|6666666.60966.peg.1670 CDS 1553775 1553659 −3 117 hypothetical protein -none- D23_1c1668 NA
fig|6666666.60966.peg.1671 CDS 1553870 1555048 2 + 1179 Phosphoglycerate Calvin-Benson cycle; D23_1c1669 Neut_1579
kinase (EC 2.7.2.3) <br>Glycolysis and
Gluconeogenesis
fig|6666666.60966.peg.1672 CDS 1555083 1556573 3 + 1491 Pyruvate kinase (EC Glycerate metabolism; D23_1c1670 Neut_1580
2.7.1.40) <br>Glycolysis and
Gluconeogenesis;
<br>Pyruvate
metabolism I:
anaplerotic reactions,
PEP
fig|6666666.60966.peg.1673 CDS 1556682 1557746 3 + 1065 Fructose-bisphosphate Calvin-Benson cycle; D23_1c1671 Neut_1581
aldolase class II (EC <br>Glycolysis and
4.1.2.13) Gluconeogenesis
fig|6666666.60966.peg.1674 CDS 1558432 1560090 1 + 1659 Cytochrome c oxidases Terminal cytochrome C D23_1c1672 Neut_1582
subunit CcoN (EC oxidases
1.9.3.1)
fig|6666666.60966.peg.1675 CDS 1560080 1560688 2 + 609 Cytochrome c oxidase Terminal cytochrome C D23_1c1673 Neut_1583
subunit CcoO (EC oxidases
1.9.3.1)
fig|6666666.60966.peg.1676 CDS 1560753 1561364 3 + 612 Copper-containing Denitrification; D23_1c1674 Neut_1584
nitrite reductase (EC <br>Denitrifying
1.7.2.1) reductase gene clusters
fig|6666666.60966.peg.1677 CDS 1561404 1562054 3 + 651 Cytochrome oxidase Biogenesis of D23_1c1675 Neut_1585
biogenesis protein cytochrome c oxidases
Sco1/SenC/PrrC,
putative copper
metallochaperone
fig|6666666.60966.peg.1678 CDS 1562150 1562635 2 + 486 hypothetical -none- D23_1c1676 Neut_1586
cytochrome oxidase
associated membrane
protein
fig|6666666.60966.peg.1679 CDS 1563699 1562746 −3 954 Rare lipoprotein A Peptidoglycan D23_1c1677 Neut_1587
precursor Biosynthesis
fig|6666666.60966.peg.1680 CDS 1564813 1563704 −1 1110 Rod shape-determining Bacterial Cytoskeleton; D23_1c1678 Neut_1588
protein RodA <br>Bacterial cell
division cluster;
<br>Peptidoglycan
Biosynthesis
fig|6666666.60966.peg.1681 CDS 1566713 1564836 −2 1878 Penicillin-binding 16S rRNA modification D23_1c1679 Neut_1589
protein 2 (PBP-2) within P site of
ribosome; <br>Bacterial
cell division cluster;
<br>CBSS-
83331.1.peg.3039;
<br>Peptidoglycan
Biosynthesis
fig|6666666.60966.peg.1682 CDS 1567261 1566710 −1 552 Rod shape-determining Bacterial Cell Division; D23_1c1680 Neut_1590
protein MreD <br>Bacterial
Cytoskeleton;
<br>Bacterial cell
division cluster;
<br>CBSS-
354.1.peg.2917
fig|6666666.60966.peg.1683 CDS 1568123 1567233 −2 891 Rod shape-determining Bacterial Cell Division; D23_1c1681 Neut_1591
protein MreC <br>Bacterial
Cytoskeleton;
<br>Bacterial cell
division cluster;
<br>CBSS-
354.1.peg.2917
fig|6666666.60966.peg.1684 CDS 1569547 1568486 −1 1062 Rod shape-determining Bacterial Cell Division; D23_1c1682 Neut_1592
protein MreB <br>Bacterial
Cytoskeleton;
<br>Bacterial cell
division cluster
fig|6666666.60966.peg.1685 CDS 1569665 1569997 2 + 333 Aspartyl-tRNA(Asn) tRNA aminoacylation, D23_1c1683 Neut_1593
amidotransferase Asp and Asn; <br>tRNA
subunit C (EC 6.3.5.6) @ aminoacylation, Glu and
Glutamyl-tRNA(Gln) Gln
amidotransferase
subunit C (EC 6.3.5.7)
fig|6666666.60966.peg.1686 CDS 1570062 1571522 3 + 1461 Aspartyl-tRNA(Asn) tRNA aminoacylation, D23_1c1684 Neut_1594
amidotransferase Asp and Asn; <br>tRNA
subunit A (EC 6.3.5.6) @ aminoacylation, Glu and
Glutamyl-tRNA(Gln) Gln
amidotransferase
subunit A (EC 6.3.5.7)
fig|6666666.60966.peg.1687 CDS 1571587 1573023 1 + 1437 Aspartyl-tRNA(Asn) tRNA aminoacylation, D23_1c1685 Neut_1595
amidotransferase Asp and Asn; <br>tRNA
subunit B (EC 6.3.5.6) @ aminoacylation, Glu and
Glutamyl-tRNA(Gln) Gln
amidotransferase
subunit B (EC 6.3.5.7)
fig|6666666.60966.peg.1688 CDS 1573150 1573001 −1 150 hypothetical protein -none- D23_1c1686 NA
fig|6666666.60966.peg.1689 CDS 1573320 1573129 −3 192 FIG00859257: -none- D23_1c1687 NA
hypothetical protein
fig|6666666.60966.peg.1691 CDS 1574140 1573703 −1 438 heat shock protein, -none- D23_1c1688 Neut_1596
Hsp20 family
fig|6666666.60966.peg.1692 CDS 1574662 1574802 1 + 141 Integrase -none- D23_1c1690 Neut_1498
fig|6666666.60966.peg.1693 CDS 1575055 1574942 −1 114 hypothetical protein -none- D23_1c1692 NA
fig|6666666.60966.peg.1694 CDS 1575572 1575369 −2 204 hypothetical protein -none- D23_1c1693 NA
fig|6666666.60966.peg.1696 CDS 1575911 1575753 −2 159 Mobile element protein -none- D23_1c1694 Neut_1094
fig|6666666.60966.peg.1697 CDS 1576265 1578433 2 + 2169 GTP pyrophosphokinase Stringent Response, D23_1c1695 Neut_1601
(EC 2.7.6.5), (p)ppGpp (p)ppGpp metabolism;
synthetase II/ <br>Stringent Response,
Guanosine- (p)ppGpp metabolism
3&#39;,5&#39;-
bis(diphosphate)
3&#39;-
pyrophosphohydrolase
(EC 3.1.7.2)
fig|6666666.60966.peg.1698 CDS 1578452 1579135 2 + 684 FIG00858669: -none- D23_1c1696 Neut_1602
hypothetical protein
fig|6666666.60966.peg.1699 CDS 1579798 1579145 −1 654 Periplasmic Biogenesis of c-type D23_1c1697 Neut_1603
thiol:disulfide cytochromes;
interchange protein <br>Periplasmic disulfide
DsbA interchange
fig|6666666.60966.peg.1700 CDS 1580580 1579915 −3 666 Cell division protein -none- D23_1c1698 Neut_1604
fig|6666666.60966.peg.1701 CDS 1582304 1580604 −2 1701 Arginyl-tRNA synthetase tRNA aminoacylation, D23_1c1699 Neut_1605
(EC 6.1.1.19) Arg
fig|6666666.60966.peg.1702 CDS 1582613 1583272 2 + 660 FIG00859197: -none- D23_1c1700 Neut_1606
hypothetical protein
fig|6666666.60966.peg.1703 CDS 1583410 1584297 1 + 888 Methylenetetrahydrofolate 5-FCL-like protein; D23_1c1701 Neut_1607
dehydrogenase <br>One-carbon
(NADP+) (EC 1.5.1.5)/ metabolism by
Methenyltetrahydrofolate tetrahydropterines;
cyclohydrolase (EC <br>One-carbon
3.5.4.9) metabolism by
tetrahydropterines
fig|6666666.60966.peg.1704 CDS 1584339 1586999 3 + 2661 Pyruvate 5-FCL-like protein; D23_1c1702 Neut_1608
dehydrogenase E1 <br>Dehydrogenase
component (EC 1.2.4.1) complexes;
<br>Methionine
Degradation;
<br>Pyruvate
metabolism II: acetyl-
CoA, acetogenesis from
pyruvate
fig|6666666.60966.peg.1705 CDS 1587072 1588421 3 + 1350 Dihydrolipoamide 5-FCL-like protein; D23_1c1703 Neut_1609
acetyltransferase <br>Dehydrogenase
component of pyruvate complexes;
dehydrogenase <br>Pyruvate
complex (EC 2.3.1.12) metabolism II: acetyl-
CoA, acetogenesis from
pyruvate
fig|6666666.60966.peg.1706 CDS 1588457 1589170 2 + 714 Nicotinate-nucleotide NAD and NADP cofactor D23_1c1704 Neut_1610
adenylyltransferase (EC biosynthesis global
2.7.7.18)
fig|6666666.60966.peg.1707 CDS 1589167 1589532 1 + 366 Iojap protein -none- D23_1c1705 Neut_1611
fig|6666666.60966.peg.1708 CDS 1589624 1590091 2 + 468 LSU m3Psi1915 RNA methylation; D23_1c1706 Neut_1612
methyltransferase RlmH <br>Ribosome
biogenesis bacterial;
<br>tRNA modification
Bacteria
fig|6666666.60966.peg.1709 CDS 1590169 1590792 1 + 624 Septum formation Bacterial Cell Division; D23_1c1707 Neut_1613
protein Maf <br>Bacterial
Cytoskeleton;
<br>Bacterial cell
division cluster;
<br>CBSS-
354.1.peg.2917
fig|6666666.60966.peg.1710 CDS 1590825 1592276 3 + 1452 Cytoplasmic axial Bacterial Cell Division; D23_1c1708 Neut_1614
filament protein CafA <br>CBSS-
and Ribonuclease G (EC 354.1.peg.2917;
3.1.4.—) <br>RNA processing and
degradation, bacterial
fig|6666666.60966.peg.1711 CDS 1592500 1593222 1 + 723 Ferric siderophore Ton and Tol transport D23_1c1709 Neut_1615
transport system, systems
periplasmic binding
protein TonB
fig|6666666.60966.peg.1712 CDS 1593226 1594023 1 + 798 MotA/TolQ/ExbB Ton and Tol transport D23_1c1710 Neut_1616
proton channel family systems
protein
fig|6666666.60966.peg.1713 CDS 1594023 1594448 3 + 426 Biopolymer transport Ton and Tol transport D23_1c1711 Neut_1617
protein ExbD/TolR systems
fig|6666666.60966.peg.1714 CDS 1595300 1594518 −2 783 23S rRNA (guanosine- RNA methylation D23_1c1712 Neut_1618
2&#39;-O-)-
methyltransferase rlmB
(EC 2.1.1.—)
fig|6666666.60966.peg.1715 CDS 1597532 1595328 −2 2205 3&#39;-to-5&#39; RNA processing and D23_1c1713 Neut_1619
exoribonuclease RNase R degradation, bacterial
fig|6666666.60966.peg.1717 CDS 1598152 1599303 1 + 1152 DNA polymerase IV (EC DNA repair, bacterial D23_1c1715 Neut_1620
2.7.7.7)
fig|6666666.60966.peg.1718 CDS 1599507 1599391 −3 117 hypothetical protein -none- D23_1c1716 NA
fig|6666666.60966.peg.1719 CDS 1599639 1601015 3 + 1377 Flagellar regulatory Flagellum D23_1c1717 Neut_1621
protein FleQ
fig|6666666.60966.peg.1720 CDS 1601809 1601045 −1 765 hypothetical protein -none- D23_1c1718 Neut_1622
fig|6666666.60966.peg.1721 CDS 1604085 1601893 −3 2193 hypothetical protein -none- D23_1c1719 Neut_1623
fig|6666666.60966.peg.1722 CDS 1605035 1604157 −2 879 Mobile element protein -none- D23_1c1720 Neut_1720
fig|6666666.60966.peg.1723 CDS 1605427 1605134 −1 294 Mobile element protein -none- D23_1c1721 Neut_1719
fig|6666666.60966.peg.1724 CDS 1606591 1605455 −1 1137 8-amino-7- Biotin biosynthesis; D23_1c1722 Neut_2137
oxononanoate synthase <br>Biotin biosynthesis
(EC 2.3.1.47) Experimental; <br>Biotin
synthesis cluster
fig|6666666.60966.peg.1725 CDS 1608741 1606597 −3 2145 hypothetical protein -none- D23_1c1723 NA
fig|6666666.60966.peg.1726 CDS 1610072 1608738 −2 1335 hypothetical protein -none- D23_1c1724 NA
fig|6666666.60966.peg.1727 CDS 1610798 1610106 −2 693 hypothetical protein -none- D23_1c1725 Neut_1626
fig|6666666.60966.peg.1728 CDS 1611531 1610833 −3 699 hypothetical protein -none- D23_1c1726 Neut_1626
fig|6666666.60966.peg.1729 CDS 1611922 1612056 1 + 135 hypothetical protein -none- D23_1c1727 NA
fig|6666666.60966.peg.1731 CDS 1612368 1612991 3 + 624 InterPro IPR000379 -none- D23_1c1729 Neut_1627
COGs COG2945
fig|6666666.60966.peg.1732 CDS 1614001 1613204 −1 798 Carbonic anhydrase (EC Zinc regulated enzymes D23_1c1730 Neut_1628
4.2.1.1)
fig|6666666.60966.peg.1734 CDS 1614522 1614355 −3 168 hypothetical protein -none- D23_1c1731 NA
fig|6666666.60966.peg.1735 CDS 1614827 1614699 −2 129 hypothetical protein -none- D23_1c1732 NA
fig|6666666.60966.peg.1736 CDS 1614794 1616134 2 + 1341 Probable -none- D23_1c1733 Neut_1630
transmembrane protein
fig|6666666.60966.peg.1737 CDS 1617043 1616225 −1 819 rRNA methylases -none- D23_1c1734 Neut_1631
fig|6666666.60966.peg.1738 CDS 1617516 1617061 −3 456 Mobile element protein -none- D23_1c1735 Neut_2502
fig|6666666.60966.peg.1739 CDS 1617913 1617479 −1 435 Mobile element protein -none- D23_1c1736 Neut_0884
fig|6666666.60966.peg.1740 CDS 1618427 1618293 −2 135 hypothetical protein -none- D23_1c1738 NA
fig|6666666.60966.peg.1741 CDS 1619838 1618420 −3 1419 Dihydrolipoamide 5-FCL-like protein; D23_1c1739 Neut_1632
dehydrogenase (EC <br>Glycine cleavage
1.8.1.4) system;
<br>Photorespiration
(oxidative C2 cycle);
<br>TCA Cycle
fig|6666666.60966.peg.1742 CDS 1620067 1621053 1 + 987 Malate dehydrogenase TCA Cycle D23_1c1740 Neut_1633
(EC 1.1.1.37)
fig|6666666.60966.peg.1743 CDS 1621562 1621107 −2 456 Thiol peroxidase, Bcp- CBSS- D23_1c1741 Neut_1634
type (EC 1.11.1.15) 316057.3.peg.3521;
<br>Thioredoxin-
disulfide reductase
fig|6666666.60966.peg.1744 CDS 1622938 1621595 −1 1344 Cytochrome c heme Biogenesis of c-type D23_1c1742 Neut_1635
lyase subunit CcmH cytochromes;
<br>Copper homeostasis
fig|6666666.60966.peg.1745 CDS 1623399 1622935 −3 465 Cytochrome c heme Biogenesis of c-type D23_1c1743 Neut_1636
lyase subunit CcmL cytochromes
fig|6666666.60966.peg.1746 CDS 1623982 1623458 −1 525 Cytochrome c-type Biogenesis of c-type D23_1c1744 Neut_1637
biogenesis protein cytochromes;
CcmG/DsbE, <br>Periplasmic disulfide
thiol:disulfide interchange
oxidoreductase
fig|6666666.60966.peg.1747 CDS 1626024 1623979 −3 2046 Cytochrome c heme Biogenesis of c-type D23_1c1745 Neut_1638
lyase subunit CcmF cytochromes;
<br>Copper homeostasis
fig|6666666.60966.peg.1748 CDS 1626514 1626065 −1 450 Cytochrome c-type Biogenesis of c-type D23_1c1746 Neut_1639
biogenesis protein cytochromes
CcmE, heme chaperone
fig|6666666.60966.peg.1749 CDS 1627373 1626690 −2 684 Cytochrome c-type Biogenesis of c-type D23_1c1747 Neut_1641
biogenesis protein cytochromes
CcmC, putative heme
lyase for CcmE
fig|6666666.60966.peg.1750 CDS 1628195 1627536 −2 660 ABC transporter Biogenesis of c-type D23_1c1748 Neut_1642
involved in cytochrome cytochromes
c biogenesis, CcmB
subunit
fig|6666666.60966.peg.1751 CDS 1628729 1628202 −2 528 ABC transporter Biogenesis of c-type D23_1c1749 Neut_1643
involved in cytochrome cytochromes
c biogenesis, ATPase
component CcmA
fig|6666666.60966.peg.1752 CDS 1629793 1628927 −1 867 tRNA pseudouridine CBSS- D23_1c1750 Neut_1644
synthase B (EC 4.2.1.70) 138119.3.peg.2719;
<br>RNA pseudouridine
syntheses;
<br>Riboflavin, FMN and
FAD metabolism in
plants; <br>tRNA
modification Bacteria;
<br>tRNA processing
fig|6666666.60966.peg.1753 CDS 1630354 1630001 −1 354 Ribosome-binding CBSS- D23_1c1751 Neut_1645
factor A 138119.3.peg.2719;
<br>NusA-TFII Cluster;
<br>Translation
initiation factors
bacterial
fig|6666666.60966.peg.1754 CDS 1633073 1630407 −2 2667 Translation initiation CBSS- D23_1c1752 Neut_1646
factor 2 138119.3.peg.2719;
<br>NusA-TFII Cluster;
<br>Translation
initiation factors
bacterial; <br>Universal
GTPases
fig|6666666.60966.peg.1756 CDS 1634664 1633192 −3 1473 Transcription NusA-TFII Cluster; D23_1c1753 Neut_1647
termination protein <br>Transcription
NusA factors bacterial
fig|6666666.60966.peg.1757 CDS 1635199 1634717 −1 483 COG0779: clustered -none- D23_1c1754 Neut_1648
with transcription
termination protein
NusA
fig|6666666.60966.peg.1760 CDS 1636174 1636611 1 + 438 FIG00859331: -none- D23_1c1755 Neut_1650
hypothetical protein
fig|6666666.60966.peg.1761 CDS 1637012 1636686 −2 327 Cytochrome c4 Soluble cytochromes D23_1c1756 Neut_1651
and functionally related
electron carriers
fig|6666666.60966.peg.1762 CDS 1637371 1637045 −1 327 Putative periplasmic -none- D23_1c1757 Neut_1652
cytochrome type-C
oxidoreductase signal
peptide protein (EC 1.—.—.—)
fig|6666666.60966.peg.1763 CDS 1639430 1637484 −2 1947 COG0488: ATPase -none- D23_1c1758 Neut_1653
components of ABC
transporters with
duplicated ATPase
domains
fig|6666666.60966.peg.1765 CDS 1639660 1640709 1 + 1050 Selenide, water dikinase Selenocysteine D23_1c1759 Neut_1654
(EC 2.7.9.3) metabolism; <br>tRNA
modification Bacteria
fig|6666666.60966.peg.1766 CDS 1640702 1641868 2 + 1167 Selenophosphate- Selenocysteine D23_1c1760 Neut_1655
dependent tRNA 2- metabolism; <br>tRNA
selenouridine synthase modification Bacteria
fig|6666666.60966.peg.1767 CDS 1642217 1642050 −2 168 hypothetical protein -none- D23_1c1761 NA
fig|6666666.60966.peg.1768 CDS 1643785 1642217 −1 1569 4-cresol dehydrogenase Cresol degradation D23_1c1762 Neut_1656
[hydroxylating]
flavoprotein subunit (EC
1.17.99.1)
fig|6666666.60966.peg.1769 CDS 1644507 1643782 −3 726 PchX protein -none- D23_1c1763 Neut_1657
fig|6666666.60966.peg.1770 CDS 1644874 1644518 −1 357 4-cresol dehydrogenase Cresol degradation D23_1c1764 Neut_1658
[hydroxylating]
cytochrome c subunit
precursor
fig|6666666.60966.peg.1771 CDS 1646175 1645138 −3 1038 Dihydroorotase (EC De Novo Pyrimidine D23_1c1766 Neut_1659
3.5.2.3) Synthesis; <br>Zinc
regulated enzymes
fig|6666666.60966.peg.1772 CDS 1647130 1646273 −1 858 rRNA small subunit 16S rRNA modification D23_1c1767 Neut_1660
methyltransferase I within P site of
ribosome; <br>CBSS-
160492.1.peg.550;
<br>Heat shock dnaK
gene cluster extended
fig|6666666.60966.peg.1773 CDS 1647311 1649101 2 + 1791 ABC transporter, -none- D23_1c1769 Neut_1661
multidrug efflux family
fig|6666666.60966.peg.1774 CDS 1649206 1649556 1 + 351 Predicted endonuclease CBSS-160492.1.peg.550 D23_1c1770 Neut_1662
distantly related to
archaeal Holliday
junction resolvase
fig|6666666.60966.peg.1776 CDS 1651143 1649929 −3 1215 hypothetical protein -none- D23_1c1771 Neut_1663
fig|6666666.60966.peg.1777 CDS 1651568 1651446 −2 123 hypothetical protein -none- D23_1c1772 NA
fig|6666666.60966.peg.1778 CDS 1651714 1652223 1 + 510 Putative lipoprotein -none- D23_1c1773 Neut_1664
fig|6666666.60966.peg.1779 CDS 1652740 1661706 1 + 8967 Cyclic beta-1,2-glucan Synthesis of D23_1c1774 Neut_1665
synthase (EC 2.4.1.—) osmoregulated
periplasmic glucans
fig|6666666.60966.peg.1780 CDS 1662138 1661821 −3 318 Mobile element protein -none- D23_1c1775 Neut_1666
fig|6666666.60966.peg.1781 CDS 1662168 1662344 3 + 177 hypothetical protein -none- D23_1c1776 NA
fig|6666666.60966.peg.1782 CDS 1662546 1662406 −3 141 Mobile element protein -none- D23_1c1777 Neut_2190
fig|6666666.60966.peg.1783 CDS 1663286 1663158 −2 129 hypothetical protein -none- D23_1c1778 NA
fig|6666666.60966.peg.1784 CDS 1663556 1664518 2 + 963 Mobile element protein -none- D23_1c1779 Neut_1746
fig|6666666.60966.peg.1785 CDS 1666051 1664585 −1 1467 ATP-dependent RNA ATP-dependent RNA D23_1c1780 Neut_1668
helicase helicases, bacterial
Bcep18194_A5658
fig|6666666.60966.peg.1786 CDS 1666377 1666147 −3 231 Mobile element protein -none- D23_1c1781 Neut_2088
fig|6666666.60966.peg.1787 CDS 1666620 1666441 −3 180 Mobile element protein -none- D23_1c1782 Neut_0332
fig|6666666.60966.peg.1788 CDS 1667117 1666644 −2 474 Mobile element protein -none- D23_1c1783 NA
fig|6666666.60966.peg.1789 CDS 1668091 1667294 −1 798 FIG00861229: -none- D23_1c1784 Neut_1669
hypothetical protein
fig|6666666.60966.peg.1790 CDS 1668254 1668093 −2 162 hypothetical protein -none- D23_1c1785 NA
fig|6666666.60966.peg.1791 CDS 1669037 1668330 −2 708 Cytochrome c family -none- D23_1c1786 Neut_2333
protein
fig|6666666.60966.peg.1792 CDS 1670220 1669099 −3 1122 FIG00859557: -none- D23_1c1787 Neut_1792
hypothetical protein
fig|6666666.60966.peg.1793 CDS 1671929 1670217 −2 1713 Hydroxylamine -none- D23_1c1788 Neut_2335
oxidoreductase
precursor (EC 1.7.3.4)
fig|6666666.60966.peg.1794 CDS 1672280 1672017 −2 264 SSU ribosomal protein -none- D23_1c1789 NA
S20p
fig|6666666.60966.peg.1795 CDS 1672473 1672634 3 + 162 hypothetical protein -none- D23_1c1790 NA
fig|6666666.60966.peg.1796 CDS 1672870 1672601 −1 270 Mobile element protein -none- D23_1c1791 Neut_2450
fig|6666666.60966.peg.1797 CDS 1673187 1672894 −3 294 hypothetical protein -none- D23_1c1792 Neut_2449
fig|6666666.60966.peg.1798 CDS 1673875 1673648 −1 228 hypothetical protein -none- D23_1c1795 Neut_1676
fig|6666666.60966.peg.1799 CDS 1674438 1674052 −3 387 FIG002082: Protein A Gammaproteobacteria D23_1c1796 Neut_1677
SirB2 Cluster Relating to
Translation
fig|6666666.60966.peg.1800 CDS 1674844 1674500 −1 345 FIG00858740: -none- D23_1c1797 Neut_1678
hypothetical protein
fig|6666666.60966.peg.1801 CDS 1675595 1674939 −2 657 Probable membrane -none- D23_1c1798 Neut_1679
protein
fig|6666666.60966.peg.1802 CDS 1675804 1675601 −1 204 Probable membrane -none- D23_1c1800 Neut_1679
protein
fig|6666666.60966.peg.1803 CDS 1676931 1675825 −3 1107 GbcA Glycine betaine -none- D23_1c1801 Neut_1680
demethylase subunit A
fig|6666666.60966.peg.1804 CDS 1677301 1678686 1 + 1386 FIG00858667: -none- D23_1c1802 Neut_1681
hypothetical protein
fig|6666666.60966.peg.1805 CDS 1678742 1680964 2 + 2223 Helicase PriA essential -none- D23_1c1803 Neut_1682
for oriC/DnaA-
independent DNA
replication
fig|6666666.60966.peg.1806 CDS 1681478 1681032 −2 447 Universal stress protein -none- D23_1c1804 Neut_1683
fig|6666666.60966.peg.1807 CDS 1683246 1681597 −3 1650 Folate transporter 3 -none- D23_1c1805 Neut_1684
fig|6666666.60966.peg.1808 CDS 1684397 1683258 −2 1140 Outer membrane stress Periplasmic Stress D23_1c1806 Neut_1685
sensor protease DegS Response;
<br>Proteolysis in
bacteria, ATP-dependent
fig|6666666.60966.peg.1809 CDS 1684396 1685181 1 + 786 FIG137478: -none- D23_1c1807 Neut_1686
Hypothetical protein
YbgI
fig|6666666.60966.peg.1810 CDS 1685374 1685249 −1 126 hypothetical protein -none- D23_1c1808 NA
fig|6666666.60966.peg.1811 CDS 1685328 1686644 3 + 1317 Membrane-bound lytic Murein Hydrolases D23_1c1809 Neut_1687
murein transglycosylase
A precursor (EC 3.2.1.—)
fig|6666666.60966.peg.1812 CDS 1687397 1686684 −2 714 Thiol:disulfide Periplasmic disulfide D23_1c1810 Neut_1688
interchange protein interchange
DsbC
fig|6666666.60966.peg.1813 CDS 1688609 1687443 −2 1167 2-octaprenyl-3-methyl- CBSS-87626.3.peg.3639; D23_1c1811 Neut_1689
6-methoxy-1,4- <br>Ubiquinone
benzoquinol Biosynthesis;
hydroxylase (EC <br>Ubiquinone
1.14.13.—) Biosynthesis-gjo
fig|6666666.60966.peg.1814 CDS 1688840 1690807 2 + 1968 Acetyl-coenzyme A Pyruvate metabolism II: D23_1c1812 Neut_1690
synthetase (EC 6.2.1.1) acetyl-CoA, acetogenesis
from pyruvate
fig|6666666.60966.peg.1815 CDS 1690825 1691799 1 + 975 Beta-lactamase related -none- D23_1c1813 Neut_1691
protein
fig|6666666.60966.peg.1816 CDS 1693183 1691903 −1 1281 amidohydrolase -none- D23_1c1814 Neut_1692
fig|6666666.60966.peg.1817 CDS 1693463 1693633 2 + 171 Mobile element protein -none- D23_1c1816 Neut_1693
fig|6666666.60966.peg.1818 CDS 1694024 1695034 2 + 1011 Fatty acid desaturase -none- D23_1c1817 Neut_1694
fig|6666666.60966.peg.1819 CDS 1696649 1695402 −2 1248 Mobile element protein -none- D23_1c1818 Neut_0357
fig|6666666.60966.peg.1820 CDS 1697303 1696830 −2 474 Mobile element protein -none- D23_1c1820 Neut_1256
fig|6666666.60966.peg.1821 CDS 1697769 1697377 −3 393 hypothetical protein -none- D23_1c1821 Neut_2449
fig|6666666.60966.peg.1822 CDS 1698235 1698032 −1 204 hypothetical protein -none- D23_1c1822 Neut_0363
fig|6666666.60966.peg.1823 CDS 1698639 1698322 −3 318 hypothetical protein -none- D23_1c1823 Neut_1695
fig|6666666.60966.peg.1824 CDS 1698977 1698639 −2 339 Mobile element protein -none- D23_1c1824 Neut_1696
fig|6666666.60966.peg.1825 CDS 1699393 1702311 1 + 2919 Na(+) H(+) antiporter Multi-subunit cation D23_1c1825 Neut_1697
subunit A/Na(+) H(+) antiporter; <br>Multi-
antiporter subunit B subunit cation antiporter
fig|6666666.60966.peg.1826 CDS 1702311 1702655 3 + 345 Na(+) H(+) antiporter Multi-subunit cation D23_1c1826 Neut_1698
subunit C antiporter
fig|6666666.60966.peg.1827 CDS 1702652 1704298 2 + 1647 Na(+) H(+) antiporter Multi-subunit cation D23_1c1827 Neut_1699
subunit D antiporter
fig|6666666.60966.peg.1828 CDS 1704295 1704780 1 + 486 Na(+) H(+) antiporter Multi-subunit cation D23_1c1828 Neut_1700
subunit E antiporter
fig|6666666.60966.peg.1829 CDS 1704777 1705058 3 + 282 Na(+) H(+) antiporter Multi-subunit cation D23_1c1829 Neut_1701
subunit F antiporter
fig|6666666.60966.peg.1830 CDS 1705055 1705480 2 + 426 Na(+) H(+) antiporter Multi-subunit cation D23_1c1830 Neut_1702
subunit G antiporter
fig|6666666.60966.peg.1831 CDS 1708136 1705638 −2 2499 FIG00809136: -none- D23_1c1831 Neut_1703
hypothetical protein
fig|6666666.60966.peg.1832 CDS 1709066 1708266 −2 801 ABC transporter ATP- -none- D23_1c1832 Neut_1704
binding protein YvcR
fig|6666666.60966.peg.1833 CDS 1709065 1709676 1 + 612 Arylesterase precursor -none- D23_1c1833 Neut_1705
(EC 3.1.1.2)
fig|6666666.60966.peg.1834 CDS 1710780 1709716 −3 1065 Ribosomal large subunit RNA pseudouridine D23_1c1834 Neut_1706
pseudouridine synthase syntheses;
C (EC 4.2.1.70) <br>Ribosome
biogenesis bacterial
fig|6666666.60966.peg.1835 CDS 1711189 1713738 1 + 2550 Ribonuclease E (EC RNA processing and D23_1c1835 Neut_1707
3.1.26.12) degradation, bacterial;
<br>Ribosome
biogenesis bacterial
fig|6666666.60966.peg.1836 CDS 1714787 1713870 −2 918 Tyrosine recombinase -none- D23_1c1836 Neut_1708
XerD
fig|6666666.60966.peg.1837 CDS 1715754 1714909 −3 846 CcsA-related protein -none- D23_1c1837 Neut_1709
fig|6666666.60966.peg.1838 CDS 1715897 1717246 2 + 1350 Signal recognition Bacterial signal D23_1c1838 Neut_1710
particle, subunit Ffh recognition particle
SRP54 (TC 3.A.5.1.1) (SRP); <br>Universal
GTPases
fig|6666666.60966.peg.1839 CDS 1717562 1718059 2 + 498 Cytosine/adenosine -none- D23_1c1840 Neut_1711
deaminases
fig|6666666.60966.peg.1840 CDS 1719089 1718079 −2 1011 collagen triple helix -none- D23_1c1841 Neut_1712
repeat domain protein
fig|6666666.60966.peg.1841 CDS 1719941 1719435 −2 507 Mobile element protein -none- D23_1c1843 Neut_1353
fig|6666666.60966.peg.1843 CDS 1720927 1720256 −1 672 Putative TEGT family CBSS-326442.4.peg.1852 D23_1c1844 Neut_1715
carrier/transport
protein
fig|6666666.60966.peg.1844 CDS 1721245 1721081 −1 165 hypothetical protein -none- D23_1c1845 Neut_1716
fig|6666666.60966.peg.1845 CDS 1721933 1721268 −2 666 Mobile element protein -none- D23_1c1846 Neut_1717
fig|6666666.60966.peg.1846 CDS 1722745 1722137 −1 609 Aldehyde Glycerolipid and D23_1c1847 Neut_0700
dehydrogenase (EC Glycerophospholipid
1.2.1.3) Metabolism in Bacteria;
<br>Methylglyoxal
Metabolism;
<br>Methylglyoxal
Metabolism;
<br>Pyruvate
metabolism II: acetyl-
CoA, acetogenesis from
pyruvate
fig|6666666.60966.peg.1847 CDS 1722896 1723189 2 + 294 Mobile element protein -none- D23_1c1848 Neut_1719
fig|6666666.60966.peg.1848 CDS 1723288 1724166 1 + 879 Mobile element protein -none- D23_1c1849 Neut_1720
fig|6666666.60966.peg.1849 CDS 1724724 1724179 −3 546 Aldehyde Glycerolipid and D23_1c1850 Neut_0700
dehydrogenase (EC Glycerophospholipid
1.2.1.3) Metabolism in Bacteria;
<br>Methylglyoxal
Metabolism;
<br>Methylglyoxal
Metabolism;
<br>Pyruvate
metabolism II: acetyl-
CoA, acetogenesis from
pyruvate
fig|6666666.60966.peg.1850 CDS 1726242 1724995 −3 1248 Mobile element protein -none- D23_1c1851 Neut_0357
fig|6666666.60966.peg.1851 CDS 1727368 1727126 −1 243 Mobile element protein -none- D23_1c1854 Neut_2190
fig|6666666.60966.peg.1852 CDS 1727480 1727641 2 + 162 hypothetical protein -none- D23_1c1855 NA
fig|6666666.60966.peg.1853 CDS 1727757 1727873 3 + 117 hypothetical protein -none- D23_1c1856 NA
fig|6666666.60966.peg.1854 CDS 1727880 1728818 3 + 939 Major facilitator family -none- D23_1c1857 NA
transporter
fig|6666666.60966.peg.1855 CDS 1728936 1730123 3 + 1188 Cytosine deaminase (EC CBSS- D23_1c1858 Neut_1722
3.5.4.1) 326442.4.peg.1852;
<br>Creatine and
Creatinine Degradation;
<br>pyrimidine
conversions
fig|6666666.60966.peg.1857 CDS 1730427 1730624 3 + 198 Mobile element protein -none- D23_1c1859 Neut_1748
fig|6666666.60966.peg.1858 CDS 1730716 1730937 1 + 222 Mobile element protein -none- D23_1c1860 Neut_1747
fig|6666666.60966.peg.1859 CDS 1731165 1733414 3 + 2250 Lead, cadmium, zinc Copper Transport D23_1c1862 Neut_1724
and mercury System; <br>Copper
transporting ATPase (EC homeostasis
3.6.3.3) (EC 3.6.3.5);
Copper-translocating P-
type ATPase (EC 3.6.3.4)
fig|6666666.60966.peg.1860 CDS 1733755 1733946 1 + 192 hypothetical protein -none- D23_1c1863 Neut_1734
fig|6666666.60966.peg.1861 CDS 1734020 1735762 2 + 1743 Asparagine synthetase Cyanophycin D23_1c1864 Neut_1735
[glutamine-hydrolyzing] Metabolism;
(EC 6.3.5.4) <br>Glutamate and
Aspartate uptake in
Bacteria; <br>Glutamine,
Glutamate, Aspartate
and Asparagine
Biosynthesis
fig|6666666.60966.peg.1862 CDS 1735929 1737425 3 + 1497 major facilitator -none- D23_1c1865 Neut_1736
superfamily MFS_1
fig|6666666.60966.peg.1863 CDS 1737575 1737841 2 + 267 Mobile element protein -none- D23_1c1866 NA
fig|6666666.60966.peg.1864 CDS 1737835 1737975 1 + 141 Mobile element protein -none- D23_1c1867 NA
fig|6666666.60966.peg.1865 CDS 1738803 1738006 −3 798 Mobile element protein -none- D23_1c1868 Neut_1888
fig|6666666.60966.peg.1866 CDS 1739186 1738917 −2 270 Mobile element protein -none- D23_1c1869 Neut_2500
fig|6666666.60966.peg.1868 CDS 1740582 1739374 −3 1209 hypothetical protein -none- D23_1c1870 Neut_1740
fig|6666666.60966.peg.1869 CDS 1742717 1740588 −2 2130 Ferrichrome-iron -none- D23_1c1871 Neut_1741
receptor
fig|6666666.60966.peg.1870 CDS 1744008 1742806 −3 1203 Vibrioferrin -none- D23_1c1872 Neut_1742
decarboxylase protein
PvsE
fig|6666666.60966.peg.1871 CDS 1745819 1744005 −2 1815 Vibrioferrin amide bond -none- D23_1c1873 Neut_1743
forming protein PvsD @
Siderophore synthetase
superfamily, group A
fig|6666666.60966.peg.1872 CDS 1747001 1745829 −2 1173 Vibrioferrin membrane- -none- D23_1c1874 Neut_1744
spanning transport
protein PvsC
fig|6666666.60966.peg.1873 CDS 1748855 1747044 −2 1812 Anthrachelin -none- D23_1c1875 Neut_1745
biosynthesis protein
AsbB @ Siderophore
synthetase superfamily,
group C @ Siderophore
synthetase component,
ligase
fig|6666666.60966.peg.1874 CDS 1749327 1749151 −3 177 Mobile element protein -none- D23_1c1876 Neut_1747
fig|6666666.60966.peg.1876 CDS 1750647 1749685 −3 963 Mobile element protein -none- D23_1c1878 Neut_1278
fig|6666666.60966.peg.1877 CDS 1751012 1752274 2 + 1263 hypothetical protein -none- D23_1c1879 Neut_1749
fig|6666666.60966.peg.1878 CDS 1752303 1753133 3 + 831 Potassium efflux system Potassium homeostasis D23_1c1880 NA
KefA protein/Small-
conductance
mechanosensitive
channel
fig|6666666.60966.peg.1879 CDS 1753722 1753153 −3 570 hypothetical protein -none- D23_1c1881 NA
fig|6666666.60966.peg.1880 CDS 1753823 1754629 2 + 807 Glutamate racemase Glutamine, Glutamate, D23_1c1882 Neut_1752
(EC 5.1.1.3) Aspartate and
Asparagine Biosynthesis;
<br>Peptidoglycan
Biosynthesis
fig|6666666.60966.peg.1881 CDS 1754733 1755689 3 + 957 Universal stress protein -none- D23_1c1883 Neut_1753
fig|6666666.60966.peg.1882 CDS 1756978 1755725 −1 1254 DNA repair protein DNA repair, bacterial; D23_1c1884 Neut_1754
RadA <br>Proteolysis in
bacteria, ATP-dependent
fig|6666666.60966.peg.1883 CDS 1757073 1757201 3 + 129 hypothetical protein -none- D23_1c1885 NA
fig|6666666.60966.peg.1884 CDS 1758757 1757372 −1 1386 L-serine dehydratase Glycine and Serine D23_1c1887 Neut_1760
(EC 4.3.1.17) Utilization; <br>Pyruvate
Alanine Serine
Interconversions
fig|6666666.60966.peg.1886 CDS 1759312 1760013 1 + 702 Serine protease Transcription initiation, D23_1c1890 Neut_1761
precursor MucD/AlgY bacterial sigma factors
associated with sigma
factor RpoE
fig|6666666.60966.peg.1887 CDS 1760622 1761584 3 + 963 Mobile element protein -none- D23_1c1892 Neut_1278
fig|6666666.60966.peg.1888 CDS 1761643 1762524 1 + 882 FIG071646: Sugar Cell wall related cluster D23_1c1893 Neut_1762
transferase
fig|6666666.60966.peg.1889 CDS 1762574 1764655 2 + 2082 Sensory transduction -none- D23_1c1894 Neut_1763
histidine kinases
fig|6666666.60966.peg.1890 CDS 1764739 1766601 1 + 1863 Lipid A export ATP- -none- D23_1c1895 Neut_1764
binding/permease
protein MsbA
fig|6666666.60966.peg.1891 CDS 1769731 1766636 −1 3096 Cobalt-zinc-cadmium Cobalt-zinc-cadmium D23_1c1896 Neut_1765
resistance protein CzcA; resistance; <br>Cobalt-
Cation efflux system zinc-cadmium resistance
protein CusA
fig|6666666.60966.peg.1892 CDS 1770897 1769734 −3 1164 Cobalt/zinc/cadmium Cobalt-zinc-cadmium D23_1c1897 Neut_1766
efflux RND transporter, resistance
membrane fusion
protein, CzcB family
fig|6666666.60966.peg.1893 CDS 1772112 1770907 −3 1206 Heavy metal RND efflux Cobalt-zinc-cadmium D23_1c1898 Neut_1767
outer membrane resistance
protein, CzcC family
fig|6666666.60966.peg.1894 CDS 1773163 1772504 −1 660 FIG00859115: -none- D23_1c1899 Neut_1768
hypothetical protein
fig|6666666.60966.peg.1895 CDS 1773250 1773996 1 + 747 Glycerophosphoryl CBSS- D23_1c1900 Neut_1769
diester 176299.4.peg.1996A;
phosphodiesterase (EC <br>Glycerol and
3.1.4.46) Glycerol-3-phosphate
Uptake and Utilization
fig|6666666.60966.peg.1896 CDS 1774006 1775181 1 + 1176 Aerobic glycerol-3- Glycerol and Glycerol-3- D23_1c1901 Neut_1770
phosphate phosphate Uptake and
dehydrogenase (EC Utilization;
1.1.5.3) <br>Glycerolipid and
Glycerophospholipid
Metabolism in Bacteria;
<br>Respiratory
dehydrogenases 1
fig|6666666.60966.peg.1897 CDS 1775543 1775211 −2 333 FIG00859262: -none- D23_1c1902 Neut_1771
hypothetical protein
fig|6666666.60966.peg.1898 CDS 1776076 1775636 −1 441 FIG00859309: -none- D23_1c1903 Neut_1772
hypothetical protein
fig|6666666.60966.peg.1899 CDS 1777538 1776078 −2 1461 Dihydrolipoamide Dehydrogenase D23_1c1904 Neut_1773
dehydrogenase of 2- complexes; <br>TCA
oxoglutarate Cycle
dehydrogenase (EC
1.8.1.4)
fig|6666666.60966.peg.1900 CDS 1778658 1777612 −3 1047 Beta N-acetyl- Murein Hydrolases; D23_1c1905 Neut_1774
glucosaminidase (EC <br>Recycling of
3.2.1.52) Peptidoglycan Amino
Sugars
fig|6666666.60966.peg.1901 CDS 1779038 1778661 −2 378 Holo-[acyl-carrier Fatty Acid Biosynthesis D23_1c1906 Neut_1775
protein] synthase (EC FASII
2.7.8.7)
fig|6666666.60966.peg.1902 CDS 1779760 1779035 −1 726 Pyridoxine 5&#39;- Pyridoxin (Vitamin B6) D23_1c1907 Neut_1776
phosphate synthase (EC Biosynthesis
2.6.99.2)
fig|6666666.60966.peg.1903 CDS 1780768 1779878 −1 891 GTP-binding protein Era Bacterial Cell Division; D23_1c1908 Neut_1777
<br>Glycyl-tRNA
synthetase containing
cluster; <br>Universal
GTPases
fig|6666666.60966.peg.1904 CDS 1781583 1780846 −3 738 Ribonuclease III (EC RNA processing and D23_1c1909 Neut_1778
3.1.26.3) degradation, bacterial
fig|6666666.60966.peg.1905 CDS 1781963 1781580 −2 384 possible -none- D23_1c1910 Neut_1779
transmembrane protein
fig|6666666.60966.peg.1906 CDS 1782802 1781999 −1 804 Signal peptidase I (EC Signal peptidase D23_1c1911 Neut_1780
3.4.21.89)
fig|6666666.60966.peg.1907 CDS 1784670 1782874 −3 1797 Translation elongation Heat shock dnaK gene D23_1c1912 Neut_1781
factor LepA cluster extended;
<br>Translation
elongation factors
bacterial; <br>Universal
GTPases
fig|6666666.60966.peg.1908 CDS 1784806 1784651 −1 156 hypothetical protein -none- D23_1c1913 NA
fig|6666666.60966.peg.1909 CDS 1785160 1784972 −1 189 COGs COG0526 -none- D23_1c1914 Neut_1782
fig|6666666.60966.peg.1910 CDS 1786580 1785222 −2 1359 Serine protease Transcription initiation, D23_1c1915 Neut_1783
precursor MucD/AlgY bacterial sigma factors
associated with sigma
factor RpoE
fig|6666666.60966.peg.1911 CDS 1787446 1786871 −1 576 InterPro IPR001687 -none- D23_1c1916 Neut_1784
COGs COG3073
fig|6666666.60966.peg.1912 CDS 1788062 1787460 −2 603 RNA polymerase sigma Transcription initiation, D23_1c1917 Neut_1785
factor RpoE bacterial sigma factors
fig|6666666.60966.peg.1913 CDS 1789111 1788260 −1 852 Magnesium and cobalt CBSS- D23_1c1919 Neut_1786
efflux protein CorC 56780.10.peg.1536;
<br>Copper
homeostasis: copper
tolerance; <br>Glycyl-
tRNA synthetase
containing cluster;
<br>Magnesium
transport; <br>tRNA-
methylthiotransferase
containing cluster
fig|6666666.60966.peg.1914 CDS 1789590 1789165 −3 426 Metal-dependent CBSS- D23_1c1920 Neut_1787
hydrolase YbeY, 56780.10.peg.1536;
involved in rRNA and/or <br>Glycyl-tRNA
ribosome maturation synthetase containing
and assembly cluster; <br>tRNA-
methylthiotransferase
containing cluster
fig|6666666.60966.peg.1915 CDS 1790629 1789619 −1 1011 Phosphate starvation- -none- D23_1c1921 Neut_1788
inducible ATPase PhoH
with RNA binding motif
fig|6666666.60966.peg.1916 CDS 1792022 1790691 −2 1332 tRNA-i(6)A37 Methylthiotransferases; D23_1c1922 Neut_1789
methylthiotransferase <br>tRNA-
methylthiotransferase
containing cluster;
<br>tRNA modification
Bacteria; <br>tRNA
processing
fig|6666666.60966.peg.1917 CDS 1793040 1792321 −3 720 Cytochrome c-type -none- D23_1c1923 Neut_1790
protein TorY
fig|6666666.60966.peg.1918 CDS 1793750 1793043 −2 708 Cytochrome c family -none- D23_1c1924 Neut_2333
protein
fig|6666666.60966.peg.1919 CDS 1794933 1793812 −3 1122 FIG00859557: -none- D23_1c1925 Neut_1792
hypothetical protein
fig|6666666.60966.peg.1920 CDS 1796642 1794930 −2 1713 Hydroxylamine -none- D23_1c1926 Neut_2335
oxidoreductase
precursor (EC 1.7.3.4)
fig|6666666.60966.peg.1921 CDS 1801076 1796862 −2 4215 DNA-directed RNA Mycobacterium D23_1c1927 Neut_1794
polymerase beta&#39; virulence operon
subunit (EC 2.7.7.6) involved in DNA
transcription; <br>RNA
polymerase bacterial
fig|6666666.60966.peg.1922 CDS 1805314 1801235 −1 4080 DNA-directed RNA Mycobacterium D23_1c1928 Neut_1795
polymerase beta virulence operon
subunit (EC 2.7.7.6) involved in DNA
transcription; <br>RNA
polymerase bacterial
fig|6666666.60966.peg.1923 CDS 1806051 1805680 −3 372 LSU ribosomal protein LSU ribosomal proteins D23_1c1929 Neut_1796
L7/L12 (P1/P2) cluster
fig|6666666.60966.peg.1924 CDS 1806648 1806133 −3 516 LSU ribosomal protein LSU ribosomal proteins D23_1c1930 Neut_1797
L10p (P0) cluster
fig|6666666.60966.peg.1925 CDS 1807793 1807098 −2 696 LSU ribosomal protein LSU ribosomal proteins D23_1c1931 Neut_1798
Lip (L10Ae) cluster
fig|6666666.60966.peg.1926 CDS 1808121 1807795 −3 327 LSU ribosomal protein LSU ribosomal proteins D23_1c1932 Neut_1799
L11p (L12e) cluster
fig|6666666.60966.peg.1927 CDS 1808877 1808344 −3 534 Transcription LSU ribosomal proteins D23_1c1934 Neut_1800
antitermination protein cluster;
NusG <br>Transcription
factors bacterial
fig|6666666.60966.peg.1928 CDS 1809240 1808896 −3 345 Preprotein translocase LSU ribosomal proteins D23_1c1935 Neut_1801
subunit SecE (TC cluster
3.A.5.1.1)
fig|6666666.60966.peg.1929 CDS 1810674 1809484 −3 1191 Translation elongation Mycobacterium D23_1c1937 Neut_1802
factor Tu virulence operon
involved in protein
synthesis (SSU ribosomal
proteins);
<br>Translation
elongation factors
bacterial; <br>Universal
GTPases
fig|6666666.60966.peg.1930 CDS 1813382 1811220 −2 2163 Type IV pilus biogenesis -none- D23_1c1941 Neut_1803
fig|6666666.60966.peg.1931 CDS 1813906 1813379 −1 528 Type IV pilus biogenesis -none- D23_1c1942 Neut_1804
protein PilP
fig|6666666.60966.peg.1932 CDS 1814553 1813903 −3 651 Type IV pilus biogenesis -none- D23_1c1943 Neut_1805
protein PilO
fig|6666666.60966.peg.1933 CDS 1815161 1814550 −2 612 Type IV pilus biogenesis -none- D23_1c1944 Neut_1806
protein PilN
fig|6666666.60966.peg.1934 CDS 1816207 1815158 −1 1050 Type IV pilus biogenesis -none- D23_1c1945 Neut_1807
protein PilM
fig|6666666.60966.peg.1936 CDS 1816441 1818753 1 + 2313 Multimodular Peptidoglycan D23_1c1947 Neut_1808
transpeptidase- Biosynthesis
transglycosylase (EC
2.4.1.129) (EC 3.4.—.—)
fig|6666666.60966.peg.1937 CDS 1819961 1819041 −2 921 Deacetylases, including -none- D23_1c1948 Neut_1809
yeast histone
deacetylase and acetoin
utilization protein
fig|6666666.60966.peg.1939 CDS 1820319 1820170 −3 150 hypothetical protein -none- D23_1c1949 Neut_1810
fig|6666666.60966.peg.1941 CDS 1820799 1820638 −3 162 Addiction module -none- D23_1c1950 Neut_1811
antidote protein
fig|6666666.60966.peg.1942 CDS 1821096 1820914 −3 183 hypothetical protein -none- D23_1c1951 Neut_1812
fig|6666666.60966.peg.1943 CDS 1821848 1821985 2 + 138 Prevent host death Phd-Doc, YdcE-YdcD D23_1c1953 NA
protein, Phd antitoxin toxin-antitoxin
(programmed cell death)
systems
fig|6666666.60966.peg.1944 CDS 1821982 1822278 1 + 297 Death on curing Phd-Doc, YdcE-YdcD D23_1c1954 NA
protein, Doc toxin toxin-antitoxin
(programmed cell death)
systems
fig|6666666.60966.peg.1945 CDS 1822608 1822423 −3 186 hypothetical protein -none- D23_1c1955 Neut_1816
fig|6666666.60966.peg.1946 CDS 1822933 1822688 −1 246 hypothetical protein -none- D23_1c1956 Neut_1817
fig|6666666.60966.peg.1947 CDS 1823491 1823150 −1 342 Predicted -none- D23_1c1957 NA
transcriptional
regulator
fig|6666666.60966.peg.1948 CDS 1823708 1823484 −2 225 Phage-related protein -none- D23_1c1958 NA
fig|6666666.60966.peg.1952 CDS 1824892 1824704 −1 189 hypothetical protein -none- D23_1c1959 NA
fig|6666666.60966.peg.1953 CDS 1825371 1825036 −3 336 Mobile element protein -none- D23_1c1960 Neut_1624
fig|6666666.60966.peg.1954 CDS 1825828 1825352 −1 477 Mobile element protein -none- D23_1c1961 Neut_1888
fig|6666666.60966.peg.1955 CDS 1826127 1825942 −3 186 Mobile element protein -none- D23_1c1962 Neut_2500
fig|6666666.60966.peg.1956 CDS 1826660 1826472 −2 189 Mobile element protein -none- D23_1c1963 Neut_1821
fig|6666666.60966.peg.1958 CDS 1827279 1826920 −3 360 Flagellin protein FlaG Flagellum D23_1c1964 Neut_1822
fig|6666666.60966.peg.1959 CDS 1827931 1827644 −1 288 Excinuclease ABC, C -none- D23_1c1965 Neut_1823
subunit-like
fig|6666666.60966.peg.1960 CDS 1829557 1828115 −1 1443 Flagellin protein FlaB Flagellum; <br>Flagellum D23_1c1967 Neut_1824
in Campylobacter
fig|6666666.60966.peg.1961 CDS 1830108 1830230 3 + 123 hypothetical protein -none- D23_1c1968 NA
fig|6666666.60966.peg.1962 CDS 1831067 1830276 −2 792 Mobile element protein -none- D23_1c1969 Neut_1888
fig|6666666.60966.peg.1963 CDS 1831366 1831181 −1 186 Mobile element protein -none- D23_1c1970 Neut_2500
fig|6666666.60966.peg.1964 CDS 1831759 1831616 −1 144 hypothetical protein -none- D23_1c1971 NA
fig|6666666.60966.peg.1965 CDS 1832465 1831749 −2 717 hypothetical protein -none- D23_1c1972 Neut_1827
fig|6666666.60966.peg.1967 CDS 1835117 1833291 −2 1827 DNA mismatch repair DNA repair, bacterial D23_1c1973 Neut_1828
protein MutL MutL-MutS system
fig|6666666.60966.peg.1968 CDS 1835287 1835946 1 + 660 Ribose 5-phosphate Calvin-Benson cycle; D23_1c1974 Neut_1829
isomerase A (EC 5.3.1.6) <br>D-ribose utilization;
<br>Pentose phosphate
pathway
fig|6666666.60966.peg.1969 CDS 1836022 1836150 1 + 129 hypothetical protein -none- D23_1c1975 NA
fig|6666666.60966.peg.1970 CDS 1836140 1836859 2 + 720 Phosphate transport High affinity phosphate D23_1c1976 Neut_1830
system regulatory transporter and control
protein PhoU of PHO regulon;
<br>Phosphate
metabolism
fig|6666666.60966.peg.1971 CDS 1836819 1838420 3 + 1602 Exopolyphosphatase Phosphate metabolism; D23_1c1977 Neut_1831
(EC 3.6.1.11) <br>Polyphosphate
fig|6666666.60966.peg.1972 CDS 1838878 1838429 −1 450 Type IV pilus biogenesis -none- D23_1c1978 Neut_1832
protein PilE
fig|6666666.60966.peg.1973 CDS 1842290 1838922 −2 3369 Type IV fimbrial -none- D23_1c1979 Neut_1833
biogenesis protein PilY1
fig|6666666.60966.peg.1974 CDS 1843213 1842362 −1 852 Type IV fimbrial -none- D23_1c1980 Neut_1834
biogenesis protein PilX
fig|6666666.60966.peg.1975 CDS 1844303 1843239 −2 1065 Type IV fimbrial -none- D23_1c1981 Neut_1835
biogenesis protein PilW
fig|6666666.60966.peg.1976 CDS 1844806 1844321 −1 486 Type IV fimbrial -none- D23_1c1982 Neut_1836
biogenesis protein PilV
fig|6666666.60966.peg.1977 CDS 1845339 1844830 −3 510 Type IV fimbrial -none- D23_1c1983 Neut_1837
biogenesis protein FimT
fig|6666666.60966.peg.1978 CDS 1845616 1845783 1 + 168 hypothetical protein -none- D23_1c1984 NA
fig|6666666.60966.peg.1979 CDS 1846400 1845768 −2 633 DNA-binding response -none- D23_1c1985 Neut_1839
regulator, LuxR family
fig|6666666.60966.peg.1980 CDS 1847948 1846452 −2 1497 Sensory box histidine -none- D23_1c1986 Neut_1840
kinase/response
regulator
fig|6666666.60966.peg.1981 CDS 1848084 1848206 3 + 123 hypothetical protein -none- D23_1c1987 NA
fig|6666666.60966.peg.1982 CDS 1850161 1848614 −1 1548 pilin glycosylation -none- D23_1c1988 Neut_1841
enzyme, putative
fig|6666666.60966.peg.1985 CDS 1852587 1850815 −3 1773 Gamma- Glutathione: D23_1c1989 Neut_1843
glutamyltranspeptidase Biosynthesis and
(EC 2.3.2.2) gamma-glutamyl cycle
fig|6666666.60966.peg.1986 CDS 1853865 1852903 −3 963 Mobile element protein -none- D23_1c1990 Neut_1746
fig|6666666.60966.peg.1987 CDS 1854432 1853923 −3 510 putative -none- D23_1c1991 Neut_1845
transmembrane protein
fig|6666666.60966.peg.1988 CDS 1855175 1854606 −2 570 hypothetical protein -none- D23_1c1992 Neut_1849
fig|6666666.60966.peg.1989 CDS 1855822 1855421 −1 402 Glyoxalase family protein -none- D23_1c1993 Neut_1850
fig|6666666.60966.peg.1990 CDS 1855948 1855835 −1 114 hypothetical protein -none- D23_1c1994 NA
fig|6666666.60966.peg.1991 CDS 1856595 1856026 −3 570 hypothetical protein -none- D23_1c1995 Neut_1851
fig|6666666.60966.peg.1992 CDS 1856572 1856703 1 + 132 hypothetical protein -none- D23_1c1996 NA
fig|6666666.60966.peg.1993 CDS 1858627 1856756 −1 1872 hypothetical protein -none- D23_1c1997 Neut_1853
fig|6666666.60966.peg.1994 CDS 1860549 1858642 −3 1908 hypothetical protein -none- D23_1c1998 Neut_1854
fig|6666666.60966.peg.1995 CDS 1860536 1860667 2 + 132 hypothetical protein -none- D23_1c1999 NA
fig|6666666.60966.peg.1996 CDS 1861687 1860761 −1 927 Expressed protein -none- D23_1c2000 Neut_1857
precursor
fig|6666666.60966.peg.1997 CDS 1862145 1861684 −3 462 hypothetical protein -none- D23_1c2001 Neut_1858
fig|6666666.60966.peg.1998 CDS 1865471 1862334 −2 3138 Proline dehydrogenase Proline, 4- D23_1c2002 Neut_1859
(EC 1.5.99.8) (Proline hydroxyproline uptake
oxidase)/Delta-1- and utilization;
pyrroline-5-carboxylate <br>Respiratory
dehydrogenase (EC dehydrogenases 1
1.5.1.12)
fig|6666666.60966.peg.2000 CDS 1865859 1865701 −3 159 hypothetical protein -none- D23_1c2003 Neut_1860
fig|6666666.60966.peg.2001 CDS 1866618 1866328 −3 291 hypothetical protein -none- D23_1c2004 NA
fig|6666666.60966.peg.2002 CDS 1866574 1866861 1 + 288 Probable -none- D23_1c2005 Neut_1861
transmembrane protein
fig|6666666.60966.peg.2004 CDS 1867176 1867955 3 + 780 hypothetical protein -none- D23_1c2006 Neut_1863
fig|6666666.60966.peg.2005 CDS 1870128 1868077 −3 2052 Serine peptidase -none- D23_1c2007 Neut_1864
fig|6666666.60966.peg.2006 CDS 1870373 1870546 2 + 174 hypothetical protein -none- D23_1c2008 NA
fig|6666666.60966.peg.2007 CDS 1871555 1870827 −2 729 1-acyl-sn-glycerol-3- Glycerolipid and D23_1c2009 Neut_1866
phosphate Glycerophospholipid
acyltransferase (EC Metabolism in Bacteria
2.3.1.51)
fig|6666666.60966.peg.2008 CDS 1872097 1871555 −1 543 Histidinol-phosphatase Histidine Biosynthesis D23_1c2010 Neut_1867
(EC 3.1.3.15)
fig|6666666.60966.peg.2009 CDS 1874271 1872124 −3 2148 Glycyl-tRNA synthetase Glycyl-tRNA synthetase; D23_1c2011 Neut_1868
beta chain (EC 6.1.1.14) <br>Glycyl-tRNA
synthetase containing
cluster; <br>tRNA
aminoacylation, Gly
fig|6666666.60966.peg.2010 CDS 1875191 1874268 −2 924 Glycyl-tRNA synthetase Glycyl-tRNA synthetase; D23_1c2012 Neut_1869
alpha chain (EC <br>Glycyl-tRNA
6.1.1.14) synthetase containing
cluster; <br>tRNA
aminoacylation, Gly
fig|6666666.60966.peg.2011 CDS 1876717 1875224 −1 1494 Apolipoprotein N- Copper homeostasis: D23_1c2013 Neut_1870
acyltransferase (EC copper tolerance;
2.3.1.—)/Copper <br>Lipoprotein
homeostasis protein Biosynthesis; <br>tRNA-
CutE methylthiotransferase
containing cluster;
<br>tRNA-
methylthiotransferase
containing cluster
fig|6666666.60966.peg.2012 CDS 1877111 1876773 −2 339 FIG00859587: -none- D23_1c2014 Neut_1871
hypothetical protein
fig|6666666.60966.peg.2013 CDS 1877265 1877122 −3 144 hypothetical protein -none- D23_1c2015 NA
fig|6666666.60966.peg.2014 CDS 1877596 1879305 1 + 1710 Multicopper oxidase Copper homeostasis D23_1c2016 Neut_1872
fig|6666666.60966.peg.2015 CDS 1879305 1880399 3 + 1095 Zinc ABC transporter, -none- D23_1c2017 Neut_1873
periplasmic-binding
protein ZnuA
fig|6666666.60966.peg.2016 CDS 1881044 1880847 −2 198 hypothetical protein -none- D23_1c2018 NA
fig|6666666.60966.peg.2017 CDS 1881486 1881962 3 + 477 Cytochrome c oxidase Terminal cytochrome C D23_1c2020 Neut_1874
(B(O/a)3-type) chain II oxidases
(EC 1.9.3.1)
fig|6666666.60966.peg.2018 CDS 1882000 1883478 1 + 1479 Cytochrome c oxidase Terminal cytochrome C D23_1c2021 Neut_1875
(B(O/a)3-type) chain I oxidases
(EC 1.9.3.1)
fig|6666666.60966.peg.2019 CDS 1883574 1884203 3 + 630 Cytochrome oxidase Biogenesis of D23_1c2022 Neut_1876
biogenesis protein cytochrome c oxidases
Sco1/SenC/PrrC,
putative copper
metallochaperone
fig|6666666.60966.peg.2020 CDS 1884187 1884756 1 + 570 hypothetical -none- D23_1c2023 Neut_1877
cytochrome oxidase
associated membrane
protein
fig|6666666.60966.peg.2021 CDS 1885726 1884809 −1 918 Nitrite transporter from -none- D23_1c2024 Neut_1878
formate/nitrite family
fig|6666666.60966.peg.2022 CDS 1887084 1886077 −3 1008 UDP-glucose 4- CBSS- D23_1c2026 Neut_1879
epimerase (EC 5.1.3.2) 296591.1.peg.2330;
<br>N-linked
Glycosylation in
Bacteria; <br>Rhamnose
containing glycans
fig|6666666.60966.peg.2023 CDS 1888047 1887160 −3 888 Glucose-1-phosphate Rhamnose containing D23_1c2027 Neut_1880
thymidylyltransferase glycans; <br>dTDP-
(EC 2.7.7.24) rhamnose synthesis
fig|6666666.60966.peg.2024 CDS 1888279 1888148 −1 132 hypothetical protein -none- D23_1c2028 NA
fig|6666666.60966.peg.2025 CDS 1888278 1889198 3 + 921 2-hydroxy-3- Glycerate metabolism; D23_1c2029 Neut_1881
oxopropionate <br>Photorespiration
reductase (EC 1.1.1.60) (oxidative C2 cycle)
fig|6666666.60966.peg.2026 CDS 1889188 1890642 1 + 1455 Glycolate Glycolate, glyoxylate D23_1c2030 Neut_1882
dehydrogenase (EC interconversions;
1.1.99.14), subunit GlcD <br>Photorespiration
(oxidative C2 cycle)
fig|6666666.60966.peg.2027 CDS 1890667 1891767 1 + 1101 Glycolate Glycolate, glyoxylate D23_1c2031 Neut_1883
dehydrogenase (EC interconversions;
1.1.99.14), FAD-binding <br>Photorespiration
subunit GlcE (oxidative C2 cycle)
fig|6666666.60966.peg.2028 CDS 1891771 1893039 1 + 1269 Glycolate Glycolate, glyoxylate D23_1c2032 Neut_1884
dehydrogenase (EC interconversions;
1.1.99.14), iron-sulfur <br>Photorespiration
subunit GlcF (oxidative C2 cycle)
fig|6666666.60966.peg.2029 CDS 1893781 1893065 −1 717 Putative predicted Restriction-Modification D23_1c2033 Neut_1885
metal-dependent System
hydrolase
fig|6666666.60966.peg.2030 CDS 1894582 1893806 −1 777 5&#39;- Adenosyl nucleosidases; D23_1c2034 Neut_1886
methylthioadenosine <br>Adenosyl
nucleosidase (EC nucleosidases;
3.2.2.16)/S- <br>CBSS-
adenosylhomocysteine 320388.3.peg.3759;
nucleosidase (EC <br>CBSS-
3.2.2.9) 320388.3.peg.3759;
<br>Methionine
Biosynthesis;
<br>Methionine
Degradation;
<br>Polyamine
Metabolism
fig|6666666.60966.peg.2031 CDS 1896116 1894656 −2 1461 Exodeoxyribonuclease I DNA Repair Base D23_1c2035 Neut_1887
(EC 3.1.11.1) Excision
fig|6666666.60966.peg.2032 CDS 1896438 1897133 3 + 696 FIG00657740: -none- D23_1c2036 Neut_1890
hypothetical protein
fig|6666666.60966.peg.2033 CDS 1898282 1897428 −2 855 5,10- 5-FCL-like protein; D23_1c2038 Neut_1891
methylenetetrahydrofolate <br>Methionine
reductase (EC Biosynthesis; <br>One-
1.5.1.20) carbon metabolism by
tetrahydropterines
fig|6666666.60966.peg.2034 CDS 1898327 1898494 2 + 168 hypothetical protein -none- D23_1c2039 NA
fig|6666666.60966.peg.2035 CDS 1899999 1898563 −3 1437 Adenosylhomocysteinase Methionine D23_1c2041 Neut_1892
(EC 3.3.1.1) Biosynthesis;
<br>Methionine
Degradation
fig|6666666.60966.peg.2036 CDS 1901244 1900135 −3 1110 S-adenosylmethionine Methionine D23_1c2042 Neut_1893
synthetase (EC 2.5.1.6) Biosynthesis;
<br>Methionine
Degradation
fig|6666666.60966.peg.2037 CDS 1901543 1902289 2 + 747 Short chain -none- D23_1c2043 Neut_1894
dehydrogenase
fig|6666666.60966.peg.2038 CDS 1902336 1902812 3 + 477 ATPase YjeE, predicted -none- D23_1c2044 Neut_1895
to have essential role in
cell wall biosynthesis
fig|6666666.60966.peg.2039 CDS 1903046 1904116 2 + 1071 N-acetylmuramoyl-L- Murein Hydrolases; D23_1c2045 Neut_1896
alanine amidase (EC <br>Recycling of
3.5.1.28) Peptidoglycan Amino
Acids; <br>Zinc
regulated enzymes
fig|6666666.60966.peg.2040 CDS 1904922 1904170 −3 753 FIG00859340: -none- D23_1c2046 Neut_1897
hypothetical protein
fig|6666666.60966.peg.2041 CDS 1905860 1904919 −2 942 Ribosomal protein L11 Heat shock dnaK gene D23_1c2047 Neut_1898
methyltransferase (EC cluster extended;
2.1.1.—) <br>Ribosome
biogenesis bacterial
fig|6666666.60966.peg.2042 CDS 1907254 1905896 −1 1359 Biotin carboxylase of Fatty Acid Biosynthesis D23_1c2048 Neut_1899
acetyl-CoA carboxylase FASII
(EC 6.3.4.14)
fig|6666666.60966.peg.2043 CDS 1907784 1907326 −3 459 Biotin carboxyl carrier Fatty Acid Biosynthesis D23_1c2049 Neut_1900
protein of acetyl-CoA FASII
carboxylase
fig|6666666.60966.peg.2045 CDS 1908294 1907989 −3 306 3-dehydroquinate Chorismate Synthesis; D23_1c2050 Neut_1901
dehydratase II (EC <br>Common Pathway
4.2.1.10) For Synthesis of
Aromatic Compounds
(DAHP synthase to
chorismate);
<br>Quinate
degradation
fig|6666666.60966.peg.2047 CDS 1908606 1909715 3 + 1110 Glycine oxidase ThiO Thiamin biosynthesis D23_1c2051 Neut_1902
(EC 1.4.3.19)
fig|6666666.60966.peg.2048 CDS 1910693 1909722 −2 972 4-hydroxy-3-methylbut- Isoprenoid Biosynthesis; D23_1c2052 Neut_1903
2-enyl diphosphate <br>Nonmevalonate
reductase (EC 1.17.1.2) Branch of Isoprenoid
Biosynthesis
fig|6666666.60966.peg.2049 CDS 1910983 1911267 1 + 285 FIG00858797: -none- D23_1c2053 Neut_1904
hypothetical protein
fig|6666666.60966.peg.2050 CDS 1911307 1912386 1 + 1080 Histidinol-phosphate Histidine Biosynthesis D23_1c2054 Neut_1905
aminotransferase (EC
2.6.1.9)
fig|6666666.60966.peg.2051 CDS 1912429 1913016 1 + 588 Imidazoleglycerol- Histidine Biosynthesis D23_1c2055 Neut_1906
phosphate dehydratase
(EC 4.2.1.19)
fig|6666666.60966.peg.2052 CDS 1913079 1913687 3 + 609 Imidazole glycerol Histidine Biosynthesis D23_1c2056 Neut_1907
phosphate synthase
amidotransferase
subunit (EC 2.4.2.—)
fig|6666666.60966.peg.2053 CDS 1913772 1914518 3 + 747 Phosphoribosylformimino- Chorismate: D23_1c2057 Neut_1908
5-aminoimidazole Intermediate for
carboxamide ribotide synthesis of Tryptophan,
isomerase (EC 5.3.1.16) PAPA antibiotics, PABA,
3-hydroxyanthranilate
and more.; <br>Histidine
Biosynthesis
fig|6666666.60966.peg.2054 CDS 1914604 1915380 1 + 777 Imidazole glycerol Histidine Biosynthesis D23_1c2058 Neut_1909
phosphate synthase
cyclase subunit (EC
4.1.3.—)
fig|6666666.60966.peg.2055 CDS 1915424 1915909 2 + 486 Phosphoribosyl-AMP Histidine Biosynthesis; D23_1c2059 Neut_1910
cyclohydrolase (EC <br>Zinc regulated
3.5.4.19) enzymes
fig|6666666.60966.peg.2056 CDS 1915906 1916259 1 + 354 Phosphoribosyl-ATP Histidine Biosynthesis; D23_1c2060 Neut_1911
pyrophosphatase (EC <br>Riboflavin synthesis
3.6.1.31) cluster
fig|6666666.60966.peg.2057 CDS 1916261 1916611 2 + 351 FIG146285: -none- D23_1c2061 Neut_1912
Diadenosine
tetraphosphate (Ap4A)
hydrolase and other HIT
family hydrolases
fig|6666666.60966.peg.2058 CDS 1916631 1916864 3 + 234 Twin-arginine Cluster-based Subsystem D23_1c2062 Neut_1913
translocation protein Grouping Hypotheticals-
TatA perhaps Proteosome
Related; <br>Twin-
arginine translocation
system
fig|6666666.60966.peg.2060 CDS 1916950 1917342 1 + 393 Twin-arginine Twin-arginine D23_1c2063 Neut_1914
translocation protein translocation system
TatB
fig|6666666.60966.peg.2061 CDS 1917433 1918209 1 + 777 Twin-arginine Cluster-based Subsystem D23_1c2064 Neut_1915
translocation protein Grouping Hypotheticals-
TatC perhaps Proteosome
Related; <br>Twin-
arginine translocation
system
fig|6666666.60966.peg.2062 CDS 1918395 1920518 3 + 2124 Outer membrane -none- D23_1c2065 Neut_1916
vitamin B12 receptor
BtuB
fig|6666666.60966.peg.2063 CDS 1920528 1921118 3 + 591 Optional hypothetical -none- D23_1c2066 Neut_1917
component of the B12
transporter BtuM
fig|6666666.60966.peg.2064 CDS 1921118 1921726 2 + 609 Cob(I)alamin -none- D23_1c2067 Neut_1918
adenosyltransferase (EC
2.5.1.17)
fig|6666666.60966.peg.2065 CDS 1922713 1922826 1 + 114 hypothetical protein -none- D23_1c2069 NA
fig|6666666.60966.peg.2067 CDS 1923447 1924253 3 + 807 Cytochrome bd-type -none- D23_1c2070 Neut_1920
quinol oxidase, subunit 1
fig|6666666.60966.peg.2068 CDS 1926393 1924288 −3 2106 Methionyl-tRNA Scaffold proteins for D23_1c2071 Neut_1921
synthetase (EC 6.1.1.10) [4Fe—4S] cluster
assembly (MRP family);
<br>tRNA
aminoacylation, Met
fig|6666666.60966.peg.2069 CDS 1926506 1926390 −2 117 hypothetical protein -none- D23_1c2072 NA
fig|6666666.60966.peg.2070 CDS 1926499 1927584 1 + 1086 Scaffold protein for Scaffold proteins for D23_1c2073 Neut_1922
[4Fe—4S] cluster [4Fe—4S] cluster
assembly ApbC, MRP- assembly (MRP family)
like
fig|6666666.60966.peg.2071 CDS 1927630 1928163 1 + 534 Deoxycytidine pyrimidine conversions D23_1c2074 Neut_1923
triphosphate deaminase
(EC 3.5.4.13)
fig|6666666.60966.peg.2072 CDS 1928619 1928251 −3 369 COGs COG1917 -none- D23_1c2075 Neut_1924
fig|6666666.60966.peg.2073 CDS 1929401 1928631 −2 771 Inner membrane -none- D23_1c2076 Neut_1925
protein
fig|6666666.60966.peg.2074 CDS 1929596 1929889 2 + 294 Mobile element protein -none- D23_1c2077 Neut_1719
fig|6666666.60966.peg.2075 CDS 1929988 1930866 1 + 879 Mobile element protein -none- D23_1c2078 Neut_1720
fig|6666666.60966.peg.2076 CDS 1930961 1933699 2 + 2739 Ca ion P-type ATPase -none- D23_1c2079 Neut_1926
fig|6666666.60966.peg.2078 CDS 1934003 1934323 2 + 321 hypothetical protein -none- D23_1c2080 Neut_1927
fig|6666666.60966.peg.2079 CDS 1935608 1934517 −2 1092 Prophage Lp2 protein 6 -none- D23_1c2081 Neut_1928
fig|6666666.60966.peg.2081 CDS 1935893 1936396 2 + 504 ABC transporter ATP- -none- D23_1c2083 Neut_1936
binding protein YvcR
fig|6666666.60966.peg.2083 CDS 1936587 1936880 3 + 294 Mobile element protein -none- D23_1c2085 Neut_1719
fig|6666666.60966.peg.2084 CDS 1936979 1937857 2 + 879 Mobile element protein -none- D23_1c2086 Neut_1720
fig|6666666.60966.peg.2085 CDS 1938082 1937936 −1 147 hypothetical protein -none- D23_1c2087 Neut_1937
fig|6666666.60966.peg.2086 CDS 1938637 1938188 −1 450 Ferric uptake regulation Bacterial RNA- D23_1c2088 Neut_1938
protein FUR metabolizing Zn-
dependent hydrolases;
<br>Oxidative stress
fig|6666666.60966.peg.2087 CDS 1938848 1939330 2 + 483 Outer membrane Lipopolysaccharide D23_1c2089 Neut_1939
lipoprotein SmpA, a assembly
component of the
essential YaeT outer-
membrane protein
assembly complex
fig|6666666.60966.peg.2088 CDS 1939327 1940133 1 + 807 Dihydrodipicolinate -none- D23_1c2090 Neut_1940
reductase (EC 1.3.1.26)
fig|6666666.60966.peg.2089 CDS 1941855 1940347 −3 1509 ATPase -none- D23_1c2091 Neut_1941
fig|6666666.60966.peg.2090 CDS 1942209 1942087 −3 123 hypothetical protein -none- D23_1c2092 NA
fig|6666666.60966.peg.2091 CDS 1942220 1942459 2 + 240 Type I restriction- Restriction-Modification D23_1c2093 Neut_1942
modification system, System; <br>Type I
DNA-methyltransferase Restriction-Modification
subunit M (EC 2.1.1.72)
fig|6666666.60966.peg.2092 CDS 1942456 1942860 1 + 405 Cell filamentation -none- D23_1c2094 Neut_1943
protein fic
fig|6666666.60966.peg.2093 CDS 1942823 1943278 2 + 456 Mobile element protein -none- D23_1c2095 Neut_2502
fig|6666666.60966.peg.2094 CDS 1943305 1944786 1 + 1482 Outer membrane -none- D23_1c2096 Neut_1945
component of tripartite
multidrug resistance
system
fig|6666666.60966.peg.2095 CDS 1944830 1946014 2 + 1185 Membrane fusion Multidrug Resistance D23_1c2097 Neut_1946
protein of RND family Efflux Pumps
multidrug efflux pump
fig|6666666.60966.peg.2096 CDS 1946018 1949131 2 + 3114 RND efflux system, Multidrug Resistance D23_1c2098 Neut_1947
inner membrane Efflux Pumps
transporter CmeB
fig|6666666.60966.peg.2097 CDS 1949252 1949386 2 + 135 Type I restriction- Restriction-Modification D23_1c2099 NA
modification system, System; <br>Type I
restriction subunit R (EC Restriction-Modification
3.1.21.3)
fig|6666666.60966.peg.2098 CDS 1949446 1950246 1 + 801 Bis(5&#39;-nucleosyl)- EC49-61 D23_1c2100 Neut_1949
tetraphosphatase,
symmetrical (EC
3.6.1.41)
fig|6666666.60966.peg.2099 CDS 1951009 1950200 −1 810 1-acyl-sn-glycerol-3- Glycerolipid and D23_1c2101 Neut_1950
phosphate Glycerophospholipid
acyltransferase (EC Metabolism in Bacteria
2.3.1.51)
fig|6666666.60966.peg.2100 CDS 1952008 1951073 −1 936 InterPro IPR002173 -none- D23_1c2103 Neut_1951
COGs COG0524
fig|6666666.60966.peg.2101 CDS 1953491 1952040 −2 1452 Glycine dehydrogenase Glycine and Serine D23_1c2104 Neut_1952
[decarboxylating] Utilization; <br>Glycine
(glycine cleavage cleavage system;
system P2 protein) (EC <br>Photorespiration
1.4.4.2) (oxidative C2 cycle)
fig|6666666.60966.peg.2102 CDS 1954921 1953566 −1 1356 Glycine dehydrogenase Glycine and Serine D23_1c2105 Neut_1953
[decarboxylating] Utilization; <br>Glycine
(glycine cleavage cleavage system;
system P1 protein) (EC <br>Photorespiration
1.4.4.2) (oxidative C2 cycle)
fig|6666666.60966.peg.2103 CDS 1955520 1955131 −3 390 Glycine cleavage system Glycine and Serine D23_1c2106 Neut_1954
H protein Utilization; <br>Glycine
cleavage system;
<br>Photorespiration
(oxidative C2 cycle)
fig|6666666.60966.peg.2104 CDS 1956682 1955591 −1 1092 Aminomethyltransferase CBSS-87626.3.peg.3639; D23_1c2107 Neut_1955
(glycine cleavage <br>Glycine and Serine
system T protein) (EC Utilization; <br>Glycine
2.1.2.10) cleavage system;
<br>Photorespiration
(oxidative C2 cycle)
fig|6666666.60966.peg.2106 CDS 1957270 1957133 −1 138 hypothetical protein -none- D23_1c2108 NA
fig|6666666.60966.peg.2107 CDS 1958337 1957420 −3 918 Coproporphyrinogen III Heme and Siroheme D23_1c2109 Neut_1956
oxidase, aerobic (EC Biosynthesis
1.3.3.3)
fig|6666666.60966.peg.2108 CDS 1958499 1959671 3 + 1173 Chorismate synthase Chorismate Synthesis; D23_1c2110 Neut_1957
(EC 4.2.3.5) <br>Common Pathway
For Synthesis of
Aromatic Compounds
(DAHP synthase to
chorismate)
fig|6666666.60966.peg.2110 CDS 1960360 1961133 1 + 774 IncF plasmid -none- D23_1c2111 Neut_1959
conjugative transfer
surface exclusion
protein TraT
fig|6666666.60966.peg.2111 CDS 1961191 1961517 1 + 327 hypothetical protein -none- D23_1c2112 NA
fig|6666666.60966.peg.2112 CDS 1961582 1962544 2 + 963 Mobile element protein -none- D23_1c2114 Neut_1862
fig|6666666.60966.peg.2113 CDS 1962848 1962729 −2 120 hypothetical protein -none- D23_1c2115 NA
fig|6666666.60966.peg.2115 CDS 1965546 1963441 −3 2106 Ferrichrome-iron -none- D23_1c2116 Neut_1962
receptor
fig|6666666.60966.peg.2118 CDS 1967221 1966565 −1 657 Protein of unknown -none- D23_1c2119 Neut_1964
function DUF208
fig|6666666.60966.peg.2119 CDS 1967389 1968672 1 + 1284 FIG00858634: -none- D23_1c2120 Neut_1965
hypothetical protein
fig|6666666.60966.peg.2120 CDS 1968691 1969206 1 + 516 FIG00859317: -none- D23_1c2121 Neut_1966
hypothetical protein
fig|6666666.60966.peg.2121 CDS 1969209 1969910 3 + 702 InterPro IPR000179 -none- D23_1c2122 Neut_1967
COGs COG1423
fig|6666666.60966.peg.2122 CDS 1969960 1970334 1 + 375 InterPro IPR003807 -none- D23_1c2123 Neut_1968
COGs COG2149
fig|6666666.60966.peg.2123 CDS 1971838 1970381 −1 1458 Catalase (EC 1.11.1.6) Oxidative stress; D23_1c2124 Neut_1969
<br>Photorespiration
(oxidative C2 cycle);
<br>Protection from
Reactive Oxygen Species
fig|6666666.60966.peg.2124 CDS 1973211 1971865 −3 1347 FIG00858984: -none- D23_1c2125 Neut_1970
hypothetical protein
fig|6666666.60966.peg.2125 CDS 1974046 1973246 −1 801 Protein of unknown -none- D23_1c2126 Neut_1971
function DUF81
fig|6666666.60966.peg.2126 CDS 1974579 1974124 −3 456 Protein of unknown -none- D23_1c2127 Neut_1972
function DUF55
fig|6666666.60966.peg.2127 CDS 1976514 1974985 −3 1530 Capsular polysaccharide Capsular Polysaccharides D23_1c2128 NA
biosynthesis protein Biosynthesis and
WcbQ Assembly
fig|6666666.60966.peg.2128 CDS 1977322 1976504 −1 819 Oxidoreductase, short- Capsular Polysaccharides D23_1c2129 Neut_1974
chain Biosynthesis and
dehydrogenase/reductase Assembly
family (EC 1.1.1.—)
fig|6666666.60966.peg.2129 CDS 1978801 1977323 −1 1479 Glycosyltransferase -none- D23_1c2130 Neut_1975
fig|6666666.60966.peg.2130 CDS 1979888 1978803 −2 1086 possible spore protein -none- D23_1c2131 Neut_1976
[UI:20467420]
fig|6666666.60966.peg.2131 CDS 1981090 1979921 −1 1170 FIG00858788: -none- D23_1c2132 Neut_1977
hypothetical protein
fig|6666666.60966.peg.2132 CDS 1982214 1981231 −3 984 hypothetical protein -none- D23_1c2133 NA
fig|6666666.60966.peg.2133 CDS 1982778 1982218 −3 561 hypothetical protein -none- D23_1c2134 NA
fig|6666666.60966.peg.2134 CDS 1983862 1982783 −1 1080 Glycosyltransferase (EC -none- D23_1c2135 Neut_1982
2.4.1.—)
fig|6666666.60966.peg.2135 CDS 1984198 1983896 −1 303 hypothetical protein -none- D23_1c2136 Neut_1983
fig|6666666.60966.peg.2136 CDS 1984883 1984704 −2 180 Mobile element protein -none- D23_1c2137 Neut_1984
fig|6666666.60966.peg.2137 CDS 1985076 1984852 −3 225 hypothetical protein -none- D23_1c2138 NA
fig|6666666.60966.peg.2139 CDS 1985629 1986384 1 + 756 hypothetical protein -none- D23_1c2139 Neut_1985
fig|6666666.60966.peg.2140 CDS 1987287 1988645 3 + 1359 FIG00860556: -none- D23_1c2140 Neut_1986
hypothetical protein
fig|6666666.60966.peg.2141 CDS 1988761 1989375 1 + 615 Cytochrome oxidase Biogenesis of D23_1c2141 Neut_1987
biogenesis protein cytochrome c oxidases
Sco1/SenC/PrrC,
putative copper
metallochaperone
fig|6666666.60966.peg.2142 CDS 1989381 1990007 3 + 627 FIG00859788: -none- D23_1c2142 Neut_1988
hypothetical protein
fig|6666666.60966.peg.2145 CDS 1990866 1990588 −3 279 hypothetical membrane -none- D23_1c2144 Neut_1990
protein
fig|6666666.60966.peg.2146 CDS 1991501 1991046 −2 456 InterPro IPR000485 -none- D23_1c2145 Neut_1991
fig|6666666.60966.peg.2147 CDS 1993914 1991785 −3 2130 Phosphate Fermentations: Lactate; D23_1c2146 Neut_1995
acetyltransferase (EC <br>Pyruvate
2.3.1.8) metabolism II: acetyl-
CoA, acetogenesis from
pyruvate
fig|6666666.60966.peg.2148 CDS 1995278 1994253 −2 1026 Fructose-bisphosphate Calvin-Benson cycle; D23_1c2147 Neut_1996
aldolase class I (EC <br>Glycolysis and
4.1.2.13) Gluconeogenesis
fig|6666666.60966.peg.2150 CDS 1995705 1995851 3 + 147 hypothetical protein -none- D23_1c2148 NA
fig|6666666.60966.peg.2152 CDS 1995966 1996298 3 + 333 DNA-binding protein -none- D23_1c2150 Neut_1998
fig|6666666.60966.peg.2154 CDS 1996639 1996932 1 + 294 protein of unknown -none- D23_1c2151 Neut_1999
function DUF497
fig|6666666.60966.peg.2155 CDS 1996922 1997203 2 + 282 hypothetical protein -none- D23_1c2152 Neut_2000
fig|6666666.60966.peg.2156 CDS 1997890 1998093 1 + 204 Mobile element protein -none- D23_1c2154 NA
fig|6666666.60966.peg.2157 CDS 1998565 1998266 −1 300 VapC toxin protein Toxin-antitoxin replicon D23_1c2155 NA
stabilization systems
fig|6666666.60966.peg.2158 CDS 1998899 1998666 −2 234 VapB protein (antitoxin Toxin-antitoxin replicon D23_1c2156 NA
to VapC) stabilization systems
fig|6666666.60966.peg.2159 CDS 1999186 1999344 1 + 159 hypothetical protein -none- D23_1c2157 NA
fig|6666666.60966.peg.2160 CDS 1999629 1999339 −3 291 transcriptional -none- D23_1c2158 NA
regulator, XRE family
fig|6666666.60966.peg.2161 CDS 1999997 1999692 −2 306 Phage-related protein -none- D23_1c2159 NA
fig|6666666.60966.peg.2162 CDS 2000147 2000022 −2 126 hypothetical protein -none- D23_1c2160 NA
fig|6666666.60966.peg.2163 CDS 2000220 2000486 3 + 267 Mobile element protein -none- D23_1c2161 NA
fig|6666666.60966.peg.2164 CDS 2000507 2000995 2 + 489 Mobile element protein -none- D23_1c2162 NA
fig|6666666.60966.peg.2165 CDS 2001470 2000997 −2 474 Mobile element protein -none- D23_1c2163 Neut_1256
fig|6666666.60966.peg.2166 CDS 2001936 2001544 −3 393 hypothetical protein -none- D23_1c2164 Neut_2449
fig|6666666.60966.peg.2167 CDS 2002011 2002328 3 + 318 Mobile element protein -none- D23_1c2165 NA
fig|6666666.60966.peg.2168 CDS 2003529 2002369 −3 1161 CDP-4-dehydro-6- -none- D23_1c2166 NA
deoxy-D-glucose 3-
dehydratase (EC 4.2.1.—)
fig|6666666.60966.peg.2169 CDS 2004426 2003539 −3 888 NAD-dependent CBSS-296591.1.peg.2330 D23_1c2167 NA
epimerase/dehydratase
family protein
fig|6666666.60966.peg.2170 CDS 2005586 2004468 −2 1119 GDP-mannose 4,6- -none- D23_1c2168 Neut_0156
dehydratase (EC
4.2.1.47)
fig|6666666.60966.peg.2171 CDS 2007467 2005632 −2 1836 hypothetical protein -none- D23_1c2169 NA
fig|6666666.60966.peg.2172 CDS 2010568 2007473 −1 3096 Minor teichoic acid -none- D23_1c2170 NA
biosynthesis protein
GgaB
fig|6666666.60966.peg.2173 CDS 2012163 2010694 −3 1470 InterPro IPR001173 -none- D23_1c2171 NA
COGs COG0463
fig|6666666.60966.peg.2174 CDS 2015828 2012172 −2 3657 Beta-1,3- -none- D23_1c2172 NA
glucosyltransferase
fig|6666666.60966.peg.2175 CDS 2017307 2016147 −2 1161 Capsular polysaccharide Capsular Polysaccharides D23_1c2173 NA
export system inner Biosynthesis and
membrane protein KpsE Assembly
fig|6666666.60966.peg.2176 CDS 2017966 2017304 −1 663 Capsular polysaccharide Capsular Polysaccharides D23_1c2174 Neut_0152
ABC transporter, ATP- Biosynthesis and
binding protein KpsT Assembly
fig|6666666.60966.peg.2177 CDS 2018757 2017963 −3 795 Capsular polysaccharide Capsular Polysaccharides D23_1c2175 NA
ABC transporter, Biosynthesis and
permease protein KpsM Assembly;
<br>Rhamnose
containing glycans
fig|6666666.60966.peg.2178 CDS 2019947 2018757 −2 1191 Capsular polysaccharide Capsular Polysaccharides D23_1c2176 Neut_2119
biosynthesis/export Biosynthesis and
periplasmic protein Assembly
WcbC
fig|6666666.60966.peg.2179 CDS 2021279 2019957 −2 1323 8-amino-7- Biotin biosynthesis; D23_1c2177 Neut_0461
oxononanoate synthase <br>Biotin biosynthesis
(EC 2.3.1.47) Experimental; <br>Biotin
synthesis cluster
fig|6666666.60966.peg.2180 CDS 2025121 2021276 −1 3846 Capsular polysaccharide -none- D23_1c2178 NA
biosynthesis fatty acid
synthase WcbR
fig|6666666.60966.peg.2181 CDS 2028811 2025266 −1 3546 Capsular polysaccharide -none- D23_1c2179 Neut_2003
biosynthesis fatty acid
synthase WcbR
fig|6666666.60966.peg.2182 CDS 2029053 2029166 3 + 114 hypothetical protein -none- D23_1c2180 NA
fig|6666666.60966.peg.2183 CDS 2029212 2029352 3 + 141 hypothetical protein -none- D23_1c2181 NA
fig|6666666.60966.peg.2184 CDS 2031017 2029434 −2 1584 L-aspartate oxidase (EC Mycobacterium D23_1c2182 Neut_2004
1.4.3.16) virulence operon
possibly involved in
quinolinate biosynthesis;
<br>NAD and NADP
cofactor biosynthesis
global
fig|6666666.60966.peg.2185 CDS 2031267 2032187 3 + 921 Branched-chain amino Alanine biosynthesis; D23_1c2184 Neut_2005
acid aminotransferase <br>Branched-Chain
(EC 2.6.1.42) Amino Acid Biosynthesis;
<br>Leucine
Biosynthesis;
<br>Pyruvate Alanine
Serine Interconversions
fig|6666666.60966.peg.2186 CDS 2032212 2032421 3 + 210 FIG00858455: -none- D23_1c2185 Neut_2006
hypothetical protein
fig|6666666.60966.peg.2187 CDS 2032485 2033864 3 + 1380 Phosphomannomutase Mannose Metabolism D23_1c2186 Neut_2007
(EC 5.4.2.8)/
Phosphoglucomutase
(EC 5.4.2.2)
fig|6666666.60966.peg.2188 CDS 2033901 2035508 3 + 1608 NAD synthetase (EC NAD and NADP cofactor D23_1c2187 Neut_2008
6.3.1.5)/Glutamine biosynthesis global;
amidotransferase chain <br>NAD and NADP
of NAD synthetase cofactor biosynthesis
global
fig|6666666.60966.peg.2189 CDS 2035472 2037178 2 + 1707 Exported zinc -none- D23_1c2188 Neut_2009
metalloprotease YfgC
precursor
fig|6666666.60966.peg.2190 CDS 2037257 2038402 2 + 1146 Macrolide-specific Multidrug Resistance D23_1c2189 Neut_2010
efflux protein MacA Efflux Pumps
fig|6666666.60966.peg.2191 CDS 2038413 2039180 3 + 768 Macrolide export ATP- Multidrug Resistance D23_1c2190 Neut_2011
binding/permease Efflux Pumps
protein MacB (EC 3.6.3.—)
fig|6666666.60966.peg.2192 CDS 2039177 2040400 2 + 1224 Macrolide export ATP- Multidrug Resistance D23_1c2191 Neut_2012
binding/permease Efflux Pumps
protein MacB (EC 3.6.3.—)
fig|6666666.60966.peg.2193 CDS 2040442 2040612 1 + 171 hypothetical protein -none- D23_1c2192 NA
fig|6666666.60966.peg.2195 CDS 2040690 2040875 3 + 186 hypothetical protein -none- D23_1c2193 NA
fig|6666666.60966.peg.2196 CDS 2040926 2042374 2 + 1449 ATP synthase beta chain -none- D23_1c2194 Neut_2013
(EC 3.6.3.14)
fig|6666666.60966.peg.2197 CDS 2042371 2042781 1 + 411 ATP synthase epsilon -none- D23_1c2195 Neut_2014
chain (EC 3.6.3.14)
fig|6666666.60966.peg.2198 CDS 2042778 2043059 3 + 282 ATP synthase protein I -none- D23_1c2196 Neut_2015
fig|6666666.60966.peg.2199 CDS 2043105 2043398 3 + 294 FIG048548: ATP -none- D23_1c2197 Neut_2016
synthase protein I2
fig|6666666.60966.peg.2200 CDS 2043420 2044112 3 + 693 ATP synthase A chain -none- D23_1c2198 Neut_2017
(EC 3.6.3.14)
fig|6666666.60966.peg.2201 CDS 2044115 2044393 2 + 279 ATP synthase C chain -none- D23_1c2199 Neut_2018
(EC 3.6.3.14)
fig|6666666.60966.peg.2202 CDS 2044400 2045170 2 + 771 ATP synthase B chain -none- D23_1c2200 Neut_2019
(EC 3.6.3.14)
fig|6666666.60966.peg.2203 CDS 2045183 2046733 2 + 1551 ATP synthase alpha -none- D23_1c2201 Neut_2020
chain (EC 3.6.3.14)
fig|6666666.60966.peg.2204 CDS 2046810 2047607 3 + 798 ATP synthase gamma -none- D23_1c2202 Neut_2021
chain (EC 3.6.3.14)
fig|6666666.60966.peg.2206 CDS 2048344 2050986 1 + 2643 DNA mismatch repair DNA repair, bacterial D23_1c2204 Neut_2022
protein MutS MutL-MutS system;
<br>DNA repair system
including RecA, MutS
and a hypothetical
protein
fig|6666666.60966.peg.2207 CDS 2051500 2051021 −1 480 FKBP-type peptidyl- G3E family of P-loop D23_1c2205 Neut_2023
prolyl cis-trans GTPases (metallocenter
isomerase SlyD (EC biosynthesis);
5.2.1.8) <br>Peptidyl-prolyl cis-
trans isomerase;
<br>Potassium
homeostasis
fig|6666666.60966.peg.2208 CDS 2052207 2051656 −3 552 Ribonuclease HII (EC Ribonuclease H; D23_1c2206 Neut_2024
3.1.26.4) <br>Ribonucleases in
Bacillus
fig|6666666.60966.peg.2209 CDS 2052737 2052294 −2 444 (3R)-hydroxymyristoyl- -none- D23_1c2207 Neut_2025
[acyl carrier protein]
dehydratase (EC 4.2.1.—)
fig|6666666.60966.peg.2210 CDS 2053333 2052770 −1 564 Outer membrane Lipopolysaccharide D23_1c2208 Neut_2026
protein H precursor assembly;
<br>Periplasmic Stress
Response
fig|6666666.60966.peg.2211 CDS 2055635 2053359 −2 2277 Outer membrane Lipopolysaccharide D23_1c2209 Neut_2027
protein assembly factor assembly
YaeT precursor
fig|6666666.60966.peg.2212 CDS 2057020 2055638 −1 1383 Membrane-associated -none- D23_1c2210 Neut_2028
zinc metalloprotease
fig|6666666.60966.peg.2213 CDS 2058265 2057024 −1 1242 1-deoxy-D-xylulose 5- CBSS-83331.1.peg.3039; D23_1c2211 Neut_2029
phosphate <br>Isoprenoid
reductoisomerase (EC Biosynthesis;
1.1.1.267) <br>Nonmevalonate
Branch of Isoprenoid
Biosynthesis
fig|6666666.60966.peg.2214 CDS 2059089 2058262 −3 828 Phosphatidate Glycerolipid and D23_1c2212 Neut_2030
cytidylyltransferase (EC Glycerophospholipid
2.7.7.41) Metabolism in Bacteria
fig|6666666.60966.peg.2215 CDS 2059870 2059124 −1 747 Undecaprenyl CBSS-83331.1.peg.3039; D23_1c2213 Neut_2031
diphosphate synthase <br>Isoprenoid
(EC 2.5.1.31) Biosynthesis;
<br>Isoprenoinds for
Quinones;
<br>Polyprenyl
Diphosphate
Biosynthesis
fig|6666666.60966.peg.2216 CDS 2060476 2059919 −1 558 Ribosome recycling Ribosome recycling D23_1c2214 Neut_2032
factor related cluster;
<br>Translation
termination factors
bacterial
fig|6666666.60966.peg.2217 CDS 2061239 2060577 −2 663 Uridylate kinase (EC -none- D23_1c2215 Neut_2033
2.7.4.—)
fig|6666666.60966.peg.2218 CDS 2061489 2061361 −3 129 hypothetical protein -none- D23_1c2216 NA
fig|6666666.60966.peg.2219 CDS 2062729 2061845 −1 885 Translation elongation CBSS- D23_1c2217 Neut_2034
factor Ts 312309.3.peg.1965;
<br>Ribosome recycling
related cluster;
<br>Translation
elongation factors
bacterial
fig|6666666.60966.peg.2220 CDS 2063557 2062802 −1 756 SSU ribosomal protein CBSS- D23_1c2218 Neut_2035
S2p (SAe) 312309.3.peg.1965;
<br>Ribosome recycling
related cluster
fig|6666666.60966.peg.2221 CDS 2064515 2063772 −2 744 transcriptional Oxidative stress D23_1c2219 Neut_2036
regulator, Crp/Fnr
family
fig|6666666.60966.peg.2222 CDS 2064873 2064562 −3 312 Cytochrome c, class I -none- D23_1c2220 Neut_2037
fig|6666666.60966.peg.2223 CDS 2067162 2065111 −3 2052 Zinc-regulated outer -none- D23_1c2221 Neut_2038
membrane receptor
fig|6666666.60966.peg.2225 CDS 2067907 2068395 1 + 489 Zinc uptake regulation Glycyl-tRNA synthetase D23_1c2222 NA
protein ZUR containing cluster;
<br>Oxidative stress;
<br>Zinc regulated
enzymes
fig|6666666.60966.peg.2226 CDS 2068438 2068560 1 + 123 Mobile element protein -none- D23_1c2223 Neut_0884
fig|6666666.60966.peg.2228 CDS 2068811 2069020 2 + 210 hypothetical protein -none- D23_1c2224 NA
fig|6666666.60966.peg.2231 CDS 2069466 2069332 −3 135 hypothetical protein -none- D23_1c2225 NA
fig|6666666.60966.peg.2232 CDS 2069455 2070327 1 + 873 COG0613, Predicted A cluster relating to D23_1c2226 Neut_2039
metal-dependent Tryptophanyl-tRNA
phosphoesterases (PHP synthetase; <br>tRNA
family) modification Bacteria
fig|6666666.60966.peg.2233 CDS 2070450 2071082 3 + 633 YciO family -none- D23_1c2227 Neut_2040
fig|6666666.60966.peg.2234 CDS 2071075 2071740 1 + 666 FIG004556: membrane A cluster relating to D23_1c2228 Neut_2041
metalloprotease Tryptophanyl-tRNA
synthetase
fig|6666666.60966.peg.2235 CDS 2071817 2073019 2 + 1203 Tryptophanyl-tRNA A cluster relating to D23_1c2229 Neut_2042
synthetase (EC 6.1.1.2) Tryptophanyl-tRNA
synthetase; <br>tRNA
aminoacylation, Trp
fig|6666666.60966.peg.2236 CDS 2073064 2073864 1 + 801 Segregation and -none- D23_1c2230 Neut_2043
condensation protein A
fig|6666666.60966.peg.2237 CDS 2073830 2074480 2 + 651 Segregation and -none- D23_1c2231 Neut_2044
condensation protein B
fig|6666666.60966.peg.2238 CDS 2074504 2075751 1 + 1248 Isocitrate 5-FCL-like protein; D23_1c2232 Neut_2045
dehydrogenase [NADP] <br>TCA Cycle
(EC 1.1.1.42)
fig|6666666.60966.peg.2239 CDS 2076095 2075892 −2 204 Cold shock protein CspD Cold shock, CspA family D23_1c2233 Neut_2046
of proteins
fig|6666666.60966.peg.2240 CDS 2076577 2076407 −1 171 hypothetical protein -none- D23_1c2234 NA
fig|6666666.60966.peg.2241 CDS 2076576 2076779 3 + 204 ATP-dependent Clp ClpAS cluster; D23_1c2235 Neut_2047
protease adaptor <br>Proteolysis in
protein ClpS bacteria, ATP-dependent
fig|6666666.60966.peg.2242 CDS 2076781 2079051 1 + 2271 ATP-dependent Clp ClpAS cluster; D23_1c2236 Neut_2048
protease ATP-binding <br>Proteolysis in
subunit ClpA bacteria, ATP-
dependent;
<br>Ribosome recycling
related cluster
fig|6666666.60966.peg.2243 CDS 2079170 2080129 2 + 960 TRAP transporter solute TRAP Transporter D23_1c2237 Neut_2049
receptor, unknown unknown substrate 6
substrate 6
fig|6666666.60966.peg.2244 CDS 2080157 2080885 2 + 729 Orotate De Novo Pyrimidine D23_1c2238 Neut_2050
phosphoribosyltransferase Synthesis
(EC 2.4.2.10)
fig|6666666.60966.peg.2245 CDS 2081203 2082156 1 + 954 COGs COG0715 -none- D23_1c2239 Neut_2051
fig|6666666.60966.peg.2246 CDS 2082161 2082997 2 + 837 Alkanesulfonates Alkanesulfonate D23_1c2240 Neut_2052
transport system assimilation
permease protein
fig|6666666.60966.peg.2247 CDS 2083232 2083038 −2 195 hypothetical protein -none- D23_1c2241 NA
fig|6666666.60966.peg.2248 CDS 2083287 2083823 3 + 537 ABC-type Alkanesulfonate D23_1c2242 Neut_2053
nitrate/sulfonate/bicarbonate assimilation
transport system,
ATPase component
fig|6666666.60966.peg.2249 CDS 2083938 2086493 3 + 2556 Glycogen Glycogen metabolism D23_1c2243 Neut_2054
phosphorylase (EC
2.4.1.1)
fig|6666666.60966.peg.2251 CDS 2086807 2086661 −1 147 hypothetical protein -none- D23_1c2244 NA
fig|6666666.60966.peg.2252 CDS 2086806 2087288 3 + 483 Flagellar biosynthesis Flagellum D23_1c2245 Neut_2055
protein FliL
fig|6666666.60966.peg.2253 CDS 2087301 2088293 3 + 993 Flagellar motor switch Flagellar motility; D23_1c2246 Neut_2056
protein FliM <br>Flagellum
fig|6666666.60966.peg.2254 CDS 2088322 2088795 1 + 474 Flagellar motor switch Flagellar motility; D23_1c2247 Neut_2057
protein FliN <br>Flagellum
fig|6666666.60966.peg.2255 CDS 2088822 2089265 3 + 444 Flagellar biosynthesis Flagellum D23_1c2248 Neut_2058
protein FliQ
fig|6666666.60966.peg.2256 CDS 2089255 2090040 1 + 786 Flagellar biosynthesis Flagellum D23_1c2249 Neut_2059
protein FliP
fig|6666666.60966.peg.2257 CDS 2090056 2090331 1 + 276 Flagellar biosynthesis Flagellum D23_1c2250 Neut_2060
protein FliQ
fig|6666666.60966.peg.2258 CDS 2090429 2091229 2 + 801 Flagellar biosynthesis Flagellar motility; D23_1c2251 Neut_2061
protein FliR <br>Flagellum
fig|6666666.60966.peg.2259 CDS 2091389 2093485 2 + 2097 FIG00858519: -none- D23_1c2252 Neut_2062
hypothetical protein
fig|6666666.60966.peg.2260 CDS 2093591 2095027 2 + 1437 FIG00858578: -none- D23_1c2253 Neut_2063
hypothetical protein
fig|6666666.60966.peg.2261 CDS 2096049 2095090 −3 960 alpha/beta hydrolase -none- D23_1c2254 Neut_2064
fold
fig|6666666.60966.peg.2262 CDS 2096035 2096187 1 + 153 hypothetical protein -none- D23_1c2255 NA
fig|6666666.60966.peg.2263 CDS 2097510 2096296 −3 1215 Argininosuccinate Arginine Biosynthesis-- D23_1c2256 Neut_2065
synthase (EC 6.3.4.5) gjo; <br>Arginine
Biosynthesis extended
fig|6666666.60966.peg.2264 CDS 2098473 2097550 −3 924 Ornithine Arginine Biosynthesis-- D23_1c2257 Neut_2066
carbamoyltransferase gjo; <br>Arginine
(EC 2.1.3.3) Biosynthesis extended;
<br>Arginine and
Ornithine Degradation
fig|6666666.60966.peg.2266 CDS 2099808 2099680 −3 129 hypothetical protein -none- D23_1c2259 Neut_2067
fig|6666666.60966.peg.2265 CDS 2099605 2098649 −1 957 Acetylornithine Arginine Biosynthesis-- D23_1c2259 Neut_2067
aminotransferase (EC gjo; <br>Arginine
2.6.1.11) Biosynthesis extended
fig|6666666.60966.peg.2267 CDS 2100416 2100066 −2 351 FIG00858925: -none- D23_1c2260 Neut_2068
hypothetical protein
fig|6666666.60966.peg.2268 CDS 2100762 2100517 −3 246 FIG00859242: -none- D23_1c2261 Neut_2069
hypothetical protein
fig|6666666.60966.peg.2269 CDS 2102838 2100763 −3 2076 FIG00858999: -none- D23_1c2262 Neut_2070
hypothetical protein
fig|6666666.60966.peg.2270 CDS 2103683 2102844 −2 840 Cysteine synthase B (EC Cysteine Biosynthesis D23_1c2263 Neut_2071
2.5.1.47)
fig|6666666.60966.peg.2272 CDS 2106646 2103854 −1 2793 FIG00860005: -none- D23_1c2264 Neut_2072
hypothetical protein
fig|6666666.60966.peg.2274 CDS 2109519 2108932 −3 588 hypothetical protein -none- D23_1c2268 Neut_2074
fig|6666666.60966.peg.2275 CDS 2110331 2109591 −2 741 putative (U92432) ORF4 -none- D23_1c2269 Neut_2316
(Nitrosospira sp. NpAV)
fig|6666666.60966.peg.2276 CDS 2111663 2110398 −2 1266 Particulate methane Particulate methane D23_1c2270 Neut_2317
monooxygenase B- monooxygenase
subunit (EC 1.14.13.25) (pMMO)
fig|6666666.60966.peg.2277 CDS 2112493 2111663 −1 831 Particulate methane Particulate methane D23_1c2271 Neut_2318
monooxygenase A- monooxygenase
subunit (EC 1.14.13.25) (pMMO)
fig|6666666.60966.peg.2278 CDS 2113482 2112667 −3 816 Particulate methane Particulate methane D23_1c2272 Neut_2319
monooxygenase C- monooxygenase
subunit (EC 1.14.13.25) (pMMO)
fig|6666666.60966.peg.2279 CDS 2114624 2114052 −2 573 CDP-diacylglycerol-- Glycerolipid and D23_1c2273 Neut_2079
glycerol-3-phosphate 3- Glycerophospholipid
phosphatidyltransferase Metabolism in Bacteria
(EC 2.7.8.5)
fig|6666666.60966.peg.2280 CDS 2116254 2114755 −3 1500 Glycerol kinase (EC Glycerol and Glycerol-3- D23_1c2274 Neut_2080
2.7.1.30) phosphate Uptake and
Utilization;
<br>Glycerolipid and
Glycerophospholipid
Metabolism in Bacteria
fig|6666666.60966.peg.2281 CDS 2116718 2116305 −2 414 Regulator of nucleoside Transcription factors D23_1c2275 Neut_2081
diphosphate kinase bacterial
fig|6666666.60966.peg.2282 CDS 2116748 2116897 2 + 150 hypothetical protein -none- D23_1c2276 NA
fig|6666666.60966.peg.2283 CDS 2117727 2117005 −3 723 Phosphate regulon High affinity phosphate D23_1c2277 Neut_2082
transcriptional transporter and control
regulatory protein PhoB of PHO regulon;
(SphR) <br>PhoR-PhoB two-
component regulatory
system; <br>Phosphate
metabolism
fig|6666666.60966.peg.2284 CDS 2119187 2118225 −2 963 Mobile element protein -none- D23_1c2278 Neut_1746
fig|6666666.60966.peg.2287 CDS 2121603 2120356 −3 1248 Aspartokinase (EC CBSS-216591.1.peg.168; D23_1c2282 Neut_2084
2.7.2.4) <br>Lysine Biosynthesis
DAP Pathway, GJO
scratch; <br>Threonine
and Homoserine
Biosynthesis
fig|6666666.60966.peg.2288 CDS 2122439 2121855 −2 585 Putative peptidoglycan -none- D23_1c2283 Neut_2085
binding domain 1
fig|6666666.60966.peg.2289 CDS 2122914 2124089 3 + 1176 Acetate kinase (EC Fermentations: Lactate; D23_1c2284 Neut_2086
2.7.2.1) <br>Pyruvate
metabolism II: acetyl-
CoA, acetogenesis from
pyruvate
fig|6666666.60966.peg.2290 CDS 2124134 2126509 2 + 2376 Xylulose-5-phosphate Fermentations: Lactate; D23_1c2285 Neut_2087
phosphoketolase (EC <br>Fermentations:
4.1.2.9); Fructose-6- Lactate; <br>Pentose
phosphate phosphate pathway;
phosphoketolase (EC <br>Pentose phosphate
4.1.2.22) pathway
fig|6666666.60966.peg.2291 CDS 2126813 2126977 2 + 165 hypothetical protein -none- D23_1c2287 NA
fig|6666666.60966.peg.2292 CDS 2128152 2127058 −3 1095 Transaldolase (EC Pentose phosphate D23_1c2288 Neut_2089
2.2.1.2) pathway
fig|6666666.60966.peg.2293 CDS 2128367 2128218 −2 150 hypothetical protein -none- D23_1c2289 NA
fig|6666666.60966.peg.2294 CDS 2128351 2128908 1 + 558 FIG006045: Sigma Iron siderophore sensor D23_1c2290 Neut_2090
factor, ECF subfamily & receptor system
fig|6666666.60966.peg.2295 CDS 2128915 2129877 1 + 963 Iron siderophore sensor Iron siderophore sensor D23_1c2291 Neut_2091
protein & receptor system
fig|6666666.60966.peg.2296 CDS 2129956 2132253 1 + 2298 TonB-dependent Ton and Tol transport D23_1c2292 Neut_2092
receptor systems
fig|6666666.60966.peg.2297 CDS 2132801 2132271 −2 531 FIG00858714: -none- D23_1c2293 Neut_2093
hypothetical protein
fig|6666666.60966.peg.2298 CDS 2133157 2132813 −1 345 FIG00858447: -none- D23_1c2294 Neut_2094
hypothetical protein
fig|6666666.60966.peg.2299 CDS 2134515 2133133 −3 1383 Xaa-Pro Aminopeptidases (EC D23_1c2295 Neut_2095
aminopeptidase (EC 3.4.11.—); <br>CBSS-
3.4.11.9) 87626.3.peg.3639
fig|6666666.60966.peg.2301 CDS 2134633 2135313 1 + 681 Ribulose-phosphate 3- Calvin-Benson cycle; D23_1c2296 Neut_2096
epimerase (EC 5.1.3.1) <br>Pentose phosphate
pathway; <br>Riboflavin
synthesis cluster
fig|6666666.60966.peg.2302 CDS 2135328 2136050 3 + 723 Phosphoglycolate 2-phosphoglycolate D23_1c2297 Neut_2097
phosphatase (EC salvage; <br>Glycolate,
3.1.3.18) glyoxylate
interconversions;
<br>Photorespiration
(oxidative C2 cycle)
fig|6666666.60966.peg.2303 CDS 2136160 2137647 1 + 1488 Anthranilate synthase, Chorismate: D23_1c2298 Neut_2098
aminase component (EC Intermediate for
4.1.3.27) synthesis of Tryptophan,
PAPA antibiotics, PABA,
3-hydroxyanthranilate
and more.;
<br>Tryptophan
synthesis
fig|6666666.60966.peg.2304 CDS 2138110 2137682 −1 429 Ferredoxin reductase Anaerobic respiratory D23_1c2299 Neut_2099
reductases
fig|6666666.60966.peg.2305 CDS 2138482 2138138 −1 345 FIG00858997: -none- D23_1c2300 Neut_2100
hypothetical protein
fig|6666666.60966.peg.2306 CDS 2138586 2139236 3 + 651 Iron-sulfur cluster CBSS-196164.1.peg.1690 D23_1c2301 Neut_2101
regulator SufR
fig|6666666.60966.peg.2307 CDS 2139353 2140534 2 + 1182 FIG00859085: -none- D23_1c2302 Neut_2102
hypothetical protein
fig|6666666.60966.peg.2308 CDS 2142375 2140606 −3 1770 Dihydrolipoamide Pyruvate metabolism II: D23_1c2304 Neut_2103
dehydrogenase of acetyl-CoA, acetogenesis
pyruvate from pyruvate; <br>TCA
dehydrogenase Cycle
complex (EC 1.8.1.4)
fig|6666666.60966.peg.2309 CDS 2143648 2142380 −1 1269 Gamma-glutamyl Proline Synthesis D23_1c2305 Neut_2104
phosphate reductase
(EC 1.2.1.41)
fig|6666666.60966.peg.2310 CDS 2144399 2143713 −2 687 InterPro IPR001440 -none- D23_1c2306 Neut_2105
COGs COG0457
fig|6666666.60966.peg.2311 CDS 2145656 2144412 −2 1245 TPR/glycosyl -none- D23_1c2307 Neut_2106
transferase domain
protein
fig|6666666.60966.peg.2312 CDS 2146522 2145650 −1 873 Esterase/lipase/thioesterase -none- D23_1c2308 Neut_2107
family active site
fig|6666666.60966.peg.2313 CDS 2147373 2146519 −3 855 Esterase/lipase/thioesterase -none- D23_1c2309 Neut_2108
family active site
fig|6666666.60966.peg.2314 CDS 2147631 2147380 −3 252 FIG00858580: -none- D23_1c2310 Neut_2109
hypothetical protein
fig|6666666.60966.peg.2315 CDS 2147817 2149007 3 + 1191 Tetraacyldisaccharide Broadly distributed D23_1c2311 Neut_2110
4&#39;-kinase (EC proteins not in
2.7.1.130)/FIG002473: subsystems; <br>KDO2-
Protein YcaR in KDO2- Lipid A biosynthesis
Lipid A biosynthesis cluster 2; <br>KDO2-
cluster Lipid A biosynthesis
cluster 2
fig|6666666.60966.peg.2316 CDS 2149225 2149353 1 + 129 hypothetical protein -none- D23_1c2312 NA
fig|6666666.60966.peg.2318 CDS 2150705 2149527 −2 1179 Lipid carrier: UDP-N- CBSS- D23_1c2313 Neut_2112
acetylgalactosaminyltransferase 296591.1.peg.2330;
(EC 2.4.1.—)/ <br>CBSS-
Alpha-1,3-N- 296591.1.peg.2330;
acetylgalactosamine <br>CBSS-
transferase PglA (EC 296591.1.peg.2330;
2.4.1.—); Putative <br>N-linked
glycosyltransferase Glycosylation in
Bacteria; <br>N-linked
Glycosylation in Bacteria
fig|6666666.60966.peg.2319 CDS 2151819 2150689 −3 1131 Glycosyl transferase, -none- D23_1c2314 Neut_2113
group 1 family protein
fig|6666666.60966.peg.2320 CDS 2153132 2151816 −2 1317 hypothetical protein -none- D23_1c2315 NA
fig|6666666.60966.peg.2321 CDS 2154290 2153199 −2 1092 Alpha-1,4-N- N-linked Glycosylation in D23_1c2316 Neut_2115
acetylgalactosamine Bacteria
transferase PglJ (EC
2.4.1.—)
fig|6666666.60966.peg.2322 CDS 2155270 2154290 −1 981 COGs COG0439 -none- D23_1c2317 Neut_2116
fig|6666666.60966.peg.2323 CDS 2156578 2155337 −1 1242 Membrane protein -none- D23_1c2318 Neut_2117
involved in the export
of O-antigen, teichoic
acid lipoteichoic acids
fig|6666666.60966.peg.2324 CDS 2156818 2157207 1 + 390 Low molecular weight Capsular Polysaccharides D23_1c2319 Neut_2118
protein-tyrosine- Biosynthesis and
phosphatase Wzb (EC Assembly
3.1.3.48)
fig|6666666.60966.peg.2325 CDS 2157230 2158477 2 + 1248 Capsule polysaccharide -none- D23_1c2320 Neut_2119
export protein
fig|6666666.60966.peg.2326 CDS 2158531 2160774 1 + 2244 Tyrosine-protein kinase Capsular Polysaccharides D23_1c2321 Neut_2120
Wzc (EC 2.7.10.2) Biosynthesis and
Assembly
fig|6666666.60966.peg.2327 CDS 2160771 2162330 3 + 1560 Undecaprenyl- -none- D23_1c2322 Neut_2121
phosphate N-
acetylglucosaminyl 1-
phosphate transferase
(EC 2.7.8.—)
fig|6666666.60966.peg.2329 CDS 2165972 2162400 −2 3573 Chromosome partition DNA structural proteins, D23_1c2323 Neut_2122
protein smc bacterial
fig|6666666.60966.peg.2330 CDS 2166059 2166478 2 + 420 NADPH-dependent 7- -none- D23_1c2324 Neut_2123
cyano-7-deazaguanine
reductase (EC 1.7.1.13)
fig|6666666.60966.peg.2331 CDS 2166527 2167927 2 + 1401 Fumarate hydratase TCA Cycle D23_1c2325 Neut_2124
class II (EC 4.2.1.2)
fig|6666666.60966.peg.2332 CDS 2168192 2168052 −2 141 hypothetical protein -none- D23_1c2326 NA
fig|6666666.60966.peg.2333 CDS 2168473 2168640 1 + 168 hypothetical protein -none- D23_1c2327 NA
fig|6666666.60966.peg.2334 CDS 2168888 2169181 2 + 294 Mobile element protein -none- D23_1c2328 Neut_1719
fig|6666666.60966.peg.2335 CDS 2169280 2170158 1 + 879 Mobile element protein -none- D23_1c2329 Neut_1720
fig|6666666.60966.peg.2337 CDS 2171884 2170655 −1 1230 diguanylate -none- D23_1c2332 Neut_2126
phosphodiesterase
fig|6666666.60966.peg.2338 CDS 2172707 2171898 −2 810 Putative diheme Soluble cytochromes D23_1c2333 Neut_2127
cytochrome c-553 and functionally related
electron carriers
fig|6666666.60966.peg.2339 CDS 2172852 2172977 3 + 126 hypothetical protein -none- D23_1c2334 NA
fig|6666666.60966.peg.2340 CDS 2175331 2172950 −1 2382 Type II secretory -none- D23_1c2335 Neut_2128
pathway, ATPase
PulE/Tfp pilus assembly
pathway, ATPase PilB
fig|6666666.60966.peg.2341 CDS 2176108 2175344 −1 765 CAMP cAMP signaling in D23_1c2336 Neut_2129
phosphodiesterases bacteria
class-II:Metallo-beta-
lactamase superfamily
fig|6666666.60966.peg.2342 CDS 2176622 2176197 −2 426 Universal stress protein -none- D23_1c2337 Neut_2130
(Usp)
fig|6666666.60966.peg.2343 CDS 2177459 2176734 −2 726 Membrane protein -none- D23_1c2338 Neut_2131
TerC, possibly involved
in tellurium resistance
fig|6666666.60966.peg.2344 CDS 2178586 2177462 −1 1125 Patatin -none- D23_1c2339 Neut_2132
fig|6666666.60966.peg.2345 CDS 2178900 2179850 3 + 951 Proline iminopeptidase Proline, 4- D23_1c2340 Neut_2133
(EC 3.4.11.5) hydroxyproline uptake
and utilization
fig|6666666.60966.peg.2346 CDS 2180553 2179870 −3 684 Dethiobiotin synthetase Biotin biosynthesis; D23_1c2341 Neut_2134
(EC 6.3.3.3) <br>Biotin biosynthesis
Experimental; <br>Biotin
synthesis cluster
fig|6666666.60966.peg.2347 CDS 2181452 2180556 −2 897 Biotin synthesis protein Biotin biosynthesis; D23_1c2342 Neut_2135
BioC <br>Biotin biosynthesis
Experimental; <br>Biotin
synthesis cluster
fig|6666666.60966.peg.2348 CDS 2182200 2181442 −3 759 Biotin synthesis protein Biotin biosynthesis; D23_1c2343 Neut_2136
BioH <br>Biotin biosynthesis
Experimental; <br>Biotin
synthesis cluster
fig|6666666.60966.peg.2349 CDS 2183365 2182202 −1 1164 8-amino-7- Biotin biosynthesis; D23_1c2344 Neut_2137
oxononanoate synthase <br>Biotin biosynthesis
(EC 2.3.1.47) Experimental; <br>Biotin
synthesis cluster
fig|6666666.60966.peg.2350 CDS 2184393 2183371 −3 1023 Biotin synthase (EC Biotin biosynthesis; D23_1c2345 Neut_2138
2.8.1.6) <br>Biotin biosynthesis
Experimental; <br>Biotin
synthesis cluster
fig|6666666.60966.peg.2351 CDS 2184641 2184453 −2 189 hypothetical protein -none- D23_1c2346 NA
fig|6666666.60966.peg.2352 CDS 2184698 2185168 2 + 471 Competence protein F Biotin biosynthesis D23_1c2347 Neut_2139
homolog, Experimental; <br>Biotin
phosphoribosyltransferase synthesis cluster;
domain; protein <br>CBSS-
YhgH required for 216591.1.peg.168
utilization of DNA as
sole source of carbon
and energy
fig|6666666.60966.peg.2353 CDS 2185222 2185686 1 + 465 tRNA (cytidine(34)- Biotin synthesis cluster; D23_1c2348 Neut_2140
2&#39;-O)- <br>RNA methylation
methyltransferase (EC
2.1.1.207) ## TrmL
fig|6666666.60966.peg.2354 CDS 2185773 2186303 3 + 531 protein of unknown -none- D23_1c2349 Neut_2141
function DUF1130
fig|6666666.60966.peg.2355 CDS 2186489 2187325 2 + 837 SAM-dependent -none- D23_1c2350 Neut_2142
methyltransferase (EC
2.1.1.—)
fig|6666666.60966.peg.2356 CDS 2189013 2187523 −3 1491 Glucose-6-phosphate 1- Pentose phosphate D23_1c2351 Neut_2143
dehydrogenase (EC pathway
1.1.1.49)
fig|6666666.60966.peg.2357 CDS 2189925 2189017 −3 909 6-phosphogluconate D-gluconate and D23_1c2352 Neut_2144
dehydrogenase, ketogluconates
decarboxylating (EC metabolism;
1.1.1.44) <br>Pentose phosphate
pathway
fig|6666666.60966.peg.2358 CDS 2191152 2189995 −3 1158 COGs COG1397 -none- D23_1c2353 Neut_2145
fig|6666666.60966.peg.2359 CDS 2191494 2191195 −3 300 UPF0235 protein CBSS-630.2.peg.3360 D23_1c2354 Neut_2146
VC0458
fig|6666666.60966.peg.2360 CDS 2192054 2191494 −2 561 Integral membrane CBSS-630.2.peg.3360 D23_1c2355 Neut_2147
protein YggT, involved
in response to
extracytoplasmic stress
(osmotic shock)
fig|6666666.60966.peg.2361 CDS 2192939 2192127 −2 813 Pyrroline-5-carboxylate A Hypothetical Protein D23_1c2356 Neut_2148
reductase (EC 1.5.1.2) Related to Proline
Metabolism; <br>CBSS-
630.2.peg.3360;
<br>Proline Synthesis
fig|6666666.60966.peg.2362 CDS 2193210 2193019 −3 192 FIG00859708: -none- D23_1c2357 Neut_2149
hypothetical protein
fig|6666666.60966.peg.2364 CDS 2194302 2194580 3 + 279 Ribonuclease P protein Cell Division Subsystem D23_1c2359 Neut_2152
component (EC including YidCD;
3.1.26.5) <br>RNA modification
cluster; <br>tRNA
processing
fig|6666666.60966.peg.2365 CDS 2194877 2196745 2 + 1869 Inner membrane CTP synthase (EC D23_1c2360 Neut_2154
protein translocase 6.3.4.2) cluster; <br>Cell
component YidC, long Division Subsystem
form including YidCD;
<br>RNA modification
cluster
fig|6666666.60966.peg.2366 CDS 2196792 2198171 3 + 1380 GTPase and tRNA-U34 Cell Division Subsystem D23_1c2361 Neut_2155
5-formylation enzyme including YidCD;
TrmE <br>RNA modification
and chromosome
partitioning cluster;
<br>RNA modification
cluster; <br>Universal
GTPases; <br>mnm5U34
biosynthesis bacteria;
<br>tRNA modification
Bacteria
fig|6666666.60966.peg.2367 CDS 2198398 2198667 1 + 270 SSU ribosomal protein -none- D23_1c2363 Neut_2156
S15p (S13e)
fig|6666666.60966.peg.2368 CDS 2198846 2200963 2 + 2118 Polyribonucleotide Bacterial RNA- D23_1c2364 Neut_2157
nucleotidyltransferase metabolizing Zn-
(EC 2.7.7.8) dependent hydrolases;
<br>Polyadenylation
bacterial
fig|6666666.60966.peg.2369 CDS 2201167 2201039 −1 129 hypothetical protein -none- D23_1c2365 NA
fig|6666666.60966.peg.2371 CDS 2201553 2202926 3 + 1374 RND efflux system, Multidrug Resistance D23_1c2367 Neut_2158
outer membrane Efflux Pumps
lipoprotein CmeC
fig|6666666.60966.peg.2372 CDS 2203015 2204220 1 + 1206 Membrane fusion Multidrug Resistance D23_1c2368 Neut_2159
protein of RND family Efflux Pumps
multidrug efflux pump
fig|6666666.60966.peg.2373 CDS 2204238 2207432 3 + 3195 RND efflux system, Multidrug Resistance D23_1c2369 Neut_2160
inner membrane Efflux Pumps
transporter CmeB
fig|6666666.60966.peg.2375 CDS 2208043 2207702 −1 342 hypothetical protein -none- D23_1c2370 Neut_2161
fig|6666666.60966.peg.2376 CDS 2208812 2208072 −2 741 conserved hypothetical -none- D23_1c2371 Neut_2162
protein [Pyrococcus
horikoshii]; COG2102:
Predicted ATPases of
PP-loop superfamily;
IPR002761: Domain of
unknown function
DUF71
fig|6666666.60966.peg.2377 CDS 2209043 2208924 −2 120 FIG00859479: -none- D23_1c2372 Neut_2163
hypothetical protein
fig|6666666.60966.peg.2379 CDS 2210878 2209472 −1 1407 GTP-binding protein CBSS- D23_1c2374 Neut_2164
EngA 290633.1.peg.1906;
<br>CBSS-
498211.3.peg.1415;
<br>Universal GTPases
fig|6666666.60966.peg.2380 CDS 2212159 2210930 −1 1230 Outer membrane CBSS- D23_1c2375 Neut_2165
protein YfgL, lipoprotein 290633.1.peg.1906;
component of the <br>CBSS-
protein assembly 498211.3.peg.1415;
complex (forms a <br>Lipopolysaccharide
complex with YaeT, assembly
YfiO, and NlpB)
fig|6666666.60966.peg.2381 CDS 2212800 2212162 −3 639 Mlr7403 protein CBSS- D23_1c2376 Neut_2166
290633.1.peg.1906;
<br>CBSS-
498211.3.peg.1415
fig|6666666.60966.peg.2382 CDS 2214088 2212823 −1 1266 Histidyl-tRNA CBSS- D23_1c2377 Neut_2167
synthetase (EC 6.1.1.21) 498211.3.peg.1415;
<br>tRNA
aminoacylation, His
fig|6666666.60966.peg.2383 CDS 2215286 2214081 −2 1206 1-hydroxy-2-methyl-2- CBSS- D23_1c2378 Neut_2168
(E)-butenyl 4- 498211.3.peg.1415;
diphosphate synthase <br>CBSS-
(EC 1.17.7.1) 83331.1.peg.3039;
<br>Isoprenoid
Biosynthesis;
<br>Nonmevalonate
Branch of Isoprenoid
Biosynthesis
fig|6666666.60966.peg.2384 CDS 2216438 2215359 −2 1080 FIG021952: putative CBSS-498211.3.peg.1415 D23_1c2379 Neut_2169
membrane protein
fig|6666666.60966.peg.2385 CDS 2217306 2216428 −3 879 Type IV pilus biogenesis CBSS-498211.3.peg.1415 D23_1c2380 Neut_2170
protein PilF
fig|6666666.60966.peg.2386 CDS 2218414 2217275 −1 1140 Ribosomal RNA large CBSS- D23_1c2381 Neut_2171
subunit 498211.3.peg.1415;
methyltransferase N (EC <br>RNA methylation
2.1.1.—)
fig|6666666.60966.peg.2387 CDS 2218877 2218452 −2 426 Nucleoside diphosphate CBSS- D23_1c2382 Neut_2172
kinase (EC 2.7.4.6) 498211.3.peg.1415;
<br>Purine conversions;
<br>pyrimidine
conversions
fig|6666666.60966.peg.2389 CDS 2219591 2219175 −2 417 Chain A, Red Copper -none- D23_1c2383 Neut_2173
Protein Nitrosocyanin
fig|6666666.60966.peg.2390 CDS 2220042 2221430 3 + 1389 Aminotransferase Hopanes D23_1c2384 Neut_2174
HpnO, required for
aminobacteriohopanetriol
fig|6666666.60966.peg.2391 CDS 2222146 2221442 −1 705 DNA polymerase III CBSS-228410.1.peg.134; D23_1c2385 Neut_2175
epsilon subunit (EC <br>CBSS-
2.7.7.7) 342610.3.peg.1536
fig|6666666.60966.peg.2392 CDS 2222646 2222158 −3 489 Ribonuclease HI (EC CBSS-228410.1.peg.134; D23_1c2386 Neut_2176
3.1.26.4) <br>CBSS-
342610.3.peg.1536;
<br>Ribonuclease H
fig|6666666.60966.peg.2393 CDS 2223440 2222706 −2 735 FIG005121: SAM- CBSS-228410.1.peg.134; D23_1c2387 Neut_2177
dependent <br>CBSS-
methyltransferase (EC 342610.3.peg.1536;
2.1.1.—) <br>Glutathione: Non-
redox reactions
fig|6666666.60966.peg.2394 CDS 2223500 2224267 2 + 768 Hydroxyacylglutathione CBSS-228410.1.peg.134; D23_1c2388 Neut_2178
hydrolase (EC 3.1.2.6) <br>CBSS-
342610.3.peg.1536;
<br>Glutathione: Non-
redox reactions;
<br>Methylglyoxal
Metabolism
fig|6666666.60966.peg.2396 CDS 2225143 2224571 −1 573 hypothetical protein -none- D23_1c2389 Neut_2179
fig|6666666.60966.peg.2397 CDS 2225287 2225162 −1 126 hypothetical protein -none- D23_1c2390 NA
fig|6666666.60966.peg.2398 CDS 2226167 2225250 −2 918 hypothetical protein -none- D23_1c2391 Neut_2180
fig|6666666.60966.peg.2399 CDS 2228864 2226171 −2 2694 Helicase, SNF2/RAD54 -none- D23_1c2392 Neut_2181
family
fig|6666666.60966.peg.2401 CDS 2229650 2229480 −2 171 hypothetical protein -none- D23_1c2393 NA
fig|6666666.60966.peg.2402 CDS 2229693 2230814 3 + 1122 Oxidoreductase, FMN- -none- D23_1c2394 Neut_2182
binding
fig|6666666.60966.peg.2403 CDS 2230925 2231368 2 + 444 Ornithine Arginine and Ornithine D23_1c2395 Neut_2183
cyclodeaminase (EC Degradation
4.3.1.12)
fig|6666666.60966.peg.2404 CDS 2231434 2233005 1 + 1572 Phosphoglucomutase -none- D23_1c2396 Neut_2184
(EC 5.4.2.2)
fig|6666666.60966.peg.2405 CDS 2233192 2233344 1 + 153 hypothetical protein -none- D23_1c2397 NA
fig|6666666.60966.peg.2406 CDS 2234195 2233347 −2 849 Mobile element protein -none- D23_1c2398 Neut_1888
fig|6666666.60966.peg.2407 CDS 2234437 2234252 −1 186 Mobile element protein -none- D23_1c2399 Neut_2500
fig|6666666.60966.peg.2408 CDS 2234636 2235049 2 + 414 Cobalt-zinc-cadmium Cobalt-zinc-cadmium D23_1c2400 Neut_2185
resistance protein resistance
fig|6666666.60966.peg.2409 CDS 2235949 2235359 −1 591 Hydroxyacylglutathione CBSS-228410.1.peg.134; D23_1c2401 Neut_2178
hydrolase (EC 3.1.2.6) <br>CBSS-
342610.3.peg.1536;
<br>Glutathione: Non-
redox reactions;
<br>Methylglyoxal
Metabolism
fig|6666666.60966.peg.2410 CDS 2236135 2236287 1 + 153 hypothetical protein -none- D23_1c2403 Neut_1255
fig|6666666.60966.peg.2411 CDS 2236295 2236462 2 + 168 hypothetical protein -none- D23_1c2404 Neut_2449
fig|6666666.60966.peg.2412 CDS 2236616 2236419 −2 198 Mobile element protein -none- D23_1c2405 Neut_2268
fig|6666666.60966.peg.2414 CDS 2236758 2237006 3 + 249 Mobile element protein -none- D23_1c2406 Neut_1756
fig|6666666.60966.peg.2417 CDS 2240037 2237515 −3 2523 Aconitate hydratase (EC TCA Cycle D23_1c2409 Neut_2457
4.2.1.3)
fig|6666666.60966.peg.2418 CDS 2240239 2240093 −1 147 Aconitate hydratase (EC TCA Cycle D23_1c2410 NA
4.2.1.3)
fig|6666666.60966.peg.2419 CDS 2240661 2241623 3 + 963 Mobile element protein -none- D23_1c2411 Neut_1278
fig|6666666.60966.peg.2421 CDS 2241835 2241987 1 + 153 Mobile element protein -none- D23_1c2413 NA
fig|6666666.60966.peg.2422 CDS 2242232 2242522 2 + 291 hypothetical protein -none- D23_1c2414 NA
fig|6666666.60966.peg.2423 CDS 2242506 2243450 3 + 945 Agmatinase (EC Arginine and Ornithine D23_1c2415 Neut_2187
3.5.3.11) Degradation;
<br>Polyamine
Metabolism
fig|6666666.60966.peg.2424 CDS 2243462 2245420 2 + 1959 Biosynthetic arginine Arginine and Ornithine D23_1c2416 Neut_2188
decarboxylase (EC Degradation;
4.1.1.19) <br>Polyamine
Metabolism
fig|6666666.60966.peg.2425 CDS 2246086 2245436 −1 651 Mobile element protein -none- D23_1c2417 Neut_2189
fig|6666666.60966.peg.2426 CDS 2247251 2246148 −2 1104 hypothetical protein -none- D23_1c2418 Neut_2191
fig|6666666.60966.peg.2427 CDS 2247251 2247436 2 + 186 Mobile element protein -none- D23_1c2419 Neut_2500
fig|6666666.60966.peg.2428 CDS 2247493 2248341 1 + 849 Mobile element protein -none- D23_1c2420 Neut_1375
fig|6666666.60966.peg.2430 CDS 2249188 2249352 1 + 165 Mobile element protein -none- D23_1c2422 Neut_2186
fig|6666666.60966.peg.2431 CDS 2249749 2251734 1 + 1986 Protein-L-isoaspartate Protein-L-isoaspartate O- D23_1c2423 Neut_2323
O-methyltransferase methyltransferase;
(EC 2.1.1.77) <br>Stationary phase
repair cluster; <br>Ton
and Tol transport
systems
fig|6666666.60966.peg.2432 CDS 2252354 2253127 2 + 774 hypothetical protein -none- D23_1c2424 Neut_2196
fig|6666666.60966.peg.2433 CDS 2253955 2253515 −1 441 tRNA pseudouridine Colicin V and Bacteriocin D23_1c2425 Neut_2203
synthase A (EC 4.2.1.70) Production Cluster;
<br>RNA pseudouridine
syntheses; <br>tRNA
modification Bacteria;
<br>tRNA processing
fig|6666666.60966.peg.2434 CDS 2254408 2254247 −1 162 hypothetical protein -none- D23_1c2426 NA
fig|6666666.60966.peg.2435 CDS 2256251 2254536 −2 1716 Selenoprotein O and Selenoprotein O D23_1c2427 Neut_2204
cysteine-containing
homologs
fig|6666666.60966.peg.2436 CDS 2256898 2257503 1 + 606 GCN5-related N- -none- D23_1c2429 Neut_2208
acetyltransferase
fig|6666666.60966.peg.2437 CDS 2258004 2257552 −3 453 probable multiple -none- D23_1c2430 Neut_2211
antibiotic resistance
protein marC
fig|6666666.60966.peg.2438 CDS 2258357 2258229 −2 129 hypothetical protein -none- D23_1c2431 Neut_2212
fig|6666666.60966.peg.2440 CDS 2259106 2259264 1 + 159 hypothetical protein -none- D23_1c2432 NA
fig|6666666.60966.peg.2441 CDS 2259280 2260221 1 + 942 Ornithine Arginine and Ornithine D23_1c2433 Neut_2213
cyclodeaminase (EC Degradation
4.3.1.12)
fig|6666666.60966.peg.2442 CDS 2260562 2261791 2 + 1230 hypothetical protein -none- D23_1c2434 Neut_2214
fig|6666666.60966.peg.2443 CDS 2262110 2262748 2 + 639 hypothetical protein -none- D23_1c2435 Neut_2232
fig|6666666.60966.peg.2444 CDS 2262936 2263406 3 + 471 FIG00858867: -none- D23_1c2436 Neut_2233
hypothetical protein
fig|6666666.60966.peg.2446 CDS 2264766 2263630 −3 1137 N-succinyl-L,L- Arginine Biosynthesis-- D23_1c2437 Neut_2234
diaminopimelate gjo; <br>Arginine
desuccinylase (EC Biosynthesis extended;
3.5.1.18) <br>Lysine Biosynthesis
DAP Pathway, GJO
scratch
fig|6666666.60966.peg.2447 CDS 2265597 2264815 −3 783 Methionine ABC Methionine D23_1c2438 Neut_2235
transporter ATP-binding Biosynthesis;
protein <br>Methionine
Degradation
fig|6666666.60966.peg.2448 CDS 2266742 2265597 −2 1146 ABC-type transport -none- D23_1c2439 Neut_2236
system involved in
resistance to organic
solvents, permease
component USSDB6A
fig|6666666.60966.peg.2449 CDS 2267603 2266767 −2 837 Prolipoprotein Lipoprotein Biosynthesis D23_1c2440 Neut_2237
diacylglyceryl
transferase (EC 2.4.99.—)
fig|6666666.60966.peg.2450 CDS 2267740 2269413 1 + 1674 Dihydroxy-acid Branched-Chain Amino D23_1c2441 Neut_2238
dehydratase (EC Acid Biosynthesis
4.2.1.9)
fig|6666666.60966.peg.2451 CDS 2269430 2271499 2 + 2070 Thymidylate kinase (EC pyrimidine conversions D23_1c2442 Neut_2241
2.7.4.9)
fig|6666666.60966.peg.2452 CDS 2271523 2271834 1 + 312 Cytochrome c551/c552 Soluble cytochromes D23_1c2443 Neut_2242
and functionally related
electron carriers
fig|6666666.60966.peg.2454 CDS 2272004 2272972 2 + 969 D-3-phosphoglycerate Glycine and Serine D23_1c2444 Neut_2243
dehydrogenase (EC Utilization;
1.1.1.95) <br>Pyridoxin (Vitamin
B6) Biosynthesis;
<br>Serine Biosynthesis
fig|6666666.60966.peg.2455 CDS 2273050 2273595 1 + 546 dTDP-4- Rhamnose containing D23_1c2445 Neut_2244
dehydrorhamnose 3,5- glycans; <br>dTDP-
epimerase (EC 5.1.3.13) rhamnose synthesis
fig|6666666.60966.peg.2456 CDS 2273700 2274983 3 + 1284 Permeases of the major -none- D23_1c2446 Neut_2245
facilitator superfamily
fig|6666666.60966.peg.2457 CDS 2275758 2274997 −3 762 hypothetical protein -none- D23_1c2447 NA
fig|6666666.60966.peg.2458 CDS 2275968 2276633 3 + 666 Chromosomal Cell Division Subsystem D23_1c2449 Neut_2247
replication initiator including YidCD;
protein DnaA <br>DNA replication
cluster 1
fig|6666666.60966.peg.2459 CDS 2276770 2277435 1 + 666 Phosphoserine Glycine and Serine D23_1c2450 Neut_2248
phosphatase (EC Utilization; <br>Serine
3.1.3.3) Biosynthesis; <br>Serine
Biosynthesis
fig|6666666.60966.peg.2460 CDS 2277481 2277846 1 + 366 FIG00859424: -none- D23_1c2451 Neut_2249
hypothetical protein
fig|6666666.60966.peg.2461 CDS 2277800 2277958 2 + 159 hypothetical protein -none- D23_1c2452 NA
fig|6666666.60966.peg.2462 CDS 2277971 2279434 2 + 1464 Inosine-5&#39;- Purine conversions; D23_1c2453 Neut_2250
monophosphate <br>Purine salvage
dehydrogenase (EC cluster
1.1.1.205)
fig|6666666.60966.peg.2463 CDS 2279447 2281006 2 + 1560 GMP synthase GMP synthase; <br>GMP D23_1c2454 Neut_2251
[glutamine- synthase; <br>Purine
hydrolyzing], conversions; <br>Purine
amidotransferase conversions; <br>Purine
subunit (EC 6.3.5.2)/ salvage cluster;
GMP synthase <br>Purine salvage
[glutamine- cluster
hydrolyzing], ATP
pyrophosphatase
subunit (EC 6.3.5.2)
fig|6666666.60966.peg.2465 CDS 2282716 2281352 −1 1365 hypothetical protein -none- D23_1c2455 NA
fig|6666666.60966.peg.2466 CDS 2282899 2282762 −1 138 Mobile element protein -none- D23_1c2456 Neut_2501
fig|6666666.60966.peg.2467 CDS 2283609 2282872 −3 738 Mobile element protein -none- D23_1c2457 Neut_1888
fig|6666666.60966.peg.2468 CDS 2283851 2283666 −2 186 Mobile element protein -none- D23_1c2458 Neut_2500
fig|6666666.60966.peg.2469 CDS 2285015 2284020 −2 996 hypothetical protein -none- D23_1c2459 NA
fig|6666666.60966.peg.2470 CDS 2285305 2285048 −1 258 hypothetical protein -none- D23_1c2460 NA
fig|6666666.60966.peg.2471 CDS 2285448 2285573 3 + 126 hypothetical protein -none- D23_1c2461 NA
fig|6666666.60966.peg.2472 CDS 2285631 2286293 3 + 663 Thiopurine S- -none- D23_1c2462 Neut_2272
methyltransferase (EC
2.1.1.67)
fig|6666666.60966.peg.2473 CDS 2286615 2288795 3 + 2181 hypothetical protein -none- D23_1c2463 Neut_2273
fig|6666666.60966.peg.2474 CDS 2289016 2291046 1 + 2031 oligopeptide -none- D23_1c2464 Neut_2274
transporter
fig|6666666.60966.peg.2475 CDS 2291342 2291145 −2 198 FIG00859558: -none- D23_1c2465 Neut_2275
hypothetical protein
fig|6666666.60966.peg.2476 CDS 2291757 2291362 −3 396 FIG00859558: -none- D23_1c2466 Neut_2275
hypothetical protein
fig|6666666.60966.peg.2477 CDS 2292959 2291901 −2 1059 Putative permease -none- D23_1c2467 Neut_2276
often clustered with de
novo purine synthesis
fig|6666666.60966.peg.2478 CDS 2293039 2294097 1 + 1059 Phosphoribosylformylglycinamidine De Novo Purine D23_1c2468 Neut_2277
cyclo-ligase Biosynthesis
(EC 6.3.3.1)
fig|6666666.60966.peg.2479 CDS 2294109 2294741 3 + 633 Phosphoribosylglycinamide 5-FCL-like protein; D23_1c2469 Neut_2278
formyltransferase <br>De Novo Purine
(EC 2.1.2.2) Biosynthesis
fig|6666666.60966.peg.2480 CDS 2294738 2295460 2 + 723 FIG00859545: -none- D23_1c2470 Neut_2279
hypothetical protein
fig|6666666.60966.peg.2481 CDS 2295477 2296751 3 + 1275 Fmu (Sun)/eukaryotic -none- D23_1c2471 Neut_2280
nucleolar NOL1/Nop2p;
tRNAand rRNA
cytosine-C5-methylases
fig|6666666.60966.peg.2482 CDS 2297068 2296832 −1 237 hypothetical protein -none- D23_1c2472 Neut_2281
PA0941
fig|6666666.60966.peg.2483 CDS 2297785 2297237 −1 549 InterPro -none- D23_1c2473 Neut_2282
IPR000694:IPR001734
fig|6666666.60966.peg.2484 CDS 2297997 2297800 −3 198 hypothetical protein -none- D23_1c2474 Neut_2283
fig|6666666.60966.peg.2485 CDS 2298574 2299293 1 + 720 possible -none- D23_1c2475 Neut_2284
transmembrane protein
fig|6666666.60966.peg.2486 CDS 2299389 2301113 3 + 1725 Diguanylate -none- D23_1c2476 Neut_2285
cyclase/phosphodiesterase
domain 2 (EAL)
fig|6666666.60966.peg.2488 CDS 2301326 2301784 2 + 459 FKBP-type peptidyl- -none- D23_1c2477 Neut_2286
prolyl cis-trans
isomerase
fig|6666666.60966.peg.2489 CDS 2302743 2301856 −3 888 Ribosome small Universal GTPases D23_1c2478 Neut_2287
subunit-stimulated
GTPase EngC
fig|6666666.60966.peg.2490 CDS 2303060 2302782 −2 279 Pterin-4-alpha- Pterin carbinolamine D23_1c2479 Neut_2288
carbinolamine dehydratase
dehydratase (EC
4.2.1.96)
fig|6666666.60966.peg.2491 CDS 2304388 2303120 −1 1269 macromolecule -none- D23_1c2480 Neut_2289
metabolism;
macromolecule
degradation;
degradation of proteins,
peptides, glycopeptides
fig|6666666.60966.peg.2492 CDS 2304540 2305085 3 + 546 3&#39;-to-5&#39; RNA processing and D23_1c2481 Neut_2290
oligoribonuclease (orn) degradation, bacterial
fig|6666666.60966.peg.2493 CDS 2305123 2307678 1 + 2556 Glycogen Glycogen metabolism D23_1c2482 Neut_2291
phosphorylase (EC
2.4.1.1)
fig|6666666.60966.peg.2494 CDS 2308460 2307702 −2 759 Pantoate--beta-alanine Coenzyme A D23_1c2483 Neut_2292
ligase (EC 6.3.2.1) Biosynthesis;
<br>Coenzyme A
Biosynthesis cluster
fig|6666666.60966.peg.2495 CDS 2309368 2308559 −1 810 3-methyl-2- Coenzyme A D23_1c2484 Neut_2293
oxobutanoate Biosynthesis;
hydroxymethyltransferase <br>Coenzyme A
(EC 2.1.2.11) Biosynthesis cluster
fig|6666666.60966.peg.2496 CDS 2310016 2309372 −1 645 Deoxyadenosine kinase Purine conversions; D23_1c2485 Neut_2294
(EC 2.7.1.76)/ <br>Purine conversions
Deoxyguanosine kinase
(EC 2.7.1.113)
fig|6666666.60966.peg.2497 CDS 2310525 2310013 −3 513 2-amino-4-hydroxy-6- Folate Biosynthesis D23_1c2486 Neut_2295
hydroxymethyldihydropteridine
pyrophosphokinase (EC
2.7.6.3)
fig|6666666.60966.peg.2498 CDS 2311910 2310522 −2 1389 Poly(A) polymerase (EC Polyadenylation D23_1c2487 Neut_2296
2.7.7.19) bacterial
fig|6666666.60966.peg.2499 CDS 2313230 2312073 −2 1158 Cardiolipin synthetase Cardiolipin synthesis; D23_1c2488 Neut_2297
(EC 2.7.8.—) <br>Glycerolipid and
Glycerophospholipid
Metabolism in Bacteria
fig|6666666.60966.peg.2500 CDS 2314054 2313227 −1 828 Endonuclease/exonuclease/ -none- D23_1c2489 Neut_2298
phosphatase family
protein
fig|6666666.60966.peg.2501 CDS 2315160 2314060 −3 1101 Quinolinate synthetase Mycobacterium D23_1c2490 Neut_2299
(EC 2.5.1.72) virulence operon
possibly involved in
quinolinate biosynthesis;
<br>NAD and NADP
cofactor biosynthesis
global
fig|6666666.60966.peg.2502 CDS 2315495 2316031 2 + 537 FIG00859627: -none- D23_1c2491 Neut_2300
hypothetical protein
fig|6666666.60966.peg.2503 CDS 2316137 2316652 2 + 516 LptA, protein essential Lipopolysaccharide D23_1c2492 Neut_2301
for LPS transport across assembly
the periplasm
fig|6666666.60966.peg.2504 CDS 2316704 2317426 2 + 723 Lipopolysaccharide ABC Lipopolysaccharide D23_1c2493 Neut_2302
transporter, ATP- assembly
binding protein LptB
fig|6666666.60966.peg.2505 CDS 2317432 2318895 1 + 1464 RNA polymerase sigma- Flagellar motility; D23_1c2494 Neut_2303
54 factor RpoN <br>Flagellum;
<br>Transcription
initiation, bacterial
sigma factors
fig|6666666.60966.peg.2506 CDS 2319070 2319405 1 + 336 Ribosome hibernation Ribosome activity D23_1c2495 Neut_2304
protein YhbH modulation
fig|6666666.60966.peg.2507 CDS 2319646 2320116 1 + 471 PTS system nitrogen- -none- D23_1c2496 Neut_2305
specific IIA component,
PtsN
fig|6666666.60966.peg.2508 CDS 2320103 2321074 2 + 972 HPr HPr catabolite D23_1c2497 Neut_2306
kinase/phosphorylase repression system
(EC 2.7.1.—) (EC 2.7.4.—)
fig|6666666.60966.peg.2509 CDS 2321107 2321223 1 + 117 hypothetical protein -none- D23_1c2498 NA
fig|6666666.60966.peg.2510 CDS 2321260 2321874 1 + 615 3-polyprenyl-4- Ubiquinone D23_1c2499 Neut_2307
hydroxybenzoate Biosynthesis;
carboxy-lyase UbiX (EC <br>Ubiquinone
4.1.1.—) Biosynthesis-gjo
fig|6666666.60966.peg.2511 CDS 2322562 2321924 −1 639 5- 5-FCL-like protein; D23_1c2500 Neut_2308
formyltetrahydrofolate <br>Folate Biosynthesis;
cyclo-ligase (EC 6.3.3.2) <br>One-carbon
metabolism by
tetrahydropterines
fig|6666666.60966.peg.2512 CDS 2323682 2322555 −2 1128 A/G-specific adenine DNA repair, bacterial D23_1c2501 Neut_2309
glycosylase (EC 3.2.2.—)
fig|6666666.60966.peg.2513 CDS 2324249 2323704 −2 546 Intracellular septation CBSS-211586.9.peg.2729 D23_1c2503 Neut_2310
protein IspA
fig|6666666.60966.peg.2514 CDS 2326043 2324346 −2 1698 Lipid A export ATP- KDO2-Lipid A D23_1c2504 Neut_2311
binding/permease biosynthesis cluster 2
protein MsbA (EC
3.6.3.25)
fig|6666666.60966.peg.2515 CDS 2327134 2326562 −1 573 hypothetical protein -none- D23_1c2505 Neut_2312
fig|6666666.60966.peg.2516 CDS 2329375 2327231 −1 2145 Copper resistance Copper homeostasis D23_1c2506 Neut_2313
protein D
fig|6666666.60966.peg.2517 CDS 2329755 2329381 −3 375 Copper resistance -none- D23_1c2507 Neut_2314
protein CopC precursor
fig|6666666.60966.peg.2518 CDS 2330496 2329909 −3 588 hypothetical protein -none- D23_1c2508 Neut_2074
fig|6666666.60966.peg.2519 CDS 2331308 2330568 −2 741 putative (U92432) ORF4 -none- D23_1c2509 Neut_2316
(Nitrosospira sp. NpAV)
fig|6666666.60966.peg.2520 CDS 2332640 2331375 −2 1266 Particulate methane Particulate methane D23_1c2510 Neut_2317
monooxygenase B- monooxygenase
subunit (EC 1.14.13.25) (pMMO)
fig|6666666.60966.peg.2521 CDS 2333470 2332640 −1 831 Particulate methane Particulate methane D23_1c2511 Neut_2318
monooxygenase A- monooxygenase
subunit (EC 1.14.13.25) (pMMO)
fig|6666666.60966.peg.2522 CDS 2334459 2333644 −3 816 Particulate methane Particulate methane D23_1c2512 Neut_2319
monooxygenase C- monooxygenase
subunit (EC 1.14.13.25) (pMMO)
fig|6666666.60966.peg.2523 CDS 2334883 2335908 1 + 1026 TsaC protein (YrdC-Sua5 -none- D23_1c2513 Neut_2320
domains) required for
threonylcarbamoyladenosine
t(6)A37
modification in tRNA
fig|6666666.60966.peg.2524 CDS 2335923 2336666 3 + 744 Hypothetical protein -none- D23_1c2514 Neut_2321
CbbY
fig|6666666.60966.peg.2525 CDS 2337688 2336702 −1 987 Lipoprotein NlpD Stationary phase repair D23_1c2515 Neut_2322
cluster
fig|6666666.60966.peg.2526 CDS 2338471 2337803 −1 669 Protein-L-isoaspartate Protein-L-isoaspartate O- D23_1c2516 Neut_2323
O-methyltransferase methyltransferase;
(EC 2.1.1.77) <br>Stationary phase
repair cluster; <br>Ton
and Tol transport
systems
fig|6666666.60966.peg.2528 CDS 2339405 2338662 −2 744 5-nucleotidase SurE (EC Housecleaning D23_1c2517 Neut_2324
3.1.3.5) @ nucleoside triphosphate
Exopolyphosphatase pyrophosphatases;
(EC 3.6.1.11) <br>Phosphate
metabolism;
<br>Polyphosphate;
<br>Stationary phase
repair cluster
fig|6666666.60966.peg.2529 CDS 2340272 2339964 −2 309 Integration host factor DNA structural proteins, D23_1c2519 Neut_2325
alpha subunit bacterial
fig|6666666.60966.peg.2530 CDS 2342785 2340485 −1 2301 Phenylalanyl-tRNA tRNA aminoacylation, D23_1c2520 Neut_2326
synthetase beta chain Phe
(EC 6.1.1.20)
fig|6666666.60966.peg.2531 CDS 2343901 2342882 −1 1020 Phenylalanyl-tRNA tRNA aminoacylation, D23_1c2521 Neut_2327
synthetase alpha chain Phe
(EC 6.1.1.20)
fig|6666666.60966.peg.2532 CDS 2344231 2343989 −1 243 LSU ribosomal protein -none- D23_1c2522 Neut_2328
L20p
fig|6666666.60966.peg.2533 CDS 2345202 2344723 −3 480 Translation initiation Translation initiation D23_1c2524 Neut_2330
factor 3 factors bacterial
fig|6666666.60966.peg.2534 CDS 2347209 2345302 −3 1908 Threonyl-tRNA tRNA aminoacylation, D23_1c2525 Neut_2331
synthetase (EC 6.1.1.3) Thr
fig|6666666.60966.peg.2535 CDS 2348256 2347537 −3 720 Cytochrome c-type -none- D23_1c2526 Neut_1790
protein TorY
fig|6666666.60966.peg.2536 CDS 2348966 2348259 −2 708 Cytochrome c family -none- D23_1c2527 Neut_2333
protein
fig|6666666.60966.peg.2537 CDS 2350169 2349048 −2 1122 FIG00859557: -none- D23_1c2528 Neut_1792
hypothetical protein
fig|6666666.60966.peg.2538 CDS 2351878 2350166 −1 1713 Hydroxylamine -none- D23_1c2529 Neut_2335
oxidoreductase
precursor (EC 1.7.3.4)
fig|6666666.60966.peg.2539 CDS 2352170 2353255 2 + 1086 tRNA-specific 2- RNA methylation D23_1c2530 Neut_2336
thiouridylase MnmA
fig|6666666.60966.peg.2540 CDS 2354395 2353256 −1 1140 Twitching motility -none- D23_1c2531 Neut_2337
protein PilT
fig|6666666.60966.peg.2541 CDS 2355448 2354405 −1 1044 Twitching motility -none- D23_1c2532 Neut_2338
protein PilT
fig|6666666.60966.peg.2543 CDS 2355643 2356359 1 + 717 Hypothetical protein A Hypothetical Protein D23_1c2533 Neut_2339
YggS, proline synthase Related to Proline
co-transcribed bacterial Metabolism; <br>CBSS-
homolog PROSC 630.2.peg.3360
fig|6666666.60966.peg.2544 CDS 2356597 2356328 −1 270 4Fe—4S ferredoxin, iron- Inorganic Sulfur D23_1c2534 Neut_2340
sulfur binding Assimilation
fig|6666666.60966.peg.2545 CDS 2357097 2356603 −3 495 Phosphopantetheine CBSS- D23_1c2535 Neut_2341
adenylyltransferase (EC 266117.6.peg.1260;
2.7.7.3) <br>CBSS-269801.1.peg.1715;
<br>Coenzyme A
Biosynthesis
fig|6666666.60966.peg.2546 CDS 2357644 2357090 −1 555 16S rRNA CBSS- D23_1c2536 Neut_2342
(guanine(966)-N(2))- 266117.6.peg.1260;
methyltransferase (EC <br>CBSS-
2.1.1.171) ## SSU rRNA 269801.1.peg.1715;
m(2)G966 <br>Heat shock Cell
division Proteases and a
Methyltransferase;
<br>RNA methylation
fig|6666666.60966.peg.2547 CDS 2358960 2357659 −3 1302 FIG015287: Zinc Heat shock Cell division D23_1c2537 Neut_2343
protease Proteases and a
Methyltransferase
fig|6666666.60966.peg.2548 CDS 2359437 2359126 −3 312 Transposase -none- D23_1c2538 Neut_2344
fig|6666666.60966.peg.2549 CDS 2360187 2359819 −3 369 Mobile element protein -none- D23_1c2539 Neut_1814
fig|6666666.60966.peg.2550 CDS 2360570 2360247 −2 324 Putative periplasmic -none- D23_1c2540 Neut_2357
protein
fig|6666666.60966.peg.2551 CDS 2361073 2360771 −1 303 hypothetical protein -none- D23_1c2541 Neut_2349
fig|6666666.60966.peg.2552 CDS 2361307 2361110 −1 198 CsbD family protein -none- D23_1c2542 Neut_2359
fig|6666666.60966.peg.2553 CDS 2361551 2361384 −2 168 protein of unknown -none- D23_1c2543 NA
function DUF1328
fig|6666666.60966.peg.2554 CDS 2361863 2362066 2 + 204 Mobile element protein -none- D23_1c2544 Neut_2365
fig|6666666.60966.peg.2555 CDS 2362071 2362247 3 + 177 hypothetical protein -none- D23_1c2545 NA
fig|6666666.60966.peg.2556 CDS 2362394 2362957 2 + 564 Alkyl hydroperoxide Thioredoxin-disulfide D23_1c2546 Neut_2366
reductase protein C (EC reductase
1.6.4.—)
fig|6666666.60966.peg.2557 CDS 2363052 2363633 3 + 582 putative lipoprotein -none- D23_1c2547 Neut_2367
fig|6666666.60966.peg.2558 CDS 2364440 2363661 −2 780 Putative -none- D23_1c2548 Neut_2368
stomatin/prohibitin-
family membrane
protease subunit
aq_911
fig|6666666.60966.peg.2559 CDS 2365869 2364442 −3 1428 Putative membrane- -none- D23_1c2549 Neut_2369
bound ClpP-class
protease associated
with aq_911
fig|6666666.60966.peg.2560 CDS 2366482 2365880 −1 603 ADP-ribose CBSS-216591.1.peg.168; D23_1c2550 Neut_2370
pyrophosphatase (EC <br>NADand NADP
3.6.1.13) cofactor biosynthesis
global; <br>Nudix
proteins (nucleoside
triphosphate hydrolases)
fig|6666666.60966.peg.2561 CDS 2367579 2366665 −3 915 putative membrane -none- D23_1c2551 Neut_2371
protein
fig|6666666.60966.peg.2562 CDS 2367673 2368539 1 + 867 Protein YicC CBSS-323097.3.peg.2594 D23_1c2552 Neut_2372
fig|6666666.60966.peg.2563 CDS 2369652 2368633 −3 1020 C4-dicarboxylate -none- D23_1c2553 Neut_2373
transporter/malic acid
transport protein
fig|6666666.60966.peg.2564 CDS 2371015 2370053 −1 963 Mobile element protein -none- D23_1c2554 Neut_1746
fig|6666666.60966.peg.2565 CDS 2371724 2371065 −2 660 Glucose-1-phosphate Rhamnose containing D23_1c2555 Neut_2374
thymidylyltransferase glycans; <br>dTDP-
(EC 2.7.7.24) rhamnose synthesis
fig|6666666.60966.peg.2566 CDS 2372737 2371739 −1 999 COG3178: Predicted -none- D23_1c2556 Neut_2375
phosphotransferase
related to Ser/Thr
protein kinases
fig|6666666.60966.peg.2567 CDS 2372902 2373210 1 + 309 Putative cytoplasmic -none- D23_1c2557 Neut_2376
protein
fig|6666666.60966.peg.2568 CDS 2373276 2374775 3 + 1500 MG(2+) CHELATASE -none- D23_1c2559 Neut_2377
FAMILY PROTEIN/
ComM-related protein
fig|6666666.60966.peg.2569 CDS 2376191 2374794 −2 1398 Replicative DNA -none- D23_1c2560 Neut_2378
helicase (EC 3.6.1.—)
fig|6666666.60966.peg.2571 CDS 2376752 2376297 −2 456 LSU ribosomal protein Primosomal replication D23_1c2561 Neut_2379
L9p protein N clusters with
ribosomal proteins
fig|6666666.60966.peg.2572 CDS 2377049 2376771 −2 279 SSU ribosomal protein Primosomal replication D23_1c2562 Neut_2380
S18p @ SSU ribosomal protein N clusters with
protein S18p, zinc- ribosomal proteins
independent
fig|6666666.60966.peg.2573 CDS 2377399 2377091 −1 309 Primosomal replication Primosomal replication D23_1c2563 Neut_2381
protein N protein N clusters with
ribosomal proteins
fig|6666666.60966.peg.2574 CDS 2377721 2377401 −2 321 SSU ribosomal protein Primosomal replication D23_1c2564 Neut_2382
S6p protein N clusters with
ribosomal proteins
fig|6666666.60966.peg.2576 CDS 2378765 2378340 −2 426 hypothetical protein -none- D23_1c2565 NA
fig|6666666.60966.peg.2578 CDS 2379069 2380031 3 + 963 Mobile element protein -none- D23_1c2566 Neut_1746
fig|6666666.60966.peg.2580 CDS 2380409 2380864 2 + 456 Mobile element protein -none- D23_1c2567 Neut_0883
fig|6666666.60966.peg.2581 CDS 2381862 2380975 −3 888 Acetylglutamate kinase Arginine Biosynthesis-- D23_1c2568 Neut_2384
(EC 2.7.2.8) gjo; <br>Arginine
Biosynthesis extended
fig|6666666.60966.peg.2582 CDS 2382398 2381919 −2 480 type IV pili signal -none- D23_1c2569 Neut_2385
transduction protein Pill
fig|6666666.60966.peg.2583 CDS 2382774 2382427 −3 348 twitching motility -none- D23_1c2570 Neut_2386
protein PilH
fig|6666666.60966.peg.2584 CDS 2383169 2383639 2 + 471 21 kDa hemolysin CBSS-160492.1.peg.550 D23_1c2571 Neut_2387
precursor
fig|6666666.60966.peg.2585 CDS 2383676 2385043 2 + 1368 Fe—S protein, homolog -none- D23_1c2572 Neut_2388
of lactate
dehydrogenase SO1521
fig|6666666.60966.peg.2586 CDS 2386032 2385136 −3 897 Heme O synthase, Biogenesis of D23_1c2573 Neut_2389
protoheme IX cytochrome c oxidases;
farnesyltransferase (EC <br>CBSS-
2.5.1.—) COX10-CtaB 196164.1.peg.1690;
<br>CBSS-
316057.3.peg.563
fig|6666666.60966.peg.2587 CDS 2386422 2386123 −3 300 Probable -none- D23_1c2574 Neut_2390
transmembrane protein
fig|6666666.60966.peg.2588 CDS 2387398 2386679 −1 720 Cytochrome oxidase Biogenesis of D23_1c2575 Neut_2391
biogenesis protein cytochrome c oxidases;
Surf1, facilitates heme <br>CBSS-
A insertion 316057.3.peg.563
fig|6666666.60966.peg.2589 CDS 2388336 2387491 −3 846 Cytochrome c oxidase CBSS-316057.3.peg.563; D23_1c2576 Neut_2392
polypeptide III (EC <br>Terminal
1.9.3.1) cytochrome C oxidases
fig|6666666.60966.peg.2590 CDS 2389047 2388529 −3 519 Cytochrome oxidase Biogenesis of cytochrome c oxidases; D23_1c2577 Neut_2393
biogenesis protein <br>CBSS-
Cox11-CtaG, copper 316057.3.peg.563
delivery to Cox1
fig|6666666.60966.peg.2591 CDS 2390759 2389182 −2 1578 Cytochrome c oxidase Terminal cytochrome C D23_1c2578 Neut_2394
polypeptide I (EC oxidases
1.9.3.1)
fig|6666666.60966.peg.2592 CDS 2391643 2390819 −1 825 Cytochrome c oxidase CBSS-316057.3.peg.563; D23_1c2579 Neut_2395
polypeptide II (EC <br>Terminal
1.9.3.1) cytochrome C oxidases
fig|6666666.60966.peg.2594 CDS 2392145 2392567 2 + 423 Putative TEGT family CBSS-326442.4.peg.1852 D23_1c2580 NA
carrier/transport
protein
fig|6666666.60966.peg.2595 CDS 2392600 2392884 1 + 285 Putative TEGT family CBSS-326442.4.peg.1852 D23_1c2581 Neut_1715
carrier/transport
protein
fig|6666666.60966.peg.2596 CDS 2393084 2393302 2 + 219 Copper chaperone Copper homeostasis D23_1c2582 Neut_2397
fig|6666666.60966.peg.2597 CDS 2393426 2394394 2 + 969 Acetyl-coenzyme A Fatty Acid Biosynthesis D23_1c2583 Neut_2398
carboxyl transferase FASII
alpha chain (EC 6.4.1.2)
fig|6666666.60966.peg.2598 CDS 2394357 2395742 3 + 1386 tRNA(Ile)-lysidine -none- D23_1c2584 Neut_2399
synthetase
fig|6666666.60966.peg.2599 CDS 2395746 2396807 3 + 1062 dTDP-glucose 4,6- CBSS- D23_1c2585 Neut_2400
dehydratase (EC 296591.1.peg.2330;
4.2.1.46) <br>Rhamnose
containing glycans;
<br>dTDP-rhamnose
synthesis
fig|6666666.60966.peg.2600 CDS 2396804 2397700 2 + 897 dTDP-4- Rhamnose containing D23_1c2586 Neut_2401
dehydrorhamnose glycans; <br>dTDP-
reductase (EC rhamnose synthesis
1.1.1.133)
fig|6666666.60966.peg.2601 CDS 2398663 2397710 −1 954 InterPro IPR002142 -none- D23_1c2587 Neut_2402
COGs COG0616
fig|6666666.60966.peg.2602 CDS 2399353 2398691 −1 663 Outer membrane Ton and Tol transport D23_1c2588 Neut_2403
lipoprotein omp16 systems
precursor
fig|6666666.60966.peg.2603 CDS 2400398 2399562 −2 837 SH3, type 3 domain -none- D23_1c2590 Neut_2404
protein
fig|6666666.60966.peg.2604 CDS 2400602 2401477 2 + 876 esterase/lipase/thioesterase -none- D23_1c2591 Neut_2408
family active site
fig|6666666.60966.peg.2605 CDS 2402010 2401492 −3 519 Mobile element protein -none- D23_1c2592 Neut_2502
fig|6666666.60966.peg.2606 CDS 2402097 2403560 3 + 1464 hypothetical protein -none- D23_1c2593 Neut_2493
fig|6666666.60966.peg.2607 CDS 2403699 2404946 3 + 1248 Lipoprotein releasing Lipopolysaccharide D23_1c2594 Neut_2492
system transmembrane assembly;
protein LolE <br>Lipoprotein sorting
system
fig|6666666.60966.peg.2608 CDS 2404939 2405613 1 + 675 Lipoprotein releasing Lipopolysaccharide D23_1c2595 Neut_2491
system ATP-binding assembly;
protein LolD <br>Lipoprotein sorting
system
fig|6666666.60966.peg.2609 CDS 2406957 2405641 −3 1317 FIG065221: Holliday CBSS-83333.1.peg.876 D23_1c2596 Neut_2490
junction DNA helicase
fig|6666666.60966.peg.2610 CDS 2407570 2406950 −1 621 Outer membrane CBSS-83333.1.peg.876; D23_1c2597 Neut_2489
lipoprotein carrier <br>Lipopolysaccharide
protein LolA assembly;
<br>Lipoprotein sorting
system
fig|6666666.60966.peg.2611 CDS 2409936 2407630 −3 2307 Cell division protein Bacterial cell Division; D23_1c2598 Neut_2488
FtsK <br>Bacterial
cytoskeleton;
<br>Bacterial RNA-
metabolizing Zn-
dependent hydrolases;
<br>CBSS-
83333.1.peg.876
fig|6666666.60966.peg.2612 CDS 2411206 2410151 −1 1056 InterPro IPR002110 -none- D23_1c2600 Neut_2487
COGs COG0666
fig|6666666.60966.peg.2613 CDS 2412939 2411203 −3 1737 Succinate Succinate D23_1c2601 Neut_2486
dehydrogenase dehydrogenase;
flavoprotein subunit (EC <br>TCA Cycle
1.3.99.1)
fig|6666666.60966.peg.2614 CDS 2413237 2412968 −1 270 Succinate Succinate D23_1c2602 Neut_2485
dehydrogenase dehydrogenase
hydrophobic membrane
anchor protein
fig|6666666.60966.peg.2615 CDS 2413803 2413315 −3 489 Succinate Succinate D23_1c2603 Neut_2484
dehydrogenase dehydrogenase
cytochrome b-556
subunit
fig|6666666.60966.peg.2616 CDS 2413889 2415583 2 + 1695 CTP synthase (EC CTP synthase (EC D23_1c2604 Neut_2483
6.3.4.2) 6.3.4.2) cluster;
<br>pyrimidine
conversions
fig|6666666.60966.peg.2617 CDS 2415872 2417158 2 + 1287 Enolase (EC 4.2.1.11) Glycolysis and D23_1c2605 Neut_2482
Gluconeogenesis
fig|6666666.60966.peg.2618 CDS 2417185 2417436 1 + 252 Cell division protein Bacterial cell Division; D23_1c2606 Neut_2481
DivIC (FtsB), stabilizes <br>Bacterial
FtsL against RasP cytoskeleton;
cleavage <br>Stationary phase
repair cluster
fig|6666666.60966.peg.2619 CDS 2417726 2417860 2 + 135 hypothetical protein -none- D23_1c2607 NA
fig|6666666.60966.peg.2621 CDS 2419576 2418317 −1 1260 Transcription Transcription factors D23_1c2609 Neut_2479
termination factor Rho bacterial
fig|6666666.60966.peg.2622 CDS 2420006 2419791 −2 216 Thioredoxin -none- D23_1c2610 Neut_2478
fig|6666666.60966.peg.2624 CDS 2420605 2421762 1 + 1158 Membrane-bound lytic Murein Hydrolases; D23_1c2611 Neut_2477
murein transglycosylase <br>Peptidoglycan
B precursor (EC 3.2.1.—) Biosynthesis
fig|6666666.60966.peg.2625 CDS 2422278 2421835 −3 444 Universal stress protein -none- D23_1c2612 Neut_2476
family COG0589
fig|6666666.60966.peg.2626 CDS 2424743 2422389 −2 2355 Partial urea carboxylase Urea carboxylase and D23_1c2613 Neut_2475
2 (EC 6.3.4.6) Allophanate hydrolase
cluster; <br>Urea
decomposition
fig|6666666.60966.peg.2627 CDS 2425462 2424797 −1 666 Urea carboxylase- Urea decomposition D23_1c2614 Neut_2474
related
aminomethyltransferase
(EC 2.1.2.10)
fig|6666666.60966.peg.2628 CDS 2426187 2425459 −3 729 Urea carboxylase- Urea decomposition D23_1c2615 Neut_2473
related
aminomethyltransferase
(EC 2.1.2.10)
fig|6666666.60966.peg.2629 CDS 2427740 2426202 −2 1539 Urea carboxylase- Urea decomposition D23_1c2616 Neut_2472
related amino acid
permease
fig|6666666.60966.peg.2630 CDS 2427773 2427892 2 + 120 hypothetical protein -none- D23_1c2617 NA
fig|6666666.60966.peg.2631 CDS 2428128 2428319 3 + 192 hypothetical protein -none- D23_1c2618 NA
fig|6666666.60966.peg.2632 CDS 2428646 2428518 −2 129 hypothetical protein -none- D23_1c2620 NA
fig|6666666.60966.peg.2633 CDS 2428671 2432291 3 + 3621 Urea carboxylase (EC Urea carboxylase and D23_1c2621 Neut_2470
6.3.4.6) Allophanate hydrolase
cluster; <br>Urea
decomposition
fig|6666666.60966.peg.2634 CDS 2433643 2432279 −1 1365 Membrane-bound lytic CBSS-228410.1.peg.134; D23_1c2622 Neut_2469
murein transglycosylase <br>CBSS-
D precursor (EC 3.2.1.—) 342610.3.peg.1536;
<br>Murein Hydrolases
fig|6666666.60966.peg.2635 CDS 2434924 2433791 −1 1134 Ribonucleotide Ribonucleotide D23_1c2623 Neut_2468
reductase of class Ia reduction
(aerobic), beta subunit
(EC 1.17.4.1)
fig|6666666.60966.peg.2636 CDS 2437918 2434976 −1 2943 Ribonucleotide Ribonucleotide D23_1c2624 Neut_2467
reductase of class Ia reduction
(aerobic), alpha subunit
(EC 1.17.4.1)
fig|6666666.60966.peg.2637 CDS 2438096 2441536 2 + 3441 Long-chain-fatty-acid-- Biotin biosynthesis; D23_1c2625 Neut_2466
CoA ligase (EC 6.2.1.3) <br>Biotin synthesis
cluster; <br>Fatty acid
metabolism cluster
fig|6666666.60966.peg.2638 CDS 2441648 2441788 2 + 141 hypothetical protein -none- D23_1c2626 NA
fig|6666666.60966.peg.2639 CDS 2441958 2441845 −3 114 hypothetical protein -none- D23_1c2627 NA
fig|6666666.60966.peg.2640 CDS 2441984 2442337 2 + 354 S-adenosylmethionine Polyamine Metabolism D23_1c2628 Neut_2465
decarboxylase
proenzyme (EC
4.1.1.50), prokaryotic
class 1B
fig|6666666.60966.peg.2641 CDS 2442337 2443296 1 + 960 Spermidine synthase Polyamine Metabolism D23_1c2629 Neut_2464
(EC 2.5.1.16)
fig|6666666.60966.peg.2642 CDS 2444178 2443342 −3 837 Cytochrome c family -none- D23_1c2630 Neut_2463
protein
fig|6666666.60966.peg.2643 CDS 2446065 2444275 −3 1791 ABC transporter, fused -none- D23_1c2631 Neut_2462
permease and ATPase
domains
fig|6666666.60966.peg.2644 CDS 2446735 2446268 −1 468 Single-stranded DNA- DNA repair, bacterial D23_1c2632 Neut_2461
binding protein
fig|6666666.60966.peg.2645 CDS 2448142 2446736 −1 1407 Putative transport -none- D23_1c2633 Neut_2460
protein
fig|6666666.60966.peg.2646 CDS 2448217 2451054 1 + 2838 Excinuclease ABC DNA repair, UvrABC D23_1c2634 Neut_2459
subunit A system
fig|6666666.60966.peg.2647 CDS 2451051 2452322 3 + 1272 D-glycerate 2-kinase (EC Glycerate metabolism D23_1c2635 Neut_2458
2.7.1.—)
fig|6666666.60966.peg.2648 CDS 2455286 2452443 −2 2844 Aconitate hydratase (EC TCA Cycle D23_1c2637 Neut_2457
4.2.1.3)
fig|6666666.60966.peg.2649 CDS 2455429 2456334 1 + 906 Aldose 1-epimerase -none- D23_1c2638 Neut_2456
fig|6666666.60966.peg.2650 CDS 2456378 2456941 2 + 564 NADPH-dependent -none- D23_1c2639 Neut_2455
FMN reductase
fig|6666666.60966.peg.2651 CDS 2457281 2457051 −2 231 HrgA protein -none- D23_1c2640 Neut_2454
fig|6666666.60966.peg.2652 CDS 2457998 2457480 −2 519 HrgA protein -none- D23_1c2641 NA
fig|6666666.60966.peg.2653 CDS 2459350 2458013 −1 1338 hypothetical protein -none- D23_1c2642 NA
fig|6666666.60966.peg.2654 CDS 2460249 2459347 −3 903 hypothetical protein -none- D23_1c2643 NA
fig|6666666.60966.peg.2655 CDS 2463305 2460264 −2 3042 Type I restriction- Restriction-Modification D23_1c2644 NA
modification system, System; <br>Type I
restriction subunit R (EC Restriction-Modification
3.1.21.3)
fig|6666666.60966.peg.2656 CDS 2463943 2463341 −1 603 hypothetical protein -none- D23_1c2645 NA
fig|6666666.60966.peg.2657 CDS 2465348 2463960 −2 1389 Type I restriction- Restriction-Modification D23_1c2646 NA
modification system, System; <br>Type I
specificity subunit S (EC Restriction-Modification
3.1.21.3)
fig|6666666.60966.peg.2658 CDS 2467567 2465348 −1 2220 Type I restriction- Restriction-Modification D23_1c2647 Neut_0541
modification system, System; <br>Type I
DNA-methyltransferase Restriction-Modification
subunit M (EC 2.1.1.72)
fig|6666666.60966.peg.2659 CDS 2468029 2467751 −1 279 Type I restriction- Restriction-Modification D23_1c2648 Neut_2448
modification system, System; <br>Type I
DNA-methyltransferase Restriction-Modification
subunit M (EC 2.1.1.72)
fig|6666666.60966.peg.2660 CDS 2468945 2468235 −2 711 RNA polymerase sigma Flagellar motility; D23_1c2650 Neut_2447
factor for flagellar <br>Flagellum;
operon <br>Transcription
initiation, bacterial
sigma factors
fig|6666666.60966.peg.2661 CDS 2469847 2468954 −1 894 Flagellar synthesis Flagellar motility; D23_1c2651 Neut_2446
regulator FleN <br>Flagellum
fig|6666666.60966.peg.2662 CDS 2471090 2469840 −2 1251 Flagellar biosynthesis Flagellar motility; D23_1c2652 Neut_2445
protein FlhF <br>Flagellum
fig|6666666.60966.peg.2663 CDS 2473171 2471087 −1 2085 Flagellar biosynthesis Flagellar motility; D23_1c2653 Neut_2444
protein FlhA <br>Flagellum
fig|6666666.60966.peg.2664 CDS 2474349 2473219 −3 1131 Flagellar biosynthesis Flagellar motility; D23_1c2654 Neut_2443
protein FlhB <br>Flagellum
fig|6666666.60966.peg.2665 CDS 2476208 2474601 −2 1608 Peptide chain release Translation termination D23_1c2655 Neut_2442
factor 3 factors bacterial
fig|6666666.60966.peg.2666 CDS 2478262 2476208 −1 2055 Dipeptide transport ABC transporter D23_1c2656 Neut_2441
ATP-binding protein dipeptide (TC 3.A.1.5.2)
DppF (TC 3.A.1.5.2)
fig|6666666.60966.peg.2667 CDS 2479752 2478259 −3 1494 Oligopeptide transport -none- D23_1c2657 Neut_2440
system permease
protein
fig|6666666.60966.peg.2669 CDS 2480032 2480334 1 + 303 Negative regulator of Flagellum D23_1c2658 Neut_2439
flagellin synthesis
fig|6666666.60966.peg.2670 CDS 2480417 2480800 2 + 384 Flagellar biosynthesis Flagellum D23_1c2659 Neut_2438
protein FlgN
fig|6666666.60966.peg.2671 CDS 2481184 2483109 1 + 1926 tRNA uridine 5- Cell Division Subsystem D23_1c2660 Neut_2437
carboxymethylaminomethyl including YidCD;
modification <br>RNA modification
enzyme GidA and chromosome
partitioning cluster;
<br>mnm5U34
biosynthesis bacteria;
<br>tRNA modification
Bacteria
fig|6666666.60966.peg.2672 CDS 2483084 2483728 2 + 645 rRNA small subunit 7- Cell Division Subsystem D23_1c2661 Neut_2436
methylguanosine (m7G) including YidCD;
methyltransferase GidB <br>RNA methylation;
<br>RNA modification
and chromosome
partitioning cluster
fig|6666666.60966.peg.2673 CDS 2483792 2484556 2 + 765 Chromosome (plasmid) Bacterial Cell Division; D23_1c2662 Neut_2435
partitioning protein <br>Bacterial
ParA/Sporulation Cytoskeleton;
initiation inhibitor <br>Bacterial
protein Soj Cytoskeleton; <br>Cell
Division Subsystem
including YidCD;
<br>RNA modification
and chromosome
partitioning cluster
fig|6666666.60966.peg.2674 CDS 2484637 2485440 1 + 804 Chromosome (plasmid) Bacterial Cytoskeleton; D23_1c2663 Neut_2434
partitioning protein <br>Bacterial
ParB/Stage 0 Cytoskeleton; <br>Cell
sporulation protein J Division Subsystem
including YidCD;
<br>RNA modification
and chromosome
partitioning cluster
fig|6666666.60966.peg.2675 CDS 2485777 2488083 1 + 2307 Glucose-6-phosphate Glycolysis and D23_1c2664 Neut_2433
isomerase (EC 5.3.1.9) Gluconeogenesis
fig|6666666.60966.peg.2676 CDS 2488076 2489131 2 + 1056 6-phosphogluconate D-gluconate and D23_1c2665 Neut_2432
dehydrogenase, ketogluconates
decarboxylating (EC metabolism;
1.1.1.44) <br>Pentose phosphate
pathway
fig|6666666.60966.peg.2677 CDS 2489149 2490591 1 + 1443 Glucose-6-phosphate 1- Pentose phosphate D23_1c2666 Neut_2431
dehydrogenase (EC pathway
1.1.1.49)
fig|6666666.60966.peg.2678 CDS 2490598 2490741 1 + 144 hypothetical protein -none- D23_1c2667 NA
fig|6666666.60966.peg.2679 CDS 2491345 2490770 −1 576 putative membrane -none- D23_1c2668 Neut_2430
protein
fig|6666666.60966.peg.2680 CDS 2491701 2492270 3 + 570 DedA family inner DedA family of inner D23_1c2669 Neut_2429
membrane protein membrane proteins
YohD
fig|6666666.60966.peg.2681 CDS 2492664 2492897 3 + 234 Mobile element protein -none- D23_1c2671 Neut_2428
fig|6666666.60966.peg.2682 CDS 2493050 2494789 2 + 1740 ABC-type anion -none- D23_1c2672 Neut_2427
transport system,
duplicated permease
component
fig|6666666.60966.peg.2683 CDS 2494811 2496100 2 + 1290 ABC-type Alkanesulfonate D23_1c2673 Neut_2426
nitrate/sulfonate/bicarbonate assimilation
transport system,
ATPase component
fig|6666666.60966.peg.2684 CDS 2499268 2496263 −1 3006 Exonuclease SbcC DNA repair, bacterial; D23_1c2676 Neut_2425
<br>Rad50-Mre11 DNA
repair cluster
fig|6666666.60966.peg.2685 CDS 2499230 2499520 2 + 291 hypothetical protein -none- D23_1c2677 NA
fig|6666666.60966.peg.2686 CDS 2500770 2499526 −3 1245 Exonuclease SbcD DNA repair, bacterial; D23_1c2678 Neut_2424
<br>Rad50-Mre11 DNA
repair cluster
fig|6666666.60966.peg.2687 CDS 2501402 2500767 −2 636 FIG01057587: -none- D23_1c2679 NA
hypothetical protein
fig|6666666.60966.peg.2688 CDS 2501615 2502037 2 + 423 Mobile element protein -none- D23_1c2680 Neut_2450
fig|6666666.60966.peg.2689 CDS 2502217 2502050 −1 168 hypothetical protein -none- D23_1c2681 NA
fig|6666666.60966.peg.2691 CDS 2503677 2502628 −3 1050 hypothetical protein -none- D23_1c2682 Neut_2415
fig|6666666.60966.peg.2692 CDS 2503893 2504105 3 + 213 hypothetical protein -none- D23_1c2683 NA
fig|6666666.60966.peg.2693 CDS 2505239 2504595 −2 645 hypothetical protein -none- D23_1c2685 NA
fig|6666666.60966.peg.2694 CDS 2506092 2505229 −3 864 Mobile element protein -none- D23_1c2686 Neut_2192
fig|6666666.60966.peg.2695 CDS 2506385 2506089 −2 297 Mobile element protein -none- D23_1c2687 Neut_2193
fig|6666666.60966.peg.2696 CDS 2506924 2506445 −1 480 DNA primase/helicase, Phage replication D23_1c2688 NA
phage-associated
fig|6666666.60966.peg.2697 CDS 2507166 2506921 −3 246 hypothetical protein -none- D23_1c2689 NA
fig|6666666.60966.peg.2698 CDS 2507393 2507166 −2 228 hypothetical protein -none- D23_1c2690 NA
fig|6666666.60966.peg.2699 CDS 2507735 2508577 2 + 843 hypothetical protein -none- D23_1c2691 NA
fig|6666666.60966.peg.2700 CDS 2508650 2509111 2 + 462 Putative bacteriophage- -none- D23_1c2692 NA
related protein
fig|6666666.60966.peg.2701 CDS 2509108 2510448 1 + 1341 probable DNA invertase -none- D23_1c2693 Neut_2563
fig|6666666.60966.peg.2702 CDS 2510478 2510897 3 + 420 elements of external -none- D23_1c2694 NA
origin; phage-related
functions and
prophages
fig|6666666.60966.peg.2703 CDS 2512240 2511590 −1 651 Similar to 2-phosphoglycolate D23_1c2696 Neut_2506
phosphoglycolate salvage
phosphatase, clustered
with ubiquinone
biosynthesis SAM-
dependent O-
methyltransferase
fig|6666666.60966.peg.2704 CDS 2512973 2512269 −2 705 3-demethylubiquinol 3- Ubiquinone D23_1c2697 Neut_2507
O-methyltransferase Biosynthesis;
(EC 2.1.1.64) <br>Ubiquinone
Biosynthesis-gjo
fig|6666666.60966.peg.2705 CDS 2513079 2512963 −3 117 hypothetical protein -none- D23_1c2698 NA
fig|6666666.60966.peg.2706 CDS 2513892 2513197 −3 696 Outer membrane Osmoregulation D23_1c2699 Neut_2508
protein A precursor
fig|6666666.60966.peg.2708 CDS 2514251 2515009 2 + 759 ABC-type multidrug CBSS-196164.1.peg.1690 D23_1c2700 Neut_2509
transport system,
ATPase component
fig|6666666.60966.peg.2709 CDS 2515006 2515752 1 + 747 gliding motility protein -none- D23_1c2701 Neut_2510
GldF
fig|6666666.60966.peg.2710 CDS 2515776 2517128 3 + 1353 Mucin 2 precursor -none- D23_1c2702 Neut_2511
fig|6666666.60966.peg.2711 CDS 2517144 2517959 3 + 816 Formamidopyrimidine- DNA Repair Base D23_1c2703 Neut_2512
DNA glycosylase (EC Excision
3.2.2.23)
fig|6666666.60966.peg.2712 CDS 2518479 2517994 −3 486 Thioredoxin -none- D23_1c2704 Neut_2513
fig|6666666.60966.peg.2713 CDS 2520458 2518644 −2 1815 GTP-binding protein Universal GTPases D23_1c2705 Neut_2514
TypA/BipA
fig|6666666.60966.peg.2714 CDS 2520591 2521196 3 + 606 Riboflavin synthase Riboflavin, FMN and FAD D23_1c2706 Neut_2515
eubacterial/eukaryotic metabolism;
(EC 2.5.1.9) <br>Riboflavin, FMN and
FAD metabolism in
plants; <br>Riboflavin
synthesis cluster;
<br>riboflavin to FAD
fig|6666666.60966.peg.2715 CDS 2521193 2522302 2 + 1110 3,4-dihydroxy-2- Riboflavin, FMN and FAD D23_1c2707 Neut_2516
butanone 4-phosphate metabolism;
synthase (EC 4.1.99.12)/ <br>Riboflavin, FMN and
GTP cyclohydrolase II FAD metabolism;
(EC 3.5.4.25) <br>Riboflavin, FMN and
FAD metabolism in
plants; <br>Riboflavin,
FMN and FAD
metabolism in plants;
<br>Riboflavin synthesis
cluster; <br>Riboflavin
synthesis cluster;
<br>riboflavin to FAD
fig|6666666.60966.peg.2716 CDS 2522529 2523026 3 + 498 6,7-dimethyl-8- Possible RNA D23_1c2708 Neut_2517
ribityllumazine synthase degradation cluster;
(EC 2.5.1.78) <br>Riboflavin, FMN and
FAD metabolism;
<br>Riboflavin, FMN and
FAD metabolism in
plants; <br>Riboflavin
synthesis cluster
fig|6666666.60966.peg.2717 CDS 2523023 2523526 2 + 504 Transcription Riboflavin synthesis D23_1c2709 Neut_2518
termination protein cluster;
NusB <br>Transcription
factors bacterial
fig|6666666.60966.peg.2719 CDS 2523801 2524787 3 + 987 Thiamine- 5-FCL-like protein; D23_1c2710 Neut_2519
monophosphate kinase <br>Riboflavin synthesis
(EC 2.7.4.16) cluster; <br>Thiamin
biosynthesis
fig|6666666.60966.peg.2720 CDS 2524864 2525307 1 + 444 Phosphatidylglycerophosphatase Glycerolipid and D23_1c2711 Neut_2520
A (EC 3.1.3.27) Glycerophospholipid
Metabolism in Bacteria;
<br>Riboflavin synthesis
cluster
fig|6666666.60966.peg.2721 CDS 2525304 2525846 3 + 543 C-terminal domain of DNA repair system D23_1c2712 Neut_2521
CinA type S; Protein including RecA, MutS
Implicated in DNA and a hypothetical
repair function with protein; <br>NAD and
RecA and MutS NADP cofactor
biosynthesis global;
<br>NAD and NADP
cofactor biosynthesis
global; <br>Possible RNA
degradation cluster;
<br>Riboflavin, FMN and
FAD metabolism in
plants; <br>Riboflavin
synthesis cluster
fig|6666666.60966.peg.2722 CDS 2527502 2526306 −2 1197 FIG00859610: -none- D23_1c2713 Neut_2522
hypothetical protein
fig|6666666.60966.peg.2723 CDS 2529448 2527829 −1 1620 ATP-dependent DNA -none- D23_1c2714 Neut_2523
helicase RecQ
fig|6666666.60966.peg.2724 CDS 2529855 2529445 −3 411 Ribosome-associated DNA replication cluster D23_1c2715 Neut_2524
heat shock protein 1; <br>Heat shock dnaK
implicated in the gene cluster extended
recycling of the 50S
subunit (S4 paralog)
fig|6666666.60966.peg.2725 CDS 2530686 2529877 −3 810 InterPro IPR002781 -none- D23_1c2716 Neut_2525
COGs COG0730
fig|6666666.60966.peg.2726 CDS 2532376 2530694 −1 1683 FIG003847: CBSS-269482.4.peg.5018 D23_1c2717 Neut_2526
Oxidoreductase
(flavoprotein)
fig|6666666.60966.peg.2727 CDS 2532913 2532488 −1 426 Transcriptional -none- D23_1c2718 Neut_2527
regulator, ArsR family
fig|6666666.60966.peg.2728 CDS 2533377 2532910 −3 468 GENE II AND X -none- D23_1c2719 Neut_2528
PROTEINS
fig|6666666.60966.peg.2729 CDS 2533835 2533407 −2 429 Probable -none- D23_1c2720 Neut_2529
transmembrane protein
fig|6666666.60966.peg.2730 CDS 2533940 2534806 2 + 867 FIG146518: Zn- CBSS-269482.4.peg.5018 D23_1c2721 Neut_2530
dependent hydrolases,
including glyoxylases
fig|6666666.60966.peg.2731 CDS 2535475 2534891 −1 585 FIG001587: exported -none- D23_1c2722 Neut_2531
protein
fig|6666666.60966.peg.2732 CDS 2537039 2535534 −2 1506 FIG00859025: -none- D23_1c2723 Neut_2532
hypothetical protein
fig|6666666.60966.peg.2733 CDS 2537388 2537077 −3 312 hypothetical protein -none- D23_1c2724 NA
fig|6666666.60966.rna.11 RNA 226254 226324 3 + 71 tRNA-Gly-CCC tRNAs NA NA
fig|6666666.60966.rna.2 RNA 6795 6868 3 + 74 tRNA-Cys-GCA tRNAs NA NA
fig|6666666.60966.rna.39 RNA 1810921 1810848 −1 74 tRNA-Gly-TCC -none- NA NA
fig|6666666.60966.rna.23 RNA 969765 969839 3 + 75 tRNA-Gln-TTG -none- NA NA
fig|6666666.60966.rna.36 RNA 1758968 1759042 2 + 75 tRNA-Val-CAC tRNAs NA NA
fig|6666666.60966.rna.38 RNA 1810812 1810738 −3 75 tRNA-Thr-GGT -none- NA NA
fig|6666666.60966.rna.1 RNA 6614 6689 2 + 76 tRNA-Gly-GCC tRNAs NA NA
fig|6666666.60966.rna.7 RNA 120428 120503 2 + 76 tRNA-Ala-TGC -none- NA NA
fig|6666666.60966.rna.12 RNA 284547 284472 −3 76 tRNA-Glu-TTC -none- NA NA
fig|6666666.60966.rna.13 RNA 284648 284573 −2 76 tRNA-Ala-GGC tRNAs NA NA
fig|6666666.60966.rna.14 RNA 493566 493641 3 + 76 tRNA-Thr-CGT -none- NA NA
fig|6666666.60966.rna.16 RNA 561828 561903 3 + 76 tRNA-Val-TAC -none- NA NA
fig|6666666.60966.rna.20 RNA 859357 859282 −1 76 tRNA-Lys-TTT -none- NA NA
fig|6666666.60966.rna.21 RNA 948801 948876 3 + 76 tRNA-Thr-TGT -none- NA NA
fig|6666666.60966.rna.24 RNA 1157662 1157587 −1 76 tRNA-Arg-CCT -none- NA NA
fig|6666666.60966.rna.25 RNA 1199325 1199250 −3 76 tRNA-His-GTG -none- NA NA
fig|6666666.60966.rna.29 RNA 1470510 1470435 −3 76 tRNA-Asn-GTT -none- NA NA
fig|6666666.60966.rna.33 RNA 1618239 1618314 3 + 76 tRNA-Met-CAT -none- NA NA
fig|6666666.60966.rna.34 RNA 1673498 1673423 −2 76 tRNA-Arg-CCG tRNAs NA NA
fig|6666666.60966.rna.37 RNA 1809438 1809363 −3 76 tRNA-Trp-CCA tRNAs NA NA
fig|6666666.60966.rna.42 RNA 2107281 2107356 3 + 76 tRNA-Phe-GAA tRNAs NA NA
fig|6666666.60966.rna.6 RNA 120349 120425 1 + 77 tRNA-Ile-GAT -none- NA NA
fig|6666666.60966.rna.10 RNA 196762 196838 1 + 77 tRNA-Met-CAT -none- NA NA
fig|6666666.60966.rna.15 RNA 524553 524629 3 + 77 tRNA-Val-GAC tRNAs NA NA
fig|6666666.60966.rna.17 RNA 561963 562039 3 + 77 tRNA-Asp-GTC -none- NA NA
fig|6666666.60966.rna.18 RNA 728392 728316 −1 77 tRNA-Pro-CGG tRNAs NA NA
fig|6666666.60966.rna.26 RNA 1199452 1199376 −1 77 tRNA-Arg-TCT -none- NA NA
fig|6666666.60966.rna.27 RNA 1199573 1199497 −2 77 tRNA-Pro-TGG -none- NA NA
fig|6666666.60966.rna.28 RNA 1427736 1427812 3 + 77 tRNA-Met-CAT -none- NA NA
fig|6666666.60966.rna.41 RNA 2107137 2107213 3 + 77 tRNA-Arg-ACG tRNAs NA NA
fig|6666666.60966.rna.44 RNA 2339644 2339568 −1 77 tRNA-Pro-GGG tRNAs NA NA
fig|6666666.60966.rna.19 RNA 835520 835604 2 + 85 tRNA-Leu-GAG tRNAs NA NA
fig|6666666.60966.rna.32 RNA 1597631 1597715 2 + 85 tRNA-Leu-CAG tRNAs NA NA
fig|6666666.60966.rna.40 RNA 1811116 1811032 −1 85 tRNA-Tyr-GTA -none- NA NA
fig|6666666.60966.rna.4 RNA 97072 96987 −1 86 tRNA-Leu-TAG -none- NA NA
fig|6666666.60966.rna.31 RNA 1574940 1574854 −3 87 tRNA-Leu-CAA tRNAs NA NA
fig|6666666.60966.rna.30 RNA 1550222 1550135 −2 88 tRNA-Ser-TGA -none- NA NA
fig|6666666.60966.rna.3 RNA 6894 6982 3 + 89 tRNA-Leu-TAA -none- NA NA
fig|6666666.60966.rna.22 RNA 956464 956374 −1 91 tRNA-Ser-GGA tRNAs NA NA
fig|6666666.60966.rna.35 RNA 1757250 1757342 3 + 93 tRNA-Ser-CGA tRNAs NA NA
fig|6666666.60966.rna.43 RNA 2120297 2120205 −2 93 tRNA-Ser-GCT -none- NA NA
fig|6666666.60966.peg.111 CDS 108515 108628 2 + 114 hypothetical protein -none- NA NA
fig|6666666.60966.peg.353 CDS 326760 326647 −3 114 hypothetical protein -none- NA NA
fig|6666666.60966.peg.404 CDS 375917 375804 −2 114 hypothetical protein -none- NA NA
fig|6666666.60966.peg.432 CDS 397539 397426 −3 114 hypothetical protein -none- NA NA
fig|6666666.60966.peg.509 CDS 474482 474369 −2 114 hypothetical protein -none- NA NA
fig|6666666.60966.peg.589 CDS 543008 543121 2 + 114 hypothetical protein -none- NA NA
fig|6666666.60966.peg.838 CDS 770105 770218 2 + 114 hypothetical protein -none- NA NA
fig|6666666.60966.peg.923 CDS 855159 855046 −3 114 hypothetical protein -none- NA NA
fig|6666666.60966.peg.943 CDS 873193 873306 1 + 114 hypothetical protein -none- NA NA
fig|6666666.60966.peg.1081 CDS 1010260 1010373 1 + 114 hypothetical protein -none- NA NA
fig|6666666.60966.peg.1333 CDS 1235666 1235779 2 + 114 hypothetical protein -none- NA NA
fig|6666666.60966.peg.1414 CDS 1326350 1326463 2 + 114 hypothetical protein -none- NA NA
fig|6666666.60966.peg.1695 CDS 1575540 1575653 3 + 114 hypothetical protein -none- NA NA
fig|6666666.60966.peg.1875 CDS 1749599 1749486 −2 114 Mobile element protein -none- NA NA
fig|6666666.60966.peg.2082 CDS 1936491 1936378 −3 114 hypothetical protein -none- NA NA
fig|6666666.60966.peg.2205 CDS 2047715 2047828 2 + 114 hypothetical protein -none- NA NA
fig|6666666.60966.peg.2370 CDS 2201390 2201277 −2 114 hypothetical protein -none- NA NA
fig|6666666.60966.peg.2413 CDS 2236764 2236651 −3 114 hypothetical protein -none- NA NA
fig|6666666.60966.peg.2577 CDS 2379043 2378930 −1 114 hypothetical protein -none- NA NA
fig|6666666.60966.peg.421 CDS 392634 392518 −3 117 hypothetical protein -none- NA NA
fig|6666666.60966.peg.431 CDS 397234 397350 1 + 117 hypothetical protein -none- NA NA
fig|6666666.60966.peg.1104 CDS 1033773 1033889 3 + 117 hypothetical protein -none- NA NA
fig|6666666.60966.peg.1856 CDS 1730271 1730155 −3 117 hypothetical protein -none- NA NA
fig|6666666.60966.peg.2044 CDS 1907891 1907775 −2 117 hypothetical protein -none- NA NA
fig|6666666.60966.peg.2046 CDS 1908400 1908516 1 + 117 hypothetical protein -none- NA NA
fig|6666666.60966.peg.2250 CDS 2086632 2086516 −3 117 hypothetical protein -none- NA NA
fig|6666666.60966.peg.2378 CDS 2209362 2209246 −3 117 hypothetical protein -none- NA NA
fig|6666666.60966.peg.28 CDS 31960 31841 −1 120 hypothetical protein -none- NA NA
fig|6666666.60966.peg.536 CDS 496598 496717 2 + 120 hypothetical protein -none- NA NA
fig|6666666.60966.peg.866 CDS 794273 794392 2 + 120 hypothetical protein -none- NA NA
fig|6666666.60966.peg.1031 CDS 956342 956223 −2 120 hypothetical protein -none- NA NA
fig|6666666.60966.peg.1238 CDS 1152349 1152230 −1 120 hypothetical protein -none- NA NA
fig|6666666.60966.peg.1279 CDS 1184453 1184572 2 + 120 hypothetical protein -none- NA NA
fig|6666666.60966.peg.1566 CDS 1462529 1462410 −2 120 hypothetical protein -none- NA NA
fig|6666666.60966.peg.1604 CDS 1492079 1491960 −2 120 hypothetical protein -none- NA NA
fig|6666666.60966.peg.1610 CDS 1495100 1495219 2 + 120 hypothetical protein -none- NA NA
fig|6666666.60966.peg.1938 CDS 1820165 1820046 −2 120 hypothetical protein -none- NA NA
fig|6666666.60966.peg.1940 CDS 1820392 1820511 1 + 120 hypothetical protein -none- NA NA
fig|6666666.60966.peg.2194 CDS 2040715 2040596 −1 120 hypothetical protein -none- NA NA
fig|6666666.60966.peg.2229 CDS 2069192 2069073 −2 120 hypothetical protein -none- NA NA
fig|6666666.60966.peg.2542 CDS 2355482 2355601 2 + 120 hypothetical protein -none- NA NA
fig|6666666.60966.peg.477 CDS 444630 444508 −3 123 hypothetical protein -none- NA NA
fig|6666666.60966.peg.634 CDS 579242 579364 2 + 123 hypothetical protein -none- NA NA
fig|6666666.60966.peg.927 CDS 859107 859229 3 + 123 hypothetical protein -none- NA NA
fig|6666666.60966.peg.1015 CDS 941818 941940 1 + 123 hypothetical protein -none- NA NA
fig|6666666.60966.peg.1388 CDS 1298114 1298236 2 + 123 hypothetical protein -none- NA NA
fig|6666666.60966.peg.1755 CDS 1633195 1633073 −1 123 hypothetical protein -none- NA NA
fig|6666666.60966.peg.2224 CDS 2067753 2067631 −3 123 hypothetical protein -none- NA NA
fig|6666666.60966.peg.2271 CDS 2103666 2103788 3 + 123 hypothetical protein -none- NA NA
fig|6666666.60966.peg.2336 CDS 2170340 2170462 2 + 123 hypothetical protein -none- NA NA
fig|6666666.60966.peg.2415 CDS 2237130 2237008 −3 123 Hydroxyacylglutathione CBSS-228410.1.peg.134; NA NA
hydrolase (EC 3.1.2.6) <br>CBSS-
342610.3.peg.1536;
<br>Glutathione: Non-
redox reactions;
<br>Methylglyoxal
Metabolism
fig|6666666.60966.peg.82 CDS 79801 79676 −1 126 hypothetical protein -none- NA NA
fig|6666666.60966.peg.585 CDS 541998 542123 3 + 126 hypothetical protein -none- NA NA
fig|6666666.60966.peg.1268 CDS 1176741 1176866 3 + 126 hypothetical protein -none- NA NA
fig|6666666.60966.peg.1473 CDS 1385674 1385799 1 + 126 hypothetical protein -none- NA NA
fig|6666666.60966.peg.1510 CDS 1423155 1423030 −3 126 hypothetical protein -none- NA NA
fig|6666666.60966.peg.1690 CDS 1573599 1573474 −3 126 hypothetical protein -none- NA NA
fig|6666666.60966.peg.1758 CDS 1635456 1635331 −3 126 hypothetical protein -none- NA NA
fig|6666666.60966.peg.1935 CDS 1816227 1816352 3 + 126 hypothetical protein -none- NA NA
fig|6666666.60966.peg.1966 CDS 1832788 1832913 1 + 126 hypothetical protein -none- NA NA
fig|6666666.60966.peg.2285 CDS 2119314 2119439 3 + 126 hypothetical protein -none- NA NA
fig|6666666.60966.peg.21 CDS 28650 28522 −3 129 hypothetical protein -none- NA NA
fig|6666666.60966.peg.27 CDS 31632 31760 3 + 129 hypothetical protein -none- NA NA
fig|6666666.60966.peg.247 CDS 231537 231665 3 + 129 hypothetical protein -none- NA NA
fig|6666666.60966.peg.300 CDS 272364 272492 3 + 129 hypothetical protein -none- NA NA
fig|6666666.60966.peg.864 CDS 792354 792226 −3 129 hypothetical protein -none- NA NA
fig|6666666.60966.peg.1166 CDS 1092637 1092509 −1 129 hypothetical protein -none- NA NA
fig|6666666.60966.peg.1314 CDS 1216530 1216658 3 + 129 hypothetical protein -none- NA NA
fig|6666666.60966.peg.1730 CDS 1612183 1612311 1 + 129 hypothetical protein -none- NA NA
fig|6666666.60966.peg.2328 CDS 2162434 2162306 −1 129 hypothetical protein -none- NA NA
fig|6666666.60966.peg.122 CDS 124194 124063 −3 132 hypothetical protein -none- NA NA
fig|6666666.60966.peg.154 CDS 155514 155645 3 + 132 hypothetical protein -none- NA NA
fig|6666666.60966.peg.874 CDS 801546 801677 3 + 132 hypothetical protein -none- NA NA
fig|6666666.60966.peg.894 CDS 823808 823939 2 + 132 hypothetical protein -none- NA NA
fig|6666666.60966.peg.960 CDS 886681 886550 −1 132 hypothetical protein -none- NA NA
fig|6666666.60966.peg.1188 CDS 1108861 1108730 −1 132 hypothetical protein -none- NA NA
fig|6666666.60966.peg.1578 CDS 1468706 1468837 2 + 132 hypothetical protein -none- NA NA
fig|6666666.60966.peg.1950 CDS 1824304 1824435 1 + 132 hypothetical protein -none- NA NA
fig|6666666.60966.peg.1983 CDS 1850338 1850469 1 + 132 hypothetical protein -none- NA NA
fig|6666666.60966.peg.2066 CDS 1923319 1923450 1 + 132 hypothetical protein -none- NA NA
fig|6666666.60966.peg.2445 CDS 2263603 2263472 −1 132 hypothetical protein -none- NA NA
fig|6666666.60966.peg.2570 CDS 2376200 2376331 2 + 132 hypothetical protein -none- NA NA
fig|6666666.60966.peg.296 CDS 267656 267790 2 + 135 hypothetical protein -none- NA NA
fig|6666666.60966.peg.1086 CDS 1016149 1016015 −1 135 hypothetical protein -none- NA NA
fig|6666666.60966.peg.1167 CDS 1092703 1092837 1 + 135 hypothetical protein -none- NA NA
fig|6666666.60966.peg.1560 CDS 1459112 1459246 2 + 135 hypothetical protein -none- NA NA
fig|6666666.60966.peg.1597 CDS 1486647 1486513 −3 135 hypothetical protein -none- NA NA
fig|6666666.60966.peg.1949 CDS 1824258 1824124 −3 135 hypothetical protein -none- NA NA
fig|6666666.60966.peg.2059 CDS 1916861 1916995 2 + 135 hypothetical protein -none- NA NA
fig|6666666.60966.peg.2151 CDS 1995848 1995982 2 + 135 FIG00858674: -none- NA NA
hypothetical protein
fig|6666666.60966.peg.2230 CDS 2069201 2069335 2 + 135 hypothetical protein -none- NA NA
fig|6666666.60966.peg.2363 CDS 2194044 2194178 3 + 135 LSU ribosomal protein Cell Division Subsystem NA NA
L34p including YidCD;
<br>RNA modification
cluster
fig|6666666.60966.peg.2527 CDS 2338623 2338489 −3 135 hypothetical protein -none- NA NA
fig|6666666.60966.peg.1276 CDS 1182314 1182177 −2 138 hypothetical protein -none- NA NA
fig|6666666.60966.peg.1317 CDS 1218021 1218158 3 + 138 hypothetical protein -none- NA NA
fig|6666666.60966.peg.1606 CDS 1493209 1493072 −1 138 hypothetical protein -none- NA NA
fig|6666666.60966.peg.1867 CDS 1739233 1739370 1 + 138 Error-prone, lesion -none- NA NA
bypass DNA polymerase
V(UmuC)
fig|6666666.60966.peg.2117 CDS 1966387 1966250 −1 138 hypothetical protein -none- NA NA
fig|6666666.60966.peg.2227 CDS 2068598 2068735 2 + 138 hypothetical protein -none- NA NA
fig|6666666.60966.peg.163 CDS 160970 160830 −2 141 hypothetical protein -none- NA NA
fig|6666666.60966.peg.173 CDS 168825 168965 3 + 141 hypothetical protein -none- NA NA
fig|6666666.60966.peg.1286 CDS 1189481 1189621 2 + 141 hypothetical protein -none- NA NA
fig|6666666.60966.peg.1416 CDS 1328534 1328674 2 + 141 hypothetical protein -none- NA NA
fig|6666666.60966.peg.1422 CDS 1330733 1330873 2 + 141 hypothetical protein -none- NA NA
fig|6666666.60966.peg.1759 CDS 1635699 1635839 3 + 141 hypothetical protein -none- NA NA
fig|6666666.60966.peg.1775 CDS 1649712 1649572 −3 141 Mobile element protein -none- NA NA
fig|6666666.60966.peg.1984 CDS 1850712 1850572 −3 141 hypothetical protein -none- NA NA
fig|6666666.60966.peg.2003 CDS 1866906 1867046 3 + 141 hypothetical protein -none- NA NA
fig|6666666.60966.peg.2080 CDS 1935668 1935808 2 + 141 hypothetical protein -none- NA NA
fig|6666666.60966.peg.2487 CDS 2301272 2301132 −2 141 hypothetical protein -none- NA NA
fig|6666666.60966.peg.369 CDS 342367 342224 −1 144 hypothetical protein -none- NA NA
fig|6666666.60966.peg.635 CDS 579509 579652 2 + 144 hypothetical protein -none- NA NA
fig|6666666.60966.peg.1001 CDS 928837 928980 1 + 144 hypothetical protein -none- NA NA
fig|6666666.60966.peg.1642 CDS 1524746 1524603 −2 144 hypothetical protein -none- NA NA
fig|6666666.60966.peg.2114 CDS 1962886 1963029 1 + 144 hypothetical protein -none- NA NA
fig|6666666.60966.peg.2593 CDS 2391861 2392004 3 + 144 hypothetical protein -none- NA NA
fig|6666666.60966.peg.205 CDS 197036 196890 −2 147 Integrase -none- NA NA
fig|6666666.60966.peg.284 CDS 260995 261141 1 + 147 hypothetical protein -none- NA NA
fig|6666666.60966.peg.1885 CDS 1759287 1759141 −3 147 hypothetical protein -none- NA NA
fig|6666666.60966.peg.2453 CDS 2272001 2271855 −2 147 hypothetical protein -none- NA NA
fig|6666666.60966.peg.2620 CDS 2417974 2417828 −1 147 hypothetical protein -none- NA NA
fig|6666666.60966.peg.2623 CDS 2420545 2420399 −1 147 hypothetical protein -none- NA NA
fig|6666666.60966.peg.108 CDS 106117 106266 1 + 150 hypothetical protein -none- NA NA
fig|6666666.60966.peg.813 CDS 746234 746085 −2 150 hypothetical protein -none- NA NA
fig|6666666.60966.peg.1296 CDS 1205130 1205279 3 + 150 hypothetical protein -none- NA NA
fig|6666666.60966.peg.1334 CDS 1235992 1235843 −1 150 hypothetical protein -none- NA NA
fig|6666666.60966.peg.2300 CDS 2134634 2134485 −2 150 hypothetical protein -none- NA NA
fig|6666666.60966.peg.35 CDS 36062 35910 −2 153 hypothetical protein -none- NA NA
fig|6666666.60966.peg.1312 CDS 1215961 1216113 1 + 153 hypothetical protein -none- NA NA
fig|6666666.60966.peg.2143 CDS 1990257 1990105 −3 153 hypothetical protein -none- NA NA
fig|6666666.60966.peg.359 CDS 335237 335392 2 + 156 hypothetical protein -none- NA NA
fig|6666666.60966.peg.546 CDS 506105 505950 −2 156 FIG00858972: -none- NA NA
hypothetical protein
fig|6666666.60966.peg.1174 CDS 1095978 1095823 −3 156 Mobile element protein -none- NA NA
fig|6666666.60966.peg.1384 CDS 1296435 1296280 −3 156 hypothetical protein -none- NA NA
fig|6666666.60966.peg.2575 CDS 2378324 2378169 −2 156 hypothetical protein -none- NA NA
fig|6666666.60966.peg.89 CDS 85217 85059 −2 159 hypothetical protein -none- NA NA
fig|6666666.60966.peg.556 CDS 516983 516825 −2 159 hypothetical protein -none- NA NA
fig|6666666.60966.peg.562 CDS 523304 523462 2 + 159 hypothetical protein -none- NA NA
fig|6666666.60966.peg.1099 CDS 1029431 1029589 2 + 159 hypothetical protein -none- NA NA
fig|6666666.60966.peg.1571 CDS 1466563 1466405 −1 159 hypothetical protein -none- NA NA
fig|6666666.60966.peg.613 CDS 562226 562065 −2 162 hypothetical protein -none- NA NA
fig|6666666.60966.peg.886 CDS 814562 814401 −2 162 hypothetical protein -none- NA NA
fig|6666666.60966.peg.1114 CDS 1043720 1043559 −2 162 hypothetical protein -none- NA NA
fig|6666666.60966.peg.291 CDS 265661 265825 2 + 165 FIG00856904: -none- NA NA
hypothetical protein
fig|6666666.60966.peg.2077 CDS 1934012 1933848 −2 165 hypothetical protein -none- NA NA
fig|6666666.60966.peg.620 CDS 568234 568401 1 + 168 Methyltransferase (EC -none- NA NA
2.1.1.—)
fig|6666666.60966.peg.2317 CDS 2149354 2149521 1 + 168 Mobile element protein -none- NA NA
fig|6666666.60966.peg.2420 CDS 2241817 2241650 −1 168 hypothetical protein -none- NA NA
fig|6666666.60966.peg.856 CDS 785317 785147 −1 171 hypothetical protein -none- NA NA
fig|6666666.60966.peg.1487 CDS 1401876 1401706 −3 171 FIG00858878: -none- NA NA
hypothetical protein
fig|6666666.60966.peg.2286 CDS 2119703 2119873 2 + 171 hypothetical protein -none- NA NA
fig|6666666.60966.peg.2707 CDS 2514260 2514090 −2 171 hypothetical protein -none- NA NA
fig|6666666.60966.peg.862 CDS 790885 790712 −1 174 hypothetical protein -none- NA NA
fig|6666666.60966.peg.1450 CDS 1360555 1360382 −1 174 Mobile element protein -none- NA NA
fig|6666666.60966.peg.1572 CDS 1466783 1466956 2 + 174 hypothetical protein -none- NA NA
fig|6666666.60966.peg.1608 CDS 1494659 1494835 2 + 177 hypothetical protein -none- NA NA
fig|6666666.60966.peg.2416 CDS 2237303 2237127 −2 177 hypothetical protein -none- NA NA
fig|6666666.60966.peg.2668 CDS 2479940 2479764 −2 177 hypothetical protein -none- NA NA
fig|6666666.60966.peg.748 CDS 694556 694377 −2 180 hypothetical protein -none- NA NA
fig|6666666.60966.peg.1667 CDS 1550475 1550296 −3 180 hypothetical protein -none- NA NA
fig|6666666.60966.peg.2116 CDS 1965779 1965600 −2 180 hypothetical protein -none- NA NA
fig|6666666.60966.peg.2144 CDS 1990362 1990541 3 + 180 Mobile element protein -none- NA NA
fig|6666666.60966.peg.2400 CDS 2229074 2228895 −2 180 hypothetical protein -none- NA NA
fig|6666666.60966.peg.287 CDS 262264 262446 1 + 183 hypothetical protein -none- NA NA
fig|6666666.60966.peg.422 CDS 392649 392831 3 + 183 hypothetical protein -none- NA NA
fig|6666666.60966.peg.1562 CDS 1459862 1460044 2 + 183 hypothetical protein -none- NA NA
fig|6666666.60966.peg.2388 CDS 2218996 2219178 1 + 183 hypothetical protein -none- NA NA
fig|6666666.60966.peg.338 CDS 308508 308323 −3 186 hypothetical protein -none- NA NA
fig|6666666.60966.peg.1842 CDS 1720173 1719988 −3 186 hypothetical protein -none- NA NA
fig|6666666.60966.peg.286 CDS 262147 261959 −1 189 hypothetical protein -none- NA NA
fig|6666666.60966.peg.1202 CDS 1125016 1124828 −1 189 hypothetical protein -none- NA NA
fig|6666666.60966.peg.1304 CDS 1209919 1209731 −1 189 FIG00858878: -none- NA NA
hypothetical protein
fig|6666666.60966.peg.2395 CDS 2224520 2224332 −2 189 hypothetical protein -none- NA NA
fig|6666666.60966.peg.250 CDS 233011 233202 1 + 192 hypothetical protein -none- NA NA
fig|6666666.60966.peg.794 CDS 729662 729471 −2 192 hypothetical protein -none- NA NA
fig|6666666.60966.peg.1764 CDS 1639415 1639606 2 + 192 hypothetical protein -none- NA NA
fig|6666666.60966.peg.808 CDS 741018 740824 −3 195 hypothetical protein -none- NA NA
fig|6666666.60966.peg.276 CDS 255673 255870 1 + 198 Mobile element protein -none- NA NA
fig|6666666.60966.peg.749 CDS 694591 694788 1 + 198 hypothetical protein -none- NA NA
fig|6666666.60966.peg.2718 CDS 2523733 2523536 −1 198 hypothetical protein -none- NA NA
fig|6666666.60966.peg.217 CDS 203959 204159 1 + 201 Mobile element protein -none- NA NA
fig|6666666.60966.peg.682 CDS 631759 631959 1 + 201 FIG00859622: -none- NA NA
hypothetical protein
fig|6666666.60966.peg.208 CDS 199189 199392 1 + 204 Cold shock protein CspA Cold shock, CspA family NA NA
of proteins
fig|6666666.60966.peg.380 CDS 348880 348677 −1 204 SSU ribosomal protein -none- NA NA
S16p
fig|6666666.60966.peg.2149 CDS 1995706 1995503 −1 204 dTDP-4- Rhamnose containing NA NA
dehydrorhamnose glycans; <br>dTDP-
reductase (EC rhamnose synthesis
1.1.1.133)
fig|6666666.60966.peg.1148 CDS 1073050 1073259 1 + 210 hypothetical protein -none- NA NA
fig|6666666.60966.peg.2464 CDS 2281343 2281134 −2 210 hypothetical protein -none- NA NA
fig|6666666.60966.peg.522 CDS 484104 484316 3 + 213 LSU ribosomal protein -none- NA NA
L29p (L35e)
fig|6666666.60966.peg.1481 CDS 1395113 1394901 −2 213 hypothetical protein -none- NA NA
fig|6666666.60966.peg.292 CDS 265809 266024 3 + 216 hypothetical protein -none- NA NA
fig|6666666.60966.peg.511 CDS 475254 475469 3 + 216 SSU ribosomal protein Mycobacterium NA NA
S12p (S23e) virulence operon
involved in protein
synthesis (SSU ribosomal
proteins);
<br>Ribosomal protein
S12p Asp
methylthiotransferase
fig|6666666.60966.peg.529 CDS 490129 490347 1 + 219 Translation initiation Translation initiation NA NA
factor 1 factors bacterial
fig|6666666.60966.peg.2374 CDS 2207422 2207640 1 + 219 hypothetical protein -none- NA NA
fig|6666666.60966.peg.2105 CDS 1956719 1956940 2 + 222 hypothetical protein -none- NA NA
fig|6666666.60966.peg.2690 CDS 2502317 2502538 2 + 222 hypothetical protein -none- NA NA
fig|6666666.60966.peg.2153 CDS 1996354 1996578 1 + 225 hypothetical protein -none- NA NA
fig|6666666.60966.peg.2138 CDS 1985283 1985510 3 + 228 hypothetical protein -none- NA NA
fig|6666666.60966.peg.442 CDS 405529 405299 −1 231 hypothetical protein -none- NA NA
fig|6666666.60966.peg.1716 CDS 1598000 1597770 −2 231 hypothetical protein -none- NA NA
fig|6666666.60966.peg.2439 CDS 2259000 2258770 −3 231 hypothetical protein -none- NA NA
fig|6666666.60966.peg.1111 CDS 1042874 1043110 2 + 237 Mobile element protein -none- NA NA
fig|6666666.60966.peg.1999 CDS 1865704 1865468 −1 237 hypothetical protein -none- NA NA
fig|6666666.60966.peg.1214 CDS 1136308 1136069 −1 240 hypothetical protein -none- NA NA
fig|6666666.60966.peg.1733 CDS 1614273 1614031 −3 243 hypothetical protein -none- NA NA
fig|6666666.60966.peg.48 CDS 47253 47498 3 + 246 Alpha-L-Rha alpha-1,3- Rhamnose containing NA NA
L-rhamnosyltransferase glycans
(EC 2.4.1.—)
fig|6666666.60966.peg.423 CDS 393586 393338 −1 249 Mobile element protein -none- NA NA
fig|6666666.60966.peg.429 CDS 396754 396506 −1 249 Transglycosylase- -none- NA NA
associated protein
fig|6666666.60966.peg.1147 CDS 1072594 1072842 1 + 249 hypothetical protein -none- NA NA
fig|6666666.60966.peg.1951 CDS 1824656 1824408 −2 249 Plasmid stabilization -none- NA NA
system protein
fig|6666666.60966.peg.2579 CDS 2380195 2380446 1 + 252 Mobile element protein -none- NA NA
fig|6666666.60966.peg.523 CDS 484294 484548 1 + 255 SSU ribosomal protein -none- NA NA
S17p (S11e)
fig|6666666.60966.peg.1022 CDS 948522 948782 3 + 261 Stringent starvation Carbon Starvation NA NA
protein B
fig|6666666.60966.peg.1957 CDS 1826664 1826936 3 + 273 hypothetical protein -none- NA NA
fig|6666666.60966.peg.2273 CDS 2108052 2108336 3 + 285 putative DNA transport -none- NA NA
competence protein
fig|6666666.60966.peg.46 CDS 46807 46481 −1 327 Conserved domain -none- NA NA
protein
fig|6666666.60966.peg.2109 CDS 1959886 1960239 1 + 354 hypothetical protein -none- NA NA
fig|6666666.60966.peg.2429 CDS 2248841 2248488 −2 354 hypothetical protein -none- NA NA
fig|6666666.60966.peg.1579 CDS 1468834 1469334 1 + 501 hypothetical protein -none- NA NA
fig|6666666.60966.peg.293 CDS 266114 266689 2 + 576 hypothetical protein -none- NA NA

SUPPLEMENTARY TABLE 2
Selected D23 sequences
SEQ ID
and
length Description Sequence
SEQ ID amoC1 MATTLGTSSASSVSSRGYDMSLWYDSKFYKFGLITMLLVAIFWVWYQRYF
NO: 4 (D23_1c22 AYSHGMDSMEPEFDRVWMGLWRVHMAIMPLFALVTWGWIWKTRDTEEQLN
(271 72) NLDPKLEIKRYFYYMMWLGVYIFGVYWGGSFFTEQDASWHQVIIRDTSFT
aa) protein PSHVVVFYGSFPMYIVCGVATYLYAMTRLPLFHRGISFPLVMAIAGPLMI
LPNVGLNEWGHAFWFMEELFSAPLHWGFVVLGWAGLFQGGVAAQIITRYS
NLTDVVWNNQSKEILNNRVVA
SEQ ID amoC1 ATGGCAACTACGTTAGGAACGAGCAGTGCCTCATCAGTCTCATCAAGAGG
NO: 5 (D23_1c22 CTATGACATGTCACTGTGGTATGACTCCAAATTTTATAAATTTGGTTTAA
(816 72) DNA TAACCATGTTGTTGGTAGCGATATTCTGGGTATGGTATCAACGTTACTTT
nt) GCCTATTCACACGGAATGGATTCAATGGAACCAGAGTTTGACCGTGTATG
GATGGGCCTGTGGCGTGTGCACATGGCCATTATGCCGCTGTTTGCACTGG
TAACCTGGGGCTGGATCTGGAAAACACGTGATACAGAAGAGCAATTGAAT
AACCTGGATCCGAAACTGGAAATCAAACGCTACTTCTACTACATGATGTG
GCTGGGTGTATACATTTTTGGTGTTTACTGGGGTGGTAGCTTCTTTACGG
AGCAAGATGCCTCCTGGCACCAGGTGATTATTCGTGACACCAGCTTTACA
CCAAGTCACGTAGTCGTGTTTTATGGATCATTTCCGATGTACATCGTCTG
CGGAGTTGCAACCTATCTGTATGCAATGACCCGTCTGCCGCTGTTTCATC
GTGGAATTTCTTTCCCACTGGTGATGGCGATTGCAGGTCCTCTGATGATT
CTGCCAAACGTTGGTCTGAATGAATGGGGTCATGCTTTCTGGTTCATGGA
AGAGCTGTTCAGCGCACCGCTGCATTGGGGTTTTGTAGTGCTCGGTTGGG
CTGGGTTATTCCAGGGTGGAGTTGCTGCCCAAATCATTACCCGTTATTCC
AACCTGACTGACGTGGTCTGGAATAATCAAAGCAAAGAAATTCTGAATAA
CCGGGTTGTAGCTTAG
SEQ ID amoA1 VSIFRTEEILKAAKMPPEAVHMSRLIDAVYFPILVVLLVGTYHMHFMLLA
NO: 6 (D23_1c22 GDWDFWMDWKDRQWWPVVTPIVGITYCSAIMYYLWVNYRQPFGATLCVVC
(276 71) LLIGEWLTRYWGFYWWSHYPLNFVTPGIMLPGALMLDFTMYLTRNWLVTA
aa) protein LVGGGFFGLLFYPGNWAIFGPTHLPIVVEGTLLSMADYMGHLYVRTGTPE
YVRHIEQGSLRTFGGHTTVIAAFFAAFVSMLMFAVWWYLGKVYCTAFFYV
KGKRGRIVQRNDVTAFGEEGFPEGIK
SEQ ID amoA1 GTGAGTATATTTAGAACAGAAGAGATCCTGAAAGCGGCCAAGATGCCGCC
NO: 7 (D23_1c22 GGAAGCGGTCCATATGTCACGCCTGATTGATGCGGTTTATTTTCCGATTC
(831 71) DNA TGGTTGTTCTGTTGGTAGGTACCTACCATATGCACTTCATGTTGTTGGCA
nt) GGTGACTGGGATTTCTGGATGGACTGGAAAGATCGTCAATGGTGGCCTGT
AGTAACACCTATTGTAGGCATTACCTATTGCTCGGCAATTATGTATTACC
TGTGGGTCAACTACCGTCAACCATTTGGTGCGACTCTGTGCGTAGTGTGT
TTGCTGATAGGTGAGTGGCTGACACGTTACTGGGGTTTCTACTGGTGGTC
ACACTATCCACTCAATTTTGTAACCCCAGGTATCATGCTCCCGGGTGCAT
TGATGTTGGATTTCACAATGTATCTGACACGTAACTGGTTGGTGACTGCA
TTGGTTGGGGGTGGATTCTTTGGTCTGCTGTTTTACCCGGGTAACTGGGC
AATCTTTGGTCCGACCCATCTGCCAATCGTTGTAGAAGGAACACTGTTGT
CGATGGCTGACTATATGGGTCACCTGTATGTTCGTACGGGTACACCTGAG
TATGTTCGTCATATTGAACAAGGTTCATTACGTACCTTTGGTGGTCACAC
CACAGTTATTGCAGCATTCTTCGCTGCGTTTGTATCCATGCTGATGTTTG
CAGTCTGGTGGTATCTTGGAAAAGTTTACTGCACAGCCTTCTTCTACGTT
AAAGGTAAAAGAGGACGTATCGTGCAGCGCAATGATGTTACGGCATTTGG
TGAAGAAGGGTTTCCAGAGGGGATCAAATAA
SEQ ID amoB1 MGIKNLYKRGMMGLCGVAVYAMAALTMTVTLDVSTVAAHGERSQEPFLRM
NO: 8 (D23_1c22 RTVQWYDVKWGPEVTKVNENAQITGKFHLAEDWPRAAARPDFAFFNVGSP
(421 70) SSVYVRLSTKINGHPWFISGPLQIGRDYAFEVQLRARIPGRHHMHAMLNV
aa) protein KDAGPIAGPGAWMNITGSWDDFTNPLKLLTGETIDSETFNLSNGIFWHIL
WMSIGIFWIGIFVARPMFLPRSRVLLAYGDDLLLDPMDKKITWVLAILTL
AIVWGGYRYTETKHPYTVPIQAGQSKVAPLPVAPNPVAIKITDANYDVPG
RALRVSMEVTNNGDTPVTFGEFTTAGIRFVNSTGRKYLDPQYPRELVAVG
LNFDDDGAIQPGETKQLRMEAKDALWEIQRLMALLGDPESRFGGLLMSWD
SEGNRHINSIAGPVIPVFTKL
SEQ ID amoB1 ATGGGTATCAAGAACCTTTATAAACGTGGAATGATGGGACTTTGTGGCGT
NO: 9 (D23_1c22 TGCTGTTTATGCAATGGCGGCACTGACCATGACAGTGACACTAGATGTCT
(1266 70) DNA CAACAGTAGCAGCCCATGGAGAACGATCCCAGGAACCGTTTCTTCGGATG
nt) CGTACAGTACAGTGGTACGATGTTAAGTGGGGTCCGGAAGTAACCAAAGT
CAATGAGAATGCCCAAATTACCGGCAAATTTCACTTGGCTGAAGACTGGC
CGCGTGCGGCAGCAAGACCGGATTTCGCATTCTTTAACGTAGGTAGCCCA
AGCTCGGTATACGTGCGTTTGAGTACGAAGATTAATGGCCACCCATGGTT
TATTTCAGGTCCGCTGCAAATTGGTCGTGACTATGCGTTCGAAGTTCAGC
TGAGAGCACGTATTCCAGGACGCCATCACATGCACGCCATGTTAAACGTT
AAAGATGCAGGTCCAATTGCAGGACCGGGTGCATGGATGAACATTACCGG
AAGCTGGGATGATTTTACTAATCCACTCAAGCTGCTGACAGGCGAAACAA
TTGACTCAGAAACATTCAACCTGTCAAACGGTATTTTCTGGCATATTCTC
TGGATGTCAATTGGTATATTTTGGATTGGTATCTTTGTAGCGCGTCCGAT
GTTCCTGCCACGTAGCCGGGTATTGCTCGCTTATGGTGATGATCTGTTGC
TGGATCCGATGGATAAGAAAATCACCTGGGTACTTGCAATCCTGACCTTG
GCTATAGTATGGGGTGGATACCGCTATACAGAAACCAAGCATCCATACAC
AGTACCTATCCAGGCTGGTCAATCCAAAGTTGCACCATTACCGGTAGCAC
CAAATCCGGTAGCAATCAAAATTACAGATGCTAACTATGACGTACCGGGA
CGTGCACTGCGTGTATCGATGGAAGTAACCAACAACGGTGATACACCAGT
CACATTTGGTGAATTTACCACAGCAGGTATTCGTTTCGTTAACAGTACCG
GCCGCAAGTACCTGGATCCACAGTATCCTCGTGAACTGGTTGCAGTAGGC
TTGAATTTTGATGATGATGGTGCAATTCAGCCAGGCGAGACCAAGCAATT
GAGGATGGAAGCCAAAGATGCTCTGTGGGAAATCCAACGTCTGATGGCGT
TGCTGGGTGACCCGGAAAGCCGTTTTGGTGGACTGTTAATGTCTTGGGAT
TCAGAAGGTAATCGCCATATCAACAGTATTGCTGGTCCGGTGATTCCAGT
CTTTACCAAGCTCTAA
SEQ ID amoC2 MATTLGTSSASSVSSRGYDMSLWYDSKFYKFGLITMLLVAIFWVWYQRYF
NO: 10 (D23_1c25 AYSHGMDSMEPEFDRVWMGLWRVHMAIMPLFALVTWGWIWKTRDTEEQLN
(271 12) NLDPKLEIKRYFYYMMWLGVYIFGVYWGGSFFTEQDASWHQVIIRDTSFT
aa) protein PSHVVVFYGSFPMYIVCGVATYLYAMTRLPLFHRGISFPLVMAIAGPLMI
LPNVGLNEWGHAFWFMEELFSAPLHWGFVVLGWAGLFQGGVAAQIITRYS
NLTDVVWNNQSKEILNNRVVA
SEQ ID amoC2 ATGGCAACTACGTTAGGAACGAGCAGTGCCTCATCAGTCTCATCAAGAGG
NO: 11 (D23_1c25 CTATGACATGTCACTGTGGTATGACTCCAAATTTTATAAATTTGGTTTAA
(816 12) DNA TAACCATGTTGTTGGTAGCGATATTCTGGGTATGGTATCAACGTTACTTT
nt) GCCTATTCACACGGAATGGATTCAATGGAACCAGAGTTTGACCGTGTATG
GATGGGCCTGTGGCGTGTGCACATGGCCATTATGCCGCTGTTTGCACTGG
TAACCTGGGGCTGGATCTGGAAAACACGTGATACAGAAGAGCAATTGAAT
AACCTGGATCCGAAACTGGAAATCAAACGCTACTTCTACTACATGATGTG
GCTGGGTGTATACATTTTTGGTGTTTACTGGGGTGGTAGCTTCTTTACGG
AGCAAGATGCCTCCTGGCACCAGGTGATTATTCGTGACACCAGCTTTACA
CCAAGTCACGTAGTCGTGTTTTATGGATCATTTCCGATGTACATCGTCTG
CGGAGTTGCAACCTATCTGTATGCAATGACCCGTCTGCCGCTGTTTCATC
GTGGAATTTCTTTCCCACTGGTGATGGCGATTGCAGGTCCTCTGATGATT
CTGCCAAACGTTGGTCTGAATGAATGGGGTCATGCTTTCTGGTTCATGGA
AGAGCTGTTCAGCGCACCGCTGCATTGGGGTTTTGTAGTGCTCGGTTGGG
CTGGGTTATTCCAGGGTGGAGTTGCTGCCCAAATCATTACCCGTTATTCC
AACCTGACTGACGTGGTCTGGAATAATCAAAGCAAAGAAATTCTGAATAA
CCGGGTTGTAGCTTAG
SEQ ID amoA2 VSIFRTEEILKAAKMPPEAVHMSRLIDAVYFPILVVLLVGTYHMHFMLLA
NO: 12 (D23_1c25 GDWDFWMDWKDRQWWPVVTPIVGITYCSAIMYYLWVNYRQPFGATLCVVC
(276 11) LLIGEWLTRYWGFYWWSHYPLNFVTPGIMLPGALMLDFTMYLTRNWLVTA
aa) protein LVGGGFFGLLFYPGNWAIFGPTHLPIVVEGTLLSMADYMGHLYVRTGTPE
YVRHIEQGSLRTFGGHTTVIAAFFAAFVSMLMFAVWWYLGKVYCTAFFYV
KGKRGRIVQRNDVTAFGEEGFPEGIK
SEQ ID amoA2 GTGAGTATATTTAGAACAGAAGAGATCCTGAAAGCGGCCAAGATGCCGCC
NO: 13 (D23_1c25 GGAAGCGGTCCATATGTCACGCCTGATTGATGCGGTTTATTTTCCGATTC
(831 11) DNA TGGTTGTTCTGTTGGTAGGTACCTACCATATGCACTTCATGTTGTTGGCA
nt) GGTGACTGGGATTTCTGGATGGACTGGAAAGATCGTCAATGGTGGCCTGT
AGTAACACCTATTGTAGGCATTACCTATTGCTCGGCAATTATGTATTACC
TGTGGGTCAACTACCGTCAACCATTTGGTGCGACTCTGTGCGTAGTGTGT
TTGCTGATAGGTGAGTGGCTGACACGTTACTGGGGTTTCTACTGGTGGTC
ACACTATCCACTCAATTTTGTAACCCCAGGTATCATGCTCCCGGGTGCAT
TGATGTTGGATTTCACAATGTATCTGACACGTAACTGGTTGGTGACTGCA
TTGGTTGGGGGTGGATTCTTTGGTCTGCTGTTTTACCCGGGTAACTGGGC
AATCTTTGGTCCGACCCATCTGCCAATCGTTGTAGAAGGAACACTGTTGT
CGATGGCTGACTATATGGGTCACCTGTATGTTCGTACGGGTACACCTGAG
TATGTTCGTCATATTGAACAAGGTTCATTACGTACCTTTGGTGGTCACAC
CACAGTTATTGCAGCATTCTTCGCTGCGTTTGTATCCATGCTGATGTTTG
CAGTCTGGTGGTATCTTGGAAAAGTTTACTGCACAGCCTTCTTCTACGTT
AAAGGTAAAAGAGGACGTATCGTGCAGCGCAATGATGTTACGGCATTTGG
TGAAGAAGGGTTTCCAGAGGGGATCAAATAA
SEQ ID amoB2 MGIKNLYKRGMMGLCGVAVYAMAALTMTVTLDVSTVAAHGERSQEPFLRM
NO: 14 (D23_1c25 RTVQWYDVKWGPEVTKVNENAQITGKFHLAEDWPRAAARPDFAFFNVGSP
(421 10) SSVYVRLSTKINGHPWFISGPLQIGRDYAFEVQLRARIPGRHHMHAMLNV
aa) protein KDAGPIAGPGAWMNITGSWDDFTNPLKLLTGETIDSETFNLSNGIFWHIL
WMSIGIFWIGIFVARPMFLPRSRVLLAYGDDLLLDPMDKKITWVLAILTL
AIVWGGYRYTETKHPYTVPIQAGQSKVAPLPVAPNPVAIKITDANYDVPG
RALRVSMEVTNNGDTPVTFGEFTTAGIRFVNSTGRKYLDPQYPRELVAVG
LNFDDDGAIQPGETKQLRMEAKDALWEIQRLMALLGDPESRFGGLLMSWD
SEGNRHINSIAGPVIPVFTKL
SEQ ID amoB2 ATGGGTATCAAGAACCTTTATAAACGTGGAATGATGGGACTTTGTGGCGT
NO: 15 (D23_1c25 TGCTGTTTATGCAATGGCGGCACTGACCATGACAGTGACACTAGATGTCT
(1266 10) DNA CAACAGTAGCAGCCCATGGAGAACGATCCCAGGAACCGTTTCTTCGGATG
nt) CGTACAGTACAGTGGTACGATGTTAAGTGGGGTCCGGAAGTAACCAAAGT
CAATGAGAATGCCCAAATTACCGGCAAATTTCACTTGGCTGAAGACTGGC
CGCGTGCGGCAGCAAGACCGGATTTCGCATTCTTTAACGTAGGTAGCCCA
AGCTCGGTATACGTGCGTTTGAGTACGAAGATTAATGGCCACCCATGGTT
TATTTCAGGTCCGCTGCAAATTGGTCGTGACTATGCGTTCGAAGTTCAGC
TGAGAGCACGTATTCCAGGACGCCATCACATGCACGCCATGTTAAACGTT
AAAGATGCAGGTCCAATTGCAGGACCGGGTGCATGGATGAACATTACCGG
AAGCTGGGATGATTTTACTAATCCACTCAAGCTGCTGACAGGCGAAACAA
TTGACTCAGAAACATTCAACCTGTCAAACGGTATTTTCTGGCATATTCTC
TGGATGTCAATTGGTATATTTTGGATTGGTATCTTTGTAGCGCGTCCGAT
GTTCCTGCCACGTAGCCGGGTATTGCTCGCTTATGGTGATGATCTGTTGC
TGGATCCGATGGATAAGAAAATCACCTGGGTACTTGCAATCCTGACCTTG
GCTATAGTATGGGGTGGATACCGCTATACAGAAACCAAGCATCCATACAC
AGTACCTATCCAGGCTGGTCAATCCAAAGTTGCACCATTACCGGTAGCAC
CAAATCCGGTAGCAATCAAAATTACAGATGCTAACTATGACGTACCGGGA
CGTGCACTGCGTGTATCGATGGAAGTAACCAACAACGGTGATACACCAGT
CACATTTGGTGAATTTACCACAGCAGGTATTCGTTTCGTTAACAGTACCG
GCCGCAAGTACCTGGATCCACAGTATCCTCGTGAACTGGTTGCAGTAGGC
TTGAATTTTGATGATGATGGTGCAATTCAGCCAGGCGAGACCAAGCAATT
GAGGATGGAAGCCAAAGATGCTCTGTGGGAAATCCAACGTCTGATGGCGT
TGCTGGGTGACCCGGAAAGCCGTTTTGGTGGACTGTTAATGTCTTGGGAT
TCAGAAGGTAATCGCCATATCAACAGTATTGCTGGTCCGGTGATTCCAGT
CTTTACCAAGCTCTAA
SEQ ID amoC3 MATNILKDKAAQQVADKPTYDKSEWFDAKYYKFGLLPILAVAVMWVYFQR
NO: 16 (D23_1c16 TYAYSHGMDSMEPEFDRIWMGLWRVQMAALPLIALFTWGWLYKTRNTAEQ
(274 05) LANLTPKQEIKRYFYFLMWLGVYIFAVYWGSSFFTEQDASWHQVIIRDTS
aa) protein FTPSHIPLFYGSFPVYIIMGVSMIIYANTRLPLYNKGWSFPLIMTVAGPL
MSLPNVGLNEWGHAFWFMEELFSAPLHWGFVILAWAALFQGGLAVQIIAR
FSNLLDVEWNKQDRAILDDVVTAP
SEQ ID amoC3 ATGGCTACAAATATATTAAAAGACAAAGCTGCACAGCAGGTTGCTGATAA
NO: 17 (D23_1c16 ACCAACTTATGATAAATCCGAGTGGTTTGATGCTAAATACTATAAATTCG
(825 05) DNA GGCTGCTACCTATCTTAGCTGTAGCTGTGATGTGGGTTTATTTCCAGCGC
nt) ACATACGCCTATTCTCACGGCATGGATTCAATGGAACCGGAATTTGACCG
GATCTGGATGGGCTTGTGGCGTGTTCAAATGGCCGCTCTGCCTCTTATAG
CACTTTTTACGTGGGGATGGTTATATAAAACCCGCAATACTGCAGAACAG
CTTGCCAATCTGACTCCAAAGCAGGAAATAAAGCGGTATTTCTATTTCCT
CATGTGGCTTGGGGTCTATATATTTGCAGTTTACTGGGGATCAAGCTTCT
TTACCGAGCAGGACGCTTCATGGCACCAGGTGATTATCAGGGATACAAGT
TTTACTCCTAGCCATATTCCTCTGTTTTATGGTTCATTCCCGGTATACAT
CATCATGGGAGTATCGATGATTATTTACGCCAACACCCGGTTGCCGCTGT
ACAACAAAGGGTGGTCATTCCCTCTGATCATGACCGTAGCAGGACCGTTG
ATGAGTCTGCCTAACGTTGGCCTGAACGAGTGGGGACACGCCTTCTGGTT
CATGGAAGAACTTTTCAGCGCACCGCTGCACTGGGGCTTCGTGATTCTGG
CTTGGGCTGCCCTGTTCCAGGGTGGGCTTGCAGTACAGATCATAGCTCGC
TTTTCCAACTTGCTTGACGTGGAGTGGAATAAACAAGACAGAGCCATATT
GGACGATGTCGTAACTGCTCCTTAA
SEQ ID hao1 MRLGEYLKGMLLCAGLLLIGPVQADISTVPDETYEALKLDRSKATPKETY
NO: 18 (D23_1c25 DALVKRYKDPAHGAGKGTMGDYWEPIALSIYMDPSTFYKPPVSPKEIAER
(570 29) KDCVECHSDETPVWVRAWKRSTHANLDKIRNLKPEDPLFYKKGKLEEVEN
aa) protein NLRSMGKLGEKEALKEVGCIDCHVDINAKKKADHTKDVRMPTADVCGTCH
LREFAERESERDTMIWPNGQWPDGRPSHALDYTANIETTVWAAMPQREVA
EGCTMCHTNQNKCDNCHTRHEFSAAESRKPEACATCHSGVDHNNYEAYIM
SKHGKLAEMNRENWNWNVRLKDAFSKGGQTAPTCAACHMEYEGEYTHNIT
RKTRWANYPFVPGIAENITSDWSEARLDSWVVTCTQCHSERFARSYLDLM
DKGTLEGLAKYQEANAIVHKMYEDGTLTGQKTNRPNPPAPEKPGFGIFTQ
LFWSKGNNPASLELKVLEMAENNLAKMHVGLAHVNPGGWTYTEGWGPMNR
AYVEIQDEYTKMQEMTALQARVNKLEGKKTSLLDLKGAGEKISLGGLGGG
MLLAGAIALIGWRKRKQTQA
SEQ ID hao1 ATGAGATTAGGGGAGTATTTGAAGGGGATGCTGCTGTGTGCGGGCCTGTT
NO: 19 (D23_1c25 GTTGATTGGGCCGGTACAGGCGGATATATCGACGGTACCGGATGAGACGT
(1713 29) DNA ATGAAGCATTGAAGCTGGATCGCAGCAAAGCCACGCCGAAAGAGACCTAT
nt) GATGCGCTGGTGAAGCGTTACAAGGATCCTGCACATGGTGCTGGCAAGGG
CACGATGGGAGACTACTGGGAACCGATAGCGCTTAGTATCTACATGGACC
CGAGCACCTTTTACAAACCACCGGTTTCCCCGAAAGAAATTGCTGAGCGC
AAAGACTGCGTTGAATGCCACTCTGATGAAACGCCGGTTTGGGTAAGAGC
ATGGAAACGCAGCACCCACGCCAACCTGGACAAAATACGCAACCTCAAGC
CGGAAGATCCGCTTTTTTACAAAAAAGGCAAGCTGGAAGAAGTTGAGAAC
AACCTGCGCTCCATGGGCAAACTTGGAGAGAAGGAAGCGCTCAAGGAAGT
AGGCTGTATTGACTGTCACGTTGACATCAACGCCAAAAAGAAAGCAGATC
ACACCAAAGACGTACGCATGCCTACAGCTGACGTTTGCGGAACCTGTCAC
CTGAGAGAATTTGCCGAGCGTGAATCCGAGCGTGACACCATGATCTGGCC
GAATGGCCAGTGGCCTGACGGACGTCCATCCCACGCACTGGACTACACAG
CCAACATTGAAACCACCGTTTGGGCAGCCATGCCGCAACGTGAAGTGGCA
GAAGGTTGCACCATGTGCCACACCAACCAGAACAAATGCGACAACTGCCA
TACCCGCCATGAATTTTCGGCGGCAGAATCCCGCAAACCGGAAGCCTGTG
CCACCTGTCACAGCGGCGTGGATCATAATAACTATGAAGCCTACATTATG
TCCAAGCACGGCAAACTGGCTGAAATGAACCGGGAGAACTGGAACTGGAA
TGTTCGTCTGAAAGACGCCTTCTCCAAAGGAGGTCAGACCGCACCGACCT
GTGCAGCCTGCCACATGGAATACGAAGGGGAATATACCCATAACATCACC
CGTAAGACCCGCTGGGCAAACTACCCGTTTGTTCCGGGGATTGCAGAAAA
CATCACCAGCGACTGGTCAGAAGCTCGTCTGGATTCCTGGGTTGTGACCT
GTACCCAATGTCACTCGGAACGGTTTGCCCGCTCCTACCTGGATCTCATG
GACAAAGGTACCCTGGAAGGGTTGGCTAAATACCAGGAAGCCAATGCCAT
TGTTCACAAAATGTATGAAGACGGCACCCTGACTGGTCAAAAAACCAATC
GTCCGAATCCACCGGCGCCAGAGAAACCGGGTTTTGGTATCTTCACCCAA
CTGTTCTGGTCCAAGGGTAACAACCCGGCCTCACTTGAACTGAAAGTGCT
GGAAATGGCAGAAAACAACCTGGCCAAAATGCACGTAGGACTGGCACACG
TTAATCCAGGTGGCTGGACATATACCGAAGGTTGGGGCCCGATGAACCGT
GCCTATGTTGAAATCCAGGATGAATACACCAAGATGCAGGAAATGACAGC
TCTGCAAGCGCGTGTTAACAAACTGGAAGGTAAAAAAACCAGCCTGCTTG
ACCTCAAGGGAGCGGGAGAAAAGATCTCGCTGGGAGGACTGGGAGGTGGC
ATGTTGCTGGCGGGAGCGATTGCTCTGATTGGCTGGCGTAAACGTAAGCA
AACGCAAGCTTGA
SEQ ID hao2 MRLGEYLKGMLLCAGLLLIGPVQADISTVPDETYEALKLDRSKATPKETY
NO: 20 (D23_1c19 DALVKRYKDPAHGAGKGTMGDYWEPIALSIYMDPSTFYKPPVSPKEIAER
(570 26) KDCVECHSDETPVWVRAWKRSTHANLDKIRNLKPEDPLFYKKGKLEEVEN
aa) protein NLRSMGKLGEKEALKEVGCIDCHVDINAKKKADHTKDVRMPTADVCGTCH
LREFAERESERDTMIWPNGQWPDGRPSHALDYTANIETTVWAAMPQREVA
EGCTMCHTNQNKCDNCHTRHEFSAAESRKPEACATCHSGVDHNNYEAYIM
SKHGKLAEMNRENWNWNVRLKDAFSKGGQTAPTCAACHMEYEGEYTHNIT
RKTRWANYPFVPGIAENITSDWSEARLDSWVVTCTQCHSERFARSYLDLM
DKGTLEGLAKYQEANAIVHKMYEDGTLTGQKTNRPNPPAPEKPGFGIFTQ
LFWSKGNNPASLELKVLEMAENNLAKMHVGLAHVNPGGWTYTEGWGPMNR
AYVEIQDEYTKMQEMTALQARVNKLEGKKTSLLDLKGAGEKISLGGLGGG
MLLAGAIALIGWRKRKQTQA
SEQ ID hao2 ATGAGATTAGGGGAGTATTTGAAGGGGATGCTGCTGTGTGCGGGCCTGTT
NO: 21 (D23_1c19 GTTGATTGGGCCGGTACAGGCGGATATATCGACGGTACCGGATGAGACGT
(1713 26) DNA ATGAAGCATTGAAGCTGGATCGCAGCAAAGCCACGCCGAAAGAGACCTAT
nt) GATGCGCTGGTGAAGCGTTACAAGGATCCTGCACATGGTGCTGGCAAGGG
CACGATGGGAGACTACTGGGAACCGATAGCGCTTAGTATCTACATGGACC
CGAGCACCTTTTACAAACCACCGGTTTCCCCGAAAGAAATTGCTGAGCGC
AAAGACTGCGTTGAATGCCACTCTGATGAAACGCCGGTTTGGGTAAGAGC
ATGGAAACGCAGCACCCACGCCAACCTGGACAAAATACGCAACCTCAAGC
CGGAAGATCCGCTTTTTTACAAAAAAGGCAAGCTGGAAGAAGTTGAGAAC
AACCTGCGCTCCATGGGCAAACTTGGAGAGAAGGAAGCGCTCAAGGAAGT
AGGCTGTATTGACTGTCACGTTGACATCAACGCCAAAAAGAAAGCAGATC
ACACCAAAGACGTACGCATGCCTACAGCTGACGTTTGCGGAACCTGTCAC
CTGAGAGAATTTGCCGAGCGTGAATCCGAGCGTGACACCATGATCTGGCC
GAATGGCCAGTGGCCTGACGGACGTCCATCCCACGCACTGGACTACACAG
CCAACATTGAAACCACCGTTTGGGCAGCCATGCCGCAACGTGAAGTGGCA
GAAGGTTGCACCATGTGCCACACCAACCAGAACAAATGCGACAACTGCCA
TACCCGCCATGAATTTTCGGCGGCAGAATCCCGCAAACCGGAAGCCTGTG
CCACCTGTCACAGCGGCGTGGATCATAATAACTATGAAGCCTACATTATG
TCCAAGCACGGCAAACTGGCTGAAATGAACCGGGAGAACTGGAACTGGAA
TGTTCGTCTGAAAGACGCCTTCTCCAAAGGAGGTCAGACCGCACCGACCT
GTGCAGCCTGCCACATGGAATACGAAGGGGAATATACCCATAACATCACC
CGTAAGACCCGCTGGGCAAACTACCCGTTTGTTCCGGGGATTGCAGAAAA
CATCACCAGCGACTGGTCAGAAGCTCGTCTGGATTCCTGGGTTGTGACCT
GTACCCAATGTCACTCGGAACGGTTTGCCCGCTCCTACCTGGATCTCATG
GACAAAGGTACCCTGGAAGGGTTGGCTAAATACCAGGAAGCCAATGCCAT
TGTTCACAAAATGTATGAAGACGGCACCCTGACTGGTCAAAAAACCAATC
GTCCGAATCCACCGGCGCCAGAGAAACCGGGTTTTGGTATCTTCACCCAA
CTGTTCTGGTCCAAGGGTAACAACCCGGCCTCACTTGAACTGAAAGTGCT
GGAAATGGCAGAAAACAACCTGGCCAAAATGCACGTAGGACTGGCACACG
TTAATCCAGGTGGCTGGACATATACCGAAGGTTGGGGCCCGATGAACCGT
GCCTATGTTGAAATCCAGGATGAATACACCAAGATGCAGGAAATGACAGC
TCTGCAAGCGCGTGTTAACAAACTGGAAGGTAAAAAAACCAGCCTGCTTG
ACCTCAAGGGAGCGGGAGAAAAGATCTCGCTGGGAGGACTGGGAGGTGGC
ATGTTGCTGGCGGGAGCGATTGCTCTGATTGGCTGGCGTAAACGTAAGCA
AACGCAAGCTTGA
SEQ ID hao3 MRLGEYLKGMLLCAGLLLIGPVQADISTVPDETYEALKLDRSKATPKETY
NO: 22 (D23_1c17 DALVKRYKDPAHGAGKGTMGDYWEPIALSIYMDPSTFYKPPVSPKEIAER
(570 88) KDCVECHSDETPVWVRAWKRSTHANLDKIRNLKPEDPLFYKKGKLEEVEN
aa) protein NLRSMGKLGEKEALKEVGCIDCHVDINAKKKADHTKDVRMPTADVCGTCH
LREFAERESERDTMIWPNGQWPDGRPSHALDYTANIETTVWAAMPQREVA
EGCTMCHTNQNKCDNCHTRHEFSAAESRKPEACATCHSGVDHNNYEAYIM
SKHGKLAEMNRENWNWNVRLKDAFSKGGQTAPTCAACHMEYEGEYTHNIT
RKTRWANYPFVPGIAENITSDWSEARLDSWVVTCTQCHSERFARSYLDLM
DKGTLEGLAKYQEANAIVHKMYEDGTLTGQKTNRPNPPAPEKPGFGIFTQ
LFWSKGNNPASLELKVLEMAENNLAKMHVGLAHVNPGGWTYTEGWGPMNR
AYVEIQDEYTKMQEMTALQARVNKLEGKKTSLLDLKGAGEKISLGGLGGG
MLLAGAIALIGWRKRKQTQA
SEQ ID hao3 ATGAGATTAGGGGAGTATTTGAAGGGGATGCTGCTGTGTGCGGGCCTGTT
NO: 23 (D23_1c17 GTTGATTGGGCCGGTACAGGCGGATATATCGACGGTACCGGATGAGACGT
(1713 88) DNA ATGAAGCATTGAAGCTGGATCGCAGCAAAGCCACGCCGAAAGAGACCTAT
nt) GATGCGCTGGTGAAGCGTTACAAGGATCCTGCGCATGGTGCTGGCAAGGG
CACGATGGGAGACTACTGGGAACCGATAGCGCTTAGTATCTACATGGACC
CGAGCACCTTTTACAAACCACCGGTTTCCCCGAAAGAAATTGCTGAGCGC
AAAGACTGCGTTGAATGCCACTCTGATGAAACGCCGGTTTGGGTAAGAGC
ATGGAAACGCAGCACCCACGCCAACCTGGACAAAATACGCAACCTCAAGC
CGGAAGATCCGCTTTTTTACAAAAAAGGCAAGCTGGAAGAAGTTGAGAAC
AACCTGCGCTCCATGGGCAAACTTGGAGAGAAGGAAGCGCTCAAGGAAGT
AGGCTGTATTGACTGTCACGTTGACATCAACGCCAAAAAGAAAGCAGATC
ACACCAAAGACGTACGCATGCCTACAGCTGACGTTTGCGGAACCTGTCAC
CTGAGAGAATTTGCCGAGCGTGAATCCGAGCGTGACACCATGATCTGGCC
GAATGGCCAGTGGCCTGACGGACGTCCATCCCACGCACTGGACTACACAG
CCAACATTGAAACCACCGTTTGGGCAGCCATGCCGCAACGTGAAGTGGCA
GAAGGTTGCACCATGTGCCACACCAACCAGAACAAATGCGACAACTGCCA
TACCCGCCATGAATTTTCGGCGGCAGAATCCCGCAAACCGGAAGCCTGTG
CCACCTGTCACAGCGGCGTGGATCATAATAACTATGAAGCCTACATTATG
TCCAAGCACGGCAAACTGGCTGAAATGAACCGGGAGAACTGGAACTGGAA
TGTTCGTCTGAAAGACGCCTTCTCCAAAGGAGGTCAGACCGCACCGACCT
GTGCAGCCTGCCACATGGAATACGAAGGGGAATATACCCATAACATCACC
CGTAAGACCCGCTGGGCAAACTACCCGTTTGTTCCGGGGATTGCAGAAAA
CATCACCAGCGACTGGTCAGAAGCTCGTCTGGATTCCTGGGTTGTGACCT
GTACCCAATGTCACTCGGAACGGTTTGCCCGCTCCTACCTGGATCTCATG
GACAAAGGTACCCTGGAAGGGTTGGCTAAATACCAGGAAGCCAATGCCAT
TGTTCACAAAATGTATGAAGACGGCACCCTGACTGGTCAAAAAACCAATC
GTCCGAATCCACCGGCGCCAGAGAAACCGGGTTTTGGTATCTTCACCCAA
CTGTTCTGGTCCAAGGGTAACAACCCGGCCTCACTTGAACTGAAAGTGCT
GGAAATGGCAGAAAACAACCTGGCCAAAATGCACGTAGGACTGGCACACG
TTAATCCAGGTGGCTGGACATATACCGAAGGTTGGGGCCCGATGAACCGT
GCCTATGTTGAAATCCAGGATGAATACACCAAGATGCAGGAAATGACAGC
TCTGCAAGCGCGTGTTAACAAACTGGAAGGTAAAAAAACCAGCCTGCTTG
ACCTCAAGGGAGCGGGAGAAAAGATCTCGCTGGGAGGACTGGGAGGTGGC
ATGTTGCTGGCGGGAGCGATTGCTCTGATTGGCTGGCGTAAACGTAAGCA
AACGCAAGCTTGA
SEQ ID c554 MKIIIACGLVAAALFTLTSGQSLAADAPFEGRKKCSSCHKPQAQSWKHTA
NO: 24 cycA1 HAKAMESLKPNVKVEAKQKAKLDPTKDYTQDKDCVGCHVDGFGQKGGYTI
(235 (D23_1c25 DSPKPMLTGVGCESCHGPGRKYRGDHRKAGQAFEKSGKKAPRKTLASKGQ
aa) 27) DFNFEERCSACHLNYEGSPWKGAKPPYTPYTPEVDPKYTFKFDEMVKDVK
protein AMHEHYKLDGVFDGEPKFKFHDEFQANAKTAKKGK
SEQ ID c554 ATGAAAATAATAATAGCCTGCGGACTGGTTGCTGCAGCCCTGTTCACCCT
NO: 25 cycA1 GACAAGTGGGCAGAGTCTGGCAGCGGATGCTCCGTTTGAAGGTCGGAAAA
(708 (D23_1c25 AGTGCAGTTCCTGTCACAAACCACAAGCCCAGTCGTGGAAACATACTGCC
nt) 27) DNA CACGCCAAGGCGATGGAATCGCTCAAGCCCAATGTCAAAGTGGAAGCCAA
ACAAAAAGCCAAACTGGATCCTACCAAGGACTACACCCAGGACAAAGACT
GCGTAGGTTGCCACGTGGATGGATTTGGCCAGAAAGGCGGCTACACGATA
GACTCCCCCAAACCCATGCTGACTGGCGTAGGCTGTGAATCCTGCCACGG
GCCTGGACGTAAATACCGGGGAGATCACCGCAAGGCCGGGCAAGCATTTG
AGAAATCGGGCAAAAAAGCGCCGCGCAAGACCCTGGCAAGCAAGGGGCAA
GACTTTAATTTTGAAGAACGTTGCAGCGCCTGCCATCTGAACTATGAAGG
GTCACCCTGGAAAGGAGCAAAACCTCCCTATACCCCGTATACACCGGAAG
TGGATCCGAAATACACCTTCAAGTTTGACGAGATGGTAAAAGACGTCAAA
GCCATGCACGAGCATTACAAACTGGATGGCGTATTTGACGGAGAGCCTAA
ATTCAAGTTCCATGACGAATTCCAGGCCAACGCTAAAACTGCCAAAAAAG
GAAAATAG
SEQ ID cycA2 MKIIIACGLVAAALFTLTSGQSLAADAPFEGRKKCSSCHKPQAQSWKHTA
NO: 26 (D23_1c19 HAKAMESLKPNVKVEAKQKAKLDPTKDYTQDKDCVGCHVDGFGQKGGYTI
(235 24) DSPKPMLTGVGCESCHGPGRKYRGDHRKAGQAFEKSGKKAPRKTLASKGQ
aa) protein DFNFEERCSACHLNYEGSPWKGAKPPYTPYTPEVDPKYTFKFDEMVKDVK
AMHEHYKLDGVFDGEPKFKFHDEFQANAKTAKKGK
SEQ ID cycA2 ATGAAAATAATAATAGCCTGCGGACTGGTTGCTGCAGCCCTGTTCACCCT
NO: 27 (D23_1c19 GACAAGTGGGCAGAGTCTGGCAGCGGATGCTCCGTTTGAAGGTCGGAAAA
(708 24) DNA AGTGCAGTTCCTGTCACAAACCACAAGCCCAGTCGTGGAAACATACTGCC
nt) CACGCCAAGGCGATGGAATCGCTCAAGCCCAATGTCAAAGTGGAAGCCAA
ACAAAAAGCCAAACTGGATCCTACCAAGGACTACACCCAGGACAAAGACT
GCGTAGGTTGCCACGTGGATGGATTTGGCCAGAAAGGCGGCTACACGATA
GACTCCCCCAAACCCATGCTGACTGGCGTAGGCTGTGAATCCTGCCACGG
GCCTGGACGTAAATACCGGGGAGATCACCGCAAGGCTGGGCAAGCATTTG
AGAAATCGGGCAAAAAAGCGCCGCGCAAGACCCTGGCAAGCAAGGGGCAA
GACTTTAATTTTGAAGAACGTTGCAGCGCCTGCCATCTGAACTATGAAGG
GTCACCCTGGAAAGGAGCAAAACCTCCCTATACCCCGTATACACCGGAAG
TGGATCCGAAATACACCTTCAAGTTTGACGAGATGGTAAAAGACGTCAAA
GCCATGCACGAGCATTACAAACTGGATGGCGTATTTGACGGAGAGCCTAA
ATTCAAGTTCCATGACGAATTCCAGGCCAACGCTAAAACTGCCAAAAAAG
GAAAATAG
SEQ ID cycA3 MKIIIACGLVAAALFTLTSGQSLAADAPFEGRKKCSSCHKPQAQSWKHTA
NO: 28 (D23_1c17 HAKAMESLKPNVKVEAKQKAKLDPTKDYTQDKDCVGCHVDGFGQKGGYTI
(235 86) DSPKPMLTGVGCESCHGPGRKYRGDHRKAGQAFEKSGKKAPRKTLASKGQ
aa) protein DFNFEERCSACHLNYEGSPWKGAKPPYTPYTPEVDPKYTFKFDEMVKDVK
AMHEHYKLDGVFDGEPKFKFHDEFQANAKTAKKGK
SEQ ID cycA3 ATGAAAATAATAATAGCCTGCGGACTGGTTGCTGCAGCCCTGTTCACCCT
NO: 29 (D23_1c17 GACAAGTGGGCAGAGTCTGGCAGCGGATGCTCCGTTTGAAGGTCGGAAAA
(708 86) DNA AGTGCAGTTCCTGTCACAAACCACAAGCCCAGTCGTGGAAACATACTGCC
nt) CACGCCAAGGCGATGGAATCGCTCAAGCCCAATGTCAAAGTGGAAGCCAA
ACAAAAAGCCAAACTGGATCCTACCAAGGACTACACCCAGGACAAAGACT
GCGTAGGTTGCCACGTGGATGGATTTGGCCAGAAAGGCGGCTACACGATA
GACTCCCCCAAACCCATGCTGACTGGCGTAGGCTGTGAATCCTGCCACGG
GCCTGGACGTAAATACCGGGGAGATCACCGCAAGGCTGGGCAAGCATTTG
AGAAATCGGGCAAAAAAGCGCCGCGCAAGACCCTGGCAAGCAAGGGGCAA
GACTTTAATTTTGAAGAACGTTGCAGCGCCTGCCATCTGAACTATGAAGG
GTCACCCTGGAAAGGAGCAAAACCTCCCTATACCCCGTATACACCGGAAG
TGGATCCGAAATACACCTTCAAGTTTGACGAGATGGTAAAAGACGTCAAA
GCCATGCACGAGCATTACAAACTGGATGGCGTATTTGACGGAGAGCCTAA
ATTCAAGTTCCATGACGAATTCCAGGCCAACGCTAAAACTGCCAAAAAAG
GAAAATAG
SEQ ID cM552 MTRLQKGSIGTLLTGALLGIALVAVVFGGEAALSTEEFCTSCHSMSYPQS
NO: 30 cycB1 ELKESTHYGALGVNPTCKDCHIPQGIENFHLAVATHVVDGARELWLEMVN
(239 (D23_1c19 DYSTLEKFNERRLEMAHDARMNLKKWDSITCRTCHVKPAPPGESAQAEHK
aa) 23) KMETEGATCIDCHQNLVHEEAPMTDLNASLAAGKLVLKPEEGDGDDDDDV
protein DVDDEEEDEEVEVEVEETETADDSDSASSSNHDDDSDDE
SEQ ID cM552 ATGACTAGACTGCAAAAAGGATCAATTGGTACTTTACTGACAGGAGCTCT
NO: 31 cycB1 GCTGGGAATAGCATTGGTGGCTGTGGTTTTTGGTGGGGAAGCTGCGTTAT
(720 (D23_1c19 CGACCGAAGAGTTTTGTACCAGCTGTCATTCCATGTCATACCCACAGAGT
nt) 23) DNA GAATTAAAAGAATCCACCCACTATGGTGCATTGGGGGTTAATCCGACTTG
TAAAGACTGTCATATTCCACAAGGGATAGAAAATTTCCACCTGGCAGTAG
CAACTCACGTGGTTGATGGTGCCAGAGAACTTTGGTTGGAGATGGTCAAT
GACTACTCCACCCTGGAGAAGTTCAACGAAAGAAGATTGGAAATGGCGCA
TGATGCCCGGATGAACCTCAAGAAATGGGACAGCATCACCTGCCGTACCT
GTCATGTAAAACCAGCTCCTCCGGGAGAAAGCGCCCAGGCGGAACATAAG
AAAATGGAAACGGAAGGAGCAACCTGCATAGACTGTCATCAGAATCTGGT
GCATGAAGAAGCGCCGATGACAGATTTGAATGCAAGTCTTGCTGCAGGCA
AGCTGGTATTAAAGCCAGAAGAGGGTGACGGTGACGATGACGATGACGTT
GACGTTGATGACGAGGAGGAGGATGAAGAAGTCGAGGTGGAAGTTGAAGA
AACTGAAACAGCTGACGACAGCGACTCCGCTTCCTCCAGCAACCATGATG
ACGATAGTGATGATGAGTAA
SEQ ID cycB2 MTRLQKGSIGTLLTGALLGIALVAVVFGGEAALSTEEFCTSCHSMSYPQS
NO: 32 (D23_1c25 ELKESTHYGALGVNPTCKDCHIPQGIENFHLAVATHVVDGARELWLEMVN
(239 26) DYSTLEKFNERRLEMAHDARMNLKKWDSITCRTCHVKPAPPGESAQAEHK
aa) protein KMETEGATCIDCHQNLVHEEAPMTDLNASLAAGKLVLKPEEGDDDDDDDV
DVDDEEEDEEVEVEVEETETADDSDSASSSNHDDDSDDE
SEQ ID cycB2 ATGACTAGACTGCAAAAAGGATCAATTGGCACTTTACTGACAGGAGCTCT
NO: 33 (D23_1c25 GCTGGGAATAGCATTGGTGGCTGTGGTTTTTGGTGGGGAAGCTGCGTTAT
(720 26) DNA CGACCGAAGAGTTTTGTACCAGCTGTCATTCCATGTCATACCCACAGAGT
nt) GAATTAAAAGAATCCACCCACTATGGTGCATTGGGGGTTAATCCGACTTG
TAAAGACTGTCATATTCCACAAGGGATAGAAAATTTCCACCTGGCAGTAG
CAACTCACGTGGTTGATGGTGCCAGAGAACTTTGGTTGGAGATGGTCAAT
GACTACTCCACCCTGGAGAAGTTCAACGAAAGAAGATTGGAAATGGCGCA
TGATGCCCGGATGAACCTCAAGAAATGGGACAGCATCACCTGCCGTACCT
GTCATGTAAAACCAGCTCCTCCGGGAGAAAGCGCCCAGGCGGAACATAAG
AAAATGGAAACGGAAGGAGCAACCTGCATAGACTGTCATCAGAATCTGGT
GCATGAAGAAGCGCCGATGACAGATTTGAATGCAAGTCTTGCTGCAGGCA
AGCTGGTATTAAAGCCAGAAGAGGGTGACGATGACGATGACGATGACGTT
GACGTTGATGACGAGGAGGAGGATGAAGAAGTCGAGGTGGAAGTTGAAGA
AACTGAAACAGCTGACGACAGCGACTCCGCTTCCTCCAGCAACCATGATG
ACGATAGTGATGATGAGTAA

INCORPORATION BY REFERENCE

All publications and patents mentioned herein are hereby incorporated by reference in their entirety as if each individual publication or patent was specifically and individually indicated to be incorporated by reference.

While specific embodiments of the subject invention have been discussed, the above specification is illustrative and not restrictive. Many variations of the invention will become apparent to those skilled in the art upon review of this specification and the claims below. The full scope of the invention should be determined by reference to the claims, along with their full scope of equivalents, and the specification, along with such variations.

Certain embodiments are within the following claims.

Claims

What is claimed is:

1. A purified preparation of optimized Nitrosomonas eutropha (N. eutropha) bacterium having at least one property selected from:

an optimized growth rate;

an optimized NH4+ oxidation rate; and

an optimized resistance to NH4+.

2. The preparation of N. eutropha bacterium of claim 1, wherein the optimized growth rate is a rate allowing a continuous culture of N. eutropha at an OD600 (optical density at 600 nm) of about 0.15-0.18 to reach an OD600 of about 0.5-0.6 in about 1-2 days.

3. The preparation of N. eutropha bacterium of claim 1 or 2, wherein the optimized growth rate is a doubling time of about 8 hours when cultured under batch culture conditions.

4. The preparation of N. eutropha bacterium of any of claims 1-3, wherein the optimized NH4+ oxidation rate is a rate of at least about 125 micromoles per minute of oxidizing NH4+ to NO2.

5. The preparation of N. eutropha bacterium of any of claims 1-4, wherein the optimized resistance to NH4+ is an ability to grow in medium comprising about 200 mM NH4+ for at least about 48 hours.

6. The preparation of N. eutropha bacterium of any of claims 1-5, which has at least two properties selected from an optimized growth rate, an optimized NH4+ oxidation rate, and an optimized resistance to NH4+.

7. The preparation of N. eutropha bacterium of claim 1-6, which has an optimized growth rate, an optimized NH4+ oxidation rate, and an optimized resistance to NH4+.

8. The preparation of N. eutropha bacterium of any of claims 1-7, which comprises a chromosome that hybridizes under very high stringency to SEQ ID NO: 1.

9. The preparation of N. eutropha bacterium of any of claim 1-8, which comprises an AmoA protein having an identity to SEQ ID NO: 6 or 12 selected from at least about 80%, 85%, 90%, 95%, 98%, 99%, 99.5%, and 100% identical, an AmoB protein having an identity to SEQ ID NO: 8 or 14 selected from at least about 80%, 85%, 90%, 95%, 98%, 99%, 99.5%, and 100% identical, an amoC gene having an identity to SEQ ID NO: 4, 10, or 16 selected from at least about 80%, 85%, 90%, 95%, 98%, 99%, 99.5%, and 100% identical, a hydroxylamine oxidoreductase protein having an identity to SEQ ID NO: 18, 20, or 22 selected from at least 80%, 85%, 90%, 95%, 98%, 99%, 99.5%, and 100% identical, a cytochrome c554 protein having an identity to SEQ ID NO: 24, 26, or 28 selected from at least about 80%, 85%, 90%, 95%, 98%, 99%, 99.5%, and 100% identical, or a cytochrome cM552 protein having an identity to SEQ ID NO: 30 or 32 selected from at least about 80%, 85%, 90%, 95%, 98%, 99%, 99.5%, and 100% identical.

10. The preparation of N. eutropha bacterium of any of claims 1-9, which comprises 1-5, 5-10, 10-15, 15-20, 20-25, 25-30, or all of the sequence characteristics of Table 2.

11. The preparation of N. eutropha bacterium of claim 10, which comprises an AmoA1 or AmoA2 protein having (or gene encoding) a mutation relative to N. eutropha strain C91 at position 1, e.g., a V at position 1.

12. The preparation of N. eutropha bacterium of any of claims 10-11, which comprises an AmoA1 or AmoA2 protein having (or gene encoding) a mutation relative to N. eutropha strain C91 at position 160, e.g., an L at position 160.

13. The preparation of N. eutropha bacterium of any of claims 10-12, which comprises an AmoA1 or AmoA2 protein having (or gene encoding) a mutation relative to N. eutropha strain C91 at position 167, e.g., an A at position 167.

14. The preparation of N. eutropha bacterium of any of claims 10-13, which comprises an AmoB1 or AmoB2 protein having (or gene encoding) a mutation relative to N. eutropha strain C91 at position 33, e.g., a V at position 33.

15. The preparation of N. eutropha bacterium of any of claims 10-14, which comprises an AmoB1 or AmoB2 protein having (or gene encoding) a mutation relative to N. eutropha strain C91 at position 165, e.g., an I at position 165.

16. The preparation of N. eutropha bacterium of any of claims 10-15, which comprises an AmoC3 protein having (or gene encoding) a mutation relative to N. eutropha strain C91 at position 79, e.g., an A at position 79.

17. The preparation of N. eutropha bacterium of any of claims 10-16, which comprises an AmoC3 protein having (or gene encoding) a mutation relative to N. eutropha strain C91 at position 271, e.g., a V at position 271.

18. The preparation of N. eutropha bacterium of any of claims 10-17, which comprises a Hao1, Hao2, or Hao3 protein having (or gene encoding) a mutation relative to N. eutropha strain C91 at position 85, e.g., an S at position 85.

19. The preparation of N. eutropha bacterium of any of claims 10-18, which comprises a Hao1, Hao2, or Hao3 protein having (or gene encoding) a mutation relative to N. eutropha strain C91 at position 312, e.g., an E at position 312.

20. The preparation of N. eutropha bacterium of any of claims 10-19, which comprises a Hao1 protein having (or gene encoding) a mutation relative to N. eutropha strain C91 at position 163, e.g., an A at position 163.

21. The preparation of N. eutropha bacterium of any of claims 10-20, which comprises a c554 CycA1, c554 CycA2, or c554 CycA3 protein having (or gene encoding) a mutation relative to N. eutropha strain C91 at position 65, e.g., a T at position 65.

22. The preparation of N. eutropha bacterium of any of claims 10-21, which comprises a c554 CycA1 protein having (or gene encoding) a mutation relative to N. eutropha strain C91 at position 186, e.g., a T at position 186.

23. The preparation of N. eutropha bacterium of any of claims 10-22, which comprises a cM552 CycB1 or cM552 CycB2 protein having (or gene encoding) a mutation relative to N. eutropha strain C91 at position 63, e.g., a V at position 63.

24. The preparation of N. eutropha bacterium of any of claims 10-23, which comprises a cM552 CycB1 or cM552 CycB2 protein having (or gene encoding) a mutation relative to N. eutropha strain C91 at position 189, e.g., a P at position 189.

25. The preparation of N. eutropha bacterium of any of claims 10-24, which comprises a cM552 CycB1 or cM552 CycB2 protein having (or gene encoding) a mutation relative to N. eutropha strain C91 at position 206, e.g., an insE at position 206.

26. The preparation of N. eutropha bacterium of any of claims 10-25, which comprises a cM552 CycB1 or cM552 CycB2 protein having (or gene encoding) a mutation relative to N. eutropha strain C91 at position 207, e.g., an insE at position 207.

27. The preparation of N. eutropha bacterium of any of claims 10-26, which comprises a cM552 CycB1 protein having (or gene encoding) a mutation relative to N. eutropha strain C91 at position 195, e.g., an insD at position 195.

28. The preparation of N. eutropha bacterium of any of claims 10-27, which comprises a cM552 CycB1 protein having (or gene encoding) a mutation relative to N. eutropha strain C91 at position 196, e.g., an insD at position 196.

29. The preparation of N. eutropha bacterium of any of claims 10-28, which comprises a cM552 CycB1 protein having (or gene encoding) a mutation relative to N. eutropha strain C91 at position 197, e.g., an insD at position 197.

30. The preparation of N. eutropha bacterium of any of the preceding claims, which comprises at least one structural difference, e.g., at least one mutation, relative to a wild-type bacterium such as N. eutropha strain C91.

31. The preparation of N. eutropha bacterium of any of the preceding claims, which comprises a nucleic acid that can be amplified using a pair of primers described herein, e.g., a primer comprising a sequence of SEQ ID NO: 64 and a primer comprising a sequence of SEQ ID NO: 65.

32. The preparation of N. eutropha bacterium of any of the preceding claims, which comprises a nucleic acid or protein at least 80%, 85%, 90%, 95%, 98%, 99%, 99.5%, or 100% identical to a gene of FIG. 6 or a protein encoded by a gene of FIG. 6.

33. The preparation of N. eutropha bacterium of any of the preceding claims, which comprises a nucleic acid or protein at least 80%, 85%, 90%, 95%, 98%, 99%, 99.5%, or 100% identical to a sequence of any of SEQ ID NOS: 64-66 or a protein encoded by a sequence of any of SEQ ID NOS: 64-66.

34. An N. eutropha bacterium, or a purified preparation thereof, comprising a mutation in an ammonia monooxygenase gene, a hydroxylamine oxidoreductase gene, a cytochrome c554 gene, or a cytochrome cm552 gene relative to a wild-type bacterium such as N. eutropha strain C91.

35. The N. eutropha bacterium, or a purified preparation thereof, of claim 34, wherein said mutation is in the amoA1 gene.

36. The N. eutropha bacterium, or a purified preparation thereof, of claim 34, wherein said mutation is in the amoA2 gene.

37. The N. eutropha bacterium, or a purified preparation thereof, of claim 34, wherein said mutation is in the amoB1 gene.

38. The N. eutropha bacterium, or a purified preparation thereof, of claim 34, wherein said mutation is in the amoB2 gene.

39. The N. eutropha bacterium, or a purified preparation thereof, of claim 34, wherein said mutation is in the amoC3 gene.

40. The N. eutropha bacterium, or a purified preparation thereof, of any of claims 34-39, wherein said mutation is at a position described herein, e.g., in Table 2.

41. The N. eutropha bacterium, or a purified preparation thereof, of any of claims 34-39, wherein said mutation is a mutation described herein, e.g., in Table 2.

42. The N. eutropha bacterium, or a purified preparation thereof, of claim 34, wherein said mutation is in the hao1 gene.

43. The N. eutropha bacterium, or a purified preparation thereof, of claim 34, wherein said mutation is in the hao2 gene.

44. The N. eutropha bacterium, or a purified preparation thereof, of claim 34, wherein said mutation is in the hao3 gene.

45. The N. eutropha bacterium, or a purified preparation thereof, of any of claims 42-44, wherein said mutation is at a position described herein, e.g., in Table 2.

46. The N. eutropha bacterium, or a purified preparation thereof, of any of claims 42-44, wherein said mutation is a mutation described herein, e.g., in Table 2.

47. The N. eutropha bacterium, or a purified preparation thereof, of claim 34, wherein said mutation is in the c554 cycA1 gene.

48. The N. eutropha bacterium, or a purified preparation thereof, of claim 34, wherein said mutation is in the c554 cycA2 gene.

49. The N. eutropha bacterium, or a purified preparation thereof, of claim 34, wherein said mutation is in the c554 cycA3 gene.

50. The N. eutropha bacterium, or a purified preparation thereof, of any of claims 47-49, wherein said mutation is at a position described herein, e.g., in Table 2.

51. The N. eutropha bacterium, or a purified preparation thereof, of any of claims 47-49, wherein said mutation is a mutation described herein, e.g., in Table 2.

52. The N. eutropha bacterium, or a purified preparation thereof, of claim 34, wherein said mutation is in the cM552 cycB1 gene.

53. The N. eutropha bacterium, or a purified preparation thereof, of claim 34, wherein said mutation is in the c554 cycB2 gene.

54. The N. eutropha bacterium, or a purified preparation thereof, of any of claims 52-53, wherein said mutation is at a position described herein, e.g., in Table 2.

55. The N. eutropha bacterium, or a purified preparation thereof, of any of claims 52-53, wherein said mutation is a mutation described herein, e.g., in Table 2.

56. The purified preparation of optimized N. eutropha bacterium of claim 1, comprising a mutation in an ammonia monooxygenase gene, a hydroxylamine oxidoreductase gene, a cytochrome c554 gene, or a cytochrome cm552 gene.

57. The purified preparation of optimized N. eutropha bacterium of claim 56, wherein said mutation is in the amoA1 gene.

58. The purified preparation of optimized N. eutropha bacterium of claim 56, wherein said mutation is in the amoA2 gene.

59. The purified preparation of optimized N. eutropha bacterium of claim 56, wherein said mutation is in the amoB1 gene.

60. The purified preparation of optimized N. eutropha bacterium of claim 56, wherein said mutation is in the amoB2 gene.

61. The purified preparation of optimized N. eutropha bacterium of claim 56, wherein said mutation is in the amoC3 gene.

62. The purified preparation of optimized N. eutropha bacterium of any of claims 57-61, wherein said mutation is at a position described herein, e.g., in Table 2.

63. The purified preparation of optimized N. eutropha bacterium of any of claims 57-61, wherein said mutation is a mutation described herein, e.g., in Table 2.

64. The purified preparation of optimized N. eutropha bacterium of claim 56, wherein said mutation is in the hao1 gene.

65. The purified preparation of optimized N. eutropha bacterium of claim 56, wherein said mutation is in the hao2 gene.

66. The purified preparation of optimized N. eutropha bacterium of claim 56, wherein said mutation is in the hao3 gene.

67. The purified preparation of optimized N. eutropha bacterium of any of claims 64-66, wherein said mutation is at a position described herein, e.g., in Table 2.

68. The purified preparation of optimized N. eutropha bacterium of any of claims 64-66, wherein said mutation is a mutation described herein, e.g., in Table 2.

69. The purified preparation of optimized N. eutropha bacterium of claim 56, wherein said mutation is in the c554 cycA1 gene.

70. The purified preparation of optimized N. eutropha bacterium of claim 56, wherein said mutation is in the c554 cycA2 gene.

71. The purified preparation of optimized N. eutropha bacterium of claim 56, wherein said mutation is in the c554 cycA3 gene.

72. The purified preparation of optimized N. eutropha bacterium of any of claims 69-71, wherein said mutation is at a position described herein, e.g., in Table 2.

73. The purified preparation of optimized N. eutropha bacterium of any of claims 69-71, wherein said mutation is a mutation described herein, e.g., in Table 2.

74. The purified preparation of optimized N. eutropha bacterium of claim 56, wherein said mutation is in the cM552 cycB1 gene.

75. The purified preparation of optimized N. eutropha bacterium of claim 56, wherein said mutation is in the cM552 cycB2 gene.

76. The purified preparation of optimized N. eutropha bacterium of any of claims 56, 74, and 75, wherein said mutation is at a position described herein, e.g., in Table 2.

77. The purified preparation of optimized N. eutropha bacterium of any of claims 56, 74, and 75, wherein said mutation is a mutation described herein, e.g., in Table 2.

78. The N. eutropha bacterium, or a purified preparation thereof, of claim 34, which has a mutation in at least 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, or 35 positions of one or more of amoA1 gene, amoA2 gene, amoB1 gene, amoB2 gene, amoC3 gene, hao1 gene, hao2 gene, hao3 gene, c554 cycA1 gene, c554 cycA2 gene, c554 cycA3 gene, cM552 cycB1 gene, and c554 cycB2 gene.

79. The purified preparation of optimized N. eutropha bacterium of claim 56, which has a mutation in at least 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, or 35 positions of one or more of amoA1 gene, amoA2 gene, amoB1 gene, amoB2 gene, amoC3 gene, hao1 gene, hao2 gene, hao3 gene, c554 cycA1 gene, c554 cycA2 gene, c554 cycA3 gene, cM552 cycB1 gene, and c554 cycB2 gene.

80. A N. eutropha bacterium comprising a chromosome that hybridizes at high stringency to SEQ ID NO: 1.

81. The N. eutropha bacterium of claim 80, wherein the chromosome hybridizes at very high stringency to SEQ ID NO: 1.

82. The N. eutropha bacterium of claim 80 or 81, which comprises at least one of the genes of FIGS. 6-8, or a gene with at least 80% identity thereto.

83. The N. eutropha bacterium of claim 80 or 81, which comprises at least one of the genes of FIGS. 6-8.

84. The N. eutropha bacterium of any of claims 80-82, which lacks any plasmid that is at least about 80% identical to SEQ ID NO: 2 or SEQ ID NO: 3.

85. The N. eutropha bacterium of claim any of claims 80-84, which lacks any plasmid.

86. A N. eutropha bacterium comprising one or more of an AmoA1 gene at least about 98.9% identical to SEQ ID NO: 7 and an amoA2 gene at least about 98.8% identical to SEQ ID NO: 13.

87. A N. eutropha bacterium comprising one or more of an AmoA1 protein at least about 99.0% identical to SEQ ID NO: 6 and an AmoA2 protein at least about 99.0% identical to SEQ ID NO: 12.

88. A N. eutropha bacterium comprising one or more of an amoB1 gene at least about 99.2% identical to SEQ ID NO: 9 and an amoB2 gene at least about 99.2% identical to SEQ ID NO: 15.

89. The N. eutropha bacterium of claim 88, further comprising one or more of an AmoA1 or amoA2 gene at least about 98.9% identical to SEQ ID NO: 7 or 13.

90. An N. eutropha bacterium comprising one or more of an AmoB1 protein at least about 99.6% identical to SEQ ID NO: 8 or an AmoB1 protein at least about 99.6% identical to SEQ ID NO: 14.

91. The N. eutropha bacterium of claim 90, further comprising one or more of an AmoA1 protein at least about 99.0% identical to SEQ ID NO: 6 and an AmoA2 protein at least about 99.0% identical to SEQ ID NO: 12.

92. An N. eutropha bacterium comprising one or more of an amoC1 gene at least about 99.9% identical to SEQ ID NO: 5, an amoC2 gene at least about 99.9% identical to SEQ ID NO: 11, and an amoC3 gene at least about 99.0% identical to SEQ ID NO: 17.

93. The N. eutropha bacterium of claim 92, further comprising one or more of an amoA1 gene at least about 98.9% identical to SEQ ID NO: 7, an amo2 gene at least about 98.9% identical to SEQ ID NO: 13, an amoB1 gene at least about 99.2% identical to SEQ ID NO: 9, and an amoB2 gene at least about 99.2% identical to SEQ ID NO: 15.

94. A N. eutropha bacterium comprising an AmoC3 protein at least about 99.4% identical to SEQ ID NO: 16.

95. The N. eutropha bacterium of claim 94, further comprising one or more of an AmoA1 protein at least about 99.0% identical to SEQ ID NO: 6, an AmoA2 protein at least about 99.0% identical to SEQ ID NO: 12, an AmoB1 protein at least about 99.6% identical to SEQ ID NO: 8, and an AmoB1 protein at least about 99.6% identical to SEQ ID NO: 14.

96. A N. eutropha bacterium comprising one or more of a hao1 gene at least about 99.1% identical to SEQ ID NO: 19, a hao2 gene at least about 99.5% identical to SEQ ID NO: 21, and a hao3 gene at least about 99.3% identical to SEQ ID NO: 23.

97. The N. eutropha bacterium of claim 96, further comprising one or more of an amoA1 gene at least about 98.9% identical to SEQ ID NO: 7, an amo2 gene at least about 98.9% identical to SEQ ID NO: 13, an amoB1 gene at least about 99.2% identical to SEQ ID NO: 9, an amoB2 gene at least about 99.2% identical to SEQ ID NO: 15, an amoC1 gene at least about 99.9% identical to SEQ ID NO: 5, an amoC2 gene at least about 99.9% identical to SEQ ID NO: 11, and an amoC3 gene at least about 99.0% identical to SEQ ID NO: 17.

98. A N. eutropha bacterium comprising one or more of a Hao1 protein at least about 99.6% identical to SEQ ID NO: 18, a Hao2 protein at least about 99.7% identical to SEQ ID NO: 20, and a Hao3 protein at least about 99.7% identical to SEQ ID NO: 22.

99. The N. eutropha bacterium of claim 98, further comprising an AmoA1 protein at least about 99.0% identical to SEQ ID NO: 6, an AmoA2 protein at least about 99.0% identical to SEQ ID NO: 12, an AmoB1 protein at least about 99.6% identical to SEQ ID NO: 8, an AmoB1 protein at least about 99.6% identical to SEQ ID NO: 14, or an AmoC3 protein at least about 99.4% identical to SEQ ID NO: 16.

100. An N. eutropha bacterium comprising one or more of a cycA1 gene at least about 98.1% identical to SEQ ID NO: 25, a cycA2 gene at least about 98.8% identical to SEQ ID NO: 27, and a cycA3 gene at least about 99.4% identical to SEQ ID NO: 28.

101. The N. eutropha bacterium of claim 100, further comprising one or more of an amoA1 gene at least about 98.9% identical to SEQ ID NO: 7, an amo2 gene at least about 98.9% identical to SEQ ID NO: 13, an amoB1 gene at least about 99.2% identical to SEQ ID NO: 9, an amoB2 gene at least about 99.2% identical to SEQ ID NO: 15, an amoC1 gene at least about 99.9% identical to SEEQ ID NO: 5, an amoC2 gene at least about 99.9% identical to SEQ ID NO: 11, an amoC3 gene at least about 99.0% identical to SEQ ID NO: 17, a hao1 gene at least about 99.1% identical to SEQ ID NO: 19, a hao2 gene at least about 99.5% identical to SEQ ID NO: 21, and a hao3 gene at least about 99.3% identical to SEQ ID NO: 23.

102. An N. eutropha bacterium comprising one or more of a CycA1 protein at least about 99.2% identical to SEQ ID NO: 24, a CycA2 protein at least about 99.7% identical to SEQ ID NO: 26, and a CycA3 protein at least about 99.7% identical to SEQ ID NO: 28.

103. The N. eutropha bacterium of claim 102, further comprising one or more of an AmoA1 protein at least about 99.0% identical to SEQ ID NO: 6, an AmoA2 protein at least about 99.0% identical to SEQ ID NO: 12, an AmoB1 protein at least about 99.6% identical to SEQ ID NO: 8, an AmoB1 protein at least about 99.6% identical to SEQ ID NO: 14, an AmoC3 protein at least about 99.4% identical to SEQ ID NO: 16, a Hao1 protein at least about 99.6% identical to SEQ ID NO: 18, a Hao2 protein at least about 99.7% identical to SEQ ID NO: 20, and a Hao3 protein at least about 99.7% identical to SEQ ID NO: 22.

104. A N. eutropha bacterium comprising one or more of a cycB1 gene at least about 96.8% identical to SEQ ID NO: 31 and a cycB2 gene at least about 97.2% identical to SEQ ID NO: 33.

105. The N. eutropha bacterium of claim 104, further comprising one or more of an amoA1 gene at least about 98.9% identical to SEQ ID NO: 7, an amo2 gene at least about 98.9% identical to SEQ ID NO: 13, an amoB1 gene at least about 99.2% identical to SEQ ID NO: 9, an amoB2 gene at least about 99.2% identical to SEQ ID NO: 15, an amoC1 gene at least about 99.9% identical to SEQ ID NO: 5, an amoC2 gene at least about 99.9% identical to SEQ ID NO: 11, an amoC3 gene at least about 99.0% identical to SEQ ID NO: 17, a hao1 gene at least about 99.1% identical to SEQ ID NO: 19, a hao2 gene at least about 99.5% identical to SEQ ID NO: 21, a hao3 gene at least about 99.3% identical to SEQ ID NO: 23, a cycA1 gene at least about 98.1% identical to SEQ ID NO: 25, a cycA2 gene at least about 98.8% identical to SEQ ID NO: 27, and a cycA3 gene at least about 99.4% identical to SEQ ID NO: 28.

106. A N. eutropha bacterium comprising one or more of a CycB1 protein at least about 97.2% identical to SEQ ID NO: 30 or a CycB2 protein at least about 98.8% identical to SEQ ID NO: 32.

107. The N. eutropha bacterium of claim 106, further comprising one or more of an AmoA1 protein at least about 99.0% identical to SEQ ID NO: 6, an AmoA2 protein at least about 99.0% identical to SEQ ID NO: 12, an AmoB1 protein at least about 99.6% identical to SEQ ID NO: 8, an AmoB1 protein at least about 99.6% identical to SEQ ID NO: 14, an AmoC3 protein at least about 99.4% identical to SEQ ID NO: 16, a Hao1 protein at least about 99.6% identical to SEQ ID NO: 18, a Hao2 protein at least about 99.7% identical to SEQ ID NO: 20, a Hao3 protein at least about 99.7% identical to SEQ ID NO: 22, a CycA1 protein at least about 99.2% identical to SEQ ID NO: 24, a CycA2 protein at least about 99.7% identical to SEQ ID NO: 26, and a CycA3 protein at least about 99.7% identical to SEQ ID NO: 28.

108. A N. eutropha bacterium comprising one or more genes according to SEQ ID NOS: 5, 7, 9, 11, 13, 15, 17, 19, 21, 23, 25, 27, 29, 31, and 33.

109. A N. eutropha bacterium comprising one or more proteins according to SEQ ID NOS: 4, 6, 8, 10, 12, 14, 16, 18, 20, 22, 24, 26, 28, 30, and 32.

110. A N. eutropha bacterium comprising a protein that is mutant relative to N. eutropha strain C91 at at least 1, 2, 3, 4, 5, 10, 15, 20, 25, 30, or all of the amino acid positions listed in Table 2.

111. A N. eutropha bacterium comprising proteins that are mutant relative to N. eutropha strain C91 at all of the amino acid positions listed in Table 2.

112. The N. eutropha bacterium of any one of claims 1-111, which is transgenic.

113. The N. eutropha bacterium of any one of claims 80-112, having at least one property selected from an optimized growth rate, an optimized NH4+ oxidation rate, and an optimized resistance to NH4+.

114. The N. eutropha bacterium of claim 113, which has at least two properties selected from an optimized growth rate, an optimized NH4+ oxidation rate, and an optimized resistance to NH4+.

115. The N. eutropha bacterium of claim 113, which has an optimized growth rate, an optimized NH4+ oxidation rate, and an optimized resistance to NH4+.

116. A composition comprising the N. eutropha bacterium of any one of claims 1-115, wherein the composition is substantially free of other organisms.

117. A composition comprising the N. eutropha bacterium of one any of claims 1-115 and further comprising a second organism, wherein the composition is substantially free of other organisms.

118. The composition of claim 117, wherein the second organism is an ammonia oxidizing bacterium.

119. The composition of claim 117, wherein the second organism is selected from the group consisting of Nitrosomonas, Nitrosococcus, Nitrosospria, Nitrosocystis, Nitrosolobus, Nitrosovibrio, Lactobacillus, Streptococcus, and Bifidobacter, and combinations thereof.

120. A composition comprising a cell suspension of an actively dividing culture of N. eutropha bacteria having an OD600 of at least about 0.2, wherein the composition is substantially free of other organisms.

121. A composition for topical administration, comprising the N. eutropha bacterium of any one of claims 1-115 and a pharmaceutically or cosmetically acceptable excipient suitable for topical administration.

122. The composition of claim 121, which is substantially free of other organisms.

123. The composition of claim 121, further comprising a second organism.

124. The composition of claim 123, wherein the second organism is an ammonia oxidizing bacterium.

125. The composition of claim 123, wherein the second organism is selected from the group consisting of Nitrosomonas, Nitrosococcus, Nitrosospria, Nitrosocystis, Nitrosolobus, Nitrosovibrio, Lactobacillus, Streptococcus, and Bifidobacter, and combinations thereof.

126. The composition of any of claims 121-125, which is provided as or disposed in a powder, cosmetic, cream, stick, aerosol, salve, wipe, or bandage.

127. The composition of any of claims 121-126, which further comprises a moisturizing agent, deodorizing agent, scent, colorant, insect repellant, cleansing agent, or UV-blocking agent.

128. The composition of any of claims 121-127, wherein the excipient comprises an anti-adherent, binder, coat, disintegrant, filler, flavor, color, lubricant, glidant, sorbent, preservative, or sweetener.

129. The composition of any of claims 121-128, wherein the concentration of N. eutropha in the composition is about 1011-1012 CFU/L.

130. The composition of any of claims 121-129, wherein the concentration of N. eutropha in the composition is about 109 CFU/ml.

131. The composition of any of claims 121-130, wherein the mass ratio of N. eutropha to pharmaceutical excipient is in a range of about 0.1 grams per liter to about 1 gram per liter.

132. A composition comprising at least about 1,000 L at about 1012 CFUs/L of the N. eutropha bacterium of any one of claims 1-115.

133. A composition comprising at least about 1, 2, 5, 10, 20, 50, 100, 200, or 500 g of the N. eutropha bacterium of any one of claims 1-115, e.g., as a dry formulation such as a powder.

134. An article of clothing comprising the N. eutropha of any one of claims 1-115, e.g., at a concentration that provides one or more of a treatment or prevention of a skin disorder, a treatment or prevention of a disease or condition associated with low nitrite levels, a treatment or prevention of body odor, a treatment to supply nitric oxide to a subject, or a treatment to inhibit microbial growth.

135. The article of clothing of claim 134, which is packaged.

136. The article of clothing of claim 134-135, which is packaged in a material that is resistant to gaseous exchange or resistant to water.

137. A cloth comprising the N. eutropha of any one of claims 1-115.

138. A yarn comprising the N. eutropha of any one of claims 1-115.

139. A thread comprising the N. eutropha of any one of claims 1-115.

140. A method of obtaining, e.g., manufacturing, an N. eutropha bacterium having an optimized growth rate, an optimized NH4+ oxidation rate, or an optimized resistance to NH4+, comprising:

(a) culturing the bacterium under conditions that select for one or more of an optimized growth rate, an optimized NH4+ oxidation rate, or an optimized resistance to NH4+, thereby producing a culture;

(b) testing a sample from the culture for an optimized growth rate, an optimized NH4+ oxidation rate, or an optimized resistance to NH4+; and

(c) repeating the culturing and testing steps until a bacterium having an optimized growth rate, an optimized NH4+ oxidation rate, or an optimized resistance to NH4+ is obtained.

141. The method of claim 140, further comprising a step of obtaining an N. eutropha bacterium from a source.

142. The method of claim 141, wherein the source is soil or the skin of an individual.

143. The method of claim 142, wherein culturing the bacterium under conditions that select for one or more of an optimized growth rate, an optimized NH4+ oxidation rate, or an optimized resistance to NH4+ comprises culturing the bacterium in N. europae medium that comprises about 200 mM NH4+.

144. The method of claim 143, which comprises a step of creating an axenic culture.

145. The method of claim 143 or 144, which comprises a step of co-culturing the N. eutropha together with at least one other type of ammonia oxidizing bacteria.

146. The method of any of claims 140-145, wherein the N. eutropha of step (a) lack an optimized growth rate, an optimized NH4+ oxidation rate, and an optimized resistance to NH4+.

147. The method of any of claims 140-146, wherein step (c) comprises repeating the culturing and testing steps until a bacterium having at least two of an optimized growth rate, an optimized NH4+ oxidation rate, and an optimized resistance to NH4+ is obtained.

148. An N. eutropha bacterium produced by the method of any of claims 140-147.

149. A method of testing a preparation of N. eutropha, comprising:

assaying the N. eutropha for one or more of an optimized growth rate, an optimized NH4+ oxidation rate, or an optimized resistance to NH4+; and

if the N. eutropha has one or more of an optimized growth rate, an optimized NH4+ oxidation rate, or an optimized resistance to NH4+, classifying the N. eutropha as accepted.

150. The method of claim 149, further comprising a step of testing the preparation for contaminating organisms.

151. The method of any of claims 149-150, further comprising a step of removing a sample from the preparation and conducting testing on the sample.

152. The method of any of claims 149-151, further comprising testing medium in which the N. eutropha is cultured.

153. The method of any of claims 149-152, further comprising packaging N. eutropha from the preparation into a package.

154. The method of any of claims 149-153, further comprising placing N. eutropha from the preparation into commerce.

155. A method of producing, e.g., manufacturing N. eutropha, comprising contacting N. eutropha with culture medium and culturing the N. eutropha until an OD600 of at least about 0.5 is reached.

156. The method of claim 155, further comprising assaying the N. eutropha and culture medium for contaminating organisms.

157. The method of any of claims 155-156, further comprising assaying the N. eutropha for one or more of an optimized growth rate, an optimized NH4+ oxidation rate, or an optimized resistance to NH4+.

158. The method of any of claims 155-157, which comprises producing at least at least about 1,000 L per day at about 1012 CFUs/L of N. eutropha.

159. A method of producing, e.g., manufacturing, N. eutropha, comprising contacting N. eutropha with culture medium and culturing the N. eutropha until about at least about 1,000 L at about 1012 CFUs/L N. eutropha are produced.

160. The method of claim 159, further comprising a step of assaying the N. eutropha for one or more of an optimized growth rate, an optimized NH4+ oxidation rate, or an optimized resistance to NH4+.

161. The method of any of claims 159-160, further comprising a step of testing the N. eutropha or culture medium for contaminating organisms.

162. The method of any of claims 159-161, wherein the N. eutropha brought into contact with the culture medium is an N. eutropha having one or more of an optimized growth rate, an optimized NH4+ oxidation rate, or an optimized resistance to NH4+.

163. A method of producing, e.g., manufacturing N. eutropha, comprising:

(a) contacting N. eutropha with a culture medium; and

(b) culturing the N. eutropha for 1-2 days, thereby creating a culture, until the culture reaches an OD600 of about 0.5-0.6.

164. The method of claim 163, further comprising a step of assaying the N. eutropha for one or more of an optimized growth rate, an optimized NH4+ oxidation rate, or an optimized resistance to NH4+.

165. The method of any of claims 163-164, further comprising a step of testing the culture for contaminating organisms.

166. The method of any of claims 163-165, wherein the N. eutropha of step (a) is an N. eutropha having one or more of an optimized growth rate, an optimized NH4+ oxidation rate, or an optimized resistance to NH4+.

167. The method of any of claims 163-166, which comprises producing at least at least about 1,000 L per day at about 1012 CFUs/L of N. eutropha.

168. An N. eutropha bacterium produced by the method of any of claims 155-167.

169. A preparation of N. eutropha made by the method of any of claims 155-167.

170. The preparation of claim 169, wherein the preparation comprises at least about 0.1 to about 100 milligrams (mg) of N. eutropha.

171. A reaction mixture comprising N. eutropha at an optical density of about 0.5 to about 0.6.

172. A method of producing N. eutropha-bearing clothing, comprising contacting an article of clothing with of the N. eutropha of any one of claims 1-115.

173. The method of claim 172, which comprises producing at least 10, 100, or 1000 articles of clothing.

174. The method of claim 172, which comprises contacting the article of clothing with at least 1010 CFUs of N. eutropha.

175. The method of claim 172, further comprising packaging the clothing.

176. A method of obtaining a formulation of N. eutropha, combining contacting N. eutropha of any of claims 1-115 with a pharmaceutically or cosmetically acceptable excipient.

177. The method of claim 176, further comprising mixing the N. eutropha and the excipient.

178. The method of claim 176, which is performed under conditions that are substantially free of contaminating organisms.

179. A method of packaging N. eutropha, comprising assembling N. eutropha of any of claim 1-115 into a package.

180. The method of claim 179, wherein the package is resistant to gaseous exchange or resistant to water.

181. The method of claim 179, wherein the package is permeable to gaseous exchange, NH3, NH4+, or NO2.

182. A method of inhibiting microbial growth on a subject's skin, comprising topically administering to a subject in need thereof an effective dose of the N. eutropha bacteria of any one of claims 1-115.

183. The method of claim 182, wherein the effective dose is approximately 1.5×1010 CFU.

184. The method of any of claims 182-183, wherein the administration is performed twice per day.

185. The method of any of claims 182-184, wherein the subject is a human.

186. The method of any of claims 182-185, wherein the microbial growth to be inhibited is growth of Pseudomonas aeruginosa, Staphylococcus aureus, Streptococcus pyogenes, or Acinetobacter baumannii.

187. A method of supplying nitric oxide to a subject, comprising positioning an effective dose of the N. eutropha bacteria of any one of claims 1-115 in close proximity to the subject.

188. A method of reducing body odor, comprising topically administering to a subject in need thereof an effective dose of the N. eutropha bacteria of any one of claims 1-115.

189. A method of treating a disease associated with low nitrite levels, comprising topically administering to a subject in need thereof a therapeutically effective dose of the N. eutropha bacteria of any of claims 1-115.

190. The method of claim 189, wherein the disease is HIV dermatitis, infection in a diabetic foot ulcer, atopic dermatitis, acne, e.g., acne vulgaris, eczema, contact dermatitis, allergic reaction, psoriasis, skin infections, vascular disease, vaginal yeast infection, a sexually transmitted disease, heart disease, atherosclerosis, baldness, leg ulcers secondary to diabetes or confinement to bed, angina, particularly chronic, stable angina pectoris, ischemic diseases, congestive heart failure, myocardial infarction, ischemia reperfusion injury, laminitis, hypertension, hypertrophic organ degeneration, Raynaud's phenomenon, fibrosis, fibrotic organ degeneration, allergies, autoimmune sensitization, end stage renal disease, obesity, impotence, or cancer.

191. A method of treating a skin disorder, comprising topically administering to a subject in need thereof a therapeutically effective dose of the N. eutropha bacteria of any of claims 1-115.

192. The method of claim 191, wherein the skin disorder is acne, e.g., acne vulgaris, rosacea, eczema, or psoriasis.

193. The method of claim 191, wherein the skin disorder is an ulcer, e.g., venous ulcer, e.g., leg ulcer, e.g., venous leg ulcer, e.g., infection in a diabetic foot ulcer.

195. The method of any one of claims 191-194, wherein topically administering comprises topically administering prior to occurrence of the skin disorder.

196. The method of any one of claims 191-195, wherein topically administering comprises topically administering subsequent to occurrence of the skin disorder.

197. A method of promoting wound healing or closure, comprising administering to a wound an effective dose of the N. eutropha bacteria of any of claims 1-115.

198. The method of claim 197, wherein the wound comprises one or more undesirable bacteria, e.g., pathogenic bacteria.

199. The method of claim 197, wherein the wound comprises Staphylococcus aureus, Pseudomonas aeruginosa, or Acinetobacter baumannii.

200. The method of claim 197, wherein the N. eutropha is administered to the subject prior to occurrence of the wound.

201. The method of claim 197, wherein administering to the wound comprises administering to the subject prior to occurrence of the wound.

202. The method of any one of claims 197-201, further comprising administering N. eutropha to the wound subsequent to occurrence of the wound.

203. A method of killing or inhibiting growth of pathogenic bacteria comprising contacting, e.g., applying, N. eutropha bacteria, e.g., an N. eutropha bacterium of any of claims 1-115, to the skin.

204. The method of claim 203, wherein the pathogenic bacteria contribute to one or more of the following conditions: HIV dermatitis, an ulcer, e.g., venous ulcer, e.g., leg ulcer, e.g., venous leg ulcer, e.g., infection in a diabetic foot ulcer, atopic dermatitis, acne, e.g., acne vulgaris, eczema, contact dermatitis, allergic reaction, psoriasis, uticaria, rosacea, skin infections, vascular disease, vaginal yeast infection, a sexually transmitted disease, heart disease, atherosclerosis, baldness, leg ulcers secondary to diabetes or confinement to bed, angina, particularly chronic, stable angina pectoris, ischemic diseases, congestive heart failure, myocardial infarction, ischemia reperfusion injury, laminitis, hypertension, hypertrophic organ degeneration, Raynaud's phenomenon, fibrosis, fibrotic organ degeneration, allergies, autoimmune sensitization, end stage renal disease, obesity, impotence, pneumonia, primary immunodeficiency, epidermal lysis bulosa, or cancer.

205. The method of claim 204, wherein the condition is an ulcer, e.g., venous ulcer, e.g., leg ulcer, e.g., venous leg ulcer, e.g., infection in a diabetic foot ulcer.

206. The method of claim 204, wherein the condition is a venous leg ulcer.

207. The method of claim 204, wherein the condition is acne, e.g., acne vulgaris.

208. The method of claim 204, wherein the condition is acne vulgaris.

209. The method of any one of claims 203-208, wherein the pathogenic bacteria is one or more of Propionibacterium acnes, Pseudomonas aeruginosa, Staphylococcus aureus, Streptococcus pyogenes, or Acinetobacter baumannii.

210. The method of any one of claims 203-209, further comprising determining whether the subject is in need of killing or inhibiting growth of pathogenic bacteria, e.g., determining that the subject is in need of killing or inhibiting growth of pathogenic bacteria.

211. The method of any one of claims 203-210, further comprising selecting the subject in need of killing or inhibiting growth of pathogenic bacteria.

212. A method of changing a composition of a skin microbiome of a subject comprising:

administering, e.g., applying, a preparation comprising ammonia oxidizing bacteria to a surface of the skin,

wherein the amount and frequency of administration, e.g., application, is sufficient to reduce the proportion of pathogenic bacteria on the surface of the skin.

213. The method of claim 212, further comprising, selecting the subject on the basis of the subject being in need of a reduction in the proportion of pathogenic bacteria on the surface of the skin.

214. The method of any one of claims 212-213, wherein the preparation comprises at least one of ammonia, ammonium salts, and urea.

215. The method of any one of claims 212-214, wherein the preparation comprises a controlled release material, e.g., slow release material.

216. The method of any one of claims 212-215, wherein the preparation of ammonia oxidizing bacteria, further comprises an excipient, e.g., one of a pharmaceutically acceptable excipient or a cosmetically acceptable excipient.

217. The method of claim 216, wherein the excipient, e.g., one of the pharmaceutically acceptable excipient and the cosmetically acceptable excipient, is suitable for one of topical, nasal, pulmonary, and gastrointestinal administration.

218. The method of any one of claims 216-217, wherein the excipient, e.g., one of the pharmaceutically acceptable excipient and the cosmetically acceptable excipient, is a surfactant.

219. The method of claim 218, wherein the surfactant is selected from the group consisting of cocamidopropyl betaine (ColaTeric COAB), polyethylene sorbitol ester (e.g., Tween 80), ethoxylated lauryl alcohol (RhodaSurf 6 NAT), sodium laureth sulfate/lauryl glucoside/cocamidopropyl betaine (Plantapon 611 L UP), sodium laureth sulfate (e.g., RhodaPex ESB 70 NAT), alkyl polyglucoside (e.g., Plantaren 2000 N UP), sodium laureth sulfate (Plantaren 200), Dr. Bronner's Castile soap, Lauramine oxide (ColaLux Lo), sodium dodecyl sulfate (SDS), polysulfonate alkyl polyglucoside (PolySufanate 160 P), sodium lauryl sulfate (Stepanol-WA Extra K), and any combination thereof.

220. The method of any one of claims 212-219, wherein the preparation is substantially free of other organisms.

221. The method of any one of claims 212-220, wherein the preparation is disposed in a powder, cosmetic, cream, stick, aerosol, salve, wipe, or bandage.

222. The method of any one of claims 212-221, wherein the preparation is provided as a powder, cosmetic, cream, stick, aerosol, salve, wipe, or bandage.

223. The method of any one of claims 212-222, wherein the preparation comprises a moisturizing agent, deodorizing agent, scent, colorant, insect repellant, cleansing agent, or UV-blocking agent.

224. The method of any one of claims 216-217, wherein the excipient, e.g., the pharmaceutically acceptable excipient or the cosmetically acceptable excipient, comprises an anti-adherent, binder, coat, disintegrant, filler, flavor, color, lubricant, glidant, sorbent, preservative, or sweetener.

225. The method of any one of claims 212-224, wherein the preparation comprising ammonia oxidizing bacteria comprises about 108 to about 1014 CFU/L.

226. The method of claim 225, wherein the preparation comprises between about 1×109 CFU/L to about 10×109 CFU/L.

227. The method of any one of claims 212-226, wherein the preparation comprising ammonia oxidizing bacteria comprises between about 50 milligrams (mg) and about 1000 mg of ammonia oxidizing bacteria.

228. The method of any one of claims 216-227, wherein the mass ratio of ammonia oxidizing bacteria to the excipient, e.g., the pharmaceutically acceptable excipient or the cosmetically acceptable excipient is in a range of about 0.1 grams per liter to about 1 gram per liter.

229. The method of any one of claims 212-228, wherein the preparation of ammonia oxidizing bacteria are useful for treating or preventing a skin disorder, a treatment or prevention of a disease or condition associated with low nitrite levels, a treatment or prevention of body odor, a treatment to supply nitric oxide to a subject, or a treatment to inhibit microbial growth, e.g., pathogenic bacterial growth.

230. The method of any one of claims 212-229, wherein the ammonia oxidizing bacteria is selected from the group consisting of Nitrosomonas, Nitrosococcus, Nitrosospria, Nitrosocystis, Nitrosolobus, Nitrosovibrio, and combinations thereof.

231. The method of any one of claims 212-230, wherein the preparation comprises an organism selected from the group consisting of Lactobacillus, Streptococcus, Bifidobacter, and combinations thereof.

232. The method of any one of claims 212-230, wherein the preparation is substantially free of organisms other than ammonia oxidizing bacteria.

233. The method of any one of claims 212-232, wherein the preparation of ammonia oxidizing bacteria comprises ammonia oxidizing bacteria in a growth state.

234. The method of any one of claims 212-232, wherein the preparation of ammonia oxidizing bacteria comprises ammonia oxidizing bacteria in a storage state.

235. The method of any one of claims 212-234, to deliver a cosmetic product.

236. The method of any one of claims 212-234, to deliver a therapeutic product.

237. The method of any one of claims 212-236, wherein the preparation is useful for treatment of at least one of HIV dermatitis, infection in a diabetic foot ulcer, atopic dermatitis, acne, e.g., acne vulgaris, eczema, contact dermatitis, allergic reaction, psoriasis, uticaria, rosacea, skin infections, vascular disease, vaginal yeast infection, a sexually transmitted disease, heart disease, atherosclerosis, baldness, leg ulcers secondary to diabetes or confinement to bed, angina, particularly chronic, stable angina pectoris, ischemic diseases, congestive heart failure, myocardial infarction, ischemia reperfusion injury, laminitis, hypertension, hypertrophic organ degeneration, Raynaud's phenomenon, fibrosis, fibrotic organ degeneration, allergies, autoimmune sensitization, end stage renal disease, obesity, impotence, pneumonia, primary immunodeficiency, epidermal lysis bulosa, or cancer.

238. The method of claim 237, wherein the preparation is useful for treatment of at least one of acne, e.g., acne vulgaris, eczema, psoriasis, uticaria, rosacea, and skin infections.

239. The method of any one of claims 212-238, wherein the preparation is provided in a container, the preparation and the container having a weight of less than about 50, 100, 200, 300, 400, 500, 600, 700, 800, 900, 1000, 1500, or 2000 grams.

240. The method of any one of claims 212-239, wherein the preparation has less than about 0.1% to about 10% of surfactant.

241. The method of any one of claims 212-240, wherein the preparation is substantially free of surfactant.

242. The method of any one of claims 212-241, wherein the preparation comprises a chelator.

243. The method of any one of claims 212-242, wherein the preparation is applied about 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, or 24 times per day.

244. The method of any one of claims 212-243, wherein the preparation is applied one time per day.

245. The method of any one of claims 212-243, wherein the preparation is applied two times per day.

246. The method of any one of claims 212-245, wherein the preparation is applied for about 1-3, 3-5, 5-7, 7-9, 5-10, 10-14, 12-18, 12-21, 21-28, 28-35, 35-42, 42-49, 49-56, 46-63, 63-70, 70-77, 77-84, or 84-91 days.

247. The method of any one of claims 212-246, wherein the preparation is applied for about 16 days.

248. The method of any one of claims 212-247 further comprising obtaining a sample from the surface of the skin.

249. The method of claim 248, further comprising isolating DNA of bacteria in the sample.

250. The method of any one of claims 248-249, further comprising sequencing DNA of bacteria in the sample.

251. The method of any one of claims 212-250, wherein administering the ammonia oxidizing bacteria provides for an increase in the proportion of non-pathogenic bacteria on the surface.

252. The method of claim 251, wherein the non-pathogenic bacteria is commensal non-pathogenic bacteria.

253. The method of claim 252, wherein the non-pathogenic bacteria is commensal non-pathogenic bacteria of the genus Staphylococcus.

254. The method of claim 253, wherein the non-pathogenic bacteria is commensal non-pathogenic bacteria Staphylococcus epidermidis.

255. The method of any one of claims 252-254, wherein the non-pathogenic bacteria of the genus Staphylococcus is, or is identified as being, increased after about 2 weeks.

256. The method of claim 255, wherein the non-pathogenic bacteria Staphylococcus epidermidis is, or is identified as being, increased after about 2 weeks.

257. The method of any one of claims 212-256, wherein potentially pathogenic or disease associated Propionibacteria is, or is identified as being, reduced after about 2 weeks.

258. The method of any one of claims 212-257, wherein potentially pathogenic or disease associated Stenotrophomonas is, or is identified as being, reduced after about 2 weeks.

259. The method of any one of claims 212-258, wherein the surface of the skin comprises a wound.

260. A method of treating acne e.g., acne vulgaris, by the method of any one of claims 212-259.

261. A method of treating eczema by the method of any one of claims 212-259.

262. A method of treating psoriasis by the method of any one of claims 212-259.

263. A method of treating uticaria by the method of any one of claims 212-259.

264. A method of treating rosacea by the method of any one of claims 212-259.

265. A method of treating a skin infection by the method of any one of claims 212-259.

266. A method of reducing an amount of undesirable bacteria on a surface of a subject by the method of any one of claims 212-258.

267. A nucleic acid comprising a sequence of 15-100 consecutive nucleotides from within SEQ ID NO: 66, or a reverse complement thereof, provided that the nucleic acid has a non-naturally occurring sequence, or another modification, e.g., a label, or both.

268. The nucleic acid of claim 267, wherein the sequence of 15-100 consecutive nucleotides is a sequence not found in N. Eutropha strain C91.

269. The nucleic acid of claim 267 or 268, further comprising a heterologous sequence 5′ to the sequence of 15-100 consecutive nucleotides from within SEQ ID NO: 66.

270. The nucleic acid of claim 267 or 268, further comprising a heterologous sequence 3′ to the sequence of 15-100 consecutive nucleotides from within SEQ ID NO: 66.

271. The nucleic acid of claim 267 or 268, further comprising a first heterologous sequence 5′ to the sequence of 15-100 consecutive nucleotides from within SEQ ID NO: 66 and a second heterologous sequence 3′ to the sequence of 15-100 consecutive nucleotides from within SEQ ID NO: 66.

272. The nucleic acid of any of claims 267-271, which has a length of 15-20, 20-25, 25-30, 30-24, or 25-40 nucleotides.

273. The nucleic acid of any of claims 267-272, which is bound, e.g., covalently bound, to a detectable label, e.g., a fluorescent label.

274. A composition comprising:

a first nucleic acid comprising 15-100 consecutive nucleotides from within SEQ ID NO: 66; and

a second nucleic acid comprising 15-100 consecutive nucleotides from within a reverse complement of SEQ ID NO: 66,

provided that the first nucleic acid or the second nucleic acid or both has a non-naturally occurring sequence or a modification such as a label, or both.

275. The composition of claim 274, wherein the first nucleic acid, the second nucleic acid, or each of the first nucleic acid and second nucleic acid does not comprise a sequence found in N. Eutropha strain C91.

276. The composition of claim 274 or 275, wherein the first nucleic acid, the second nucleic acid, or each of the first nucleic acid and second nucleic acid further comprises a heterologous sequence 5′ to the sequence of 15-100 consecutive nucleotides from within SEQ ID NO: 66.

277. The composition of any of claims 274-276, wherein the first nucleic acid, the second nucleic acid, or each of the first nucleic acid and second nucleic acid further comprises a heterologous sequence 3′ to the sequence of 15-100 consecutive nucleotides from within SEQ ID NO: 66.

278. The composition of any of claims 274-277, wherein the first nucleic acid, the second nucleic acid, or each of the first nucleic acid and second nucleic acid has a length of 15-20, 20-25, 25-30, 30-24, or 25-40 nucleotides.

279. The composition of any of claims 274-278, wherein the first nucleic acid, the second nucleic acid, or each of the first nucleic acid and second nucleic acid is bound, e.g., covalently bound, to a detectable label, e.g., a fluorescent label.

280. A nucleic acid consisting of the sequence AATCTGTCTCCACAGGCAGC (SEQ ID NO: 64).

281. A nucleic acid consisting of the sequence TATACCCACCACCCACGCTA (SEQ ID NO: 65).

282. A molecule comprising the nucleic acid of claim 280 or 281 and a detectable label, e.g., a fluorescent label.

283. A composition comprising a first nucleic acid consisting of the sequence AATCTGTCTCCACAGGCAGC (SEQ ID NO: 64) and a second nucleic acid consisting of the sequence TATACCCACCACCCACGCTA (SEQ ID NO: 65).

284. A composition comprising:

a first molecule comprising (i) a first nucleic acid consisting of the sequence AATCTGTCTCCACAGGCAGC (SEQ ID NO: 64) and optionally comprising (ii) a detectable label, e.g., a fluorescent label; and

a second molecule comprising (i) a second nucleic acid consisting of the sequence TATACCCACCACCCACGCTA (SEQ ID NO: 65) and optionally comprising (ii) a detectable label, e.g., a fluorescent label.

285. A method of detecting whether a D23 N. eutropha nucleic acid is present in a sample, comprising:

performing a polymerase chain reaction (PCR) on the sample using primers specific to N. eutropha D23, and

determining whether a PCR product is produced, wherein the presence of a PCR product indicates that the D23 N. eutropha nucleic acid was present in the sample.

Resources

Images & Drawings included:

Sources:

Recent applications in this class: