US20170183671A1
2017-06-29
15/209,923
2016-07-14
Isolated polynucleotides and polypeptides and recombinant DNA constructs useful for conferring drought tolerance, compositions (such as plants or seeds) comprising these recombinant DNA constructs, and methods utilizing these recombinant DNA constructs. The recombinant DNA construct comprises a polynucleotide operably linked to a promoter that is functional in a plant, wherein said polynucleotide encodes a PRE2 polypeptide.
Get notified when new applications in this technology area are published.
C12N15/8201 » CPC main
Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor; Recombinant DNA-technology; Introduction of foreign genetic material using vectors; Vectors; Use of hosts therefor; Regulation of expression; Vectors or expression systems specially adapted for eukaryotic hosts for plant cells, e.g. plant artificial chromosomes (PACs) Methods for introducing genetic material into plant cells, e.g. DNA, RNA, stable or transient incorporation, tissue culture methods adapted for transformation
C12N15/8261 » CPC further
Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor; Recombinant DNA-technology; Introduction of foreign genetic material using vectors; Vectors; Use of hosts therefor; Regulation of expression; Vectors or expression systems specially adapted for eukaryotic hosts for plant cells, e.g. plant artificial chromosomes (PACs); Phenotypically and genetically modified plants via recombinant DNA technology with agronomic (input) traits, e.g. crop yield
C12N15/82 IPC
Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor; Recombinant DNA-technology; Introduction of foreign genetic material using vectors; Vectors; Use of hosts therefor; Regulation of expression; Vectors or expression systems specially adapted for eukaryotic hosts for plant cells, e.g. plant artificial chromosomes (PACs)
C12N15/113 » CPC further
Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor; Recombinant DNA-technology; DNA or RNA fragments; Modified forms thereof Non-coding nucleic acids modulating the expression of genes, e.g. antisense oligonucleotides
This continuation application is a continuation application of U.S. Ser. No. 13/819,619 filed Feb. 27, 2013, which is a 35 USC §371 National Stage application of PCT/US2012/44434 filed Jun. 27, 2012, which claims priority to U.S. Ser. No. 61/503,852 filed Jul. 1, 2011, all of which are incorporated herein by reference.
The field of disclosure relates to plant breeding and genetics and, in particular, relates to recombinant DNA constructs useful in plants for conferring improved agronomic traits.
Improving agronomic traits in crop plants is beneficial to farmers. Several factors crop yield. Abiotic stress is the primary cause of crop loss worldwide, causing average yield losses of more than 50% for major crops. Among the various abiotic stresses, drought is a major factor that limits crop productivity worldwide. Exposure of plants to a water-limiting environment during various developmental stages appears to activate various physiological and developmental changes. Molecular mechanisms of abiotic stress responses and the genetic regulatory networks of drought stress tolerance have been studied.
Natural responses to abiotic stress vary among plant species and among varieties and cultivars within a plant species. Certain species, varieties or cultivars are more tolerant to abiotic stress such as drought than others. Transgenic approaches including overexpression and downregulation are evaluated for engineering drought tolerance in crop plants. Nitrogen utilization efficiency also affects crop yield, especially where the application of nitrogen fertilizer is limited.
Methods and compositions to increase yield and stress tolerance in plants are disclosed. In an embodiment, reduced activity or expression of Pre2 gene results in increased tolerance to drought and improved nitrogen utilization.
A method of altering an agronomic trait or parameter of a plant, the method includes expressing a polynucleotide that down-regulates the endogenous expression of a messenger RNA encoding a polypeptide, wherein the polypeptide includes a conserved domain selected from the group consisting of SEQ ID NOS: 27-48. In an embodiment, the agronomic trait or parameter is selected from the group consisting of drought tolerance, increased nitrogen use efficiency, and increased yield. In an embodiment, the suppression of endogenous expression of the messenger RNA is by RNAi.
In an embodiment, the expression of the endogenous Pre2 gene or production of its protein is reduced by anti-sense expression, co-suppression, dsRNA, ribozymes, microRNA, genome editing, targeted promoter inactivation, site-directed mutagenesis and knock-outs.
In an embodiment, a plant comprising in its genome a recombinant DNA construct comprising a polynucleotide operably linked to at least one regulatory element, wherein said polynucleotide comprises a nucleotide sequence selected from the group consisting of: (a) a nucleotide sequence encoding a polypeptide with drought tolerance activity, wherein the polypeptide has an amino acid sequence of at least 60%, 80%, 85%, 90%, 95% or 100% sequence identity, based on the Clustal W method of alignment with pairwise alignment default parameters (GAP PENALTY=10, GAP LENGTH PENALTY=0.2, DELAY DEVERGENT SEQS(%)=30%, DNA TRANSITION WEIGHT=0.5, PROTEIN WEIGHT MATRIX āGonnet Seriesā), when compared to a sequence selected from the group consisting of SEQ ID NOS: 3, 5, 7, 9, 11, 13, 15, 18, 20 and 22; (b) a nucleotide sequence encoding a polypeptide with drought tolerance activity, wherein the nucleotide sequence is hybridizable under stringent conditions with a DNA molecule comprising the full complement to a sequence selected from the group consisting of SEQ ID NOS: 1, 2, 4, 6, 8, 10, 12, 14, 16, 17, 19, 21, 23-26; (c) a nucleotide sequence encoding a polypeptide with drought tolerance activity, wherein the nucleotide sequence is derived from a sequence selected from the group consisting of SEQ ID NOS: 1, 2, 4, 6, 8, 10, 12, 14, 16, 17, 19, 21, 23-26 by alteration of one or more nucleotides by at least one method selected from the group consisting of: deletion, substitution, addition and insertion; (d) a nucleotide sequence encoding a polypeptide wherein the amino acid sequence of the polypeptide comprises a sequence selected from the group consisting of SEQ ID NOS: 3, 5, 7, 9, 11, 13, 15, 18, 20 and 22; and (e) a nucleotide sequence comprising a sequence selected from the group consisting of SEQ ID NOS: 1, 2, 4, 6, 8, 10, 12, 14, 16, 17, 19, 21, 23-26; and wherein said plant exhibits increased drought tolerance when compared to a control plant not comprising said recombinant DNA construct. The plant may be a monocot or dicot.
In another embodiment, a plant comprising in its genome a recombinant DNA construct comprising a polynucleotide operably linked to at least one regulatory element, wherein said polynucleotide comprises a nucleotide sequence selected from the group consisting of: (a) a nucleotide sequence encoding a polypeptide with drought tolerance activity, wherein the polypeptide has an amino acid sequence of at least 60%, 80%, 85%, 90%, 95% or 100% sequence identity, based on the Clustal W method of alignment with pairwise alignment default parameters (GAP PENALTY=10, GAP LENGTH PENALTY=0.2, DELAY DEVERGENT SEQS(%)=30%, DNA TRANSITION WEIGHT=0.5, PROTEIN WEIGHT MATRIX āGonnet Seriesā), when compared to a sequence selected from the group consisting of SEQ ID NOS: 3, 5, 7, 9, 11, 13, 15, 18, 20 and 22; (b) a nucleotide sequence encoding a polypeptide with drought tolerance activity, wherein the nucleotide sequence is hybridizable under stringent conditions with a DNA molecule comprising the full complement to a sequence selected from the group consisting of SEQ ID NOS: 1, 2, 4, 6, 8, 10, 12, 14, 16, 17, 19, 21, 23-26; (c) a nucleotide sequence encoding a polypeptide with drought tolerance activity, wherein the nucleotide sequence is derived from a sequence selected from the group consisting of SEQ ID NOS: 1, 2, 4, 6, 8, 10, 12, 14, 16, 17, 19, 21, 23-26 by alteration of one or more nucleotides by at least one method selected from the group consisting of: deletion, substitution, addition and insertion; (d) a nucleotide sequence encoding a polypeptide wherein the amino acid sequence of the polypeptide comprises a sequence selected from the group consisting of SEQ ID NOS: 3, 5, 7, 9, 11, 13, 15, 18, 20 and 22; and (e) a nucleotide sequence comprising a sequence selected from the group consisting of SEQ ID NOS: 1, 2, 4, 6, 8, 10, 12, 14, 16, 17, 19, 21, 23-26; and wherein said plant exhibits an increase in yield when compared to a control plant not comprising said recombinant DNA construct. The plant may exhibit said increase in yield when compared, under water limiting conditions, to said control plant not comprising said recombinant DNA construct. The plant may be a monocot or dicot.
In another embodiment, a method of increasing drought tolerance in a plant, comprising: (a) introducing into a regenerable plant cell a recombinant DNA construct comprising a polynucleotide operably linked to at least one regulatory element, wherein said polynucleotide comprises a nucleotide sequence selected from the group consisting of: (i) a nucleotide sequence encoding a polypeptide with drought tolerance activity, wherein the polypeptide has an amino acid sequence of at least 60%, 80%, 85%, 90%, 95% or 100% sequence identity, based on the Clustal W method of alignment with pairwise alignment default parameters (GAP PENALTY=10, GAP LENGTH PENALTY=0.2, DELAY DEVERGENT SEQS(%)=30%, DNA TRANSITION WEIGHT=0.5, PROTEIN WEIGHT MATRIX āGonnet Seriesā), when compared to a sequence selected from the group consisting of SEQ ID NOS: 3, 5, 7, 9, 11, 13, 15, 18, 20 and 22; (ii) a nucleotide sequence encoding a polypeptide with drought tolerance activity, wherein the nucleotide sequence is hybridizable under stringent conditions with a DNA molecule comprising the full complement to a sequence selected from the group consisting of SEQ ID NOS: 1, 2, 4, 6, 8, 10, 12, 14, 16, 17, 19, 21, 23-26; (iii) a nucleotide sequence encoding a polypeptide with drought tolerance activity, wherein the nucleotide sequence is a sequence selected from the group consisting of SEQ ID NOS: 1, 2, 4, 6, 8, 10, 12, 14, 16, 17, 19, 21, 23-26 by alteration of one or more nucleotides by at least one method selected from the group consisting of: deletion, substitution, addition and insertion; (iv) a nucleotide sequence encoding a polypeptide wherein the amino acid sequence of the polypeptide comprises a sequence selected from the group consisting of SEQ ID NOS: 3, 5, 7, 9, 11, 13, 15, 18, 20 and 22; and (v) a nucleotide sequence comprising a sequence selected from the group consisting of SEQ ID NOS: 1, 2, 4, 6, 8, 10, 12, 14, 16, 17, 19, 21, 23-26; and (b) regenerating a transgenic plant from the regenerable plant cell after step (a), wherein the transgenic plant comprises in its genome the recombinant DNA construct and exhibits increased drought tolerance when compared to a control plant not comprising the recombinant DNA construct. The method may further comprise: (c) obtaining a progeny plant derived from the transgenic plant, wherein said progeny plant comprises in its genome the recombinant DNA construct and exhibits increased drought tolerance when compared to a control plant not comprising the recombinant DNA construct.
In another embodiment, a method of evaluating drought tolerance in a plant, comprising: (a) obtaining a transgenic plant, wherein the transgenic plant comprises in its genome a recombinant DNA construct comprising a polynucleotide operably linked to at least one regulatory element, wherein said polynucleotide comprises a nucleotide sequence selected from the group consisting of: (i) a nucleotide sequence encoding a polypeptide with drought tolerance activity, wherein the polypeptide has an amino acid sequence of at least 60%, 80%, 85%, 90%, 95% or 100% sequence identity, based on the Clustal W method of alignment with pairwise alignment default parameters (GAP PENALTY=10, GAP LENGTH PENALTY=0.2, DELAY DEVERGENT SEQS(%)=30%, DNA TRANSITION WEIGHT=0.5, PROTEIN WEIGHT MATRIX āGonnet Seriesā), when compared to a sequence selected from the group consisting of SEQ ID NOS: 3, 5, 7, 9, 11, 13, 15, 18, 20 and 22; (ii) a nucleotide sequence encoding a polypeptide with drought tolerance activity, wherein the nucleotide sequence is hybridizable under stringent conditions with a DNA molecule comprising the full complement of a sequence selected from the group consisting of SEQ ID NOS: 1, 2, 4, 6, 8, 10, 12, 14, 16, 17, 19, 21, 23-26; (iii) a nucleotide sequence encoding a polypeptide with drought tolerance activity, wherein the nucleotide sequence is a sequence selected from the group consisting of SEQ ID NOS: 1, 2, 4, 6, 8, 10, 12, 14, 16, 17, 19, 21, 23-26 by alteration of one or more nucleotides by at least one method selected from the group consisting of: deletion, substitution, addition and insertion; (iv) a nucleotide sequence encoding a polypeptide wherein the amino acid sequence of the polypeptide comprises a sequence selected from the group consisting of SEQ ID NOS: 3, 5, 7, 9, 11, 13, 15, 18, 20 and 22; and (v) a nucleotide sequence comprising a sequence selected from the group consisting of SEQ ID NOS: 1, 2, 4, 6, 8, 10, 12, 14, 16, 17, 19, 21, 23-26; and (b) obtaining a progeny plant derived from the transgenic plant of (a), wherein the progeny plant comprises in its genome the recombinant DNA construct; and (c) evaluating the progeny plant for drought tolerance compared to a control plant not comprising the recombinant DNA construct.
In another embodiment, a method of determining an alteration of an agronomic characteristic in a plant, comprising: (a) obtaining a transgenic plant, wherein the transgenic plant comprises in its genome a recombinant DNA construct comprising a polynucleotide operably linked to at least one regulatory element, wherein said polynucleotide comprises a nucleotide sequence selected from the group consisting of: (i) a nucleotide sequence encoding a polypeptide with drought tolerance activity, wherein the polypeptide has an amino acid sequence of at least 60%, 80%, 85%, 90%, 95% or 100% sequence identity, based on the Clustal W method of alignment with pairwise alignment default parameters (GAP PENALTY=10, GAP LENGTH PENALTY=0.2, DELAY DEVERGENT SEQS(%)=30%, DNA TRANSITION WEIGHT=0.5, PROTEIN WEIGHT MATRIX āGonnet Seriesā), when compared to a sequence selected from the group consisting of SEQ ID NOS: 3, 5, 7, 9, 11, 13, 15, 18, 20 and 22; (ii) a nucleotide sequence encoding a polypeptide with drought tolerance activity, wherein the nucleotide sequence is hybridizable under stringent conditions with a DNA molecule comprising the full complement of a sequence selected from the group consisting of SEQ ID NOS: 1, 2, 4, 6, 8, 10, 12, 14, 16, 17, 19, 21, 23-26; (iii) a nucleotide sequence encoding a polypeptide with drought tolerance activity, wherein the nucleotide sequence is a sequence selected from the group consisting of SEQ ID NOS: 1, 2, 4, 6, 8, 10, 12, 14, 16, 17, 19, 21, 23-26 by alteration of one or more nucleotides by at least one method selected from the group consisting of: deletion, substitution, addition and insertion; (iv) a nucleotide sequence encoding a polypeptide wherein the amino acid sequence of the polypeptide comprises a sequence selected from the group consisting of SEQ ID NOS: 3, 5, 7, 9, 11, 13, 15, 18, 20 and 22; and (v) a nucleotide sequence comprising a sequence selected from the group consisting of SEQ ID NOS: 1, 2, 4, 6, 8, 10, 12, 14, 16, 17, 19, 21, 23-26; and (b) obtaining a progeny plant derived from the transgenic plant of step (a), wherein the progeny plant comprises in its genome the recombinant DNA construct; and (c) determining whether the progeny plant exhibits an alteration of at least one agronomic characteristic when compared to a control plant not comprising the recombinant DNA construct. Said determining step (c) may comprise determining whether the transgenic plant exhibits an alteration of at least one agronomic characteristic when compared, under water limiting conditions, to a control plant not comprising the recombinant DNA construct. Said at least one agronomic trait may be yield and furthermore may be an increase in yield.
In another embodiment, an isolated polynucleotide comprising a nucleotide sequence selected from the group consisting of: (a) a nucleotide sequence encoding a polypeptide with drought tolerance activity, wherein the polypeptide has an amino acid sequence of at least 60%, 80%, 85%, 90% or 95% sequence identity, based on the Clustal W method of alignment with pairwise alignment default parameters (GAP PENALTY=10, GAP LENGTH PENALTY=0.2, DELAY DEVERGENT SEQS(%)=30%, DNA TRANSITION WEIGHT=0.5, PROTEIN WEIGHT MATRIX āGonnet Seriesā), when compared to a sequence selected from the group consisting of SEQ ID NOS: 3, 5, 7, 9, 11, 13, 15, 18, 20 and 22; b) a nucleotide sequence encoding a polypeptide with drought tolerance activity, wherein the nucleotide sequence is hybridizable under stringent conditions with a DNA molecule comprising the full complement of a sequence selected from the group consisting of SEQ ID NOS: 1, 2, 4, 6, 8, 10, 12, 14, 16, 17, 19, 21, 23-26; (c) a nucleotide sequence encoding a polypeptide with drought tolerance activity, wherein the nucleotide sequence is a sequence selected from the group consisting of SEQ ID NOS: 1, 2, 4, 6, 8, 10, 12, 14, 16, 17, 19, 21, 23-26 by alteration of one or more nucleotides by at least one method selected from the group consisting of: deletion, substitution, addition and insertion; (d) a nucleotide sequence encoding a polypeptide wherein the amino acid sequence of the polypeptide comprises a sequence selected from the group consisting of SEQ ID NOS: 3, 5, 7, 9, 11, 13, 15, 18, 20 and 22; and (e) a a nucleotide sequence comprising a sequence selected from the group consisting of SEQ ID NOS: 1, 2, 4, 6, 8, 10, 12, 14, 16, 17, 19, 21, 23-26.
In another embodiment, an isolated polynucleotide comprising the full complement of the nucleotide sequence of the disclosure, wherein the full complement and the nucleotide sequence of the disclosure consist of the same number of nucleotides and are 100% complementary.
In another embodiment, a recombinant DNA construct comprising the isolated polynucleotide of the disclosure operably linked to at least one regulatory element.
In another embodiment, a cell comprising the recombinant DNA construct of the disclosure, wherein the cell is selected from the group consisting of a bacterial cell, a yeast cell, and insect cell and a plant cell.
In another embodiment, a plant or a seed comprising the recombinant DNA construct of the disclosure. The plant or seed may be a monocot or a dicot plant or seed.
In another embodiment, a method for isolating a polypeptide encoded by the recombinant DNA construct of the disclosure, wherein the method comprises the following: (a) transforming a cell with the recombinant DNA construct of the disclosure; (b) growing the transformed cell of step (a) under conditions suitable for expression of the recombinant DNA construct; and (c) isolating the polypeptide from the transformed cell of step (b).
In another embodiment, an isolated polypeptide selected from the group consisting of: (a) a polypeptide with drought tolerance activity, wherein the polypeptide has an amino acid sequence of at least 60%, 80%, 85%, 90% or 95% sequence identity, based on the Clustal W method of alignment with pairwise alignment default parameters (GAP PENALTY=10, GAP LENGTH PENALTY=0.2, DELAY DEVERGENT SEQS(%)=30%, DNA TRANSITION WEIGHT=0.5, PROTEIN WEIGHT MATRIX āGonnet Seriesā), when compared to a sequence selected from the group consisting of SEQ ID NOS: 3, 5, 7, 9, 11, 13, 15, 18, 20 and 22; (b) a polypeptide with drought tolerance activity, wherein the amino acid sequence is a sequence selected from the group consisting of SEQ ID NOS: 1, 2, 4, 6, 8, 10, 12, 14, 16, 17, 19, 21, 23-26; by alteration of one or more amino acids by at least one method selected from the group consisting of: deletion, substitution, addition and insertion; and (c) a polypeptide wherein the amino acid sequence of the polypeptide comprises a sequence selected from the group consisting of SEQ ID NOS: 3, 5, 7, 9, 11, 13, 15, 18, 20 and 22.
In another embodiment, a vector that includes the polynucleotide of the disclosure is described.
In another embodiment, a method for producing a transgenic plant comprising transforming a plant cell with the recombinant DNA construct of the disclosure and regenerating a transgenic plant from the transformed plant cell.
In another embodiment, the present disclosure includes any of the plants of the present disclosure wherein the plant is selected from the group consisting of: maize, soybean, sunflower, sorghum, canola, wheat, alfalfa, cotton, rice, barley, millet, sugarcane, switchgrass, tobacco, potato and sugar beet.
In another embodiment, the present disclosure includes any of the methods of the present disclosure wherein the plant is selected from the group consisting of: maize, soybean, sunflower, sorghum, canola, wheat, alfalfa, cotton, rice, barley, millet, sugarcane, switchgrass, tobacco, potato and sugar beet.
In another embodiment, the present disclosure includes seed of any of the plants of the present disclosure, wherein said seed comprises in its genome a recombinant DNA construct comprising a polynucleotide operably linked to at least one regulatory element, wherein said polynucleotide encodes a polypeptide having an amino acid sequence of at least 60% sequence identity, based on the Clustal W method of alignment, when compared to a sequence selected from the group consisting of SEQ ID NOS: 3, 5, 7, 9, 11, 13, 15, 18, 20 and 22; and wherein a plant produced from said seed exhibits either an increased drought tolerance, or an increase in yield, or both, when compared to a control plant not comprising said recombinant DNA construct.
A method of identifying a plant that exhibits increased drought tolerance or an improved agronomic parameter, the method includes screening a population of maize plants for drought tolerance or enhanced nitrogen utilization efficiency and analyzing the sequence of a polynucleotide encoding a protein comprising SEQ ID NO: 3 and identifying the plant with drought tolerance or enhanced nitrogen utilization efficiency.
A method of identifying alleles in maize plants or germplasm that are associated with enhanced tolerance to drought and/or increased nitrogen use efficiency comprising:
A transgenic plant includes in its genome a recombinant construct, the recombinant construct comprising a genetic element that reduces the expression of an endogenous gene, wherein the endogenous gene encodes a polypeptide that comprises an amino acid sequence of SEQ ID NO: 3 or a sequence that is 90% identical to SEQ ID NO: 3. In an embodiment, the genetic element includes a RNAi construct.
A plant comprising in its genome a genetic modification that results in the reduced expression of a gene that encodes a polypeptide that comprises an amino acid sequence of SEQ ID NO: 3 or a sequence that is 95% identical to SEQ ID NO: 3 or the reduced activity of the polypeptide, wherein the plant shows one or more improved agronomic parameters that contribute to drought tolerance or yield. In an embodiment, the plant is a maize plant.
The disclosure can be more fully understood from the following detailed description and the accompanying drawings and Sequence Listing which form a part of this application.
FIG. 1 shows the phenotype of pre-mature senescence (pre2) mutation (1A) and co-segregation analysis using SAIFF (Selective Amplification of Insertion Flanking Fragments) protocol to isolate a candidate gene responsible for the pre2 mutant phenotype in corn (1B).
FIG. 2 shows RT-PCR and Southern blot analyses of Pre2 candidate gene: Reverse transcriptase-polymerase chain reaction (RT-PCR) of pre2 mutant showing four transcripts with variable intensities as compared to one in WT-sib (2A). Cloning and sequence analysis of these transcripts were due to interference of the Mutator resulting into differential splicing in mutant mature RNA (2C). Southern blot analysis of pre2-2 mutant allele indicates a tight linkage between the pre2 mutant phenotype with the polymorphism in the candidate gene (2B).
FIG. 3 shows a diagramatic representation of gene expression of Pre2 gene in different plant parts of Arabodopsis. Red (dark shade) and yellow (light shade) colors depict the highest and lowest gene expression, respectively.
FIG. 4 show PCR fingerprinting of T-DNA insertion plants of Arabidopsis: PCR-FP analysis to identify homozygous knockouts, heterozygous and wild-type plants for T-DNA insertion of pre2 gene.
FIG. 5A shows that homozygous (pre2/pre2) knockout mutants (#11 and #25) exhibit robust growth and more siliques at flowering as compared to its both wild-type (+/+) and heterozygous (+/pre2) sibs. FIG. 5B shows average biomass of homozygous T-DNA knockout mutant (KO) plants is significantly higher as compared to its homozygous WT-sibs (WT) and heterozygous WT-sibs (Het).
FIG. 6 shows Arabidopsis knockout mutant (homozygous) for corn homolog of pre2 candidate gene and its WT-sib were screened for drought assay. The Atpre2 mutant was an outlier in this assay with a score (2 sigma) higher than 0.9 and with positive deviation. Arabidopsis transgene with corn native gene was a control and was hypersensitive to drought stress.
FIG. 7 shows phenotypic response of Arabidopsis knockout mutant (homozygous) for homolog of corn pre2 along with its WT-sib screened on Low N.
FIG. 8 shows screening of pre2 knockout mutant for pre2 of Arabidopsis showing root inhibition (sensitivity) to high N.
FIG. 9 shows trait summary of T0 plants for ear characteristics and seed number along with their molecular analysis (A) and the T1 reproductive assays results for three events (B). Significantly positive attributes are shown in bold.
FIG. 10 (A-E) shows multiple alignment of Arabidopsis Pre2 peptide with monocots (Bahia, Sudan and Resurrection grasses, sorghum, rice, and maize) and other dicots (soybean and castor bean). The order of sequences shown in the alignment is SEQ ID NOS: 15, 9, 5, 22, 18, 20, 3, 13, 7 and 11. The consensus regions are shown at the end of the alignment. A few exemplary conserved regions are indicated by horizontal bars.
FIG. 11(A-C) shows conserved domain sequences from Pre2 polypeptide sequences.
FIG. 12 shows germination rate on media containing 1 μM ABA. Col-0 and Atpre2 are represented as dark and light boxes, respectively. The data are averages of germination rate with standard deviations from three replications.
| Description and Abbreviation | SEQ ID NO. | |
| Maize (ZmPre2 genomic sequence) | 1 | |
| Maize (ZmPre2 cDNA sequence) | 2 | |
| Maize (ZmPRE2 amino acid sequence) | 3 | |
| Rice (OsPre2 cDNA) | 4 | |
| Rice (OsPRE2 aa sequence) | 5 | |
| Sorghum (SbPre2 cDNA) | 6 | |
| Sorghum (SbPRE2_aa sequence) | 7 | |
| BahiaGrass cDNA sequence | 8 | |
| BahiaGrass PRE2 aa | 9 | |
| SudanGrass_CDS (partial length sequence) | 10 | |
| SudanGrass_aa partial length sequence | 11 | |
| ResurrectionGrass CDS | 12 | |
| ResurrectionGrass_aa | 13 | |
| At1g72390FL cDNA Arabidopsis | 14 | |
| AtPRE2_aa sequence | 15 | |
| At1g72390genomic Arabidopsis | 16 | |
| GM_chr16_Pre2 CDS | 17 | |
| GM_chr16_Pre2 (amino acid) | 18 | |
| GM_chr7_Pre2 (CDS) | 19 | |
| GM_chr7_Pre2 (amino acid) | 20 | |
| Castor bean Pre2 CDS | 21 | |
| Castor bean PRE2 amino acid | 22 | |
| BrassicaOleracea_Pre2 | 23 | |
| (gi_17734666_gb_BH526581.1) CDS | ||
| BrassicaRapa_Pre2(PBR136351) CDS | 24 | |
| Canola(PBN029307) CDS | 25 | |
| Soybean GM-Pre2 (PSO423639) DNA | 26 | |
| ZmPre2 TR1 (Fwd) | 49 | |
| ZmPre2 TR1 (Rev) | 50 | |
| Soybean Pre2 RNAi target sequence | 51 | |
| Conserved Domain 1 | 27 | |
| Conserved Domain 2 | 28 | |
| Conserved Domain 3 | 29 | |
| Conserved Domain 4 | 30 | |
| Conserved Domain 5 | 31 | |
| Descriptionāand | SEQ | |
| Abbreviation | Consensusāsequencesā(aminoāacid) | IDāNO: |
| ConservedāRegionā1 | MSLENIVKDIPSISDNSWTYGDLMEVESKILKALQPK | 32 |
| LHLDPTPKLDRL | ||
| ConservedāRegionā2 | SWTYGDLMEVES | 33 |
| ConservedāRegionā3 | SWTYGDLMEVESKILKALQP | 34 |
| ConservedāRegionā4 | GKKVCIDRVQESS | 35 |
| ConservedāRegionā5 | QSPRLSAGALPQSPLSSKSGEFS | 36 |
| ConservedāRegionā6 | SPLSSKSGEFS | 37 |
| ConservedāRegionā7 | AQLAAKRRSNSLPKT | 38 |
| ConservedāRegionā8 | VGSPVSVGTTSVPLNANSP | 39 |
| ConservedāRegionā9 | RFSKIEMVTMRHQLNFKK | 40 |
| ConservedāRegionā10 | LPNTHSADLLAQQFCSLMVREG | 41 |
| ConservedāRegionā11 | QALQMSQGLLSGVSM | 42 |
| ConservedāRegionā12 | SPQQMSQRTPMSPQISSGAIHAMSAGNPEACPASP | 43 |
| QLSSQTLGSVSSITNSPM | ||
| ConservedāRegionā13 | CPASPQLSSQTLGSVSSITNSPM | 44 |
| ConservedāRegionā14 | HEVSFTFSLYDRGYLISKSAAMDPSQTSIQDGKTLH | 45 |
| PYDRASEKLFSAIEAGRLPGDILDEIPSKYYNGSVVC | ||
| EIRDYRKHVSNQAPASSAELGLPIVNKVRLRMTFEN | ||
| VVKDITLLSDDSWSYRDFVEAEARIVRALQPELCLD | ||
| PTPKLDRLCQDPVPHKLSLGIGKKRRLRQNPEVVVT | ||
| SSNMSHGKKVCIDR | ||
| ConservedāRegionā15 | LCLDPTPKLDRLCQDPVPHKLSLGIGKKRRLRQNP | 46 |
| ConservedāRegionā16 | LCLDPTPKLDRL | 47 |
| ConservedāRegionā17 | QDPVPHKLSLGIGKKRRLRQNP | 48 |
The sequence descriptions and Sequence Listing attached hereto comply with the rules governing nucleotide and/or amino acid sequence disclosures in patent applications as set forth in 37 C.F.R. §1.821-1.825.
The Sequence Listing contains the one letter code for nucleotide sequence characters and the three letter codes for amino acids as defined in conformity with the IUPAC-IUBMB standards described in Nucleic Acids Res. 13:3021-3030 (1985) and in the Biochemical J. 219(2):345-373 (1984) which are herein incorporated by reference. The symbols and format used for nucleotide and amino acid sequence data comply with the rules set forth in 37 C.F.R. §1.822.
Pre2 nucleotide sequences and polypeptide sequences improve stress tolerance and yield of agronomically important crop plants and vegetables. Reduced expression of Pre2 mRNA results in enhanced tolerance to drought and improved utilization of nitrogen (NUE) under nitrogen limiting conditions. Suppressing of one or more Pre2 endogenous genes results in improved agronomic performance. One way of suppressing endogenous Pre2 gene expression is through RNAi. Other modes of suppression include anti-sense, co-suppression, promoter inverted repeats, and micro RNA. Another non-transgenic approach is to generate native variation in the expression levels of endogenous Pre2.
One or more of the plant Pre2 polypeptides disclosed herein include an Spt20 domain that is found in the Spt20 family of proteins from both human and yeast. The Spt20 protein is part of the SAGA complex which is a large complex that may be involved in histone deacetylation. Yeast Spt20 has been shown to play a role in structural integrity of the SAGA complex as no intact SAGA could be purified in spt20 deletion strains. The Spt20 domain or a sub-region thereof may be involved in DNA binding. For example, in an embodiment, the Spt20 domain comprises amino acid positions 69-227 of the castor bean Pre2 polypeptide. Relative positions in other Pre2 homologs or orthologs from one or more other species also contain this conserved region. In an embodiment, this conserved region is designated as āpfam12090ā.
Pre2 homozygous mutants were robust in growth with more pod numbers but were late in maturity by 4 to 5 days as compared to its WT-sibs (FIG. 5A). For measuring total biomass, 9 whole plants, each of knock out #11, knock out #25, homozygous WT, and heterozygous WT-sibs, were harvested and air dried for 14 days at room temperature. Total weight was determined by weighing and average and standard deviation were calculated for statistical analysis. The total biomass of both knockouts (combined) was found to be significantly higher (t test at P<0.01) when compared to both homozygous and heterozygous WT-sibs (FIG. 5B). In an embodiment, three maize gene suppression events (e.g., RNAi events namely 1.4, 1.5, and 2.5) exhibited improved agronomic parameters in an NUE Reproductive Assay in T1 generation under 4.0 mMol Nitrate-suboptimal nitrogen conditions. Two of three events (1.5 and 2.5) showed significant increase (percent change vs. Null) in silk count, ear length, ear width, and ear area (FIG. 9B). In addition to these traits, event 2.5 also showed significant difference for Days to shed and days to silk as compared to its nulls. Thus, transgenic plants where the expression of the Pre2 mRNA has been modulated exhibit significant differences in one or more agronomic parameters of interest for crop plants.
In ABA-sensitivity experiments, Atpre2 mutant showed a hypersensitive response to ABA in a dosage dependent manner. The seed germination in mutant was reduced or delayed by more than 50% as compare to wild type in presence of 1 uM ABA (FIG. x). Endogenous AT-PRE2 gene expression was higher in guard cells in wild type plants and was down-regulated by ABA treatment both in seedling and leaf based on gene expression databases. In addition AtPRE2 was also up-regulated by nitrate in roots. These results indicate a direct or indirect role of AtPRE2 in ABA and N signaling/pathway.
The disclosure of each reference set forth herein is hereby incorporated by reference in its entirety. Some of the agronomic parameters that correlate with nitrogen use efficiency analysis and/or include for e.g., root dwt (g), root: shoot dwt ratio, shoot dwt (g), shoot nitrogen (mg/g dwt), shoot total nitrogen (mg) and total plant dwt (g). Some of the variables that for nitrogen use efficiency reproductive assay include e.g., anthesis to silking interval (days), days to shed, days to silk, ear area 8 days after silk (sq cm), ear length 8 days after silk (cm), ear width 8 days after silk (cm), max total area, specific growth rate, and silk count.
As used herein and in the appended claims, the singular forms āaā, āanā, and ātheā include plural reference unless the context clearly dictates otherwise. Thus, for example, reference to āa plantā includes a plurality of such plants, reference to āa cellā includes one or more cells and equivalents thereof known to those skilled in the art, and so forth.
As used herein:
The terms āmonocotā and āmonocotyledonous plantā are used interchangeably herein. A monocot of the current disclosure includes the Gramineae.
The terms ādicotā and ādicotyledonous plantā are used interchangeably herein. A dicot of the current disclosure includes the following families: Brassicaceae, Leguminosae, and Solanaceae.
The terms āfull complementā and āfull-length complementā are used interchangeably herein, and refer to a complement of a given nucleotide sequence, wherein the complement and the nucleotide sequence consist of the same number of nucleotides and are 100% complementary.
āArabidopsisā and āArabidopsis thalianaā are used interchangeably herein, unless otherwise indicated.
An āExpressed Sequence Tagā (āESTā) is a DNA sequence derived from a cDNA library and therefore is a sequence which has been transcribed. An EST is typically obtained by a single sequencing pass of a cDNA insert. The sequence of an entire cDNA insert is termed the āFull-Insert Sequenceā (āFISā). A āContigā sequence is a sequence assembled from two or more sequences that can be selected from, but not limited to, the group consisting of an EST, FIS and PCR sequence. A sequence encoding an entire or functional protein is termed a āComplete Gene Sequenceā (āCGSā) and can be derived from an FIS or a contig.
āAgronomic characteristicā or āagronomic parameterā is a measurable parameter including but not limited to, greenness, yield, growth rate, biomass, fresh weight at maturation, dry weight at maturation, fruit yield, seed yield, total plant nitrogen content, fruit nitrogen content, seed nitrogen content, nitrogen content in a vegetative tissue, total plant free amino acid content, fruit free amino acid content, seed free amino acid content, free amino acid content in a vegetative tissue, total plant protein content, fruit protein content, seed protein content, protein content in a vegetative tissue, drought tolerance, nitrogen uptake, root lodging, harvest index, stalk lodging, plant height, ear height, ear length, salt tolerance, early seedling vigor and seedling emergence under low temperature stress.
āTransgenicā refers to any cell, cell line, callus, tissue, plant part or plant, the genome of which has been altered by the presence of a heterologous nucleic acid, such as a recombinant DNA construct, including those initial transgenic events as well as those created by sexual crosses or asexual propagation from the initial transgenic event. The term ātransgenicā as used herein does not encompass the alteration of the genome (chromosomal or extra-chromosomal) by conventional plant breeding methods or by naturally occurring events such as random cross-fertilization, non-recombinant viral infection, non-recombinant bacterial transformation, non-recombinant transposition or spontaneous mutation.
āGenomeā as it applies to plant cells encompasses not only chromosomal DNA found within the nucleus, but organelle DNA found within subcellular components (e.g., mitochondrial, plastid) of the cell.
āPlantā includes reference to whole plants, plant organs, plant tissues, seeds and plant cells and progeny of same. Plant cells include, without limitation, cells from seeds, suspension cultures, embryos, meristematic regions, callus tissue, leaves, roots, shoots, gametophytes, sporophytes, pollen, and microspores.
āProgenyā comprises any subsequent generation of a plant.
āTransgenic plantā includes reference to a plant which comprises within its genome a heterologous polynucleotide. For example, the heterologous polynucleotide is stably integrated within the genome such that the polynucleotide is passed on to successive generations. The heterologous polynucleotide may be integrated into the genome alone or as part of a recombinant DNA construct.
āHeterologousā with respect to sequence means a sequence that originates from a foreign species, or, if from the same species, is substantially modified from its native form in composition and/or genomic locus by deliberate human intervention.
āPolynucleotideā, ānucleic acid sequenceā, ānucleotide sequenceā, or ānucleic acid fragmentā are used interchangeably and is a polymer of RNA or DNA that is single- or double-stranded, optionally containing synthetic, non-natural or altered nucleotide bases. Nucleotides (usually found in their 5ā²-monophosphate form) are referred to by their single letter designation as follows: āAā for adenylate or deoxyadenylate (for RNA or DNA, respectively), āCā for cytidylate or deoxycytidylate, āGā for guanylate or deoxyguanylate, āUā for uridylate, āTā for deoxythymidylate, āRā for purines (A or G), āYā for pyrimidines (C or T), āKā for G or T, āHā for A or C or T, āIā for inosine and āNā for any nucleotide.
āPolypeptideā, āpeptideā, āamino acid sequenceā and āproteinā are used interchangeably herein to refer to a polymer of amino acid residues. The terms apply to amino acid polymers in which one or more amino acid residue is an artificial chemical analogue of a corresponding naturally occurring amino acid, as well as to naturally occurring amino acid polymers. The terms āpolypeptideā, āpeptideā, āamino acid sequenceā, and āproteinā are also inclusive of modifications including, but not limited to, glycosylation, lipid attachment, sulfation, gamma-carboxylation of glutamic acid residues, hydroxylation and ADP-ribosylation.
āMessenger RNA (mRNA)ā refers to the RNA that is without introns and that can be translated into protein by the cell.
ācDNAā refers to a DNA that is complementary to and synthesized from a mRNA template using the enzyme reverse transcriptase. The cDNA can be single-stranded or converted into the double-stranded form using the Klenow fragment of DNA polymerase I.
āMatureā protein refers to a post-translationally processed polypeptide; i.e., one from which any pre- or pro-peptides present in the primary translation product have been removed.
Nitrogen utilization efficiency (NUE) genes affect yield and have utility for improving the use of nitrogen in crop plants, especially maize. Increased nitrogen use efficiency can result from enhanced uptake and assimilation of nitrogen fertilizer and/or the subsequent remobilization and reutilization of accumulated nitrogen reserves, as well as increased tolerance of plants to stress situations such as low nitrogen environments. The genes can be used to alter the genetic composition of the plants, rendering them more productive with current fertilizer application standards or maintaining their productive rates with significantly reduced fertilizer or reduced nitrogen availability. Improving NUE in corn would increase corn harvestable yield per unit of input nitrogen fertilizer, both in developing nations where access to nitrogen fertilizer is limited and in developed nations where the level of nitrogen use remains high. Nitrogen utilization improvement also allows decreases in on-farm input costs, decreased use and dependence on the non-renewable energy sources required for nitrogen fertilizer production and reduces the environmental impact of nitrogen fertilizer manufacturing and agricultural use
āPrecursorā protein refers to the primary product of translation of mRNA; i.e., with pre- and pro-peptides still present. Pre- and pro-peptides may be and are not limited to intracellular localization signals.
āIsolatedā refers to materials, such as nucleic acid molecules and/or proteins, which are substantially free or otherwise removed from components that normally accompany or interact with the materials in a naturally occurring environment. Isolated polynucleotides may be purified from a host cell in which they naturally occur. Conventional nucleic acid purification methods known to skilled artisans may be used to obtain isolated polynucleotides. The term also embraces recombinant polynucleotides and chemically synthesized polynucleotides.
āRecombinantā refers to an artificial combination of two otherwise separated segments of sequence, e.g., by chemical synthesis or by the manipulation of isolated segments of nucleic acids by genetic engineering techniques. āRecombinantā also includes reference to a cell or vector, that has been modified by the introduction of a heterologous nucleic acid or a cell derived from a cell so modified, but does not encompass the alteration of the cell or vector by naturally occurring events (e.g., spontaneous mutation, natural transformation/transduction/transposition) such as those occurring without deliberate human intervention.
āRecombinant DNA constructā refers to a combination of nucleic acid fragments that are not normally found together in nature. Accordingly, a recombinant DNA construct may comprise regulatory sequences and coding sequences that are derived from different sources, or regulatory sequences and coding sequences derived from the same source, but arranged in a manner different than that normally found in nature.
The terms āentry cloneā and āentry vectorā are used interchangeably herein.
āRegulatory sequencesā refer to nucleotide sequences located upstream (5ā² non-coding sequences), within, or downstream (3ā² non-coding sequences) of a coding sequence, and which influence the transcription, RNA processing or stability, or translation of the associated coding sequence. Regulatory sequences may include, but are not limited to, promoters, translation leader sequences, introns, and polyadenylation recognition sequences. The terms āregulatory sequenceā and āregulatory elementā are used interchangeably herein.
āPromoterā refers to a nucleic acid fragment capable of controlling transcription of another nucleic acid fragment.
āPromoter functional in a plantā is a promoter capable of controlling transcription in plant cells whether or not its origin is from a plant cell.
āTissue-specific promoterā and ātissue-preferred promoterā are used interchangeably, and refer to a promoter that is expressed predominantly but not necessarily exclusively in one tissue or organ, but that may also be expressed in one specific cell.
āDevelopmentally regulated promoterā refers to a promoter whose activity is determined by developmental events.
āOperably linkedā refers to the association of nucleic acid fragments in a single fragment so that the function of one is regulated by the other. For example, a promoter is operably linked with a nucleic acid fragment when it is capable of regulating the transcription of that nucleic acid fragment.
āExpressionā refers to the production of a functional product. For example, expression of a nucleic acid fragment may refer to transcription of the nucleic acid fragment (e.g., transcription resulting in mRNA or functional RNA) and/or translation of mRNA into a precursor or mature protein.
āPhenotypeā means the detectable characteristics of a cell or organism.
āIntroducedā in the context of inserting a nucleic acid fragment (e.g., a recombinant DNA construct) into a cell, means ātransfectionā or ātransformationā or ātransductionā and includes reference to the incorporation of a nucleic acid fragment into a eukaryotic or prokaryotic cell where the nucleic acid fragment may be incorporated into the genome of the cell (e.g., chromosome, plasmid, plastid or mitochondrial DNA), converted into an autonomous replicon, or transiently expressed (e.g., transfected mRNA).
A ātransformed cellā is any cell into which a nucleic acid fragment (e.g., a recombinant DNA construct) has been introduced.
āTransformationā as used herein refers to both stable transformation and transient transformation.
āStable transformationā refers to the introduction of a nucleic acid fragment into a genome of a host organism resulting in genetically stable inheritance. Once stably transformed, the nucleic acid fragment is stably integrated in the genome of the host organism and any subsequent generation.
āTransient transformationā refers to the introduction of a nucleic acid fragment into the nucleus, or DNA-containing organelle, of a host organism resulting in gene expression without genetically stable inheritance.
āAlleleā is one of several alternative forms of a gene occupying a given locus on a chromosome. When the alleles present at a given locus on a pair of homologous chromosomes in a diploid plant are the same that plant is homozygous at that locus. If the alleles present at a given locus on a pair of homologous chromosomes in a diploid plant differ that plant is heterozygous at that locus. If a transgene is present on one of a pair of homologous chromosomes in a diploid plant that plant is hemizygous at that locus.
The percent identity between two amino acid or nucleic acid sequences may be determined by visual inspection and mathematical calculation.
Sequence alignments and percent identity calculations may be determined using a variety of comparison methods designed to detect homologous sequences including, but not limited to, the MEGALIGNĀ® program of the LASERGENEĀ® bioinformatics computing suite (DNASTARĀ® Inc., Madison, Wis.). Unless stated otherwise, multiple alignment of the sequences provided herein were performed using the Clustal W method of alignment (Thompson, et al., (1994). Nucleic Acids Research 22:4673-80) with the default parameters (GAP PENALTY=10, GAP LENGTH PENALTY=0.2, DELAY DEVERGENT SEQS(%)=30%, DNA TRANSITION WEIGHT=0.5, PROTEIN WEIGHT MATRIX āGonnet Seriesā).
Default parameters for pairwise alignments using the Clustal W method were SLOW-ACCURATE, GAP PENALTY=10, GAP LENGTH=0.10, PROTEIN WEIGHT MATRIX āGonnet 250ā. After alignment of the sequences, using the Clustal W program, it is possible to obtain āpercent identityā and ādivergenceā values by viewing the āsequence distancesā table on the same program; unless stated otherwise, percent identities and divergences provided and claimed herein were calculated in this manner.
Alternatively, sequence alignments and percent identity calculations may be determined using a variety of comparison methods designed to detect homologous sequences including, but not limited to, the Clustal V method of alignment (Higgins and Sharp, (1989) CAB/OS 5:151-153) with the default parameters (GAP PENALTY=10, GAP LENGTH PENALTY=10). Default parameters for pairwise alignments and calculation of percent identity of protein sequences using the Clustal V method are KTUPLE=1, GAP PENALTY=3, WINDOW=5 and DIAGONALS SAVED=5. For nucleic acids these parameters are KTUPLE=2, GAP PENALTY=5, WINDOW=4 and DIAGONALS SAVED=4.
Alternatively, the percent identity of two protein sequences may be determined by comparing sequence information based on the algorithm of Needleman and Wunsch, (J. Mol. Biol. 48:443-453, 1970) and using the GAP computer program available from the University of Wisconsin Genetics Computer Group (UWGCG). The preferred default parameters for the GAP program include: (1) a scoring matrix, blosum62, as described by Henikoff and Henikoff, (Proc. Natl. Acad. Sci. USA 89:10915-10919 1992); (2) a gap weight of 12; (3) a gap length weight of 4; and (4) no penalty for end gaps.
Other programs used by those skilled in the art of sequence comparison may also be used. The percent identity can be determined by comparing sequence information using, e.g., the BLAST program described by Altschul, et al., (Nucl. Acids. Res. 25:3389-3402 1997). This program is available on the Internet at the web site of the National Center for Biotechnology Information (NCBI) or the DNA Data Bank of Japan (DDBJ). The details of various conditions (parameters) for identity search using the BLAST program are shown on these web sites, and default values are commonly used for search although part of the settings may be changed as appropriate. Alternatively, the percent identity of two amino acid sequences may be determined by using a program such as genetic information processing software GENETYX Ver.7 (Genetyx Corporation, Japan) or using an algorithm such as FASTA. In this case, default values may be used for search.
The percent identity between two nucleic acid sequences can be determined by visual inspection and mathematical calculation, or more preferably, the comparison is done by comparing sequence information using a computer program. An exemplary, preferred computer program is the Genetic Computer Group (GCGĀ®; Madison, Wis.) WISCONSIN PACKAGEĀ® version 10.0 program, āGAPā (Devereux, et al., (1984) Nucl. Acids Res. 12:387). In addition to making a comparison between two nucleic acid sequences, this āGAPā program can be used for comparison between two amino acid sequences and between a nucleic acid sequence and an amino acid sequence. The preferred default parameters for the āGAPā program include: (1) the GCGĀ® implementation of a unary comparison matrix (containing a value of 1 for identities and 0 for non-identities) for nucleotides, and the weighted amino acid comparison matrix of Gribskov and Burgess, (1986) Nucl. Acids Res. 14:6745, as described by Schwartz and Dayhoff, eds., āAtlas of Polypeptide Sequence and Structure,ā National Biomedical Research Foundation, pp. 353-358, (1979), or other comparable comparison matrices; (2) a penalty of 30 for each gap and an additional penalty of 1 for each symbol in each gap for amino acid sequences, or penalty of 50 for each gap and an additional penalty of 3 for each symbol in each gap for nucleotide sequences; (3) no penalty for end gaps; and (4) no maximum penalty for long gaps. Other programs used by those skilled in the art of sequence comparison can also be used, such as, for example, the BLASTN program version 2.2.7, available for use via the National Library of Medicine website, or the WU-BLAST 2.0 algorithm (Advanced Biocomputing, LLC). In addition, the BLAST algorithm uses the BLOSUM62 amino acid scoring matrix, and optional parameters that can be used are as follows: (A) inclusion of a filter to mask segments of the query sequence that have low compositional complexity (as determined by the SEG program of Wootton and Federhen (Computers and Chemistry, 1993); also see, Wootton and Federhen, (1996) Methods Enzymol. 266:554-71) or segments consisting of short-periodicity internal repeats (as determined by the XNU program of Claverie and States (Computers and Chemistry, 1993)), and (B) a statistical significance threshold for reporting matches against database sequences, or E-score (the expected probability of matches being found merely by chance, according to the stochastic model of Karlin and Altschul, 1990; if the statistical significance ascribed to a match is greater than this E-score threshold, the match will not be reported); preferred E-score threshold values are 0.5, or in order of increasing preference, 0.25, 0.1, 0.05, 0.01, 0.001, 0.0001, 1 e-5, le-10, 1 e-15, 1 e-20, 1 e-25, 1 e-30, 1 e-40, 1 e-50, 1 e-75 or 1 e-100.
Standard recombinant DNA and molecular cloning techniques used herein are well known in the art and are described more fully in Sambrook, et al., Molecular Cloning: A Laboratory Manual; Cold Spring Harbor Laboratory Press: Cold Spring Harbor, 1989 (hereinafter āSambrookā).
The term āconsisting essentially ofā in the context of a polypeptide sequence generally refers to the specified portion of the amino acid sequence and those other sequences that do not materially affect the basic and novel characteristics of the disclosed sequences herein. For example, in the context of an RNAi sequence, the term consisting essentially generally refers to that portion of the target sequence and those other nucleotide sequences that do not materially affect the binding and suppressing properties of the sequence targets disclosed herein.
Embodiments include isolated polynucleotides and polypeptides, recombinant DNA constructs useful for conferring drought tolerance, compositions (such as plants or seeds) comprising these recombinant DNA constructs, and methods utilizing these recombinant DNA constructs.
Isolated Polynucleotides and Polypeptides:
The present disclosure includes the following isolated polynucleotides and polypeptides:
An isolated polypeptide having an amino acid sequence of at least 50%, 51%, 52%, 53%, 54%, 55%, 56%, 57%, 58%, 59%, 60%, 61%, 62%, 63%, 64%, 65%, 66%, 67%, 68%, 69%, 70%, 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity, based on the Clustal W method of alignment, when compared to a sequence selected from the group consisting of SEQ ID NOS: 3, 5, 7, 9, 11, 13, 15, 18, 20 and 22. The polypeptide is preferably a PRE2 polypeptide.
An isolated polypeptide wherein the amino acid sequence is a sequence selected from the group consisting of SEQ ID NOS: 3, 5, 7, 9, 11, 13, 15, 18, 20 and 22; by alteration of one or more amino acids by at least one method selected from the group consisting of: deletion, substitution, addition and insertion; and (c) a polypeptide wherein the amino acid sequence of the polypeptide comprises a sequence selected from the group consisting of SEQ ID NOS: 3, 5, 7, 9, 11, 13, 15, 18, 20 and 22. The polypeptide is preferably a PRE2 polypeptide.
An isolated polynucleotide comprising a nucleotide sequence encoding a polypeptide with drought tolerance activity, wherein the nucleotide sequence is hybridizable under stringent conditions with a DNA molecule comprising the full complement of a sequence selected from the group consisting of SEQ ID NOS: 1, 2, 4, 6, 8, 10, 12, 14, 16, 17, 19, 21, 23-26; An isolated polynucleotide comprising a nucleotide sequence encoding a polypeptide with drought tolerance activity, wherein the nucleotide sequence is a sequence selected from the group consisting of SEQ ID NOS: 1, 2, 4, 6, 8, 10, 12, 14, 16, 17, 19, 21, 23-26; by alteration of one or more nucleotides by at least one method selected from the group consisting of: deletion, substitution, addition and insertion.
Recombinant DNA Constructs:
In one aspect, the present disclosure includes recombinant DNA constructs.
In one embodiment, a recombinant DNA construct comprises a polynucleotide operably linked to at least one regulatory sequence (e.g., a promoter functional in a plant), wherein the polynucleotide comprises (i) a nucleic acid sequence encoding an amino acid sequence of at least 50%, 51%, 52%, 53%, 54%, 55%, 56%, 57%, 58%, 59%, 60%, 61%, 62%, 63%, 64%, 65%, 66%, 67%, 68%, 69%, 70%, 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity, based on the Clustal W method of alignment, when compared to a sequence selected from the group consisting of SEQ ID NOS: 3, 5, 7, 9, 11, 13, 15, 18, 20 and 22; or (ii) a full complement of the nucleic acid sequence of (i).
In another embodiment, a recombinant DNA construct comprises a polynucleotide operably linked to at least one regulatory sequence (e.g., a promoter functional in a plant), wherein said polynucleotide encodes a PRE2 polypeptide. The PRE2 polypeptide may be from Arabidopsis thaliana, Zea mays, Glycine max, Glycine tabacina, Glycine soja and Glycine tomentella.
It is understood, as those skilled in the art will appreciate, that the disclosure encompasses more than the specific exemplary sequences. Alterations in a nucleic acid fragment which result in the production of a chemically equivalent amino acid at a given site, but do not affect the functional properties of the encoded polypeptide, are well known in the art. For example, a codon for the amino acid alanine, a hydrophobic amino acid, may be substituted by a codon encoding another less hydrophobic residue, such as glycine, or a more hydrophobic residue, such as valine, leucine, or isoleucine. Similarly, changes which result in substitution of one negatively charged residue for another, such as aspartic acid for glutamic acid, or one positively charged residue for another, such as lysine for arginine, can also be expected to produce a functionally equivalent product. Nucleotide changes which result in alteration of the N-terminal and C-terminal portions of the polypeptide molecule would also not be expected to alter the activity of the polypeptide. Each of the proposed modifications is well within the routine skill in the art, as is determination of retention of biological activity of the encoded products.
The protein of the current disclosure may also be a protein which comprises an amino acid sequence comprising deletion, substitution, insertion and/or addition of one or more amino acids in an amino acid sequence selected from the group consisting of SEQ ID NOS: 3, 5, 7, 9, 11, 13, 15, 18, 20 and 22. The substitution may be conservative, which means the replacement of a certain amino acid residue by another residue having similar physical and chemical characteristics. Non-limiting examples of conservative substitution include replacement between aliphatic group-containing amino acid residues such as Ile, Val, Leu or Ala, and replacement between polar residues such as Lys-Arg, Glu-Asp or Gln-Asn replacement.
Proteins derived by amino acid deletion, substitution, insertion and/or addition can be prepared when DNAs encoding their wild-type proteins are subjected to, for example, well-known site-directed mutagenesis (see, e.g., Nucleic Acid Research, 10(20):6487-6500, (1982), which is hereby incorporated by reference in its entirety). As used herein, the term āone or more amino acidsā is intended to mean a possible number of amino acids which may be deleted, substituted, inserted and/or added by site-directed mutagenesis.
Site-directed mutagenesis may be accomplished, for example, as follows using a synthetic oligonucleotide primer that is complementary to single-stranded phage DNA to be mutated, except for having a specific mismatch (i.e., a desired mutation). Namely, the above synthetic oligonucleotide is used as a primer to cause synthesis of a complementary strand by phages, and the resulting duplex DNA is then used to transform host cells. The transformed bacterial culture is plated on agar, whereby plaques are allowed to form from phage-containing single cells. As a result, in theory, 50% of new colonies contain phages with the mutation as a single strand, while the remaining 50% have the original sequence. At a temperature which allows hybridization with DNA completely identical to one having the above desired mutation, but not with DNA having the original strand, the resulting plaques are allowed to hybridize with a synthetic probe labeled by kinase treatment. Subsequently, plaques hybridized with the probe are picked up and cultured for collection of their DNA.
Techniques for allowing deletion, substitution, insertion and/or addition of one or more amino acids in the amino acid sequences of biologically active peptides such as enzymes while retaining their activity include site-directed mutagenesis mentioned above, as well as other techniques such as those for treating a gene with a mutagen and those in which a gene is selectively cleaved to remove, substitute, insert or add a selected nucleotide or nucleotides, and then ligated. Alternatively, random mutagenesis approaches may be used to disrupt or āknock-outā the expression of a Pre2 gene using either chemical or insertional mutagenesis or irradiation. A mutagenesis and mutant identification system known as TILLING (for targeting induced local lesions in genomes) can also be used. In this method, mutations are induced in the seed of a plant of interest, for example, using EMS treatment. The resulting plants are grown and self-fertilized, and the progeny are assessed. For example, the plants may be assed using PCR to identify whether a mutated plant has a Pre2 mutation, e.g., that reduces expression of a Pre2 gene. See, e.g., Colbert, et al., (2001) Plant Physiol 126:480-484; McCallum, et al., (2000) Nature Biotechnology 18:455-457.
The term āunder stringent conditionsā means that two sequences hybridize under moderately or highly stringent conditions. More specifically, moderately stringent conditions can be readily determined by those having ordinary skill in the art, e.g., depending on the length of DNA. The basic conditions are set forth by Sambrook, et al., Molecular Cloning: A Laboratory Manual, Third Edition, Chapters 6 and 7, Cold Spring Harbor Laboratory Press, 2001 and include the use of a prewashing solution for nitrocellulose filters 5ĆSSC, 0.5% SDS, 1.0 mM EDTA (pH 8.0), hybridization conditions of about 50% formamide, 2ĆSSC to 6ĆSSC at about 40-50° C. (or other similar hybridization solutions, such as Stark's solution, in about 50% formamide at about 42° C.) and washing conditions of, for example, about 40-60° C., 0.5-6ĆSSC, 0.1% SDS. Preferably, moderately stringent conditions include hybridization (and washing) at about 50° C. and 6ĆSSC. Highly stringent conditions can also be readily determined by those skilled in the art, e.g., depending on the length of DNA.
Generally, such conditions include hybridization and/or washing at higher temperature and/or lower salt concentration (such as hybridization at about 65° C., 6ĆSSC to 0.2ĆSSC, preferably 6ĆSSC, more preferably 2ĆSSC, most preferably 0.2ĆSSC), compared to the moderately stringent conditions. For example, highly stringent conditions may include hybridization as defined above, and washing at approximately 65-68° C., 0.2ĆSSC, 0.1% SDS. SSPE (1ĆSSPE is 0.15 M NaCl, 10 mM NaH2PO4, and 1.25 mM EDTA, pH 7.4) can be substituted for SSC (1ĆSSC is 0.15 M NaCl and 15 mM sodium citrate) in the hybridization and washing buffers; washing is performed for 15 minutes after hybridization is completed.
It is also possible to use a commercially available hybridization kit which uses no radioactive substance as a probe. Specific examples include hybridization with an ECL direct labeling & detection system (Amersham). Stringent conditions include, for example, hybridization at 42° C. for 4 hours using the hybridization buffer included in the kit, which is supplemented with 5% (w/v) Blocking reagent and 0.5 M NaCl, and washing twice in 0.4% SDS, 0.5ĆSSC at 55° C. for 20 minutes and once in 2ĆSSC at room temperature for 5 minutes.
The protein of the present disclosure is preferably a protein with drought tolerance activity.
āSuppression DNA constructā is a recombinant DNA construct which when transformed or stably integrated into the genome of the plant, results in āsilencingā of a target gene in the plant. The target gene may be endogenous or transgenic to the plant. āSilencing,ā as used herein with respect to the target gene, refers generally to the suppression of levels of mRNA or protein/enzyme expressed by the target gene and/or the level of the enzyme activity or protein functionality. The terms āsuppressionā, āsuppressingā and āsilencingā, used interchangeably herein, include lowering, reducing, declining, decreasing, inhibiting, eliminating or preventing. āSilencingā or āgene silencingā does not specify mechanism and is inclusive, and not limited to, anti-sense, cosuppression, viral-suppression, hairpin suppression, stem-loop suppression, RNAi-based approaches and small RNA-based approaches.
A suppression DNA construct may comprise a region derived from a target gene of interest (e.g., Pre2) and may comprise all or part of the nucleic acid sequence of the sense strand (or antisense strand) of the target gene of interest. Depending upon the approach to be utilized, the region may be 100% identical or less than 100% identical (e.g., at least 50%, 51%, 52%, 53%, 54%, 55%, 56%, 57%, 58%, 59%, 60%, 61%, 62%, 63%, 64%, 65%, 66%, 67%, 68%, 69%, 70%, 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or 99% identical) to all or part of the sense strand (or antisense strand) of the gene of interest.
For example, an RNAi target sequence includes about 20 to about 1000 contiguous bases of the disclosed Pre2 sense or anti-sense strand. In an embodiment, the target sequence includes about 50, 100, 200, 300, 400, 500, 600, 700, 800, 900, 1000, 1100 and 1200 bases of the Pre2 sense or anti-sense strand. Within those contiguous bases, there can be variations and the target RNAi sequences need not be identical and as described above, the similarity level can range from 50% to about 99%.
Suppression DNA constructs are well-known in the art, are readily constructed once the target gene of interest is selected, and include, without limitation, cosuppression constructs, antisense constructs, viral-suppression constructs, hairpin suppression constructs, stem-loop suppression constructs, double-stranded RNA-producing constructs and more generally, RNAi
(RNA interference) constructs and small RNA constructs such as siRNA (short interfering RNA) constructs and miRNA (microRNA) constructs.
āAntisense inhibitionā refers to the production of antisense RNA transcripts capable of suppressing the expression of the target gene or gene product. āAntisense RNAā refers to an RNA transcript that is complementary to all or part of a target primary transcript or mRNA and that blocks the expression of a target isolated nucleic acid fragment (U.S. Pat. No. 5,107,065). The complementarity of an antisense RNA may be with any part of the specific gene transcript, i.e., at the 5ā² non-coding sequence, 3ā² non-coding sequence, introns or the coding sequence.
āCosuppressionā refers to the production of sense RNA transcripts capable of suppressing the expression of the target gene or gene product. āSenseā RNA refers to RNA transcript that includes the mRNA and can be translated into protein within a cell or in vitro. Cosuppression constructs in plants have been previously designed by focusing on overexpression of a nucleic acid sequence having homology to a native mRNA, in the sense orientation, which results in the reduction of all RNA having homology to the overexpressed sequence (see, Vaucheret, et al., (1998) Plant J. 16:651-659 and Gura, (2000) Nature 404:804-808).
Another variation describes the use of plant viral sequences to direct the suppression of proximal mRNA encoding sequences (PCT Publication Number WO 1998/36083 published on Aug. 20, 1998).
Promoter inverted repeats are also suitable to suppress the expression of endogenous genes including Pre2. Such targeted promoter inactivation is possible by identifying the promoter region of Pre2 and constructing promoter inverted repeat constructs.
Genome editing or genome engineering through site-directed mutagenesis by custom meganucleases with unique DNA-recognition and cleavage properties is possible (e.g., WO 2007/047859 and WO 2009/114321). This technique provides the ability to specifically modify a defined target of interest within a genome, e.g., Pre2 genomic region. Another site-directed engineering is through the use of zinc finger domain recognition coupled with the restriction properties of restriction enzyme. See, e.g., Urnov, et al., (2010) Nat Rev Genet. 11(9):636-46; Shukla, et al., (2009) Nature 459(7245):437-41. These citations are incorporated herein to the extent they relate to materials and methods to enable genome editing through site-specific modification. Such genome editing techniques are used to engineer site-directed changes including increasing gene expression of an endogenous gene (e.g., placing an enhancer element in control of the transcription), transcriptionally silencing an endogenous gene, creating mutants, variants of the encoded polypeptide, removing one or more genomic regions and other methods to modulate the gene expression and/or its activity.
Knock-out or gene knock-out refers to an inhibition or substantial suppression of endogenous gene expression either by a transgenic or a non-transgenic approach. For example, knock-outs can be achieved by a variety of approaches including transposons, retrotransposons, deletions, substitutions, mutagenesis of the endogenous coding sequence and/or a regulatory sequence such that the expression is substantially suppressed; and any other methodology that suppresses the activity of the target of interest.
Exogenous application of nucleotides including synthetic nucleotide molecules to induce RNAi-mediated silencing of the endogenous Pre2 gene is possible. See e.g., US 2008/0248576, US 2011/0296556 and WO 2011/112570. Exogenously applied agents are capable of inducing the downregulation of the endogenous gene.
Regulatory Sequences:
A recombinant DNA construct of the present disclosure may comprise at least one regulatory sequence. A regulatory sequence may be a promoter.
A number of promoters can be used in recombinant DNA constructs of the present disclosure. The promoters can be selected based on the desired outcome, and may include constitutive, tissue-specific, inducible or other promoters for expression in the host organism.
Promoters that cause a gene to be expressed in most cell types at most times are commonly referred to as āconstitutive promotersā.
High level, constitutive expression of the candidate gene under control of the 35S or UBI promoter may have pleiotropic effects, although candidate gene efficacy may be estimated when driven by a constitutive promoter. Use of tissue-specific and/or stress-specific promoters may eliminate undesirable effects but retain the ability to enhance drought tolerance. This effect has been observed in Arabidopsis (Kasuga, et al., (1999) Nature Biotechnol. 17:287-91).
Suitable constitutive promoters for use in a plant host cell include, for example, the core promoter of the Rsyn7 promoter and other constitutive promoters disclosed in WO 1999/43838 and U.S. Pat. No. 6,072,050; the core CaMV 35S promoter (Odell, et al., (1985) Nature 313:810-812); rice actin (McElroy, et al., (1990) Plant Cell 2:163-171); ubiquitin (Christensen, et al., (1989) Plant Mol. Biol. 12:619-632 and Christensen, et al., (1992) Plant Mol. Biol. 18:675-689); pEMU (Last, et al., (1991) Theor. Appl. Genet. 81:581-588); MAS (Velten, et al., (1984) EMBO J. 3:2723-2730); ALS promoter (U.S. Pat. No. 5,659,026), and the like. Other constitutive promoters include, for example, those discussed in U.S. Pat. Nos. 5,608,149; 5,608,144; 5,604,121; 5,569,597; 5,466,785; 5,399,680; 5,268,463; 5,608,142 and 6,177,611.
In choosing a promoter to use in the methods of the disclosure, it may be desirable to use a tissue-specific or developmentally regulated promoter.
A tissue-specific or developmentally regulated promoter is a DNA sequence which regulates the expression of a DNA sequence selectively in the cells/tissues of a plant critical to tassel development, seed set, or both, and limits the expression of such a DNA sequence to the period of tassel development or seed maturation in the plant. Any identifiable promoter may be used in the methods of the present disclosure which causes the desired temporal and spatial expression.
Promoters which are seed or embryo-specific and may be useful in the disclosure include soybean Kunitz trypsin inhibitor (Kti3, Jofuku and Goldberg, (1989) Plant Cell 1:1079-1093), patatin (potato tubers) (Rocha-Sosa, et al., (1989) EMBO J. 8:23-29), convicilin, vicilin, and legumin (pea cotyledons) (Rerie, et al., (1991) Mol. Gen. Genet. 259:149-157; Newbigin, et al., (1990) Planta 180:461-470; Higgins, et al., (1988) Plant. Mol. Biol. 11:683-695), zein (maize endosperm) (Schemthaner, et al., (1988) EMBO J. 7:1249-1255), phaseolin (bean cotyledon) (Segupta-Gopalan, et al., (1985) Proc. Natl. Acad. Sci. U.S.A. 82:3320-3324), phytohemagglutinin (bean cotyledon) (Voelker, et al., (1987) EMBO J. 6:3571-3577), B-conglycinin and glycinin (soybean cotyledon) (Chen, et al., (1988) EMBO J. 7:297-302), glutelin (rice endosperm), hordein (barley endosperm) (Marris, et al., (1988) Plant Mol. Biol. 10:359-366), glutenin and gliadin (wheat endosperm) (Colot, et al., (1987) EMBO J. 6:3559-3564) and sporamin (sweet potato tuberous root) (Hattori, et al., (1990) Plant Mol. Biol. 14:595-604). Promoters of seed-specific genes operably linked to heterologous coding regions in chimeric gene constructions maintain their temporal and spatial expression pattern in transgenic plants. Such examples include Arabidopsis thaliana 2S seed storage protein gene promoter to express enkephalin peptides in Arabidopsis and Brassica napus seeds (Vanderkerckhove, et al., (1989) Bio/Technology 7:L929-932), bean lectin and bean beta-phaseolin promoters to express luciferase (Riggs, et al., (1989) Plant Sci. 63:47-57) and wheat glutenin promoters to express chloramphenicol acetyl transferase (Colot, et al., (1987) EMBO J 6:3559-3564).
Inducible promoters selectively express an operably linked DNA sequence in response to the presence of an endogenous or exogenous stimulus, for example by chemical compounds (chemical inducers) or in response to environmental, hormonal, chemical and/or developmental signals. Inducible or regulated promoters include, for example, promoters regulated by light, heat, stress, flooding or drought, phytohormones, wounding or chemicals such as ethanol, jasmonate, salicylic acid or safeners.
Promoters for use in the current disclosure include the following: 1) the stress-inducible RD29A promoter (Kasuga, et al., (1999) Nature Biotechnol. 17:287-91); 2) the barley promoter, B22E; expression of B22E is specific to the pedicel in developing maize kernels (Klemsdal, et al., (1991) Mol. Gen. Genet. 228(1/2):9-16) and 3) maize promoter, Zag2 (Schmidt, et al., (1993) Plant Cell 5(7):729-737; Theissen, et al., (1995) Gene 156(2):155-166; NCBI GenBank Accession Number X80206)). Zag2 transcripts can be detected 5 days prior to pollination to 7 to 8 days after pollination (āDAPā), and directs expression in the carpel of developing female inflorescences and Ciml which is specific to the nucleus of developing maize kernels. Ciml transcript is detected 4 to 5 days before pollination to 6 to 8 DAP. Other useful promoters include any promoter which can be derived from a gene whose expression is maternally associated with developing female florets.
Additional promoters for regulating the expression of the nucleotide sequences of the present disclosure in plants are stalk-specific promoters. Such stalk-specific promoters include the alfalfa S2A promoter (GenBank Accession Number EF030816; Abrahams, et al., (1995) Plant Mol. Biol. 27:513-528) and S2B promoter (GenBank Accession Number EF030817) and the like, herein incorporated by reference.
Promoters may be derived in their entirety from a native gene or be composed of different elements derived from different promoters found in nature or even comprise synthetic DNA segments.
Promoters for use in the current disclosure may include: RIP2, mLIP15, ZmCOR1, Rab17, CaMV 35S, RD29A, B22E, Zag2, SAM synthetase, ubiquitin, CaMV 19S, nos, Adh, sucrose synthase, R-allele, the vascular tissue preferred promoters S2A (Genbank Accession Number EF030816) and S2B (Genbank Accession Number EF030817) and the constitutive promoter GOS2 from Zea mays. Other promoters include root preferred promoters, such as the maize NAS2 promoter, the maize Cyclo promoter (US 2006/0156439, published Jul. 13, 2006), the maize ROOTMET2 promoter (WO 2005/063998, published Jul. 14, 2005), the CR1BIO promoter (WO 2006/055487, published May 26, 2006), the CRWAQ81 (WO 2005/035770, published Apr. 21, 2005) and the maize ZRP2.47 promoter (NCBI Accession Number: U38790; GI Number 1063664).
Recombinant DNA constructs of the present disclosure may also include other regulatory sequences, including but not limited to, translation leader sequences, introns, and polyadenylation recognition sequences. In another embodiment of the present disclosure, a recombinant DNA construct of the present disclosure further comprises an enhancer or silencer.
An intron sequence can be added to the 5ā² untranslated region, the protein-coding region or the 3ā² untranslated region to increase the amount of the mature message that accumulates in the cytosol. Inclusion of a spliceable intron in the transcription unit in both plant and animal expression constructs has been shown to increase gene expression at both the mRNA and protein levels up to 1000-fold. Buchman and Berg, (1988) Mol. Cell Biol. 8:4395-4405; Callis, et al., (1987) Genes Dev. 1:1183-1200.
Any plant can be selected for the identification of regulatory sequences and PRE2 polypeptide genes to be used in recombinant DNA constructs of the present disclosure. Examples of suitable plant targets for the isolation of genes and regulatory sequences would include but are not limited to alfalfa, apple, apricot, Arabidopsis, artichoke, arugula, asparagus, avocado, banana, barley, beans, beet, blackberry, blueberry, broccoli, brussels sprouts, cabbage, canola, cantaloupe, carrot, cassava, castorbean, cauliflower, celery, cherry, chicory, cilantro, citrus, clementines, clover, coconut, coffee, corn, cotton, cranberry, cucumber, Douglas fir, eggplant, endive, escarole, eucalyptus, fennel, figs, garlic, gourd, grape, grapefruit, honey dew, jicama, kiwifruit, lettuce, leeks, lemon, lime, Loblolly pine, linseed, mango, melon, mushroom, nectarine, nut, oat, oil palm, oil seed rape, okra, olive, onion, orange, an ornamental plant, palm, papaya, parsley, parsnip, pea, peach, peanut, pear, pepper, persimmon, pine, pineapple, plantain, plum, pomegranate, poplar, potato, pumpkin, quince, radiata pine, radicchio, radish, rapeseed, raspberry, rice, rye, sorghum, Southern pine, soybean, spinach, squash, strawberry, sugarbeet, sugarcane, sunflower, sweet potato, sweetgum, tangerine, tea, tobacco, tomato, triticale, turf, turnip, a vine, watermelon, wheat, yams and zucchini.
Compositions:
A composition of the present disclosure is a plant comprising in its genome any of the recombinant DNA constructs of the present disclosure (such as any of the constructs discussed above). Compositions also include any progeny of the plant, and any seed obtained from the plant or its progeny, wherein the progeny or seed comprises within its genome the recombinant DNA construct. Progeny includes subsequent generations obtained by self-pollination or out-crossing of a plant. Progeny also includes hybrids and inbreds.
In hybrid seed propagated crops, mature transgenic plants can be self-pollinated to produce a homozygous inbred plant. The inbred plant produces seed containing the newly introduced recombinant DNA construct. These seeds can be grown to produce plants that would exhibit an altered agronomic characteristic (e.g., an increased agronomic characteristic optionally under water limiting conditions), or used in a breeding program to produce hybrid seed, which can be grown to produce plants that would exhibit such an altered agronomic characteristic. The seeds may be maize seeds.
The plant may be a monocotyledonous or dicotyledonous plant, for example, a maize, rice or soybean plant, such as a maize hybrid plant or a maize inbred plant. The plant may also be sunflower, sorghum, canola, wheat, alfalfa, cotton, barley, millet, sugarcane, switchgrass, tobacco, potato and sugar beet.
The recombinant DNA construct may be stably integrated into the genome of the plant.
Particularly embodiments include but are not limited to the following:
1. A plant (for example, a maize, rice or soybean plant) comprising in its genome a recombinant DNA construct comprising a polynucleotide operably linked to at least one regulatory sequence, wherein said polynucleotide encodes a polypeptide having an amino acid sequence of at least 50%, 51%, 52%, 53%, 54%, 55%, 56%, 57%, 58%, 59%, 60%, 61%, 62%, 63%, 64%, 65%, 66%, 67%, 68%, 69%, 70%, 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity, based on the Clustal W method of alignment, when compared to a sequence selected from the group consisting of SEQ ID NOS: 3, 5, 7, 9, 11, 13, 15, 18, 20 and 22; and wherein said plant exhibits increased drought tolerance when compared to a control plant not comprising said recombinant DNA construct. The plant may further exhibit an alteration of at least one agronomic characteristic when compared to the control plant.
2. A plant (for example, a maize, rice or soybean plant) comprising in its genome a recombinant DNA construct comprising a polynucleotide operably linked to at least one regulatory sequence, wherein said polynucleotide encodes a PRE2 polypeptide, and wherein said plant exhibits increased drought tolerance when compared to a control plant not comprising said recombinant DNA construct. The plant may further exhibit an alteration of at least one agronomic characteristic when compared to the control plant.
3. A plant (for example, a maize, rice or soybean plant) comprising in its genome a recombinant DNA construct comprising a polynucleotide operably linked to at least one regulatory sequence, wherein said polynucleotide encodes a PRE2 polypeptide, and wherein said plant exhibits an alteration of at least one agronomic characteristic when compared to a control plant not comprising said recombinant DNA construct.
4. A plant (for example, a maize, rice or soybean plant) comprising in its genome a recombinant DNA construct comprising a polynucleotide operably linked to at least one regulatory element, wherein said polynucleotide encodes a polypeptide having an amino acid sequence of at least 50%, 51%, 52%, 53%, 54%, 55%, 56%, 57%, 58%, 59%, 60%, 61%, 62%, 63%, 64%, 65%, 66%, 67%, 68%, 69%, 70%, 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity, based on the Clustal W method of alignment, when compared to a sequence selected from the group consisting of SEQ ID NOS: 1, 2, 4, 6, 8, 10, 12, 14, 16, 17, 19, 21, 23-26, and wherein said plant exhibits an alteration of at least one agronomic characteristic when compared to a control plant not comprising said recombinant DNA construct.
5. A plant (for example, a maize, rice or soybean plant) comprising in its genome a recombinant DNA construct comprising a polynucleotide operably linked to at least one regulatory element, wherein said polynucleotide comprises a nucleotide sequence encoding a polypeptide with drought tolerance activity, wherein the nucleotide sequence is: (a) hybridizable under stringent conditions with a DNA molecule comprising the full complement of a sequence selected from the group consisting of SEQ ID NOS: 1, 2, 4, 6, 8, 10, 12, 14, 16, 17, 19, 21, 23-26; or (b) a sequence selected from the group consisting of SEQ ID NOS: 1, 2, 4, 6, 8, 10, 12, 14, 16, 17, 19, 21, 23-26; by alteration of one or more nucleotides by at least one method selected from the group consisting of: deletion, substitution, addition and insertion; and wherein said plant exhibits increased drought tolerance when compared to a control plant not comprising said recombinant DNA construct.
6. A plant (for example, a maize, rice or soybean plant) comprising in its genome a recombinant DNA construct comprising a polynucleotide operably linked to at least one regulatory element, wherein said polynucleotide comprises a nucleotide sequence encoding a polypeptide with drought tolerance activity, wherein the nucleotide sequence is: (a) hybridizable under stringent conditions with a DNA molecule comprising the full complement of a sequence selected from the group consisting of SEQ ID NOS: 1, 2, 4, 6, 8, 10, 12, 14, 16, 17, 19, 21, 23-26; or (b) a sequence selected from the group consisting of SEQ ID NOS: 1, 2, 4, 6, 8, 10, 12, 14, 16, 17, 19, 21, 23-26; by alteration of one or more nucleotides by at least one method selected from the group consisting of: deletion, substitution, addition and insertion; and wherein said plant exhibits an alteration of at least one agronomic characteristic when compared to a control plant not comprising said recombinant DNA construct.
8. Any progeny of the above plants in embodiments 1-7, any seeds of the above plants in embodiments 1-7, any seeds of progeny of the above plants in embodiments 1-7, and cells from any of the above plants in embodiments 1-6 and progeny thereof.
In any of the foregoing embodiments 1-8 or any other embodiments of the present disclosure, the PRE2 polypeptide may be from Arabidopsis thaliana, Zea mays, Glycine max, Glycine tabacina, Glycine soja or Glycine tomentella.
In any of the foregoing embodiments 1-8 or any other embodiments of the present disclosure, the recombinant DNA construct may comprise at least a promoter functional in a plant as a regulatory sequence.
In any of the foregoing embodiments 1-8 or any other embodiments of the present disclosure, the alteration of at least one agronomic characteristic is either an increase or decrease.
In any of the foregoing embodiments 1-8 or any other embodiments of the present disclosure, the at least one agronomic characteristic may be selected from the group consisting of greenness, yield, growth rate, biomass, fresh weight at maturation, dry weight at maturation, fruit yield, seed yield, total plant nitrogen content, fruit nitrogen content, seed nitrogen content, nitrogen content in a vegetative tissue, total plant free amino acid content, fruit free amino acid content, seed free amino acid content, free amino acid content in a vegetative tissue, total plant protein content, fruit protein content, seed protein content, protein content in a vegetative tissue, drought tolerance, nitrogen uptake, root lodging, harvest index, stalk lodging, plant height, ear height, ear length, salt tolerance, early seedling vigor and seedling emergence under low temperature stress. For example, the alteration of at least one agronomic characteristic may be an increase in yield, greenness or biomass.
In any of the foregoing embodiments 1-8 or any other embodiments of the present disclosure, the plant may exhibit the alteration of at least one agronomic characteristic when compared, under water limiting conditions, to a control plant not comprising said recombinant DNA construct.
āDroughtā refers to a decrease in water availability to a plant that, especially when prolonged, can cause damage to the plant or prevent its successful growth (e.g., limiting plant growth or seed yield).
āDrought toleranceā is a trait of a plant to survive under drought conditions over prolonged periods of time without exhibiting substantial physiological or physical deterioration.
āIncreased drought toleranceā of a plant is measured relative to a reference or control plant, and is a trait of the plant to survive under drought conditions over prolonged periods of time, without exhibiting the same degree of physiological or physical deterioration relative to the reference or control plant grown under similar drought conditions. Typically, when a transgenic plant comprising a recombinant DNA construct in its genome exhibits increased drought tolerance relative to a reference or control plant, the reference or control plant does not comprise in its genome the recombinant DNA construct.
One of ordinary skill in the art is familiar with protocols for simulating drought conditions and for evaluating drought tolerance of plants that have been subjected to simulated or naturally-occurring drought conditions. For example, one can simulate drought conditions by giving plants less water than normally required or no water over a period of time, and one can evaluate drought tolerance by looking for differences in physiological and/or physical condition, including (but not limited to) vigor, growth, size, or root length, or in particular, leaf color or leaf area size. Other techniques for evaluating drought tolerance include measuring chlorophyll fluorescence, photosynthetic rates and gas exchange rates.
A drought stress experiment may involve a chronic stress (i.e., slow dry down) and/or may involve two acute stresses (i.e., abrupt removal of water) separated by a day or two of recovery. Chronic stress may last 8-10 days. Acute stress may last 3-5 days. The following variables may be measured during drought stress and well watered treatments of transgenic plants and relevant control plants:
The variable ā% area chg_start chronicāacute2ā is a measure of the percent change in total area determined by remote visible spectrum imaging between the first day of chronic stress and the day of the second acute stress
The variable ā% area chg_start chronicāend chronicā is a measure of the percent change in total area determined by remote visible spectrum imaging between the first day of chronic stress and the last day of chronic stress.
The variable ā% area chg_start chronicāharvestā is a measure of the percent change in total area determined by remote visible spectrum imaging between the first day of chronic stress and the day of harvest.
The variable ā% area chg_start chronicārecovery24 hrā is a measure of the percent change in total area determined by remote visible spectrum imaging between the first day of chronic stress and 24 hrs into the recovery (24 hrs after acute stress 2).
The variable āpsii_acute1ā is a measure of Photosystem II (PSII) efficiency at the end of the first acute stress period. It provides an estimate of the efficiency at which light is absorbed by PSII antennae and is directly related to carbon dioxide assimilation within the leaf.
The variable āpsii_acute2ā is a measure of Photosystem II (PSII) efficiency at the end of the second acute stress period. It provides an estimate of the efficiency at which light is absorbed by PSII antennae and is directly related to carbon dioxide assimilation within the leaf.
The variable āfv/fm_acute1ā is a measure of the optimum quantum yield (Fv/Fm) at the end of the first acute stressā(variable fluorescence difference between the maximum and minimum fluorescence/maximum fluorescence).
The variable āfv/fm_acute2ā is a measure of the optimum quantum yield (Fv/Fm) at the end of the second acute stressā(variable flourescence difference between the maximum and minimum fluorescence/maximum fluorescence).
The variable āleaf rolling_harvestā is a measure of the ratio of top image to side image on the day of harvest.
The variable āleaf rolling_recovery24 hrā is a measure of the ratio of top image to side image 24 hours into the recovery.
The variable āSpecific Growth Rate (SGR)ā represents the change in total plant surface area (as measured by an imaging instrument) over a single day (Y(t)=Y0*er*t). Y(t)=Y0*er*t is equivalent to % change in Y/Īt where the individual terms are as follows: Y(t)=Total surface area at t; Y0=Initial total surface area (estimated); r=Specific Growth Rate dayā1, and t=Days After Planting (āDAPā).
The variable āshoot dry weightā is a measure of the shoot weight 96 hours after being placed into a 104° C. oven.
The variable āshoot fresh weightā is a measure of the shoot weight immediately after being cut from the plant.
The Examples below describe some representative protocols and techniques for simulating drought conditions and/or evaluating drought tolerance.
One can also evaluate drought tolerance by the ability of a plant to maintain sufficient yield (at least 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% yield) in field testing under simulated or naturally-occurring drought conditions (e.g., by measuring for substantially equivalent yield under drought conditions compared to non-drought conditions, or by measuring for less yield loss under drought conditions compared to a control or reference plant).
One of ordinary skill in the art would readily recognize a suitable control or reference plant to be utilized when assessing or measuring an agronomic characteristic or phenotype of a transgenic plant in any embodiment of the present disclosure in which a control plant is utilized (e.g., compositions or methods as described herein). For example, by way of non-limiting illustrations:
1. Progeny of a transformed plant which is hemizygous with respect to a recombinant DNA construct, such that the progeny are segregating into plants either comprising or not comprising the recombinant DNA construct: the progeny comprising the recombinant DNA construct would be typically measured relative to the progeny not comprising the recombinant DNA construct (i.e., the progeny not comprising the recombinant DNA construct is the control or reference plant).
2. Introgression of a recombinant DNA construct into an inbred line, such as in maize, or into a variety, such as in soybean: the introgressed line would typically be measured relative to the parent inbred or variety line (i.e., the parent inbred or variety line is the control or reference plant).
3. Two hybrid lines, where the first hybrid line is produced from two parent inbred lines and the second hybrid line is produced from the same two parent inbred lines except that one of the parent inbred lines contains a recombinant DNA construct: the second hybrid line would typically be measured relative to the first hybrid line (i.e., the first hybrid line is the control or reference plant).
4. A plant comprising a recombinant DNA construct: the plant may be assessed or measured relative to a control plant not comprising the recombinant DNA construct but otherwise having a comparable genetic background to the plant (e.g., sharing at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity of nuclear genetic material compared to the plant comprising the recombinant DNA construct. There are many laboratory-based techniques available for the analysis, comparison and characterization of plant genetic backgrounds; among these are Isozyme Electrophoresis, Restriction Fragment Length Polymorphisms (RFLPs), Randomly Amplified Polymorphic DNAs (RAPDs), Arbitrarily Primed Polymerase Chain Reaction (AP-PCR), DNA Amplification Fingerprinting (DAF), Sequence Characterized Amplified Regions (SCARs), Amplified Fragment Length Polymorphisms (AFLP®s) and Simple Sequence Repeats (SSRs) which are also referred to as Microsatellites.
Furthermore, one of ordinary skill in the art would readily recognize that a suitable control or reference plant to be utilized when assessing or measuring an agronomic characteristic or phenotype of a transgenic plant would not include a plant that had been previously selected, via mutagenesis or transformation, for the desired agronomic characteristic or phenotype.
Methods:
Methods include but are not limited to methods for increasing drought tolerance in a plant, methods for evaluating drought tolerance in a plant, methods for altering an agronomic characteristic in a plant, methods for determining an alteration of an agronomic characteristic in a plant, and methods for producing seed. The plant may be a monocotyledonous or dicotyledonous plant, for example, a maize, rice or soybean plant. The plant may also be sunflower, sorghum, canola, wheat, alfalfa, cotton, barley or millet. The seed may be a maize, rice or soybean seed, for example, a maize hybrid seed or maize inbred seed.
Methods include but are not limited to the following:
A method for transforming a cell comprising transforming a cell with any of the isolated polynucleotides of the present disclosure. The cell transformed by this method is also included. In particular embodiments, the cell is eukaryotic cell, e.g., a yeast, insect or plant cell or prokaryotic, e.g., a bacterial cell.
A method for producing a transgenic plant comprising transforming a plant cell with any of the isolated polynucleotides or recombinant DNA constructs of the present disclosure and regenerating a transgenic plant from the transformed plant cell. The disclosure is also directed to the transgenic plant produced by this method and transgenic seed obtained from this transgenic plant.
A method for isolating a polypeptide of the disclosure from a cell or culture medium of the cell, wherein the cell comprises a recombinant DNA construct comprising a polynucleotide of the disclosure operably linked to at least one regulatory sequence and wherein the transformed host cell is grown under conditions that are suitable for expression of the recombinant DNA construct.
A method of altering the level of expression of a polypeptide of the disclosure in a host cell comprising: (a) transforming a host cell with a recombinant DNA construct of the present disclosure; and (b) growing the transformed host cell under conditions that are suitable for expression of the recombinant DNA construct wherein expression of the recombinant DNA construct results in production of altered levels of the polypeptide of the disclosure in the transformed host cell.
A method of increasing drought tolerance in a plant, comprising: (a) introducing into a regenerable plant cell a recombinant DNA construct comprising a polynucleotide operably linked to at least one regulatory sequence (for example, a promoter functional in a plant), wherein the polynucleotide encodes a polypeptide having an amino acid sequence of at least 50%, 51%, 52%, 53%, 54%, 55%, 56%, 57%, 58%, 59%, 60%, 61%, 62%, 63%, 64%, 65%, 66%, 67%, 68%, 69%, 70%, 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity, based on the Clustal W method of alignment, when compared to a sequence selected from the group consisting of SEQ ID NOS: 3, 5, 7, 9, 11, 13, 15, 18, 20 and 22; and (b) regenerating a transgenic plant from the regenerable plant cell after step (a), wherein the transgenic plant comprises in its genome the recombinant DNA construct and exhibits increased drought tolerance when compared to a control plant not comprising the recombinant DNA construct. The method may further comprise (c) obtaining a progeny plant derived from the transgenic plant, wherein said progeny plant comprises in its genome the recombinant DNA construct and exhibits increased drought tolerance when compared to a control plant not comprising the recombinant DNA construct.
A method of increasing drought tolerance in a plant, comprising: (a) introducing into a regenerable plant cell a recombinant DNA construct comprising a polynucleotide operably linked to at least one regulatory element, wherein said polynucleotide comprises a nucleotide sequence encoding a polypeptide with drought tolerance activity, wherein the nucleotide sequence is: (a) hybridizable under stringent conditions with a DNA molecule comprising the full complement of a sequence selected from the group consisting of SEQ ID NOS: 1, 2, 4, 6, 8, 10, 12, 14, 16, 17, 19, 21, 23-26; or (b) a sequence selected from the group consisting of SEQ ID NOS: 1, 2, 4, 6, 8, 10, 12, 14, 16, 17, 19, 21, 23-26; by alteration of one or more nucleotides by at least one method selected from the group consisting of: deletion, substitution, addition and insertion; and (b) regenerating a transgenic plant from the regenerable plant cell after step (a), wherein the transgenic plant comprises in its genome the recombinant DNA construct and exhibits increased drought tolerance when compared to a control plant not comprising the recombinant DNA construct. The method may further comprise (c) obtaining a progeny plant derived from the transgenic plant, wherein said progeny plant comprises in its genome the recombinant DNA construct and exhibits increased drought tolerance when compared to a control plant not comprising the recombinant DNA construct.
A method of evaluating drought tolerance in a plant, comprising (a) obtaining a transgenic plant, wherein the transgenic plant comprises in its genome a recombinant DNA construct comprising a polynucleotide operably linked to at least one regulatory sequence (for example, a promoter functional in a plant), wherein said polynucleotide encodes a polypeptide having an amino acid sequence of at least 50%, 51%, 52%, 53%, 54%, 55%, 56%, 57%, 58%, 59%, 60%, 61%, 62%, 63%, 64%, 65%, 66%, 67%, 68%, 69%, 70%, 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity, based on the Clustal W method of alignment, when compared to a sequence selected from the group consisting of SEQ ID NOS: 3, 5, 7, 9, 11, 13, 15, 18, 20 and 22; (b) obtaining a progeny plant derived from said transgenic plant, wherein the progeny plant comprises in its genome the recombinant DNA construct; and (c) evaluating the progeny plant for drought tolerance compared to a control plant not comprising the recombinant DNA construct.
A method of evaluating drought tolerance in a plant, comprising (a) obtaining a transgenic plant, wherein the transgenic plant comprises in its genome a recombinant DNA construct comprising a polynucleotide operably linked to at least one regulatory element, wherein said polynucleotide comprises a nucleotide sequence encoding a polypeptide with drought tolerance activity, wherein the nucleotide sequence is: (a) hybridizable under stringent conditions with a DNA molecule comprising the full complement of a sequence selected from the group consisting of SEQ ID NOS: 1, 2, 4, 6, 8, 10, 12, 14, 16, 17, 19, 21, 23-26; or (b) a sequence selected from the group consisting of SEQ ID NOS: 1, 2, 4, 6, 8, 10, 12, 14, 16, 17, 19, 21, 23-26; by alteration of one or more nucleotides by at least one method selected from the group consisting of: deletion, substitution, addition and insertion; (b) obtaining a progeny plant derived from said transgenic plant, wherein the progeny plant comprises in its genome the recombinant DNA construct; and (c) evaluating the progeny plant for drought tolerance compared to a control plant not comprising the recombinant DNA construct.
A method of determining an alteration of an agronomic characteristic in a plant, comprising (a) obtaining a transgenic plant, wherein the transgenic plant comprises in its genome a recombinant DNA construct comprising a polynucleotide operably linked to at least one regulatory sequence (for example, a promoter functional in a plant), wherein said polynucleotide encodes a polypeptide having an amino acid sequence of at least 50%, 51%, 52%, 53%, 54%, 55%, 56%, 57%, 58%, 59%, 60%, 61%, 62%, 63%, 64%, 65%, 66%, 67%, 68%, 69%, 70%, 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% sequence identity, based on the Clustal W method of alignment, when compared to a sequence selected from the group consisting of SEQ ID NOS: 3, 5, 7, 9, 11, 13, 15, 18, 20 and 22; (b) obtaining a progeny plant derived from said transgenic plant, wherein the progeny plant comprises in its genome the recombinant DNA construct; and (c) determining whether the progeny plant exhibits an alteration in at least one agronomic characteristic when compared, optionally under water limiting conditions, to a control plant not comprising the recombinant DNA construct.
A method of determining an alteration of an agronomic characteristic in a plant, comprising (a) obtaining a transgenic plant, wherein the transgenic plant comprises in its genome a recombinant DNA construct comprising a polynucleotide operably linked to at least one regulatory element, wherein said polynucleotide comprises a nucleotide sequence encoding a polypeptide with drought tolerance activity, wherein the nucleotide sequence is: (a) hybridizable under stringent conditions with a DNA molecule comprising the full complement of a sequence selected from the group consisting of SEQ ID NOS: 1, 2, 4, 6, 8, 10, 12, 14, 16, 17, 19, 21, 23-26; or (b) a sequence selected from the group consisting of SEQ ID NOS: 1, 2, 4, 6, 8, 10, 12, 14, 16, 17, 19, 21, 23-26; by alteration of one or more nucleotides by at least one method selected from the group consisting of: deletion, substitution, addition and insertion; (b) obtaining a progeny plant derived from said transgenic plant, wherein the progeny plant comprises in its genome the recombinant DNA construct; and (c) determining whether the progeny plant exhibits an alteration in at least one agronomic characteristic when compared, optionally under water limiting conditions, to a control plant not comprising the recombinant DNA construct.
A method of producing seed (for example, seed that can be sold as a drought tolerant product offering) comprising any of the preceding methods and further comprising obtaining seeds from said progeny plant, wherein said seeds comprise in their genome said recombinant DNA construct.
In any of the preceding methods or any other embodiments of methods of the present disclosure, in said introducing step said regenerable plant cell may comprise a callus cell, an embryogenic callus cell, a gametic cell, a meristematic cell or a cell of an immature embryo. The regenerable plant cells may derive from an inbred maize plant.
In any of the preceding methods or any other embodiments of methods of the present disclosure, said regenerating step may comprise the following: (i) culturing said transformed plant cells in a media comprising an embryogenic promoting hormone until callus organization is observed; (ii) transferring said transformed plant cells of step (i) to a first media which includes a tissue organization promoting hormone; and (iii) subculturing said transformed plant cells after step (ii) onto a second media, to allow for shoot elongation, root development or both.
In any of the preceding methods or any other embodiments of methods of the present disclosure, the at least one agronomic characteristic may be selected from the group consisting of greenness, yield, growth rate, biomass, fresh weight at maturation, dry weight at maturation, fruit yield, seed yield, total plant nitrogen content, fruit nitrogen content, seed nitrogen content, nitrogen content in a vegetative tissue, total plant free amino acid content, fruit free amino acid content, seed free amino acid content, amino acid content in a vegetative tissue, total plant protein content, fruit protein content, seed protein content, protein content in a vegetative tissue, drought tolerance, nitrogen uptake, root lodging, harvest index, stalk lodging, plant height, ear height, ear length, salt tolerance, early seedling vigor and seedling emergence under low temperature stress. The alteration of at least one agronomic characteristic may be an increase in yield, greenness or biomass.
In any of the preceding methods or any other embodiments of methods of the present disclosure, the plant may exhibit the alteration of at least one agronomic characteristic when compared, under water limiting conditions, to a control plant not comprising said recombinant DNA construct.
In any of the preceding methods or any other embodiments of methods of the present disclosure, alternatives exist for introducing into a regenerable plant cell a recombinant DNA construct comprising a polynucleotide operably linked to at least one regulatory sequence. For example, one may introduce into a regenerable plant cell a regulatory sequence (such as one or more enhancers, optionally as part of a transposable element) and then screen for an event in which the regulatory sequence is operably linked to an endogenous gene encoding a polypeptide of the instant disclosure.
Transgenic plants comprising or derived from plant cells or native plants with reduced Pre2 expression or activity of this disclosure can be further enhanced with stacked traits, e.g. a crop plant having an enhanced trait resulting from expression of DNA disclosed herein in combination with herbicide tolerance and/or pest resistance traits. For example, plants with reduced Pre2 expression can be stacked with other traits of agronomic interest, such as a trait providing herbicide resistance and/or insect resistance, such as using a gene from Bacillus thuringensis to provide resistance against one or more of lepidopteran, coliopteran, homopteran, hemiopteran and other insects. Known genes that confer tolerance to herbicides such as e.g., auxin, HPPD, glyphosate, dicamba, glufosinate, sulfonylurea, bromoxynil and norflurazon herbicides can be stacked either as a molecular stack or a breeding stack with plants expressing the traits disclosed herein. Polynucleotide molecules encoding proteins involved in herbicide tolerance include, but are not limited to, a polynucleotide molecule encoding 5-enolpyruvylshikimate-3-phosphate synthase (EPSPS) disclosed in U.S. Pat. Nos. 39,247; 6,566,587 and for imparting glyphosate tolerance; polynucleotide molecules encoding a glyphosate oxidoreductase (GOX) disclosed in U.S. Pat. No. 5,463,175 and a glyphosate-N-acetyl transferase (GAT) disclosed in U.S. Pat. Nos. 7,622,641; 7,462,481; 7,531,339; 7,527,955; 7,709,709; 7,714,188 and 7,666,643 also for providing glyphosate tolerance; dicamba monooxygenase disclosed in U.S. Pat. No. 7,022,896 and WO 2007/146706 A2 for providing dicamba tolerance; a polynucleotide molecule encoding AAD12 disclosed in US Patent Application Publication Number 2005/731044 or WO 2007/053482 A2 or encoding AAD1 disclosed in US 2011/0124503 A1 or U.S. Pat. No. 7,838,733 for providing tolerance to auxin herbicides (2,4-D); a polynucleotide molecule encoding hydroxyphenylpyruvate dioxygenase (HPPD) for providing tolerance to HPPD inhibitors (e.g., hydroxyphenylpyruvate dioxygenase) disclosed in e.g., U.S. Pat. No. 7,935,869; US 2009/0055976 A1 and US 2011/0023180 A1, each publication is herein incorporated by reference in its entirety.
Other examples of herbicide-tolerance traits that could be combined with the traits disclosed herein include those conferred by polynucleotides encoding an exogenous phosphinothricin acetyltransferase, as described in U.S. Pat. Nos. 5,969,213; 5,489,520; 5,550,318; 5,874,265; 5,919,675; 5,561,236; 5,648,477; 5,646,024; 6,177,616 and 5,879,903. Plants containing an exogenous phosphinothricin acetyltransferase can exhibit improved tolerance to glufosinate herbicides, which inhibit the enzyme glutamine synthase. Other examples of herbicide-tolerance traits include those conferred by polynucleotides conferring altered protoporphyrinogen oxidase (protox) activity, as described in U.S. Pat. Nos. 6,288,306 B1; 6,282,837 B1 and 5,767,373 and International Patent Publication WO 2001/12825. Plants containing such polynucleotides can exhibit improved tolerance to any of a variety of herbicides which target the protox enzyme (also referred to as āprotox inhibitorsā).
The introduction of recombinant DNA constructs of the present disclosure into plants may be carried out by any suitable technique, including but not limited to direct DNA uptake, chemical treatment, electroporation, microinjection, cell fusion, infection, vector-mediated DNA transfer, bombardment or Agrobacterium-mediated transformation. Techniques for plant transformation and regeneration have been described in International Patent Publication WO 2009/006276, the contents of which are herein incorporated by reference.
The development or regeneration of plants containing the foreign, exogenous isolated nucleic acid fragment that encodes a protein of interest is well known in the art. The regenerated plants may be self-pollinated to provide homozygous transgenic plants. Otherwise, pollen obtained from the regenerated plants is crossed to seed-grown plants of agronomically important lines. Conversely, pollen from plants of these important lines is used to pollinate regenerated plants. A transgenic plant of the present disclosure containing a desired polypeptide is cultivated using methods well known to one skilled in the art.
| TABLE 1A |
| Expression of maize Pre2 in different tissues as compiled |
| from MPSS-Signature Platform |
| Expression | |||
| Tissue | (PPTM) | Dev. Stage | Treatment |
| Leaf | 2880 | V5 | ECB |
| Kernel | 1750 | R1 | Drought Stress |
| Anther | 1270 | VT | Control |
| Apical Meristem, pre-floral | 1110 | V3 | |
| Endosperm | 1080 | R1 | In vitro |
| Immature Ear | 800 | V9 | |
| Pedicel and Basal Layer | 710 | R3 | |
| Root | 560 | V12 | Hydroponic |
| Lateral Branch Meristem | 540 | V8 | |
| Pericarp | 460 | R4 | |
| Stalk | 390 | Vn | Colletotrichum |
| Leaf midrib | 370 | V7 | Nitrate 4 h |
| Stalk internode | 350 | V10-V11 | |
| meristematic zone | |||
| Germination Embryo | 320 | VE | |
| Root cortex | 320 | V1 | Nitrate-4 hr |
| Aleurone | 280 | R3 | |
| Stalk nodal plate | 270 | V10-V11 | |
| Vegetative Lateral | 200 | V8 | |
| Meristems | |||
| Stalk rind | 170 | V10-V11 | |
| Root stele | 100 | V1 | Nitrate-4 hr |
| Germination Scutellum | 90 | VE | |
| Tassel Spikelet | 90 | VT | Tilt Herbicide |
| Pollen | 70 | VT | |
| Silk | 30 | R1 | |
| TABLE 1B |
| Expression of maize Pre2 in different tissues as |
| compiled from MPSS-Classic Platform |
| Tissue | Expression (PPTM) | Dev. Stage | Treatment |
| Embryo | 990 | R2 | |
| Aerial Vegetative | 950 | Vn | |
| Apical Meristem | 820 | Vn | |
| Root | 770 | V6-V8 | |
| Stalk | 760 | V6 | |
| Immature ear | 760 | Vn | |
| Stalk Node | 580 | V12-V13 | |
| Ear Shoot | 530 | V11 | |
| Leaf | 500 | V6-V8 | Transgene |
| Pericarp | 490 | R4 | |
| Stalk Internode Rind | 440 | V12-V13 | |
| Leaf-base | 390 | V3 | |
| Leaf Whorl ECB | 390 | V5 | ECB infestation |
| Endosperm | 380 | R5 | |
| Stalk Internode | 340 | VT | |
| Pedicel | 340 | R1-R2 | Drought stress |
| Kernel | 340 | R2 | |
| Tassel Spikelet | 320 | VT | |
| Root Tip Meristem | 300 | V6 | |
| Ovary | 290 | Vn | |
| Silk | 290 | VT | |
| Tassel | 280 | Vn | |
| Pollen | 280 | VT | |
| Stem, Sheath | 260 | V7-V8 | |
| Ear | 230 | V15-R1 | |
| Stalk Internode Pith | 220 | VT | |
| Mesocotyl | 110 | VE | |
| Stalk Leaf Pulvinus | 100 | VT | |
| Husk | 80 | R1 | |
| Stalk Node | 40 | V12-V13 | |
| TABLE 1C |
| Expression of maize Pre2 in different tissues as |
| compiled from Solexa-WgT Platform |
| Tissue | Expression (PPTM) | Dev. Stage | |
| Tassel | 359.04 | V6 | |
| Root | 349.75 | V19 | |
| Immature Ear | 319.93 | V8 | |
| Embryo | 270.21 | VE | |
| Leaf | 230.42 | V19 | |
| Kernel | 211.82 | R2 | |
| Root Hair | 188.91 | V1 | |
| Endosperm | 173.4 | R4 | |
| Pericarp | 137.11 | R4 | |
| Stalk | 94.79 | V8 | |
| Pollen | 52.79 | R1 | |
The Examples described below form part of the detailed description of the disclosure. The present disclosure is further illustrated in the following Examples, in which parts and percentages are by weight and degrees are Celsius, unless otherwise stated. It should be understood that these Examples, while indicating preferred embodiments of the disclosure, are given by way of illustration only. From the above discussion and these Examples, one skilled in the art can ascertain the essential characteristics of this disclosure, and without departing from the spirit and scope thereof, can make various changes and modifications of the disclosure to adapt it to various usages and conditions. Thus, various modifications of the disclosure in addition to those shown and described herein will be apparent to those skilled in the art from the foregoing description. Such modifications are also intended to fall within the scope of the appended claims.
Forward genetics was used to clone a pre-mature senescence2 (pre2) mutation isolated from a highly Mu-active stock. The senescing phenotype of pre2, which inherits in a recessive manner, is apparent 2-3 weeks prior to anthesis. Like natural senescence, the pre2 phenotype starts from the lowermost leaves and then spreads to the top of the plant in a progressive fashion (FIG. 1A). We have cloned a candidate gene for pre2 mutation using SAIFF protocol (Selective Amplification of Insertion Flanking Fragments). The candidate gene co-segregates completely with the phenotype in a population of 500 segregating F2 plants (FIG. 1B). The pre2 encodes a conserved protein of no previously known function and is expressed at very low level (less than 100 PPM) in almost all parts of corn plant. The pre2 mutant phenotype was found to be the result of an interference of the insertion in differential splicing of intron1 in the transcript (FIG. 2A), which further leads to an early termination codon in its peptide. The Mu insertion in the mutant resulted in expression 4 different species of mRNA with variable expression levels (FIG. 2A). In addition to wild type mRNA, the mutant also expresses mRNAs with 122, 170 and 373 bp insertions which due to pre mature stop codons translated into predicted polypeptides of 113, 49 and 113 amino acid residues in addition to 1271 amino acid wild type polypeptide (FIG. 2A). Reverse genetics and allelic test of two independent mutant alleles (pre2-2 and pre2-3) provided proof-of-validation that the right gene for pre2 mutation had been cloned (FIG. 2C). Only a few partial ESTs representing 3ā² end of the gene were found in the database, thus a full length cDNA of 3.9 kb was amplified using RT-PCR (FIG. 2B) and cloned into a cloning vector. The maize pre2 gene includes of 13 exons and 12 introns and has 1271 amino acid long peptide. The Zmpre2 gene was mapped to chr4 on bin 189 cM. The maize Pre2 gene expression was compiled from different libraries developed by DuPont-Pioneer using various corn tissues at different developmental stages under different treatments. The gene expression value measured in PPTM by using three platforms, MPSS-Signature, MPSS-Classic and Solexa-WgT, is summarized in Table 1A, 1B, and 10. The Pre2 gene expression is enhanced under drought stress, insect infestation, disease inoculation, herbicide spray, and Nitrate application. The Pre2 is expressing in almost all plant parts of corn with maximum expression in leaf at V5 stage followed by kernel, anther, embryo, apical meristem, and root at V6-V8 stage.
Homologous sequence of Pre2 in Arabidopsis was identified by using corn candidate gene sequence for pre-mature senescence2 as query. Then by using Atpre2 gene sequence, three independent T-DNA insertional alleles (Salk_017615, Salk_079273, Salk_107247) were identified in the Arabidopsis T-DNA mutant database. As in both SALK_079273 and SALK_107247 lines the T-DNA is situated in the 3ā² UTR region of the candidate gene (FIG. 4; top panel), Salk_017615 was analyzed in which the T-DNA is present in the coding sequence. This mutant line was obtained from ABRC and plants were grown and subjected to PCR fingerprinting and RT-PCR analyses. PCR amplification of the T-DNA flanking sequences using gene specific primer along with T-DNA primer confirmed that the T-DNA insertion is present in exon10 of At-PRE2 gene (FIG. 4; upper panel). Genomic PCRs using gene and T-DNA specific primers also showed that all plants were having T-DNA in the Atpre2 gene (FIG. 3, 2nd panel from top). The gene specific primers flanking the T-DNA insertion will amplify DNA region in wild-type (WT) plants and right size PCR product was present in all plant except plant #11 and #25 (FIG. 3, 3rd panel from top) indicating that all plants except #11 and #25 were heterozygous for this insertion. PCR amplification of Actin in both mutant and wild type plants was used as control (FIG. 4; 4th panel from top). Based on these genotyping results plant #11 and 25 were identified as homozygous for T-DNA insertion. Expression of Pre2 is low in Arabidopsis and almost present in plant parts but highest was noticed in siliques and maturing seeds (FIG. 3). Furthermore, Reverse Transcriptase Polymerase Chain Reaction (RT-PCR) was performed on these plants and, but a full length transcript of AtPre2 mRNA was not detected in plant #11 and #25 (35 cycles) indicating that AtPre2 gene expression is knocked out in these two T-DNA mutants. We harvested seed from the two homozygous and all heterozygous plants. In order to identify and multiply the seed of WT-sib (+/+), seeds from the next generation from a self progeny of heterozygous plant were grown and PCR fingerprinting was repeated. The homozygous nature of T-DNA knock out in plant #11 and #25 was confirmed and the seeds were multiplied. Morphological traits from both homozygous plant #11 and #25 were compared with homozygous WT-sib (+/+) and heterozygous WT-sib (+/Pre2) at flowering. Both homozygous mutants were robust in growth with more pod numbers but were late in maturity by 4 to 5 days as compared to its WT-sibs (FIG. 5A). For measuring total biomass, 9 whole plants, each of knock out #11, knock out #25, homozygous WT, and heterozygous WT-sibs, were harvested and air dried for 14 days at room temperature. Total weight was determined by weighing and average and standard deviation were calculated for statistical analysis. The total biomass of both knockouts (combined) was found to be significantly higher (t test at P<0.01) when compared to both homozygous and heterozygous WT-sibs (FIG. 5B).
Multisite Gateway (Invitrogen) technology was used to generate plant expression vectors. A 3978 bp coding sequence of AtPre2 (at1g72390) was amplified by PCR using forward and reverse gene specific primers (GSP-F+GSP-R) and cloned in pENTR.D.TOPO. The final expression vector (pRG1261) contained herbicide and fluorescent marker for transgenic seed sorting. Quality check was performed on the resulting expression vector by restriction digestion mapping and transferred into Agrobacterium tumefaciens LB4404JT by electroporation. The co-integrated DNA from transformed Agrobacterium was transferred in E. coli DH10B and the plasmid DNA from this strain was used to check its quality again by restriction digestion. These overexpression vectors were transformed in to Arabidopsis thaliana ecotype Columbia-0 by Agobacterium mediated Floral-Dipā² method (Clough and Bent, (1998) Plant Journal 16:735). T0 seeds were screened for T1 transformants in soil for herbicide resistance. For molecular analysis of the transgenic T1 events, RT-PCRs were conducted to detect the transgene expression, actin control and the presence of genomic DNA in the RNA preparations. Transgene expressing events were advanced for further studies. Overrexpression of ZmPre2 coding sequence in Arabidopsis resulted in a hypersensitive response to drought. (See, FIG. 6B).
In order to determine the sub-cellular localization AcGFP was fused in the c-terminal of AtPRE2. This fusion cassette was either driven by 35S promoter (pRG1263) or by ATPRE2 promoter (518 bp region upstream of start codon of Atpre2) in pRG1264. Similarly, in order to study the regulation of expression of AtPre2 in details, this 518 bp promoter region of Atpre2 was fused to GUS:RFP (a dual reporter) to generate pRG1265. All these constructs were transformed into Arabidopsis as described in Example 3.
Drought assay was performed on total 72 mutants and 72 wild-type sibs (WT) by using 8 pots (cells) for each. Each pot was sown to produce 9 mutant s or WT seedlings in a 3Ć3 array. Flats are configured with 8 square pots each in one experiment. Each pot was filled with ScottsĀ® Metro-MixĀ® 200 soil. The soil was watered to saturation and then plants were grown under standard conditions of 16 hour light, 8 hour dark cycle; 22° C.; ā60% relative humidity). No additional water was given after day 16th.
Digital images of the plants were taken at the onset of visible drought stress symptoms. Images were taken once a day (at the same time of day), until the plants appear dessicated. Typically, four consecutive days of data is captured. Color analysis was employed for identifying potential drought tolerant lines. Color analysis can be used to measure the increase in the percentage of leaf area that falls into a yellow color bin. Using hue, saturation and intensity data (āHSIā), the yellow color bin consists of hues 35 to 45. Maintenance of leaf area was also used as another criterion for identifying potential drought tolerant lines, since Arabidopsis leaves wilt during drought stress. Maintenance of leaf area can be measured as reduction of rosette leaf area over time. Leaf area was measured in terms of the number of green pixels obtained using an imaging system. Mutant and control (e.g. wild-type) plants were grown side by side in flats and when wilting begins. From these data wilting profiles are determined based on the green pixel counts obtained over four consecutive days for activation-tagged or knockout mutant plants and accompanying control plants. The profile was selected from a series of measurements over the four day period that provided the largest degree of wilting. The ability to withstand drought was measured by the tendency of plants to resist wilting compared to control their WT-sib plants (FIG. 6A).
Software was used to analyze CCD images. Estimates of the leaf area of the Arabidopsis plants were obtained in terms of the number of green pixels. The data for each image was averaged to obtain estimates of mean and standard deviation for the green pixel counts for activation-tagged and wild-type plants. Parameters for a noise function were obtained by straight line regression of the squared deviation versus the mean pixel count using data for all images in a batch. Error estimates for the mean pixel count data were calculated using the fit parameters for the noise function. The mean pixel counts for activation-tagged and wild-type plants are summed to obtain an assessment of the overall leaf area for each image. The four-day interval with maximal wilting was obtained by selecting the interval that corresponds to the maximum difference in plant growth. The individual wilting responses of the activation-tagged, knockout mutants, and wild-type plants were obtained by normalization of the data using the value of the green pixel count of the first day in the interval. The drought tolerance of the activation-tagged or ko mutant plants compared to the wild-type plant was scored by summing the weighted difference between the wilting response of mutant or activation-tagged plants and wild-type plants over day two to day four; the weights were estimated by propagating the error in the data. A positive drought tolerance score corresponds to an activation-tagged or mutant plant with slower wilting compared to the wild-type plant. Significance of the difference in wilting response between activation-tagged and wild-type plants was obtained from the weighted sum of the squared deviations.
In drought assay the Atpre2 mutant plants were showing positive score greater than 0.9 with positive standard deviation in all flats. This demonstrated that these mutant plants outperformed significantly better than their wild type sibs used as control (FIG. 6B). The second control used in this experiment was ZmPre2 gene over expressed under 35S promoter in Arabidopsis. These plants became hypersensitive to drought stress (FIG. 6B) further authenticated these drought assay results.
For low nitrogen (Low N) plate assays, 32 mutant and 32 wild type plants were grown on square plates (15 mmĆ15 mm) containing 0.5ĆN-Free Hoagland's, 0.4 mM potassium nitrate, 0.1% sucrose, 1 mM MES and 0.25% Phytagel⢠(Low N medium). Plates were kept for three days in the dark at 4° C. to stratify seeds and then placed horizontally for nine days at 22° C. light and 20° C. dark. Plates were placed under sixteen hours light and eight hours dark, with an average light intensity of Ė200 mmol/m2/s. Plates were rotated and shuffled daily within each shelf. At day twelve (nine days of growth), seedling status was evaluated by imaging the entire plate. After masking the plate image to remove background color, two different measurements were collected for each individual plant: total rosette area, and the percentage of color that falls into a green color bin using hue, saturation and intensity data (HSI). The green color bin consists of hues 50 to 66. Total rosette area was used as a measure of plant biomass, whereas the green color bin was shown by dose-response studies to be an indicator of nitrogen assimilation. In this assay Atpre2 mutant plants showed a significantly higher total area (biomass) and green color (Bin2 area) (FIG. 7).
For high nitrogen (High N) root assays, 16 mutants and 16 wild type plants instead of 32 each were grown on plates in the same light and temperature conditions as described above. The plates were having the same medium except it was containing 60 mM of potassium nitrate. N and root biomass was measured by imaging. Four independent experiments were performed and the data revealed that in each case mutant plants were hyper-sensitive to higher concentration of nitrogen which leads to severe root growth inhibition as compared to its wild type sib plants (FIG. 8).
A genomic fragment of 450 bp (from 1189 to 1638nt of ZmPre2 CDS) was used in sense and antisense orientation with an intron (ST-SL2 intron2) as a spacer to make an inverted repeat/RNAi cassette. This cassette was driven by either Zm-UBI (constitutive promoter) and/or a putative ZM-SEE1 (senescence induced promoter) promoters. MOPAT driven by Zm-UBI promoter and PMI driven by OsACTIN promoter was used as selectable markers. In addition, RFP driven by a pericarp specific promoter LTP2 was also used to sort out the transgenic seeds (red) from their segregating non-transgenic sib seeds. Transgenic lines for the constructs were generated and molecular analyses, such as PCR-FP and RT-PCR, were performed for selection of transgenic events. Several lines with significantly reduced expression of ZmPre2 have been identified and are characterized in further experiments.
ZmPre2 RNAi suppression construct is transformed into a fast cycling corn line (FASTCORN) for further transgenic validation. A full length mRNA amplified by RT-PCR (FIG. 2A) was used to make both for over-expression (Ox) and RNAi constructs using Ubi promoter. Ten transgenic events for both were screened molecularly for copy number and Pre2 gene expression by QPCR. For phenotypic data on leaf area, leaf color, height etc. digital images of the plants at various growth stages were taken as described above. Data on total biomass and stay green traits were calculated by measuring the leaf area in terms of the number of green pixels obtained using a commercially available imaging system. Data for other traits such as ear length, ear width, maximum ear area and total seed number were obtained at the time of harvesting. Data was analyzed by applying paired t-test and presented as Z-score in FIG. 9. All ten events (RNAi construct) and all but two of the (Ox) had single copy and the relative gene expression in five out ten RNAi events was significantly low (ranging from 0.07 to 0.554) as compared to internal transgenic and non-transgenic controls. All but one Ox events had 2Ć more relative expression ranging from 2.171 to 2.897. Three RNAi events (1.4, 1.5 and 2.5) were found to have significantly higher ear length, ear width and total seed numbers (FIG. 9), which is relevant to their relative gene expression. However, pre-mature senescence phenotype was not observed in these events. This could be due to the fact that all the insertion mutant alleles for the native Pre2 gene were resulting from the partial interference and differential splicing of the introns in their mature transcript, whereas the RNAi mechanism is different than Mutator insertion mutants. On the other hand, these four RNAi events with higher seed numbers as compared to all overexpression (Ox) events are behaving similar to T-DNA knockouts in Arabidopsis. These four events also show higher biomass (FIG. 9A). Three RNAi events (namely 1.4, 1.5 and 2.5) were selected for conducting NUE Reproductive Assay in T1 generation under 4.0 mMol Nitrate-suboptimal nitrogen conditions. Two of three events (1.5 and 2.5) showed significant increase (percent change vs. Null) in silk count, ear length, ear width and ear area (FIG. 9B). In addition to these traits, event 2.5 also showed significant difference for Days to shed and days to silk as compared to its nulls. Thus, transgenic plants where the expression of the Pre2 mRNA has been modulated exhibit significant differences in one or more agronomic parameters of interest for crop plants.
The protein-coding regions of other genes homologous to the PRE2 amino acid sequences disclosed herein. FIGS. 10-11 present an alignment of a plurality of amino acid sequences set forth in SEQ ID NOS: 1-48.
Sequence alignments and percent identity calculations were performed using the MEGALIGNĀ® program of the LASERGENEĀ® bioinformatics computing suite (DNASTARĀ® Inc., Madison, Wis.). Multiple alignment of the sequences was performed using the Clustal W method of alignment (Higgins and Sharp (1989) CAB/OS. 5:151-153) with the default parameters (GAP PENALTY=10, GAP LENGTH PENALTY=10). Default parameters for pairwise alignments using the Clustal method were KTUPLE=1, GAP PENALTY=3, WINDOW=5 and DIAGONALS SAVED=5.
The amino acid sequence of corn Pre2 peptide (ZmPRE2) has the following percent sequence identity with the homologs presented in FIGS. 10 and 11: Pre2 peptides of sorghum and grasses such as Sudan, Bahia and Resurrection were found to be 83% to 90% identical with corn at amino acid level whereas the rice peptide diverged from corn and showed 68%. Homologs in dicots including Arabidopsis, Soybean and Canola have 34%, 36%, and 35% identity, respectively at the global alignment level.
Molecular analysis revealed several conserved regions/domain in the Pre2 homologs. Despite the overall sequence divergence along the full-length of the Pre2 polypeptides across a variety of species shown in FIG. 10 for example, several highly conserved domains were observed (FIG. 11). SEQ ID NOS: 27-48 represent a subset of conserved regions and domains across the Pre2 polypeptide region.
Local Blast results using AtPre2 full length gene sequence as query showed that there are two copies of Pre2 gene in soybean and their partial sequences is aligned in a multiple alignment (FIG. 10). A partial EST sequence (PSO423639) of about 2800 bp in length was cloned. The expression pattern distribution of the ESTs or full-length cDNAs in the Tissue Library Browser indicate that Pre2 gene expression is very low in soybean and Pre2-ESTs have been expressed highest in seedling, mostly in shoot under biotic and abiotic stresses. Medium numbers of ESTs (20-30) have been detected in leaf, root, young cotyledons, low levels in reproductive tissues such as pod, seed and seed coat.
Sequences of both the partial Pre2 copies in soybean were aligned and the following consensus sequence of 147 bp (SEQ ID NO: 51) was selected to use in an RNAi construct using Arabidopsis UBI promoter. This construct is transformed into soybean.
Soybean embryos are bombarded with a plasmid comprising a preferred promoter operably linked to a heterologous nucleotide sequence comprising a suitable target RNAi sequence against Pre2 polynucleotide sequence or subsequence (e.g., SEQ ID NOS: 14, 16, 17 and 19), as follows. To induce somatic embryos, cotyledons of 3 to 5 mm in length are dissected from surface-sterilized, immature seeds of the soybean cultivar A2872, then cultured in the light or dark at 26° C. on an appropriate agar medium for six to ten weeks. Somatic embryos producing secondary embryos are then excised and placed into a suitable liquid medium. After repeated selection for clusters of somatic embryos that multiply as early, globular-staged embryos, the suspensions are maintained as described below.
Soybean embryogenic suspension cultures can be maintained in 35 ml liquid media on a rotary shaker, 150 rpm, at 26° C. with fluorescent lights on a 16:8 hour day/night schedule. Cultures are sub-cultured every two weeks by inoculating approximately 35 mg of tissue into 35 ml of liquid medium.
Soybean embryogenic suspension cultures may then be transformed by the method of particle gun bombardment (Klein, et al., (1987) Nature (London) 327:70-73, U.S. Pat. No. 4,945,050). A DuPont Biolistic⢠PDS1000/HE instrument (helium retrofit) can be used for these transformations.
A selectable marker gene that can be used to facilitate soybean transformation is a transgene composed of the 35S promoter from Cauliflower Mosaic Virus (Odell, et al., (1985) Nature 313:810-812), the hygromycin phosphotransferase gene from plasmid pJR225 (from E. coli; Gritz, et al., (1983) Gene 25:179-188) and the 3ā² region of the nopaline synthase gene from the T-DNA of the Ti plasmid of Agrobacterium tumefaciens. The expression cassette of interest, comprising the preferred promoter and a heterologous Pre2 polynucleotide e.g., in the sense or anti-sense or hairpin orientation, can be isolated as a restriction fragment. This fragment can then be inserted into a unique restriction site of the vector carrying the marker gene.
To 50 μl of a 60 mg/ml 1 μm gold particle suspension is added (in order): 5 μl DNA (1 μg/μl), 20 μl spermidine (0.1 M) and 50 μl CaCl2 (2.5 M). The particle preparation is then agitated for three minutes, spun in a microfuge for 10 seconds and the supernatant removed. The DNA-coated particles are then washed once in 400 μl 70% ethanol and resuspended in 40 μl of anhydrous ethanol. The DNA/particle suspension can be sonicated three times for one second each. Five microliters of the DNA-coated gold particles are then loaded on each macro carrier disk.
Approximately 300-400 mg of a two-week-old suspension culture is placed in an empty 60Ć5 mm petri dish and the residual liquid removed from the tissue with a pipette. For each transformation experiment, approximately 5-10 plates of tissue are normally bombarded. Membrane rupture pressure is set at 1100 psi, and the chamber is evacuated to a vacuum of 28 inches mercury. The tissue is placed approximately 3.5 inches away from the retaining screen and bombarded three times. Following bombardment, the tissue can be divided in half and placed back into liquid and cultured as described above.
Five to seven days post bombardment, the liquid media may be exchanged with fresh media and eleven to twelve days post-bombardment with fresh media containing 50 mg/ml hygromycin. This selective media can be refreshed weekly. Seven to eight weeks post-bombardment, green, transformed tissue may be observed growing from untransformed, necrotic embryogenic clusters. Isolated green tissue is removed and inoculated into individual flasks to generate new, clonally propagated, transformed embryogenic suspension cultures. Each new line may be treated as an independent transformation event. These suspensions can then be subcultured and maintained as clusters of immature embryos or regenerated into whole plants by maturation and germination of individual somatic embryos.
Agrobacterium-mediated transformation of maize is performed for example, as described by Zhao, et al., (2006) Meth. Mol. Biol. 318:315-323 (see also, Zhao, et al., (2001) Mol. Breed. 8:323-333 and U.S. Pat. No. 5,981,840 issued Nov. 9, 1999, incorporated herein by reference). The transformation process involves bacterium innoculation, co-cultivation, resting, selection and plant regeneration.
1. Immature Embryo Preparation:
Immature maize embryos are dissected from caryopses and placed in a 2 mL microtube containing 2 mL PHI-A medium.
2. Agrobacterium Infection and Co-Cultivation of Immature Embryos:
2.1 Infection Step:
PHI-A medium of (1) is removed with 1 mL micropipettor, and 1 mL of Agrobacterium suspension is added. The tube is gently inverted to mix. The mixture is incubated for 5 min at room temperature.
2.2 Co-culture Step:
The Agrobacterium suspension is removed from the infection step with a 1 mL micropipettor. Using a sterile spatula the embryos are scraped from the tube and transferred to a plate of PHI-B medium in a 100Ć15 mm Petri dish. The embryos are oriented with the embryonic axis down on the surface of the medium. Plates with the embryos are cultured at 20° C., in darkness, for three days. L-Cysteine can be used in the co-cultivation phase. With the standard binary vector, the co-cultivation medium supplied with 100-400 mg/L L-cysteine is critical for recovering stable transgenic events.
3. Selection of Putative Transgenic Events:
To each plate of PHI-D medium in a 100Ć15 mm Petri dish, 10 embryos are transferred, maintaining orientation and the dishes are sealed with PARAFILMĀ®. The plates are incubated in darkness at 28° C. Actively growing putative events, as pale yellow embryonic tissue, are expected to be visible in six to to eight weeks. Embryos that produce no events may be brown and necrotic, and little friable tissue growth is evident. Putative transgenic embryonic tissue is subcultured to fresh PHI-D plates at two-three week intervals, depending on growth rate. The events are recorded.
4. Regeneration of T0 plants:
Embryonic tissue propagated on PHI-D medium is subcultured to PHI-E medium (somatic embryo maturation medium), in 100Ć25 mm Petri dishes and incubated at 28° C., in darkness, until somatic embryos mature, for about ten to eighteen days. Individual, matured somatic embryos with well-defined scutellum and coleoptile are transferred to PHI-F embryo germination medium and incubated at 28° C. in the light (about 80 μE from cool white or equivalent fluorescent lamps). In seven to ten days, regenerated plants, about 10 cm tall, are potted in horticultural mix and hardened-off using standard horticultural methods.
Media for Plant Transformation:
Plants can be regenerated from the transgenic callus by first transferring clusters of tissue to N6 medium supplemented with 0.2 mg per liter of 2,4-D. After two weeks the tissue can be transferred to regeneration medium (Fromm, et al., (1990) Bio/Technology 8:833-839).
Transgenic T0 plants can be regenerated and their phenotype determined. T1 seed can be collected. T1 plants, and/or their progeny, can be grown and their phenotype determined.
Canola transformation is accomplished for example, as described in Chen and Tulsieram, US Patent Application Publication Number 2007/0107077, incorporated herein by reference. Buds are collected from a donor line and sterilized. Buds are then homogenized, filtered, and washed to collect the microspores. The resultant microspore suspension was adjusted to a specified density and cultured for 2 days. Embryogenic microspores were then isolated via gradient centrifugation and cultured.
Gold particles coated with the DNA fragment were used for transformation. Biolistic transformation is carried out using the PDS-1000/He Particle Delivery System (Bio-Rad, Hercules, Calif.) as described by Klein, et al., (1987) Nature 327:70-73. Transformed embryogenic microspores are cultured in fresh medium in dark conditions for 10-12 days, then under dim light for 1-3 weeks. Green embryos are transferred to fresh medium and cultured for two weeks to select based on the marker gene used. Germinated shoots and/or plants were transferred to growth medium supplemented with selection component.
A recombinant DNA construct containing a Pre2 down-regulating construct can be introduced into plants either by direct transformation or introgression from a separately transformed line.
Transgenic plants, either inbred or hybrid, can undergo more vigorous field-based experiments to study yield enhancement and/or stability under well-watered and water-limiting conditions.
Subsequent yield analysis can be done to determine whether plants that contain the constructs/sequences disclosed herein have an improvement in yield performance under water-limiting conditions, when compared to the control plants that do not contain the validated drought tolerant lead gene. Specifically, drought conditions can be imposed during the flowering and/or grain fill period for plants that contain the constructs/sequences disclosed herein and the control plants. Reduction in yield can be measured for both. Plants containing the constructs/sequences disclosed herein have less yield loss relative to the control plants, for example, at least 25% less yield loss, under water limiting conditions, or would have increased yield relative to the control plants under water non-limiting conditions.
The above method may be used to select transgenic plants with increased yield, under water-limiting conditions and/or well-watered conditions, when compared to a control plant not comprising said recombinant DNA construct.
In earlier experiments At-Pre2 T-DNA knock out mutant showed a significant increase in biomass, improved growth on low N plates, and drought tolerant phenotype in soil. AT-PRE2 is a large protein of 1326 amino acid residues with unknown function. To elucidate the function of this protein, several experiments were conducted. One of such experiments included ABA response of Atpre2 mutant. Seeds of Atpre2 mutant and Col-0 WT (36 seeds of each WT and mutant with 3 replications) were grown on half MS media (without sucrose) with or without abscisic acid (1 μM±-cis, trans-ABA). The plates with seeds were kept at 4° C. in dark for 3 days and then incubated in growth chamber under the long day growth conditions (16-h-light/8-h-dark cycle at 120-150 μmol m-2 sec-1 and 20° C. to 22° C., with 75% humidity). Visible radicle tips (1-2 mm) were counted after 48 hrs as a germinated seed. In these multiple experiments Atpre2 mutant showed a hypersensitive response to ABA in a dosage dependent manner. The seed germination in mutant was reduced or delayed by more than 50% as compare to wild type in presence of 1 μM ABA (FIG. 12). Searches of expression databases revealed that the endogenous AT-PRE2 gene expression was higher in guard cells in wild type plants and was down-regulated by ABA treatment both in seedling and leaf. In addition AtPRE2 was also up-regulated by nitrate in roots. These results indicate a direct or indirect role of AtPRE2 in ABA and N signaling/pathway.
1. A method of altering an agronomic parameter of a plant, the method comprising downregulating the endogenous expression of a nucleotide encoding a polypeptide, wherein the polypeptide comprises a conserved domain selected from the group consisting of SEQ ID NOS: 27-48.
2. The method of claim 1, wherein the agronomic parameter is selected from the group consisting of greenness, yield, growth rate, biomass, plant nitrogen content, drought tolerance, nitrogen uptake, root lodging, harvest index, stalk lodging, plant height, ear height, ear width, ear length, ear area, salt tolerance, early seedling vigor and seedling emergence under low temperature stress, drought tolerance, increased nitrogen use efficiency, silk count, inducing early maturity, delaying maturity, days to shed and days to silk.
3. The method of claim 1, wherein the suppression of endogenous expression of the messenger RNA is by RNAi.
4. The method of claim 1, wherein the polypeptide comprises the amino acid sequence of SEQ ID NO: 3 or a sequence that is at least 90% identical to SEQ ID NO: 3.
5. A plant comprising in its genome a polynucleotide operably linked to at least one heterologous regulatory element, wherein said polynucleotide comprises a nucleotide sequence selected from the group consisting of:
(a) a nucleotide sequence encoding a polypeptide with drought tolerance activity, wherein the polypeptide has an amino acid sequence of at least 90% sequence identity, based on the Clustal W method of alignment with pairwise alignment default parameters (GAP PENALTY=10, GAP LENGTH PENALTY=0.2, DELAY DEVERGENT SEQS(%)=30%, DNA TRANSITION WEIGHT=0.5, PROTEIN WEIGHT MATRIX āGonnet Seriesā), when compared to a sequence selected from the group consisting of SEQ ID NOS: 3, 5, 7, 9, 11, 13, 15, 18, 20 and 22 or a fragment thereof;
(b) a nucleotide sequence encoding a polypeptide with drought tolerance activity, wherein the nucleotide sequence is hybridizable under stringent conditions with a DNA molecule comprising the full complement compared to a sequence selected from the group consisting of SEQ ID NOS: 1, 2, 4, 6, 8, 10, 12, 14, 16, 17, 19, 21, 23-26;
(c) a nucleotide sequence encoding a polypeptide with drought tolerance activity, wherein the nucleotide sequence is derived from one or more SEQ ID NOS: 1, 2, 4, 6, 8, 10, 12, 14, 16, 17, 19, 21, 23-26; by alteration of one or more nucleotides by at least one method selected from the group consisting of: deletion, substitution, addition and insertion;
(d) a nucleotide sequence encoding a polypeptide wherein the amino acid sequence of the polypeptide comprises a sequence selected from the group consisting of SEQ ID NOS: 3, 5, 7, 9, 11, 13, 15, 18, 20 and 22; and
(e) a nucleotide sequence comprising a sequence selected from the group consisting of SEQ ID NOS: 1, 2, 4, 6, 8, 10, 12, 14, 16, 17, 19, 21, 23-26;
and wherein said plant exhibits increased drought tolerance or improved nitrogen utilization when compared to a control plant not comprising said polynucleotide.
6. The plant of claim 5, wherein said plant exhibits said increase in yield when compared, under water limiting conditions, to said control plant not comprising said recombinant DNA construct.
7. The plant of any one of claim 5 wherein the plant is a monocot.
8. The plant of claim 5 wherein the plant is selected from the group consisting of: maize, soybean, sunflower, sorghum, canola, wheat, alfalfa, cotton, rice, barley, millet, sugarcane, switchgrass, tobacco, potato and sugar beet.
9. An isolated polynucleotide comprising a nucleotide sequence selected from the group consisting of:
(a) a nucleotide sequence encoding a polypeptide with drought tolerance activity, wherein the polypeptide has an amino acid sequence of at least 90% sequence identity, based on the Clustal W method of alignment with pairwise alignment default parameters (GAP PENALTY=10, GAP LENGTH PENALTY=0.2, DELAY DEVERGENT SEQS(%)=30%, DNA TRANSITION WEIGHT=0.5, PROTEIN WEIGHT MATRIX āGonnet Seriesā), when compared to a sequence selected from the group consisting of SEQ ID NOS: 3, 5, 7, 9, 11, 13, 15, 18, 20 and 22;
(b) a nucleotide sequence encoding a polypeptide with drought tolerance activity, wherein the nucleotide sequence is hybridizable under stringent conditions with a DNA molecule comprising the full complement of SEQ ID NO a sequence selected from the group consisting of SEQ ID NOS: 1, 2, 4, 6, 8, 10, 12, 14, 16, 17, 19, 21, 23-26;
(c) a nucleotide sequence encoding a polypeptide with drought tolerance activity, wherein the nucleotide sequence is a sequence selected from the group consisting of SEQ ID NOS: 1, 2, 4, 6, 8, 10, 12, 14, 16, 17, 19, 21, 23-26 a sequence selected from the group consisting of SEQ ID NOS: 1, 2, 4, 6, 8, 10, 12, 14, 16, 17, 19, 21, 23-26; by alteration of one or more nucleotides by at least one method selected from the group consisting of: deletion, substitution, addition and insertion;
(d) a nucleotide sequence encoding a polypeptide wherein the amino acid sequence of the polypeptide comprises a sequence selected from the group consisting of SEQ ID NOS: 3, 5, 7, 9, 11, 13, 15, 18, 20 and 22; and
(e) a nucleotide sequence comprising a sequence selected from the group consisting of SEQ ID NOS: 1, 2, 4, 6, 8, 10, 12, 14, 16, 17, 19, 21, 23-26 a sequence selected from the group consisting of SEQ ID NOS: 1, 2, 4, 6, 8, 10, 12, 14, 16, 17, 19, 21, 23-26;
wherein the polynucleotide is operably linked to a heterologous regulatory element.
10. The polynucleotide of claim 9, wherein the polypeptide of part (a) has an amino acid sequence of at least 80% sequence identity, based on the Clustal W method of alignment with the pairwise alignment default parameters, when compared to a sequence selected from the group consisting of SEQ ID NOS: 3, 5, 7, 9, 11, 13, 15, 18, 20 and 22.
11. The polynucleotide of claim 9, wherein the polypeptide of part (a) has an amino acid sequence of at least 85% sequence identity, based on the Clustal W method of alignment with the pairwise alignment default parameters, when compared to a sequence selected from the group consisting of SEQ ID NOS: 3, 5, 7, 9, 11, 13, 15, 18, 20 and 22.
12. The polynucleotide of claim 9, wherein the polypeptide of part (a) has an amino acid sequence of at least 90% sequence identity, based on the Clustal W method of alignment with the pairwise alignment default parameters, when compared to a sequence selected from the group consisting of SEQ ID NOS: 3, 5, 7, 9, 11, 13, 15, 18, 20 and 22.
13. The polynucleotide of claim 9, wherein the polypeptide of part (a) has an amino acid sequence of at least 95% sequence identity, based on the Clustal W method of alignment with the pairwise alignment default parameters, when compared to a sequence selected from the group consisting of SEQ ID NOS: 3, 5, 7, 9, 11, 13, 15, 18, 20 and 22.
14. A recombinant DNA construct comprising the isolated polynucleotide of claim 9 operably linked to at least one regulatory element.
15. A cell comprising the recombinant DNA construct of claim 14, wherein the cell is selected from the group consisting of a bacterial cell, a yeast cell, and insect cell and a plant cell.
16. A plant comprising the recombinant DNA construct of claim 14.
17. A seed comprising the recombinant DNA construct of claim 14.
18. Seed of the plant of claim 5.
19. The plant of claim 5, wherein the plant is maize and wherein the polypeptide comprises an amino acid sequence of SEQ ID NO: 3 or a sequence that is at least 95% identical to SEQ ID NO: 3, wherein the plant shows one or more improved agronomic parameters that contribute to drought tolerance or yield.
20. A maize plant cell derived from the plant of claim 19.