US20170253664A2
2017-09-07
15/117,027
2015-02-09
Disclosed herein is a bispecific inhibitor for use in treating thrombotic disorders, such as acute thrombotic disorders like stroke and thromboembolism. The bispecific inhibitor is based on monoclonal antibodies targeting TAFI and PAI-1, and shows efficacy in the presence or the absence of plasminogen activators such as tissue-type plasminogen activator (tPA).
Get notified when new applications in this technology area are published.
C07K2317/31 » CPC further
Immunoglobulins specific features characterized by aspects of specificity or valency multispecific
C07K2317/565 » CPC further
Immunoglobulins specific features characterized by immunoglobulin fragments variable (Fv) region, i.e. VH and/or VL Complementarity determining region [CDR]
C07K2317/24 » CPC further
Immunoglobulins specific features characterized by taxonomic origin containing regions, domains or residues from different species, e.g. chimeric, humanized or veneered
C07K2317/76 » CPC further
Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen Antagonist effect on antigen, e.g. neutralization or inhibition of binding
A61K2039/505 » CPC further
Medicinal preparations containing antigens or antibodies comprising antibodies
C07K16/38 » CPC main
Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against protease inhibitors of peptide structure
The present invention relates generally to treatment and prevention of thrombotic disorders such as stroke and thromboembolism by dual inhibition of plasminogen activator inhibitor 1 (PAI-1) and Thrombin-Activatable Fibrinolysis Inhibitor (TAFI). The dual inhibition may be mediated by a bispecific antibody derivative that binds to both targets.
This application includes an electronically submitted sequence listing in .pdf format. The .pdf file contains a sequence listing entitled â19893-18-Sequence_Listing.pdfâ created on Aug. 5, 2016 and is 43 bytes in size. The sequence listing contained in this .pdf file is part of the specification and is hereby incorporated by reference herein in its entirety.
Following an acute cardiovascular accident, the only treatment currently available to recanalize an occluded blood vessel is systemic delivery of a high dose of plasminogen activators. While effective when administered soon after the event, plasminogen activators also cause debilitating side effects such as intracranial haemorrhage and neurotoxicity. In addition, successful restoration of blood flow is not guaranteed because of low recanalization and high reocclusion rates, even when high doses of plasminogen activators are administered [Saver J L. et al. (2011) J Thromb Haemost. 9 Suppl 1,333-343]. Accordingly, there remains a need in the art for effective treatments of occluded blood vessels, for example by promoting fibrinolysis or thrombolysis.
One of the causes for thrombolytic failure is the presence of circulating inhibitors of fibrinolysis, such as Thrombin-Activatable Fibrinolysis Inhibitor (TAFI) and plasminogen activator inhibitor 1 (PAI-1) [Fernandez-Cadenas I et al. (2007) J Thromb Haemost. 5,1862-1868]. Both molecules slow down the tissue type-plasminogen activator (tPA)-mediated formation of plasmin, the key enzyme in fibrinolysis, although through distinct mechanisms (as reviewed in Rijken D C & Lijnen H R (2009) J Thromb Haemost. 7, 4-13). TAFI, a 56 kDa proenzyme with a plasma level of 4-15 ÎŒg/ml, can be activated into TAFIa by thrombin, alone or in complex with thrombomodulin, or plasmin. Through its carboxypeptidase activity, TAFIa is able to cleave off C-terminal Lys residues exposed on partially degraded fibrin, which serve as a co-factor function in the tPA-mediated activation of plasminogen into plasmin. PAI-1 (45 kDa glycoprotein with a plasma level of 5-50 ng/ml and a concentration within platelets of 200 ng/ml) is the main inhibitor of tPA and belongs to the serine protease inhibitors (serpin) superfamily. The active form of PAI-1 can irreversibly neutralize the activity of tPA by forming a 1:1 stoichiometric covalent complex, accompanied by deformation of catalytic triad of the serine protease.
Given their complementary roles in inhibiting fibrinolysis, one approach to promoting fibrinolysis is dual inhibition of TAFI and PAI-1. Simultaneous targeting of TAFI and PAI-1 has been attempted in several studies. However, the results did not consistently indicate that dual inhibition of TAFI and PAI-1 improved thrombolysis as compared to single inhibition. In one study, complementary roles of TAFI and PAI-1, as well as a third molecule α2-AP, were characterized in tPA induced thrombolysis assays in the presence or absence of inhibitors of TAFI, PAI-1, and/or α2-AP [Mutch N J. et al. (2007) J Thromb Haemost. 5, 812-817]. Depending on the type of thrombus, the assays indicated either a role for all three molecules or a substantial contribution of α2-AP and TAFI, with a minor contribution from PAI-1. Similarly, single and double knockout studies in mice suggested that thrombolytic effects in certain assays were due to inhibition of TAFI rather than PAI-1 [Vercauteren E et al. (2012) J Thromb Haemost. 10, 2555-2562].
Notably, a dual targeting strategy based on bispecific antibody derivatives (diabodies) has shown promise. The diabody T12D11Ă33H1F7, based on monoclonal antibodies which bind TAFI and PAI-1, was shown to have a stimulating effect on fibrinolysis which exceeded the effect observed when its component monoclonal antibodies (MA) were tested separately. In addition, new monoclonal antibodies against TAFI and PAI-1 exhibit unique features. MA-RT36A3F5 and MA-TCK26D6 both inhibit mouse and rat TAFI, with each MA acting through distinct mechanisms: the former destabilizes TAFIa, whereas the latter impairs the plasmin-mediated activation of TAFI and also interferes with the interaction of TAFIa on fibrin [Hillmayer K et al. J (2008) Thromb Haemost. 6, 1892-1899; Vercauteren E et al. (2011) Blood 117, 4615-4622; Semeraro F, et al. (2013) J Thromb Haemost. 11, 2137-2147]. MA-33H1F7 and MA-MP2D2 inhibit mouse and rat PAI-1, by converting the active form into a substrate form of PAI-1 which is cleaved by tPA [Debrock S. & Declerck P J. (1997) Biochim Biophys Acta. 1337, 257-266; Van De Craen B. et al. (2011) Thromb Res. 128, 68-76]. In vivo studies have shown a beneficial effect of the above mentioned antibodies on the rate of survival and paralysis in mice after thromboembolic challenge [Vercauteren (2011) cited above, Van De Craen cited above]. Recently, the MA antibodies MA-33H1F7 and MA-TCK26D6 which specifically recognize the corresponding human antigens were adapted to make the bispecific antibody derivative Db-TCK26D6Ă33H1F7, and a strong profibrinolytic effect of the diabody was demonstrated in vitro [Wyseure T et al. (2013) J Thromb Haemost. 11, 2069-2071]. However, no dual targeting studies to date have conclusively demonstrated a role for inhibitors or diabodies in treating specific thrombotic disorders in vivo. In addition, no studies have provided evidence for viable treatments for thrombotic disorders based on inhibitors of fibrinolysis or thrombolysis as alternatives to plasminogen activators.
Described herein is the diabody Db-TCK26D6Ă33H1F7 for use in treating thrombotic disorders, such as stroke and thromboembolism. Db-TCK26D6Ă33H1F7 may be administered either before or after the onset of the thrombotic disorder, and moreover, may be administered in the presence or the absence of plasminogen activators such as tPA.
The present disclosure relates to a bispecific antibody derivative for use in treating an acute thrombotic disorder in a patient, comprising a first targeting domain that binds to Thrombin Activatable Fibrinolysis Inhibitor (TAFI) and comprises complementary determining regions (CDRs) represented by amino acid sequences that are at least 80% identical to each of CDR1H of SEQ ID NO:1, CDR2H of SEQ ID NO:2, CDR3H of SEQ ID NO:3, CDR1L of SEQ ID NO:4, CDR2L of SEQ ID NO:5, and CDR3L of SEQ ID NO:6; and a second targeting domain that binds to Plasminogen Activator Inhibitor-1 (PAI-1) and comprises complementary determining regions (CDRs) represented by amino acid sequences that are at least 80% identical to each of CDR1H of SEQ ID NO:7, CDR2H of SEQ ID NO:8, CDR3H of SEQ ID NO:9, CDR1L of SEQ ID NO:10, CDR2L of SEQ ID NO:11, and CDR3L of SEQ ID NO:12, wherein the bispecific antibody derivative is administered after onset of the acute thrombotic disorder.
In some embodiments, the amino acid sequences in the bispecific antibody derivatives are at least 80%, 85%, 90%, 95%, 99% or 100% identical to the amino acid sequences disclosed in SEQ ID NO:1-18. In some embodiments, the bispecific antibody derivative is for use in an acute thrombotic disorder that is at least one of acute ischemic stroke (AIS), middle cerebral artery occlusion (MCAo), thromboembolism, deep vein thrombosis, myocardial infarction (MI), pulmonary embolism, peripheral arterial disease, thrombosis of liver and/or kidneys, or catheter blockage. For example, the acute thrombotic disorder may be AIS. The acute thrombotic disorder may be MCAo.
In certain embodiments, the bispecific antibody derivative is administered between 0-15 hours after onset of symptoms of the acute thrombotic disorder. In some embodiments, the bispecific antibody derivative is administered up to 3 hours after onset of symptoms of the acute thrombotic disorder. In some embodiments, the bispecific antibody derivative is administered up to 4.5 hours after onset of symptoms of the acute thrombotic disorder. In some embodiments, the bispecific antibody derivative is administered up to 12 hours after onset of symptoms of the acute thrombotic disorder.
The bispecific antibody derivative may be administered without tPA. In some embodiments, the bispecific antibody derivative is administered without tPA during a time period of up to 90 minutes after the onset of the acute thrombotic disorder, for example, 0-90 minutes after onset.
In some embodiments, the bispecific antibody derivative is administered with tPA. For example, the bispecific antibody derivative may be administered 1 hour after administration of tPA.
In some embodiments, bispecific antibody derivative is for use in an acute thrombotic disorder that is characterized by presence of a fibrin-rich blood clot. The acute thrombotic disorder may be characterized by presence of a platelet-rich blood clot.
In certain embodiments, the bispecific antibody derivative is humanized.
A further aspect of the present disclosure relates to a bispecific antibody derivative for use in treating an acute thrombotic disorder in a patient, comprising a first targeting domain that binds to Thrombin Activatable Fibrinolysis Inhibitor (TAFI) and comprises a VH region represented by an amino acid sequence that is at least 80% identical to SEQ ID NO:13 and a VL region represented by an amino acid sequence that is at least 80% identical to SEQ ID NO:14; and a second targeting domain that binds to Plasminogen Activator Inhibitor-1 (PAI-1) and comprises a VH region represented by an amino acid sequence that is at least 80% identical to SEQ ID NO:15 and a VL region represented by an amino acid sequence that is at least 80% identical to SEQ ID NO:16, wherein the bispecific antibody derivative is administered after onset of the acute thrombotic disorder. In some embodiments, a bispecific antibody derivative for use in treating an acute thrombotic disorder in a patient, comprising a first domain represented by an amino acid sequence that is at least 80% identical to SEQ ID NO:17; and a second domain represented by an amino acid sequence that is at least 80% identical to SEQ ID NO:18, wherein the bispecific antibody derivative is administered after onset of the acute thrombotic disorder.
Yet another aspect of the present disclosure relates to a bispecific antibody derivative for use in treating an acute thrombotic disorder in a patient, comprising a first targeting domain that binds to Thrombin Activatable Fibrinolysis Inhibitor (TAFI) and comprises complementary determining regions (CDRs) represented by amino acid sequences that are at least 80% identical to each of CDR1H of SEQ ID NO:1, CDR2H of SEQ ID NO:2, CDR3H of SEQ ID NO:3, CDR1L of SEQ ID NO:4, CDR2L of SEQ ID NO:5, and CDR3L of SEQ ID NO:6; and a second targeting domain that binds to Plasminogen Activator Inhibitor-1 (PAI-1) and comprises complementary determining regions (CDRs) represented by amino acid sequences that are at least 80% identical to each of CDR1H of SEQ ID NO:7, CDR2H of SEQ ID NO:8, CDR3H of SEQ ID NO:9, CDR1L of SEQ ID NO:10, CDR2L of SEQ ID NO:11, and CDR3L of SEQ ID NO:12, wherein the bispecific antibody derivative is administered after onset of the acute thrombotic disorder and is administered without tPA. In some embodiments, the bispecific antibody derivative is administered without tPA, and within a time period that is no more than 90 minutes from the onset of the acute thrombotic disorder.
An aspect of the present invention relates to bispecific antibodies use in treating or preventing an acute thrombotic disorder in a patient. Such antibodies comprise a first targeting domain that specifically binds to Thrombin Activatable Fibrinolysis Inhibitor (TAFI) and comprises complementary determining regions (CDRs) represented by the amino acid sequences SEQ ID NO:1 of CDR1H, SEQ ID NO:2 of CDR2H, SEQ ID NO:3 of CDR3H, SEQ ID NO:4 of CDR1L , SEQ ID NO:5 of CDR2L , and SEQ ID NO:6 of CDR3L; and a second targeting domain that specifically binds to Plasminogen Activator Inhibitor-1 (PAI-1) and comprises complementary determining regions (CDRs) represented by SEQ ID NO:7 of CDR1H, SEQ ID NO:8 of CDR2H, SEQ ID NO:9 of CDR3H, SEQ ID NO:10 of CDR1L, SEQ ID NO:11 of CDR2L and SEQ ID NO:12 of CDR3L.
Embodiments hereof include bispecific antibodies wherein the first targeting domain that binds to Thrombin Activatable Fibrinolysis Inhibitor (TAFI) comprises a VH region represented by an amino acid sequence that is at least 80% identical to SEQ ID NO:13 and a VL region represented by an amino acid sequence that is at least 80% identical to SEQ ID NO:14; and the second targeting domain that binds to Plasminogen Activator Inhibitor-1 (PAI-1) and comprises a VH region represented by an amino acid sequence that is at least 80% identical to SEQ ID NO:15 and a VL region represented by an amino acid sequence that is at least 80% identical to SEQ ID NO:16.
Embodiments hereof are bispecific antibodies that are humanized.
In specific embodiments these bispecific antibodies are for use in treating or preventing brain lesions resulting from an acute thrombotic disorder
In specific embodiments the acute thrombotic disorder is selected from the group consisting of, acute peripheral arterial occlusion, middle cerebral artery occlusion (MCAo), and thromboembolism such as deep vein thromboembolism and lung embolism.
In certain embodiments the bispecific antibodies are for use in treating or preventing an acute thrombotic disorder in a patient in a combination treatment with tPA.
In other embodiments the bispecific antibodies are for use in treating or preventing an acute thrombotic disorder in a patient, where the treatment is performed without administration of tPA, prior, together of after the administration of the bispecific antibody.
The above mentioned acute thrombotic disorder is in specific embodiment characterized by the presence of a platelet-rich blood clot.
Another aspect of the present invention relates to methods for treating or preventing an acute thrombotic disorder in a patient, comprising the step of administering a bispecific antibody against TAFI and PAI. Herein the antibody comprises a first targeting domain that specifically binds to Thrombin Activatable Fibrinolysis Inhibitor (TAFI) and comprises complementary determining regions (CDRs) represented by the amino acid sequences SEQ ID NO:1 of CDR1H, SEQ ID NO:2 of CDR2H, SEQ ID NO:3 of CDR3H, SEQ ID NO:4 of CDR1L , SEQ ID NO:5 of CDR2L , and SEQ ID NO:6 of CDR3L; and a second targeting domain that specifically binds to Plasminogen Activator Inhibitor-1 (PAI-1) and comprises complementary determining regions (CDRs) represented by SEQ ID NO:7 of CDR1H, SEQ ID NO:8 of CDR2H, SEQ ID NO:9 of CDR3H, SEQ ID NO:10 of CDR1L, SEQ ID NO:11 of CDR2L and SEQ ID NO:12 of CDR3L.
The methods of the invention provide several advantages compared to existing therapies.
The methods of the present invention wherein a diabody against TAFI and PAI-1 is used have, compared to tPA, less risks of causing intracranial haemorrhage and neurotoxicity. The diabodies of the present invention are of use in reducing lesion size in patients suffering from a brain lesion. Brain lesions may be caused by thrombotic disorders, such as stroke, acute ischemic stroke (AIS), and/or middle cerebral artery occlusion (MCAo).
Compared to tPA which has short activity upon administration (about 15 minutes), diabodies can bind to their targets for a much longer time period.
High doses of tPA can result in unwanted enzymatic activity of plasmin. The use of a high dose of diabody is less critical. Antibody which does not bind PAI-1 or TAFI has no side effects.
Compared to tPA, the diabodies show a reduction in bleeding time. Accordingly the diabodies of the present invention have the advantageous property of reducing the risk of unwanted bleeding, such as intracranial haemorrhage.
FIG. 1A-1B shows the expression levels of CDR-grafted scFv. A. Modeled structure of CDR of MA-RT36A3F5 (circles) in the framework of scFv-4D5. B. Immunoblot showing periplasmic extracts containing CDR-grafted scFv-RT36A3F5-4D5 (lane 1), scFv-T12D11 as control (lane 2), scFv-RT36A3F5-T12D11 (lane 3) and scFv-RT36A3F5-4D5DM (lane 4), detected via anti-His-tag polyclonal antibody.
FIG. 2 shows a schematic representation of bispecific inhibitors: Db-RT36A3F5Ă33H1F7 (Db), Db-RT36A3F5-4D5Ă33H1F7 (CDR-grafted Db), scDb-33H1F7ĂRT36A3F5 (scDb) and scDb-33H1F7ĂRT36A3F5-4D5 (CDR-grafted scDb).
PH: variable region heavy chain anti-PAI-1 antibody; PL: variable region light chain anti-PAI-1 antibody; TH: variable region heavy chain anti-TAFI antibody; TL: variable region light chain anti-TAFI antibody; THâČ: humanised variable region heavy chain anti-TAFI antibody; TLâČ: humanised variable region light chain anti-TAFI antibody.
FIG. 3A-3B shows the plasma stability and profibrinolytic effect during in vitro clot lysis. A. Graph representing stability, determined by an ELISA-based assay to measure residual binding capacity towards TAFI and PAI-1 simultaneously. (sc)Db-variants(Db-RT36A3F5Ă33H1F7 (Db), Db-RT36A3F5-4D5Ă33H1F7 (CDR-grafted Db), scDb-33H1F7ĂRT36A3F5 (scDb) and scDb-33H1F7ĂRT36A3F5-4D5 (CDR-grafted scDb)) at 10 ÎŒg/ml were incubated in citrated rat plasma at 37° C. The control Db was Db-T12D11Ă33H1F7] At time points zero, 1 hour and 3 hours, an aliquot was analyzed and bound protein was relatively expressed towards that of time point zero (residual binding in %, mean±SEM, n=3-9). B. Graph representing stability (% residual binding after 3 hours at 37° C. in plasma, mean±SEM, n=3-9) vs. profibrinolytic properties of (sc)Db-variants at an 8-fold molar excess over TAFI during clot lysis in rat plasma (expressed as relative lysis (mean±SEM, n=3) to that of MA-RT36A3F5 at a 4-fold molar excess over TAFI).
FIG. 4A-4B shows the profibrinolytic effect of MA (single or combined addition of MA-TCK26D6 and MA-33H1F7) and Db-TCK26D6Ă33H1F7 during thromboelastometric measurements using human blood (A) and blood from endotoxemic mice (B). Graph representing (A) degree of lysis (Î L45, %; mean±SEM; n=6-12) and (B) relative Î AUC (mean±SEM, n=3-6) in the presence of MA-33H1F7, MA-TCK26D6, the combined addition of MA or diabody. Statistical significance is indicated by asterisks (*p<0.05; **p<0.01; ***p<0.001).
FIG. 5 shows an in vivo evaluation of MA in a thromboembolism model induced by systemic administration of thromboplastin. Graph representing fibrin contents in lungs injected with saline, MA-TCK26D6 at 5 mg/kg or MA-33H1F7 at 1 mg/kg (mean±SEM, n=5-7). Baseline levels were obtained by isolating lungs from mice without thrombotic challenge (mean±SEM, n=5). Statistical significance is indicated by asterisks (*p<0.05; **p<0.01; ***p<0.001).
FIG. 6A-6B shows an in vivo evaluation of MA and Db in a thromboembolism model using endotoxemic mice. Graph representing fibrin contents in lungs from endotoxemic mice injected with (A.) vehicle, MA-33H1F7 at 10 mg/kg, MA-TCK26D6 at 5 mg/kg, MA-TCK26D6 at 5 mg/kg+MA-33H1F7 at 10 mg/kg or (B.) vehicle, MA-33H1F7 at 1 mg/kg, MA-TCK26D6 at 1 mg/kg, MA-TCK26D6 at 1 mg/kg+MA-33H1F7 at 1 mg/kg, Db-TCK26D6Ă33H1F7 at 0.8 mg/kg (mean±SEM, n=5-10). Baseline levels were obtained by isolating lungs from healthy mice without thrombotic challenge (mean±SEM, n=5). Statistical significance is indicated relative to vehicle (*p<0.05; **p<0.01; ***p<0.001).
FIG. 7A-7G shows in vivo evaluation of MA in a mouse model of transient mechanical MCAo. FIGS. 7A and 7D show lesion size (mm3), FIGS. 7B and 7E show the Bederson score (0-5), FIGS. 7C and 7F show the Grip test score (0-5), measured 24 hours post occlusion in mice treated with vehicle (PBS), negative control IgG, MA-TCK26D6 at 6 mg/kg and MA-TCK26D6 at 25 mg/kg (FIG. 7A-7C, mean±SEM, n=8-12) and vehicle (PBS), negative control IgG and MA-33H1F7 at 6 mg/kg (FIG. 7D-7F, mean±SEM, n=14-16). FIG. 7G shows fibrinogen contents in ipsilateral side of brain (fold increase vs. contralateral), measured at 24 hours post occlusion in mice treated with vehicle (PBS), negative control IgG, MA-33H1F7 at 6 mg/kg and MA-TCK26D6 at 25 mg/kg (mean±SEM, n=4-5). Statistical significance is indicated as follows: *p<0.05; **p<0.01; ***p<0.001. (the control MA is MA-T30E5)
FIG. 8A-8D shows the in vivo evaluation of MA and Db in a mouse model of transient mechanical MCAo. FIG. 8A shows lesion size (mm3), FIG. 8B shows the Bederson score (0-5), FIG. 8C shows the Grip test score (0-5) measured at 24 hours post occlusion in mice treated with vehicle (PBS), negative control IgG, MA-33H1F7 at 1 mg/kg, MA-TCK26D6 at 1 mg/kg, MA-TCK26D6 at 1 mg/kg+MA-33H1F7 at 1 mg/kg or Db at 0.8 mg/kg (mean±SEM, n=10-12). FIG. 8D shows fibrinogen contents in ipsilateral side of brain (fold increase vs. contralateral), measured at 24 hours post occlusion in mice treated with vehicle (PBS), negative control IgG, MA-TCK26D6 at 1 mg/kg +MA-33H1F7 at 1 mg/kg or Db at 0.8 mg/kg (mean±SEM, n=3-4). Statistical significance is indicated as follows: *p<0.05; **p<0.01; ***p<0.001. (the control MA is MA-NB27B3)
FIG. 9A-9F shows in vivo evaluation of diabody as single treatment or as adjuvans to thrombolytic treatment in a mouse model of thrombin-induced MCAo. Graphs representing following parameters measured 24 hours post clot onset in mice treated with PBS, tPA (10 mg/kg), diabody (Db-TCK26D6Ă33H1F7) at 0.8 mg/kg) and combination therapy (diabody 0.8 mg/kg+tPA 10 mg/kg): (A) lesion size (mm3) (B) angiographic score (0-2) and (C) % reduction in cerebral blood flow (CBF) mean±SEM, n=6-8). Statistical significance is indicated relative to PBS (*p<0.05; **p<0.01; ***p<0.001).
Additional time points after thrombin-induced occlusion are presented in FIGS. 9D, 9E, and 9F. Lesion volume (mm3) at 24 h post occlusion (upper panel) and representative T2-weighted images 24 h post occlusion (lower panel)of mice treated with vehicle, tPA (10 mg/kg), Db (0.8 mg/kg) or a combination of Db (0.8 mg/kg) and tPA (10 mg/kg) 20 min post occlusion (FIG. 9D, n=6-8), 90 min post occlusion (FIG. 9E, n=9-10) and 240 min post occlusion (FIG. 9F, n=7-9). Dotted lines delineate stroke lesions. Data are represented as mean±SEM. *, p<0.05; **, p<0.01; ns=not significant. tPA indicates recombinant tissue-type plasminogen activator; Db, diabody.
FIG. 10A-10D shows in vivo evaluation of diabody in a mouse model of FeCl3-induced MCAo. Graphs representing (A) difference in cerebral blood flow (CBF) at 1 hour post occlusion (B) lesion size (mm3) (C) angiographic score (0-2) and (D) % reduction in CBF at 24 hours post occlusion, in mice treated with PBS, tPA at 10 mg/kg and diabody (Db-TCK26D6Ă33H1F7) at 1.6 mg/kg and at 3.6 mg/kg (mean±SEM, n=8-15). Statistical significance is indicated relative to PBS (*p<0.05; **p<0.01; ***p<0.001).
FIG. 11A-11C shows In vitro and in vivo expression of scDbs against TAFI and PAI-1. Graphs comparing the following properties of a series of scDbs and their variants (A) in vitro production expressed as secreted protein in conditioned medium (B) in vitro stability in plasma at 37° C. up to 72 hours, expressed as residual binding (%) and (C) in vivo expression after intramuscular DNA injection and electroporation.
FIG. 12A-12B shows tail bleeding time and accumulative bleeding up to 60 min.in mice treated with vehicle (PBS); tPA at 1 and 10 mg/kg; diabody at 0.8 mg/kg and 3.6 mg/kg; and Db (0.8 mg/kg)+tPA (10 mg/kg). FIGS. 12A and 12B show the effect of tPA and/or diabody on bleeding time and haemoglobin levels.
FIG. 13 shows systemic pharmacokinetics of the diabody after intravenous injection. Graph shows plasma levels (Όg/ml, mean±SEM) plotted against time (min) after IV injection of diabody at 0.8 mg/kg in 6 mice (red arrow indicates circulating half-life=121 min) FIG. 13A shows the time (in minutes) until initial cessation of tail bleeding as monitored in mice, and (B) accumulative bleeding (haemoglobin loss) up to 60 min, measured as haemoglobin (g/dL) (median, n=9-16 mice/group; *, p<0.05; **p<0.01; ***p<0.005). tPA indicates recombinant tissue-type plasminogen activator; Db, diabody.
FIG. 14A-14B shows the evaluation of the effect of the diabody (Db) on cortical neuronal death with or without NMDA-induced excitotoxicity. In FIG. 14A, cortical neurons were exposed to NMDA (as a full kill condition (FK); 500 ÎŒmol/L) or diabody (0.5 -50 ÎŒg/ml); In FIG. 14B cortical neurons were exposed to NMDA (500 ÎŒmol/L (full kill, FK) or 12.5 ÎŒmol/L), Db (5 ÎŒg/ml) or rtPA (20 ÎŒg/ml), either alone or in combination, during 24 hours before measurement of neuronal death (N=2 independent cultures, n=2-4, *p<0.05; ns=not significant). tPA indicates recombinant tissue-type plasminogen activator; Db, diabody; NMDA, N-methyl-D-aspartate.
The present disclosure relates to the use of bispecific antibody derivatives in treating thrombotic disorders. The bispecific antibody derivatives target TAFI and PAI-1 and inhibit both proteins in a dual targeting strategy. In some embodiments, the bispecific antibody derivative is a diabody known as Db-TCK26D6Ă33H1F7, and may be used in treating acute thrombotic disorders. In some embodiments, the bispecific antibody derivative is administered after onset of the acute thrombotic disorder. In certain embodiments, the bispecific antibody derivative is administered to patients at risk for developing thrombotic disorders, either acute or chronic thrombotic disorders.
Exemplary sequences of bispecific antibody derivatives or portions thereof are described herein (SEQ ID NOS: 1-18). In addition, bispecific antibody derivatives of the present disclosure may be identical, substantially identical, homologous, or similar to the exemplary sequences described herein.
âSequence identityâ refers to two amino acid sequences or subsequences that are identical, or that have a specified percentage of amino acid residues that are the same (e.g., 60% or 65% identity, preferably, 70%-95% identity, more preferably, >95% identity), when compared and aligned for maximum correspondence over a window of comparison, or over a designated region, as measured using a sequence comparison algorithm as known in the art, or by manual alignment and visual inspection. In certain embodiments, the described identity exists over a region that is at least about 5 to 10 amino acids in length.
Specific âdesignated regionsâ in the context of the present invention are the CDR regions or the present invention. These CDR regions are typically conserved (100% sequence identity compared to the reference sequence), although one or more substations may be allowable in one or more CDRs as long as the functional properties of the reference antibody are maintained. With CDR regions ranging from 5 to almost 20 amino acids, typical embodiments of a modified CDR of an antibody sequences have a sequence identity in the CDR region which is at least 75, 80, 85, 90, 92, 94, 95% to the reference CDR sequence.
Outside the CDR regions the sequence of a variable heavy or light chain may be less restricted while still maintaining the function of the antibody. Thus a variable chain may be at least 75, 80, 85, 90, 92, 95, 97, 98 or 99% identical to a reference sequence of a variable chain while one, two, or all three CDR sequences have one amino acid difference with the corresponding reference CDR sequence or wherein all CDR regions are identical with those of the reference sequence.
A difference at a certain position can be a change into any of the other 19 amino acids or can be a so-called âconservative substitutionâ
It is a well-established principle of protein chemistry that such âconservative amino acid substitutions,â can frequently be made in a protein without altering either the conformation or the function of the protein. Such changes include substituting any of isoleucine (I), valine (V), and leucine (L) for any other of these hydrophobic amino acids; aspartic acid (D) for glutamic acid (E) and vice versa; glutamine (Q) for asparagine (N) and vice versa; and serine (S) for threonine (T) and vice versa. Substituting any of tryptophan (W), tyrosine (Y), and phenylalanine (F) for any other of these aromatic amino acids and vice versa. Other substitutions can also be considered conservative, depending on the environment of the particular amino acid and its role in the three-dimensional structure of the protein. For example, glycine (G) and alanine (A) can frequently be interchangeable, as can alanine and valine (V). Methionine (M), which is relatively hydrophobic, can frequently be interchanged with leucine and isoleucine, and sometimes with valine. Lysine (K) and arginine (R) are frequently interchangeable in locations in which the significant feature of the amino acid residue is its charge and the differing pK's of these two amino acid residues are not significant. âBispecific antibodyâ refers to an antibody based construct that can simultaneously bind to two different antigens. In the context of the present invention this means specific binding to TAFI and specific binding to PAI-1.
âDiabodyâ refers to a specific type of bispecific antibody which comprise a heavy chain variable domain (VH) of one antibody connected to a light-chain variable domain (VL) of another antibody on the same polypeptide chain (VH-VL). By using a linker that is too short to allow pairing between the two domains on the same chain, the domains are forced to pair with the complementary domains of another chain and create two antigen-binding sites. In a diabody antigen-binding sites point in opposite directions.
Typically these are complexes of ScFv constructs. Different configurations are possible. A possible configuration is a complex of two polypeptides, namely:
a fusion protein of the VH region of an anti-TAFI antibody and the VL region of an anti PIA-1 antibody, with
a fusion protein of the VL region of an anti-TAFI antibody and the VH region of an anti-PIA-1 antibody. Other examples are a single peptide chain with two VH and two VL regions, yielding tandem scFv's. Or scFv's with linker peptides that are too short for the two variable regions to fold together (about five amino acids), forcing scFvs to dimerize.
âTargeting domainâ refers to the part of the bispecific antibody that is required to obtain specific antigen binding (antigen binding domain) with one of the antigens.
âFibrinolysisâ refers to the degradation of fibrin within a blood clot.
âThrombolysisâ refers to the degradation of a blood clot by inter alia, breakdown of fibrin threads and other structural elements which form a clot.
TAFI (Thrombin-Activatable Fibrinolysis Inhibitor) is also known as Carboxypeptidase B2 (CPB2), Carboxypeptidase U (CPU) or plasma carboxypeptidase B (pCPB). TAFI is an enzyme that reduces fibrinolysis by removing fibrin C-terminal residues that are important for the binding and activation of plasminogen.
PAI-1 (Plasminogen Activator Inhibitor-1 (PAI-1), is also known as endothelial plasminogen activator inhibitor or serpin E1. PAI- is a serine protease inhibitor that tissue plasminogen activator (tPA) and urokinase (uPA).
Thrombus refers to a clot in the cardiovascular system formed during life from blood constituents. Clots may be occlusive or attached are attached to vessel or heart wall without obstructions. Exemplary types of thrombi are fibrin clots formed by deposits of fibrin and white or pale clots mainly composed of platelets.
âtPAâ (tissue plasminogen activator) refers to the wild type protein, but also covers modified versions known as reteplase, tenecteplase
âThrombosisâ is a condition characterized by the formation of a blood clot inside a blood vessel, and is thought to result from an abnormality in one or more of hypercoagulability, endothelial injury/dysfunction, and hemodynamic changes of stasis and turbulence (together known as Virchow's triad). Thrombosis can lead to vessel blockage at the site of clot formation, or to vessel blockage at a distance from the site of origin (i.e., embolism). In both cases, obstruction of the vessel disrupts the supply of oxygen to the tissues supplied by the vessel, resulting in hypoxia, anoxia, and infarction. Accordingly, many pathological conditions arise from thrombosis, ranging from deep vein thrombosis to pulmonary embolism to arterial thrombosis which cause heart attacks and strokes, and more.
âThrombotic disordersâ as used herein includes but is not limited to deep vein thrombosis (DVT), pulmonary embolism (PE), coronary artery disease (CAD) and acute coronary syndrome (ACS), central retinal artery occlusion (CRAO), age related macular degeneration (AMD) and thrombotic neurological disorders, including stroke, acute ischemic stroke (AIS), middle cerebral artery occlusion (MCAo), acute peripheral arterial occlusion (APAO) and more.
The disorders may also be thrombotic neurological disorders comprising diseases, disorders or conditions which directly or indirectly affects the normal functioning or anatomy of a subject's nervous system, including but not limited to, cerebrovascular insufficiency, cerebral ischemia or cerebral infarction such as stroke, retinal ischemia (diabetic or otherwise), glaucoma, retinal degeneration, multiple sclerosis, ischemic optic neuropathy, reperfusion following acute cerebral ischemia, perinatal hypoxic-ischemic injury, or intracranial haemorrhage of any type (including, but not limited to, epidural, subdural, subarachnoid or intracerebral haemorrhage).
In certain embodiments, the thrombotic disorder is hereditary in origin. In certain embodiments, the thrombotic disorder is acquired. The thrombotic disorder may be acute, chronic and/or recurring. In certain embodiments, the thrombotic disorder is acute, and is at least one of acute ischemic stroke (AIS), middle cerebral artery occlusion (MCAo), thromboembolism, deep vein thrombosis, myocardial infarction (MI), pulmonary embolism, peripheral arterial disease, thrombosis of liver and/or kidneys, or catheter blockage. The thrombotic disorder may be an occlusive syndrome in the cerebral vascular system, for example, causing cerebral infarcts due to stroke or ischemic stroke. In some embodiments, the acute thrombotic disorder is AIS. In certain embodiments, the acute thrombotic disorder is MCAo.
Bispecific antibody derivatives represent the smallest format currently available to achieve bispecificity when starting from two IgG's to allow efficient penetration into the blood clot. The dual specificity confers inhibition of TAFI and PAI-1 at the same time, same localization, and same concentration, which leads to a similar pharmacokinetic profile and biodistribution. In some embodiments, the bispecific antibody derivatives for use in treating thrombotic disorders are based on monoclonal antibodies (MAs). For example, exemplary MAs which target TAFI are MA-RT36A3F5 and MA-TCK26D6 [6, 7] [Hillmayer et al. cited above; Vercauteren (2011) cited above], while exemplary MAs which targets PAI-1 are MA-33H1F7 and MA-MP2D2 [De Brock cited above, Van De Craen cited above]. One exemplary bispecific antibody derivative is DbTCK26D6Ă33H1F7 [Wyseure T et al. (2013) J Thromb Haemost. 11, 2069-2071]. In certain embodiments, the efficacy of bispecific antibody derivatives surpasses that of either MA administered alone.
In some embodiments, the bispecific antibody derivative comprises a first targeting domain that binds to Thrombin Activatable Fibrinolysis Inhibitor (TAFI) and comprises complementary determining regions (CDRs) represented by amino acid sequences that are at least 80% identical to each of CDR1H of SEQ ID NO:1, CDR2H of SEQ ID NO:2, CDR3H of SEQ ID NO:3, CDR1L of SEQ ID NO:4, CDR2L of SEQ ID NO:5, and CDR3L of SEQ ID NO:6; and a second targeting domain that binds to Plasminogen Activator Inhibitor-1 (PAI-1) and comprises complementary determining regions (CDRs) represented by amino acid sequences that are at least 80% identical to each of CDR1H of SEQ ID NO:7, CDR2H of SEQ ID NO:8, CDR3H of SEQ ID NO:9, CDR1L of SEQ ID NO:10, CDR2L of SEQ ID NO:11, and CDR3L of SEQ ID NO:12.
For example, the bispecific antibody derivative may comprise a first targeting domain that binds to Thrombin Activatable Fibrinolysis Inhibitor (TAFI) and comprises a VH region represented by an amino acid sequence that is at least 80% identical to SEQ ID NO:13 and a VL region represented by amino acid sequence that is at least 80% identical to each of SEQ ID NO:14; and a second targeting domain that binds to Plasminogen Activator Inhibitor-1 (PAI-1) and comprises a VH region represented by an amino acid sequence that is at least 80% identical to SEQ ID NO:15 and a VL region represented by amino acid sequence that is at least 80% identical to SEQ ID NO:16.
In certain embodiments, a bispecific antibody derivative comprises a first domain that comprises an amino acid sequence that is at least 80% identical to SEQ ID NO:17; and a second domain that comprises an amino acid sequence that is at least 80% identical to SEQ ID NO:18.
SEQ ID NO:17 comprises at the N terminal side the sequence with SEQ ID NO:13 and at the C terminal side the sequence of SEQ ID NO 16.
SEQ ID NO:18 comprises at the N terminal side the sequence with SEQ ID NO:15 and at the C terminal side the sequence of SEQ ID NO 14.
In some embodiments, the amino acid sequences in the bispecific antibody derivatives are at least 80%, 85%, 90%, 95%, 99% or 100% identical to the amino acid sequences disclosed in SEQ ID NO:1-18. For example, in SEQ ID NO:2, the second amino residue (marked âXâ) may be either Val or Ile (and correspondingly, in SEQ ID NO:13, the fifty first amino acid residue (marked âXâ) may be either Val or Ile. In certain embodiments, the amino acid sequences in the bispecific antibody derivatives have variations in amino acid residues which do not significantly affect the binding properties of the bispecific antibody derivatives to their targets. In some embodiments, variations in amino acid residues may affect the stability of the bispecific antibody derivative.
In some embodiments, the bispecific antibody derivative, for example, as disclosed herein is humanized.
The bispecific antibodies disclosed herein may not be neurotoxic in contrast to tPA, and may be used for reducing lesion size in patients suffering from a brain lesion. Brain lesions may be caused by thrombotic disorders, such as stroke, acute ischemic stroke (AIS), and/or middle cerebral artery occlusion (MCAo). Thrombo-inflammation in patients suffering from a thrombotic disorder may be reduced by the bispecific antibodies.
A dangerous side effect of thrombolytic treatment is increased bleeding risk, for example from intracranial haemorrhage. The bispecific antibodies described herein may be used to reduce or minimize the bleeding and/or bleeding risk, as they did not prolong bleeding in an animal model for bleeding risk, in contrast to tPA. In addition, the relatively short half-life of the bispecific antibodies may minimize side effects such as intracranial haemorrhage in patients treated with the bispecific antibodies.
A further consequence of thrombotic disorders such as stroke, acute ischemic stroke (AIS), and/or middle cerebral artery occlusion (MCAo) are neurological impairments. In some embodiments, the bispecific antibodies disclosed herein may be used for treating neurological impairments, such as motor, sensory, and/or cognitive impairments. Impairments and/or limitations in limb flexion, lateral push, grip, and more may be treated with the bispecific antibodies disclosed herein.
Timing of thrombolytic treatment is critical. In the case of acute thrombotic disorders such as acute myocardial infarction, acute ischemic stroke, or acute massive pulmonary embolism, tPA is typically administered to break down clots within 15 hours of the stroke, for example, as soon as possible after onset of stroke symptoms, at 0-6 hours, or at 4.5 hours. Similarly, in some embodiments, the bispecific antibody derivative as disclosed herein is administered between 0-15 hours after onset of symptoms of the thrombotic disorder. The thrombotic disorder may be an acute thrombotic disorder, such as a stroke, for example, AIS or MCAo. In certain embodiments, the bispecific antibody is administered at 0.5 hours, 1 hour, 1.5 hours, 3 hours, 4 hours, 4.5 hours, or more hours after onset of symptoms of the thrombotic disorder, for example, at 4.5 hours after onset of symptoms. In some embodiments, the bispecific antibody derivative is administered 12 hours after onset of symptoms of the thrombotic disorder. The bispecific antibody derivative may be administered intravenously, or directly into the blood clot.
To date, plasminogen activators such as tPA are the only thrombolytic agents approved by the US FDA, and plasminogen activators such as tPA remain the primary first-line treatment for acute thrombotic disorders. However, some patients do not respond to tPA treatment and further interventions are needed. Accordingly, in some embodiments, the bispecific antibody derivative is administered together with a plasminogen activator, for example, tPA. For example, the bispecific antibody derivative may be administered simultaneously with tPA, as a combination treatment. The bispecific antibody derivative may also be administered after tPA is administered first. In some embodiments, the bispecific antibody derivative is administered 1 hour after administration of tPA. If a patient does not respond to tPA within 1 hour, the bispecific antibody derivative may be administered as a further intervention.
A surprising and unexpected result of the present disclosure is that bispecific antibody derivatives were equally effective in the presence or in the absence of tPA when administered up to 90 minutes post-occlusion. Additionally, bispecific antibody derivatives had a superior thrombolytic effect than tPA. Thus, the bispecific antibody derivatives disclosed herein may be used as thrombolytic agents in place of a plasminogen activator such as tPA. One aspect of the present disclosure relates to the use of the bispecific antibody derivatives disclosed herein for use in treating an acute thrombotic disorder, wherein the bispecific antibody derivative is administered without tPA. In certain embodiments, the acute thrombotic disorder is characterized by the presence of a fibrin-rich blood clot. In some embodiments, the acute thrombotic disorder is characterized by the presence of a platelet-rich blood clot. In some embodiments, the bispecific antibody derivative is administered without tPA during a time period of up to 90 minutes after the onset of the acute thrombotic disorder, for example, 0-90 minutes after onset. Thus, the bispecific antibody derivative may be administered at 0, 10, 15, 20, 30, 40, 45, 50, 60, 70, 80, or 90 minutes after onset of the acute thrombotic disorder.
In some embodiments, when treatment for an acute thrombotic disorder is administered at least 90 minutes of onset of the acute thrombotic disorder, the bispecific antibody derivative is administered together with tPA. The combination of bispecific antibody derivative and tPA may be administered at 90 minutes after onset, or at 2 hours, 2.5 hours, 3 hours, 3.5 hours, 4 hours, 4.5 hours, 5 hours, 5.5 hours, 6 hours, or more after onset. In certain embodiments, administration of the diabody does not lead to deleterious neurotoxic effects. When administered in combination with tPA, the bispecific antibody derivative may potentiate the thrombolytic effect of tPA without potentiating the adverse side effects observed with tPA alone. The bispecific antibody derivatives as disclosed herein may also be combined with antiplatelet treatments such as aspirin, clopidogrel, and dipyridamole; anticoagulant treatments such as heparin, warfarin, and dabigatran; and/or surgical interventions such as revascularization, carotid endartectomy, carotid angioplasty, intra-arterial thrombolysis, and mechanical embolus removal in cerebral ischemia (MERCI).
The diabodies of the present invention can be delivered as one bolus or can be administered over a longer period of time.
The total amount of diabody, administered to a patient can range from 0,1, 0,5, 1 or kg body weight up to 2 or 5 mg/kg body weigth.
Since the administration of an excess of antibody has no detrimental side effects, a total dosis of 10, 20, 40, 80 or 100 mg of diabody may be administered regardless from the body weight of the patient.
Thrombotic disorders are common, particularly in elderly populations and/or in patients who have been previously affected by a thrombotic disorder. Thrombotic disorders may be either acute or chronic. Additional risk factors for stroke such as AIS and/or MCAo include advanced age, alcohol use, atherosclerosis, atrial fibrillation, use of birth control pills, diabetes, poor diet, family history of stroke, fibromuscular dysplasia, high blood pressure, high cholesterol, hypercoagulability (either hereditary or acquired), inflammation, low birth weight, migraine, obesity, patent foramen ovale, physical inactivity, postmenopausal hormone therapy, previous stroke, certain races/ethnicities, sickle cell disease, sleep apnoea, transient ischemic attack, tobacco use, and more. Risk factors for venous thrombosis, such as deep vein thrombosis (DVT) which is a frequent cause of pulmonary embolism, include but are not limited to advanced age, major surgery, orthopaedic surgery, cancer, immobilization, pregnancy, antiphospholipid syndrome, trauma, minor leg injury, previous venous thrombosis, use of oral contraceptives, hormonal replacement therapy, central venous catheters, inflammatory diseases or autoimmune disease, nephrotic syndrome, obesity, infection, HIV, polycythaemia vera, and chemotherapy, as well as hereditary risk factors including but not limited to antithrombin deficiency, protein C deficiency, protein S deficiency, Factor V Leiden, Prothrombin G20210A, dysfibrogenemia, and non-O blood type. Additional risk factors include but are not limited to low levels of protein S, activated protein C resistance, high Factor VIII levels, hyperhomocysteinemia, and/or high levels of fibrinogen, Factor IX, and/or Factor XI.
A further aspect of the present disclosure relates to a bispecific antibody for use in patients at risk for developing an acute or chronic thrombotic disorder, comprising a first targeting domain that binds to Thrombin-Activatable Fibrinolysis Inhibitor (TAFI) and comprises complementary determining regions (CDRs) represented by amino acid sequences that are at least 80% identical to each of CDR1H of SEQ ID NO:1, CDR2H of SEQ ID NO:2, CDR3H of SEQ ID NO:3, CDR1L of SEQ ID NO:4, CDR2L of SEQ ID NO:5, and CDR3L of SEQ ID NO:6; and a second targeting domain that binds to Plasminogen Activator Inhibitor-1 (PAI-1) and comprises complementary determining regions (CDRs) represented by amino acid sequences that are at least 80% identical to each of CDR1H of SEQ ID NO:7, CDR2H of SEQ ID NO:8, CDR3H of SEQ ID NO:9, CDR1L of SEQ ID NO:10, CDR2L of SEQ ID NO:11, and CDR3L of SEQ ID NO:12, wherein the bispecific antibody derivative is administered before onset of the acute or chronic thrombotic disorder. In certain embodiments, the acute or chronic thrombotic disorder is thromboembolism.
For example, the bispecific antibody derivative may comprise a first targeting domain that binds to Thrombin-Activatable Fibrinolysis Inhibitor (TAFI) and comprises a VH region represented by an amino acid sequence that is at least 80% identical to SEQ ID NO:13 and a VL region represented by an amino acid sequence that is at least 80% identical to SEQ ID NO:14; and a second targeting domain that binds to Plasminogen Activator Inhibitor-1 (PAI-1) and comprises a VH region represented by an amino acid sequence that is at least 80% identical to SEQ ID NO:15 and a VL region represented by an amino acid sequence that is at least 80% identical to SEQ ID NO:16.
In certain embodiments, a bispecific antibody derivative comprises a first domain that comprises an amino acid sequence that is at least 80% identical to SEQ ID NO:17; and a second domain that comprises an amino acid sequence that is at least 80% identical to SEQ ID NO:18.
In some embodiments, the amino acid sequences in the bispecific antibody derivatives are at least 80%, 85%, 90%, 95%, 99% or 100% identical to the amino acid sequences disclosed in SEQ ID NO:1-18. For example, in SEQ ID NO:2, the second amino residue (marked âXâ) may be either Val or Ile (and correspondingly, in SEQ ID NO:13, the fifty first amino acid residue (marked âXâ) may be either Val or Ile.
All publications and patents mentioned herein are hereby incorporated by reference in their entirety as if each individual publication or patent was specifically and individually indicated to be incorporated by reference. In case of conflict, the present application, including any definitions herein, will control.
While specific embodiments of the subject invention have been discussed, the above specification is illustrative and not restrictive. Many variations of the invention will become apparent to those skilled in the art upon review of this specification and the claims below. The full scope of the invention should be determined by reference to the claims, along with their full scope of equivalents, and the specification, along with such variations.
Having provided a general disclosure, the following examples help to illustrate the general disclosure. These specific examples are included merely to illustrate certain aspects and embodiments of the disclosure, and they are not intended to be limiting in any respect. Certain general principles described in the examples, however, may be generally applicable to other aspects or embodiments of the disclosure.
In a previous study, scFv-RT36A3F5 was generated, but could not be produced by bacteria and corresponding Db-RT36A3F5Ă33H1F7 was found to be unstable resulting in a diminished effect on clot lysis. Thus, the variable domains of MA-RT36A3F5 were optimized by complementarity determining region (CDR)-grafting onto the stable scaffolds of scFv-4D5 (FIG. 1A) [Jung S. & PlĂŒckthun A. (1997) Protein Eng. 10, 959-966. This article discloses the 4D5 humanised antibody used in the CDR grafting]. Two approaches were performed: (i) structure alignment-based strategy of scFv-RT36A3F5 and of scFv-4D5, generating scFv-RT36A3F5-4D5DM (in collaboration with prof Marc Demaeyer) and (ii) evidence-based strategy, generating scFv-RT36A3F5-4D5 [Ewert S. et al. (2004) Methods. 34, 184-199]. The latter approach was also performed on the stable scaffolds of scFv-T12D11 (an anti_TAFI antibody disclosed in de Develter et al. 2008 J Thromb Haemost. 6, 1884-1889, generating scFv-RT36A3F5-T12D11. Western blot analysis revealed that solely scFv-RT36A3F5-4D5 was properly expressed and secreted (FIG. 1B, lane 1) and therefore, these CDR-grafted variable domains were used in corresponding (sc)Db constructs.
B. Production of Bispecific Antibody-Based Inhibitors from MA-RT36A3F5 and MA-33H1F7
Four bispecific inhibitors were formed out of MA-RT36A3F5 and MA-33H1F7: Db-RT36A3F5Ă33H1F7 (Db), Db-RT36A3F5-4D5Ă33H1F7 (CDR-grafted Db), scDb-33H1F7ĂRT36A3F5 (scDb with an additional flexible linker between the variable domains of MA-RT36A3F5) and scDb-33H1F7ĂRT36A3F5-4D5 (CDR-grafted scDb) (FIG. 2). As a result of CDR-grafting, bacterial and eukaryotic expression of Db and scDb, respectively, were elevated (for CDR-grafted Db approximately 1.5 mg/L culture corresponding to a two-fold increase vs. Db and for CDR-grafted scDb 11±1 mg/L culture medium corresponding to a ten-fold increase vs. scDb).
Inhibitory properties of the parental antibodies were preserved in Db, CDR-grafted Db and CDR-grafted scDb as confirmed by functional assays Inhibitory properties of scDb could not be evaluated due to insufficient production.
Out of all constructs, only CDR-grafted scDb exhibited a similar stability as the control diabody, Db-T12D11Ă33H1F7 (88±13% residual binding activity after three hours at 37° C.; FIG. 3A). With a relative profibrinolytic effect of 0.81±0.23, CDR-grafted scDb was also the most potent construct compared to MA-RT36A3F5 (FIG. 3B). The contribution of the effect of the PAI-1 inhibiting moiety could not be evaluated in the plasma-based assay system due to the low baseline plasma levels of PAI-1.
In conclusion, our efforts to increase the plasma stability of an unstable bispecific antibody-based inhibitor against rat TAFI and PAI-1 resulted in a CDR-grafted scDb, exhibiting a seven-fold increased stability and profibrinolytic effect. This antibody derivative cross-reacts with mouse TAFI and mouse PAI-1, allowing further in vivo evaluation in mice and rats.
Based on the successful generation of stable scFvs with preserved inhibitory capacity of the respective parental antibodies (MA-TCK26D6 and MA-33H1F7), Db-TCK26D6Ă33H1F7 was generated. This diabody contains two polypeptide chains as depicted in FIG. 2 left bottom. The first one is a fusion protein of the VH chain of the anti TAFI antibody and the VL chain of the anti PAI-1 antibody. The second one is a fusion protein of the VL chain of the anti TAFI antibody and the VH chain of the anti PAI-1 antibody.
The production level of Db-TCK26D6Ă33H1F7 was approximately 2 mg/L culture.
Inhibitory properties of the parental antibodies against human and mouse TAFI and PAI-1 were preserved in Db-TCK26D6Ă33H1F7 as confirmed by functional assays. Moreover, Db-TCK26D6Ă33H1F7 remained stable after incubation in human, mouse and rat plasma after 8 hours at 37° C.
To evaluate the profibrinolytic effect due to TAFI and PAI-1 inhibition, Db-TCK26D6Ă33H1F7 was incubated in human whole blood from four individuals and its effect was analysed by thromboelastometry [Wyseure T. et al. (2013) J. Thromb. Haemost. 11, 2069-2071]. The combined addition of both MAs as well as the addition of diabody facilitated fibrinolysis to a very significant degree (p<0.001), whereas the addition of a single MA caused only a modest effect (FIG. 4A).
The effect of Db-TCK26D6Ă33H1F7 was also evaluated in whole blood from mice. Since PAI-1 levels are extremely low in mice (serum levels, mean±SD, n=4, 3.0±0.3 ng/ml for mice vs. 267±114 ng/ml for humans), thromboelastometric analysis in blood from mice is insensitive to PAI-1. To increase PAI-1 levels in mouse blood, we induced experimental endotoxemia through intraperitoneal injection of LPS (0.5 mg/kg) prior to collection of blood for thromboelastometric analysis. The combined addition of both MAs as well as the addition of diabody facilitated fibrinolysis to a significant degree (p<0.05), whereas the addition of a single MA caused no significant effect (FIG. 4B).
Thus, Db-TCK26D6Ă33H1F7 exhibits strong profibrinolytic properties in vitro.
Mice, pre-treated with a dose of MA-TCK26D6 or MA-33H1F7 targeting all circulating antigen, were subjected to thromboembolism by systemic administration of thromboplastin. Fibrin deposition in lungs was only decreased to baseline levels upon administration of a TAFI inhibitor (FIG. 5). Since PAI-1 levels are extremely low in mice, no effect of PAI-1 inhibition was detected.
To evaluate simultaneous inhibition of TAFI and PAI-1 in this model, endotoxemia was induced to upregulate PAI-1 levels in plasma. Fibrin deposition in the lungs was reduced through TAFI inhibition with MA-TCK26D6 (5 mg/kg) or through PAI-1 inhibition with MA-33H1F7 (10 mg/kg). However, this reduction did not reach a maximal degree. After administering a mixture of MA-TCK26D6 (5 mg/kg) and MA-33H1F7 (10 mg/kg), fibrin levels in lungs returned to baseline (FIG. 6A). This maximal effect disappeared when lowering the dosages of MA to 1 mg/kg (FIG. 6B). Upon treatment with diabody (Db-TCK26D6Ă33H1F7 at 0.8 mg/kg, i.e. a dose which targets the same amount of TAFI and PAI-1 as achieved with the combined MA each at 1 mg/kg), a maximal effect of fibrin clearance from lungs was obtained.
As demonstrated, simultaneous inhibition of TAFI and PAI-1 results in an additive effect on fibrin removal in a thromboembolism model which is most effective through Db-TCK26D6Ă33H1F7.
i. Monofilament-Mediated MCAo
Transient occlusion was accomplished by advancing a monofilament into the MCA. This model was used to assess the effect of TAFI and/or PAI-1 inhibition on cerebral ischemia/reperfusion injury. This model typically yields large lesion volumes in untreated mice which have measurable neurological/motor defects. Paramount in preclinical evaluation of stroke is to assess neurological parameters in addition to lesion size. Interestingly, in this model, tPA has a well-described deleterious effect through aggravating neuronal damage after focal cerebral ischemia [Wang Y F et al. (1998) Nat Med. 4, 228-231]. Treatment with either MA-TCK26D6 at 25 mg/kg or MA-33H1F7 at 6 mg/kg caused reduced brain lesions (FIG. 7A, 7D) and concomitant neurological and motor recovery 24 hours post occlusion (FIG. 7B-C, 7E-F). In addition, the brains of treated mice contained less fibrin(ogen) in the ipsilateral side compared to those of control mice (FIG. 7G). The control IgG in control IgG was MA-T30E5 in FIG. 7 and MA-NB27B3 in FIG. 8.Treatment with either one of the parental antibody at 1 mg/kg did not alter lesion sizes
or neurological/motor scores 24 hours post occlusion (FIG. 8A-C). However, the combined administration of the antibodies substantially reduced brain lesions 1.9-fold (FIG. 8A). Moreover, the diabody at a corresponding dose caused a similar reduction in lesion size (2.3-fold) however concomitantly improved neurological and motor scores (FIG. 8A-C). Lesion sizes were 76±11 mm3 with vehicle, 81±11 mm3 with control IgG, 43±8 mm3 with combination of MA and 35±8 mm3 with diabody. In addition, western blot analysis revealed that the combination of parental antibodies or diabody effectively reduced massive fibrin deposition induced by reperfusion injury by at least 2-fold (FIG. 8D; p<0.05; n=3-4 mice/group).
ii. Thrombin-Mediated MCAo
A model of thromboembolic stroke by thrombin injection was used in which clots are rich in fibrin and thus susceptible to be thrombolysed by tPA. The efficacy of the diabody was compared to that of tPA, the current thrombolytic agent. In order to mimic the clinical procedure of thrombolysis, the administration of tPA was performed by an initial bolus of 10% volume followed by 90% infusion during 40 min because of the short half-life of circulating tPA (·5 min) [Chandler W L et al. (1997) Circulation. 96, 761-768]. 24 h post occlusion, complete recanalization of the arterial lumen occurred in all groups including the vehicle group (median angiographic score=2, FIG. 9B). At the same time point, Speckle contrast imaging showed a 40% reduction in tissue perfusion in the MCA territory distal to the occlusion in the vehicle group (FIG. 9C). Interestingly, brain perfusion was virtually restored by the combination of diabody and tPA (FIG. 9C; p<0.05 vs. vehicle; n=6-8 mice/group), while diabody or tPA separately did not significantly increase perfusion. Lesion volume was reduced by administration of tPA, however this reduction was not statistically significant (37±13 mm3 vs. 26±12 mm3; FIGS. 9A; p=0.203; n=6-8 mice/group). In contrast, early diabody administration (0.8 mg/kg) at 20 minutes post-occlusion, regardless of the co-administration of tPA, substantially reduced lesion volume at 24 h (15±4 mm3 for diabody and 15±8 mm3 for diabody+tPA; p<0.01 and p<0.05 vs. vehicle respectively; n=6-8 mice/group FIG. 9A). [FIGS. 9A and 9D show the same conditions]. Treatments were also delayed to a clinically more relevant time point, e.g. 90 min post occlusion (intermediate time point) [Hacke W. et al. (2004) Lancet 363, 768-774], complete recanalization was also observed at 24 h post occlusion in all treatment groups (median angiographic score=2). Intermediately delayed administration of diabody nor infusion of tPA had any beneficial effect on the lesion volume (25±3 mm3 (vehicle) vs. 24±3 mm3 (tPA) vs. 21±4 mm3 (Db); FIG. 9E; n=9-10 mice/group). However, at the same treatment time point diabody administration prior to tPA infusion resulted in a significantly reduced lesion volume (15±2 mm3 (Db+tPA); p<0.05 vs. vehicle; n=10 mice/group; FIG. 9E).
None of the treatments had an effect on lesion sizes in this model when administered at 240 min post occlusion (late time point, FIG. 9F).
At 90 min post stroke onset and onwards, tPA treatment does not always result in a beneficial outcome, presumably because of the increased stability of the clot (i.e. clot retraction) resulting in thrombolytic resistance, the neurotoxic effect of tPA to the progressively damaged brain and/or the increased risk for haemorrhagic transformation. In the present example, neither tPA treatment nor diabody treatment at 90 min post occlusion reduced the lesion volumes. However, the combined treatment of the diabody and tPA resulted in a significantly decreased lesion volume, underscoring the potential clinical benefit of adding the diabody to current thrombolytic treatment. At a later treatment time point of 4 h post occlusion, a tendency towards increased lesion volumes after tPA treatment, alone or with diabody, was observed (FIG. 9F). In correspondence to the in vitro neurotoxicity data (FIG. 14), the diabody also had no deleterious effect in vivo.
iii. FeCl3-Mediated MCAo
Platelet-rich clots are more resistant to treatment with tPA [Kim E Y et al. (2006) Neurology 67, 1846-1848]. Therefore, a FeCl3-induced MCAo model was used in which clots are rich in platelets and thus mimic this clinically relevant issue. As expected, tPA was not effective in (i) increasing CBF 1 h post occlusion (laser Doppler tracings; FIG. 10A), (ii) ameliorating the angiographic score 24 h post occlusion (FIG. 10C), (iii) reducing lesion volume 24 h post occlusion (FIG. 10C) or (iv) increasing brain reperfusion 24 h post occlusion (Speckle contrast imaging, FIG. 10D). The diabody administered at 1.6 mg/kg significantly increased CBF 1 h (FIG. 10A; p<0.05 vs. vehicle; n=8-15 mice/group) and the angiographic score 24 h post occlusion (FIG. 10C; p<0.05 vs. vehicle; n=8-15 mice/group), however no amelioration of brain perfusion or lesion volume was observed 24 h post occlusion (FIG. 10B, D). In contrast, at 3.6 mg/kg the diabody significantly increased CBF at 1 h post occlusion (FIG. 10A; p<0.05 vs. vehicle; n-8-15 mice/group) which resulted in a significantly increased angiographic score (FIG. 10C; p<0.05; n=8-15 mice/group), reduced lesion volume (FIG. 10B; p<0.05 vs. vehicle; n=8-15 mice/group), and increased brain perfusion (FIG. 10D; p<0.05 vs. vehicle; n=8-14 mice/group) at 24 h.
In conclusion, the strong fibrinolytic enhancer designated as Db-TCK26D6Ă33H1F7 showed a robust in vivo performance in a set of mouse models of stroke.
scDbs were expressed in vivo as they can be efficiently produced in eukaryotic cells. The following constructs were generated against TAFI and PAI-1 and cloned into pcDNA3.1.: scDb-33H1F7ĂRT36A3F5, scDb-TCK26D6Ă33H1F7 and scDb-TCK26D6ĂMP2D2. In vitro expression levels in HEK293T cells ranged from 0.6-1.1 ÎŒg/ml (FIG. 11A). scDb-33H1F7ĂRT36A3F5 was further optimized by CDR-grafting into scDb-33H1F7ĂRT36A3F5-4D5. which resulted in a ten-fold higher expression and seven-fold increased plasma stability (after three hours of incubation at 37° C.). In mice, peak plasma levels after gene transfer were 584±79 ng/ml (n=6) and 188±19 ng/ml (n=4) for scDb-33H1F7ĂRT36A3F5-4D5 at day 3 and scDb-TCK26D6Ă33H1F7 at day 6, respectively, however no expression of scDb-TCK26D6ĂMP2D2 could be detected (FIG. 11C). As the obtained plasma levels were too low for pharmacological evaluation, pharmacokinetics of the scDbs were altered to prolong the circulating half-life. To this end, an affinity-engineered albumin binding domain [Jonsson A et al. (2008) Protein Eng Des Sel. 21, 515-527] was fused to the C-terminus of scDb-TCK26D6Ă33H1F7 and scDb-TCK26D6ĂMP2D2, which were the only constructs that remained stable during incubation in plasma at 37° C. up to three days (FIG. 11B). The albumin binding constructs were designated as scDb-TCK26D6Ă33H1F7ĂABDH and scDb-TCK26D6ĂMP2D2ĂABDH. Unfortunately, a two- to four-fold reduction in expression was observed in vitro for these constructs (FIG. 11A). However, in vivo expression levels were two-fold increased at day 9 (287±28 ng/ml, n=5) for the albumin binding variant of scDb-TCK26D6Ă33H1F7, whereas expression of the albumin binding variant of scDb-TCK26D6ĂMP2D2 was not detectable (FIG. 11C).
Additional tail bleeding experiments were performed to compare the effects of an IV injection of tPA at two different doses: the dose equivalent to that used in clinical practice for humans (1 mg/kg) and to that typically used in mice (10 mg/kg). Diabody (Db-TCK26D6Ă33H1F7) was injected at 0.8 mg/kg and 3.6 mg/kg. IV administration of diabody up to 3.6 mg/kg did not alter tail bleeding time or accumulative haemoglobin loss after 60 min tail incubation, whereas both doses of tPA prolonged bleeding time and increased haemoglobin loss (FIG. 12A and FIG. 12B; n=9-16 mice/group). Co-administration of diabody (0.8 mg/kg) and tPA (10 mg/kg), the treatment regimen tested in the thrombin-mediated MCAo model, did not further increase the tail bleeding time nor haemoglobin loss compared to tPA administration alone.
Alternatively, no cerebral haemorrhages were observed in either mechanical or thrombotic MCAo stroke models after any treatment.
The circulating half-life of diabody after IV administration in mice was 121 min (FIG. 13) which allows bolus injection as acute treatment.
Production of Diabodies (Db) and Single-Chain Diabodies (scDb)
Antibody derivatives were produced by cloning the variable domains (VH, VL) from a hybridoma cell line producing monoclonal antibody. DNA fragments containing Db or scDb were designed for bacterial production (via periplasmic secretion) and eukaryotic production (via extracellular secretion), respectively. The DNA fragments were synthetically produced and were further cloned into pSKID2 for production of Db in E. coli RV308 and into pcDNA3.1. for production of scDb using HEK293T cells. The His6-tagged antibody derivatives were purified on a Ni++-column and prior to in vivo evaluation endotoxins were removed by anion-exchange chromatography.
Quantification of (sc)Db
(sc)Dbs were quantified by an ELISA based on the simultaneous binding towards PAI-1 and TAFI. Briefly, a microtiter plate coated with mouse PAI-1 was used to bind (sc)Db and detection was performed via subsequent incubation with mouse TAFI, followed by addition of MA-TCK32G12-HRP against TAFI, which was subsequently developed using o-phenylenediamine as chromogenic substrate.
The ability of antibody derivatives to inhibit TAFI was quantified by using a chromogenic assay to measure residual TAFIa activity and was compared to the inhibitory properties of the parental monoclonal antibody (MA). TAFI was incubated with MA or sc(Db), at concentrations ranging from 0.06- to 8-fold molar ratio over TAFI, before or after activation by thrombin/thrombomodulin or plasmin, depending on the working mechanism of the MA. Residual TAFIa activity was determined using Hippuryl-Arg as a substrate, followed by a colorimetric reaction.
The ability of antibody derivatives to inhibit active PAI-1 was quantified by using a plasminogen-coupled chromogenic method and was compared to the inhibitory properties of the parental MA. PAI-1 was pre-incubated (2 hours, room temperature) with MA or (sc)Db at concentrations ranging from 0.06- to 32-fold molar ratio over PAI-1. After a consecutive incubation with tPA (15âČ 37° C.), plasminogen was added and the extent of conversion to plasmin, was quantified by a chromogenic substrate.
Pooled rat citrated plasma was pre-incubated (10âČ, 37° C.) with MA or sc(Db), followed by the addition of CaCl2 and t-PA. Clot lysis was then monitored over time through measurement of the turbidity (OD405 nm) by a microtiter plate reader. The degree of fibrinolysis was expressed as the area under the curve over a time frame of 180 min. The retrieved data were normalized to the value obtained in the presence of MA (at a concentration corresponding to the equivalent number of binding sites to the respective antigens as that of sc(Db)).
Citrated whole blood from four healthy donors or from mice (healthy or endotoxemic by intraperitoneal injection of LPS (0.5 mg/kg) six hours prior to the start of the experiment) was pre-incubated with MA or Db (at concentrations yielding an equivalent number of binding sites to the respective antigens). Clotting and subsequent fibrinolysis was initiated by thromboplastin, CaCl2 and tPA. For human blood, fibrinolysis was determined by the decrease in amplitude at 45 minutes after initial clotting relative to the maximal amplitude (L (%)=[(AmaxâA45)/Amax]*100). In each run, baseline lysis (Lwo) was determined using the same blood sample without MA or Db (Lwo never exceeded 12%). Specific inhibitor-enhanced lysis was then determined as ÎL (%)=LinhibitorâLwo. For mouse blood, specific inhibitor-enhanced fibrinolysis was determined as the difference in area under the curve (AUC from clotting time to clotting time+120 minutes) between saline (AUCwo) and treated condition (AUCinhibitor) relative to the AUCwo (relative ÎAUC=[(AUCwoâAUCinhibitor)/AUCwo]*100.
MA, diabody or saline (0.9% NaCl) was injected intravenously (IV) in overnight fasted non-anesthetized SWISS mice (healthy or endotoxemic by intraperitoneal injection of LPS (0.5 mg/kg) three hours prior to the start of the experiment). Five minutes later, thromboembolism was induced by IV injection of thromboplastin. Mice were anaesthetized by pentobarbital (60 mg/kg intraperitoneally) and 15 minutes post thrombotic challenge lungs were perfused with 10 IU/ml heparin. Then the lungs were isolated and homogenized. Washed homogenate of (left) lung was incubated with 2 ÎŒM microplasmin in order to convert fibrin into solubilized fibrin degradation products for subsequent quantification of fibrin degradation products using a cross-reacting ELISA towards mouse fibrinogen. Fibrin content in lungs was expressed as fibrinogen equivalents (ÎŒg/ml).
Anesthetized SWISS mice (by inhalation of 2% isoflurane/oxygen mixture) were placed on a stereotaxic device to expose the right middle cerebral artery (MCA) by craniectomy. In situ occlusion, as confirmed by Laser Doppler flowmetry, was performed by micro-injection of murine alpha-thrombin into the MCA [Orset C et al. (2007) Stroke. 38, 2771-2778] or by application of a filter paper saturated with 20% FeCl3 [Karatas H et al. (2011) J Cereb Blood Flow Metab. 231, 1452-1460]. Db or PBS (vehicle) was injected IV 15 minutes post clot onset. Five minutes later, tPA (10 mg/kg) or saline was administered via a tail vein catheter (10% as bolus and 90% infused over 40 minutes). 24 hours after initial occlusion, cerebral blood flow was mapped on the ipsi- and contralateral side by exposing the skull to a Speckle contrast imager (Moor FLPI-2, Moor instruments).Reduction of blood flow was expressed relative to the contralateral side. Brain lesion volume was determined by T2-weighted MRI, angiographic score in the MCA (0=occlusion, 1=partial recanalization and 2=complete recanalization) was determined by MR angiography and T2*-weighted MRI was used to exclude the occurrence of haemorrhages.
To assess different treatment time points in the thrombin-mediated model, diabody (Db) or vehicle (PBS) was injected IV via a tail vein catheter at certain time points post occlusion: an early (15 min), intermediate (90 min) or late (240 min) time point. Five min after diabody or vehicle administration, tPA (10 mg/kg) or saline was administered IV (10% as bolus and 90% infused over 40 min) Brain lesion volume was determined by T2-weighted MRI and angiographic score in the MCA (0=occlusion, 1=partial recanalization and 2=complete recanalization) was determined by MR angiography and T2*-weighted MRI was used to exclude the occurrence of haemorrhages.
After a midline skin incision in the neck of anesthetized C57BL/6 mice (by inhalation of 2% isoflurane/oxygen mixture), the proximal common carotid artery and the external carotid artery were ligated. The origin of the right MCA was occluded by inserting a standardized silicon rubber-coated 6.0 nylon monofilament via the right internal carotid artery. After 60 minutes of in situ occlusion, the intraluminal monofilament was withdrawn and 5 minutes after reperfusion, MA or PBS was injected IV. 24 hours after initial occlusion, mice were subjected to functional tests: the modified Bederson test and the grip test to assess neurological and motoric function, respectively. Mice were then euthanized and brains were harvested to determine lesion volumes (by 2,3,5-triphenyl-tetrazolium chloride staining).
24 hours post occlusion (MCAo model), mice were subjected to the modified Bederson test and the grip test to assess global neurological function and motoric function, respectively. This modified Bederson test uses the following scoring system: 0, no deficit; 1, forelimb flexion; 2, decreased resistance to lateral push; 3, unidirectional circling; 4, longitudinal spinning; 5, no movement.
The grip test was performed in which a mouse was placed on a wooden bar (3 mm diameter, 40 cm long) attached to 2 vertical supports 40 cm above a flat surface. When placing the mouse on the bar midway between the supports, the experiment was rated according to the following system: 0, falls off; 1, hangs onto bar by 2 forepaws; 2, same as for 1, but attempts to climb onto bar; 3, hangs onto bar by 2 forepaws plus 1 or both hind paws; 4, hangs onto bar by all 4 paws plus tail wrapped around bar; 5, escape (mouse able to reach one of the supports). Assessment was performed blinded.
24 hours post occlusion (MCAo model), mice were euthanized. Brains were quickly harvested and cut into 2-mm-thick coronal sections using a mouse brain slice matrix. The presence of cerebral haemorrhages was assessed visually. The slices were stained with 2% 2,3,5-triphenyl-tetrazolium chloride (Sigma-Aldrich, St. Louis, Mo.) in PBS to distinguish healthy tissue from unstained infarctions. Stained slices were photographed with a digital Nikon D70 camera, and infarct areas (white) were measured blindly using Image J software (National Institutes of Health, Bethesda, Md.).
Ischemic tissue including the cortex and basal ganglia was dissected from formalin-fixed TTC-stained brain slices and homogenized in RIPA buffer (25 mmol/L Tris pH 7.4, 150 mmol/L NaCl, 1% NP40) containing 0.1% SDS and 0.25% protease inhibitor cocktail (Roche) as previously described with slight modifications. 39 Samples were homogenized using a CLI12 mixer followed by incubation at 4° C. for 20 min and subsequent sonication on ice. Then tissue lysates were centrifuged at 15,000Ăg for 20 min at 4° C. and supernatants were subjected to Western blot analysis as follows. 30 ÎŒg of total protein was loaded, electrophoresed on a SDS-polyacrylamide gel and transferred to a nitrocellulose membrane. After blocking for 1 h with blocking buffer (5% nonfat dry milk, 50 mmol/L Tris-HCl pH 7.5, 150 mmol/L NaCl, 0.05% Tween-20) membranes were incubated with either anti-Fibrinogen polyclonal antibody (AP00766PU-N, Acris; diluted 1:500) or anti-Actin MA (MAB1501, Millipore; diluted 1:500) at 4° C. overnight or for 1 hour, respectively. Then membranes were washed followed by incubation with HRP-conjugated goat anti-rabbit IgG (Jackson ImmunoResearch; diluted 1:14000) (fibrinogen) or goat anti-mouse IgG (Dako; diluted 1:2000) (actin) for 60 min at room temperature. Blots were developed using SuperSignal West Pico Chemiluminescent Substrate (Thermo Scientific) and signal was detected with the LAS-4000 mini imager (GE Healthcare).
Mouse tail vein bleeding times were determined with a tail-clipping assay, as described previously. Mice were administered with PBS, diabody, tPA as a single administration or diabody 5 min prior to tPA as a co-administration via proximal tail vein injection. Five min post injection, a distal 3 mm segment of the tail was clipped and the amputated tail was immersed immediately in 0.9% isotonic saline at 37° C. Bleeding time was monitored until initial cessation of bleeding (i.e. no rebleeding within 30 s). Experiments were conducted blinded to treatments. Accumulative haemoglobin loss was determined over a period of 60 min after tail-clipping. Subsequent to centrifugation (10 min at 2000Ăg), blood cells were resuspended in 1 mL isotonic saline, and the haemoglobin content was measured on a Cell-Dyn 3500R counter (Abbott, Diegem, Belgium).
Db-TCK26D6Ă33H1F7 (0.8 mg/kg) was administered IV via tail vein injection in mice (n=6). Prior to the experiment, blood was withdrawn on 0.38% trisodium citrate (=pre-sample). Post injection, blood was withdrawn on 0.38% trisodium citrate at several time points: 5 min, 45 min, 3 hours, 6 hours and 24 hours. Diabody concentrations in corresponding plasma samples were determined by an ELISA based on the simultaneous binding of the diabody towards PAI-1 and TAFI. Wells of polystyrene microtiter plates were incubated with 200 ÎŒl recombinant mouse PAI-1 in PBS (pH 7.4; 4 ÎŒg/ml) for 72 hours at 4° C., emptied and treated for two hours with PBS supplemented with 1% (m/v) bovine serum albumin. After washing, serial two-fold dilutions (180 ÎŒl) of plasma samples were added to the wells and incubated overnight at 4° C. Then, the wells were washed and incubated with 170 ÎŒl mouse TAFI (0.1 ΌΌg/ml) for 2 hours at room temperature. Subsequently, plates were washed and 160 ÎŒl HRP-conjugated MA-TCK32G12 (directed against TAFI) was added to the wells followed by incubation for 2 hours at room temperature. All washing steps were performed with PBS containing Tween 80 (0.002%) and dilutions were made in PBS containing Tween 80 (0.002%) and bovine serum albumin (0.1% m/v). The ELISA was developed using 150 ÎŒl of 0.1 mol/L citrate-0.2 mol/L sodium phosphate buffer, pH 5.0, containing 300 ÎŒg/mL o-phenylenediamine and 0.01% hydrogen peroxide. After 30 min at room temperature the peroxidase reaction was stopped with 50 ÎŒl 4 mol/L H2S04. The absorbance was measured at 492 nm. Db-TCK26D6Ă33H1F7 was used as calibrator.
Anesthetized SWISS mice (by inhalation of 2% isoflurane/oxygen mixture) were pre-bled. Both quadriceps muscles received an injection of hyaluronidase three hours prior to injection of plasmid DNA (pcDNA3.1. containing scDb), followed by electroporation. Mice were bled via retro-orbital puncture to prepare citrated plasma in order to determine expression levels (cfr. 3.2) up to 15 days post DNA injection.
Neuronal cultures were prepared from Swiss mouse embryos (embryonic day 14). Cortices were dissected and dissociated in DMEM, and plated on 24-well plates coated with poly-D-lysine (0.1 mg/ml) and laminin (0.02 mg/ml). Cells were cultured in DMEM supplemented with 5% foetal bovine serum, 5% horse serum (both from Invitrogen, Cergy Pontoise, France) and 2 mM glutamine. Cultures were maintained at 37° C. in a humidified 5% CO2 atmosphere. To inhibit glial proliferation, cytosine ÎČ-D-arabinoside (10 ÎŒM) was added after 3 days in vitro (DIV) to the cortical cultures.
Excitotoxicity was induced at 12-13 DIV by exposure to NMDA (10 ÎŒM) in serum-free DMEM supplemented with 10 ÎŒM of glycine for 24 hours. NMDA was applied alone or together with rtPA (20 ÎŒg/ml) and/or diabody (5 ÎŒg/ml). As a control, the diabody was added to the neuronal culture at 12-13 DIV at several concentrations (0.5 ÎŒg/ml-50 ÎŒg/ml) in the absence of NMDA. After 24 hours, neuronal death was quantified by measurement of the activity of lactate dehydrogenase (LDH) released from damaged cells into the bathing medium (Roche Diagnostics, Mannheim, Germany). The LDH level corresponding to the maximal neuronal death (full kill, FK) was determined in sister cultures exposed to 500 ÎŒM NMDA. Background LDH levels were determined in sister cultures subjected to control washes. Experimental values were measured after subtracting LDHmin and then normalized to LDHmax-LDHmin to express the results in percentage of neuronal death.
All quantitative data are presented as mean and standard error of mean (SEM). Circulating half-life of the diabody was retrieved after nonlinear fitting of plasma levels plotted against time (Graphpad Prism Version 5, GraphPad Software, Inc., San Diego, Calif., USA). Statistical analysis was performed with GraphPad Prism Version 5 (GraphPad Software). Curves from thromboelastometry (retrieved from the Export tool) were integrated with GraphPad Prism 5. A chi-square test was performed to compare angiographic scores from different treatment groups. Outliers were excluded by performing the Grubb's test. Prior to statistical analysis, a D'Agostino and Pearson normality test was used to check data distribution. One-way ANOVA with Bonferroni's multiple comparison test was used for statistical comparison of lesion volumes and speckle contrast imaging data after FeCl3-induced MCAo and an unpaired students t-test was used for statistical comparison of lesion volumes after mechanical tMCAo. Kruskal-Wallis ANOVA with Dunn's multiple comparison test was used for statistical comparison of: (i)) thromboelastometric parameters for lysis, Î L and relative Î AUC, (ii) lung fibrinogen equivalents in the venous thromboembolism model; (iii) lesion volumes and speckle contrast imaging data in the IIa-induced MCAo model; (iv) laser Doppler data in the FeCl3-induced MCAo model and (v) tail bleeding times and haemoglobin contents. A Mann-Whitney test was performed for statistical analysis of neurological/motor data, fibrinogen levels after mechanical tMCAo and in vitro neurotoxicity data. P-values less than 0.05 were considered significant.
Underlined text: CDR sequences
N terminal Met Ala residues in SEQ ID 17 and 18 are from the PelB signal peptide
Bold text: synthetic linkers and tags
| SEQâIDâNO | Description | Sequence |
| SEQâIDâNO:â1 | VH | DNNMD |
| TCK26D6 | ||
| CDR1 | ||
| SEQâIDâNO:â2 | VH | SXYSNNGGTIYNQKFKGâ(whereâXâmayâbeâVâorâI) |
| TCK26D6 | ||
| CDR2 | ||
| SEQâIDâNO:â3 | VH | EMSDGPYWFFDV |
| TCK26D6 | ||
| CDR3 | ||
| SEQâIDâNO:â4 | VL | RASENIFRNLV |
| TCK26D6 | ||
| CDR1 | ||
| SEQâIDâNO:â5 | VL | SATNLVD |
| TCK26D6 | ||
| CDR2 | ||
| SEQâIDâNO:â6 | VL | QHFWGTPRT |
| TCK26D6 | ||
| CDR3 | ||
| SEQâIDâNO:â7 | VHâ33H1F7 | DTYIH |
| CDR1 | ||
| SEQâIDâNO:â8 | VHâ33H1F7 | RIDPANGNTKYDSKFQD |
| CDR2 | ||
| SEQâIDâNO:â9 | VHâ33H1F7 | GDYDYVYFDY |
| CDR3 | ||
| SEQâIDâNO:â10 | VLâ33H1F7 | RASQDISNFLD |
| CDR1 | ||
| SEQâIDâNO:â11 | VLâ33H1F7 | YTSRLHS |
| CDR2 | ||
| SEQâIDâNO:â12 | VLâ33H1F7 | QQGNTFPPT |
| CDR3 | ||
| SEQâIDâNO:â13 | VH | QVQLQQSGPELVKPGASVKISCKASGYTFTDNNM |
| TCK26D6 | DWAKQSHGKSLEWIGSXYSNNGGTIYNQKFKGK | |
| ATLNVDTSSSTAYMELRSLTSEDTAVYYCAREMS | ||
| DGPYWFFDVWGTGTTVTVSGâ(whereâXâmayâbeâVâorâI) | ||
| SEQâIDâNO:â14 | VL | DIQMTQSPASLSVSVGETVTITCRASENIFRNLVW |
| TCK26D6 | YQQKQGKSPQLLVYSATNLVDGVPSRFSGSGSGT | |
| QYSLKINSLQSEDFGSYYCQHFWGTPRTFGGGTK | ||
| LEIKR | ||
| SEQâIDâNO:â15 | VHâ33H1F7 | QVQLQQSGAEVVKPGASVKLACTASGFNIKDTYI |
| HWVKQGPEQGLEWIGRIDPANGNTKYDSKFQDK | ||
| ATITADTSSNTAYLHLSSLTSEDTAVYYCVRGDY | ||
| DYVYFDYWGQGTTVTVSS | ||
| SEQâIDâNO:16 | VLâ33H1F7 | DIQMTQSPSSLSASLGDRVTISCRASQDISNFLDW |
| YQQKPDGTVKLLIYYTSRLHSGVPSRFSGSGSGTD | ||
| YSLTISKLEQEDIATYFCQQGNTFPPTFGGGTKLEI | ||
| KR | ||
| SEQâID | Polypeptideâ1 | MAQVQLQQSGPELVKPGASVKISCKASGYTFTDN |
| NO:â17 | NMDWAKQSHGKSLEWIGSIYSNNGGTIYNQKFK | |
| GKATLNVDTSSSTAYMELRSLTSEDTAVYYCARE | ||
| MSDGPYWFFDVWGTGTTVTVSGAKTTPKLGGDI | ||
| QMTQSPSSLSASLGDRVTISCRASQDISNFLDWYQ | ||
| QKPDGTVKLLIYYTSRLHSGVPSRFSGSGSGTDYS | ||
| LTISKLEQEDIATYFCQQGNTFPPTFGGGTKLEIKR | ||
| ADAAAAGSEQKLISEEDLNSHHHHHH | ||
| SEQâID | Polypeptideâ2 | MAQVQLQQSGAEVVKPGASVKLACTASGFNIKD |
| NO:â18 | TYIHWVKQGPEQGLEWIGRIDPANGNTKYDSKFQ | |
| DKATITADTSSNTAYLHLSSLTSEDTAVYYCVRG | ||
| DYDYVYFDYWGQGTTVTVSSAKTTPKLGGDIQ | ||
| MTQSPASLSVSVGETVTITCRASENIFRNLVWYQQ | ||
| KQGKSPQLLVYSATNLVDGVPSRFSGSGSGTQYS | ||
| LKINSLQSEDFGSYYCQHFWGTPRTFGGGTKLEIK | ||
| RADTAPTGSEQKLISEEDLNSHHHHHH | ||
1-19. (canceled)
20. A method of treating or preventing an acute thrombotic disorder in a patient, comprising the step of administering a bispecific antibody against TAFI and PAI-1, wherein said antibody comprises
a. a first targeting domain that specifically binds to Thrombin Activatable Fibrinolysis Inhibitor (TAFI) and comprises complementary determining regions (CDRs) represented by the amino acid sequences SEQ ID NO:1 of CDR1H, SEQ ID NO:2 of CDR2H, SEQ ID NO:3 of CDR3H, SEQ ID NO:4 of CDR1L, SEQ ID NO:5 of CDR2L, and SEQ ID NO:6 of CDR3L, and
b. a second targeting domain that specifically binds to Plasminogen Activator Inhibitor-1 (PAI-1) and comprises complementary determining regions (CDRs) represented by SEQ ID NO:7 of CDR1H, SEQ ID NO:8 of CDR2H, SEQ ID NO:9 of CDR3H, SEQ ID NO:10 of CDR1L, SEQ ID NO:11 of CDR2L and SEQ ID NO:12 of CDR3L.
21. The method according to claim 20, wherein
a. said first targeting domain that binds to Thrombin Activatable Fibrinolysis Inhibitor (TAFI) comprises a VH region represented by an amino acid sequence that is at least 80% identical to SEQ ID NO:13 and a VL region represented by an amino acid sequence that is at least 80% identical to SEQ ID NO:14 and comprises complementary determining regions (CDRs) represented by the amino acid sequences SEQ ID NO:1 of CDR1H, SEQ ID NO:2 of CDR2H, SEQ ID NO:3 of CDR3H, SEQ ID NO:4 of CDR1L, SEQ ID NO:5 of CDR2L, and SEQ ID NO:6 of CDR3L; and
b. said second targeting domain that binds to Plasminogen Activator Inhibitor-1 (PAI-1) and comprises a VH region represented by an amino acid sequence that is at least 80% identical to SEQ ID NO:15 and a VL region represented by an amino acid sequence that is at least 80% identical to SEQ ID NO:16, and comprises complementary determining regions (CDRs) represented by SEQ ID NO:7 of CDR1H, SEQ ID NO:8 of CDR2H, SEQ ID NO:9 of CDR3H, SEQ ID NO:10 of CDR1L, SEQ ID NO:11 of CDR2L and SEQ ID NO:12 of CDR3L.
22. The method according to claim 20,
wherein said first targeting domain that binds to Thrombin Activatable Fibrinolysis Inhibitor (TAFI) comprises a VH region represented by an amino acid sequence that is at least 90% identical to SEQ ID NO:13 and comprises a VL region represented by an amino acid sequence that is at least 90% identical to SEQ ID NO:14, and
wherein said second targeting domain that binds to Plasminogen Activator Inhibitor-1 (PAI-1) comprises a VH region represented by an amino acid sequence that is at least 90% identical to SEQ ID NO:15 and comprises a VL region represented by an amino acid sequence that is at least 90% identical to SEQ ID NO:16.
23. The method according to claim 20,
wherein said first targeting domain that binds to Thrombin Activatable Fibrinolysis Inhibitor (TAFI) comprises a VH region represented by an amino acid sequence that is at least 95% identical to SEQ ID NO:13 and comprises a VL region represented by an amino acid sequence that is at least 95% identical to SEQ ID NO:14, and
wherein said second targeting domain that binds to Plasminogen Activator Inhibitor-1 (PAI-1) comprises a VH region represented by an amino acid sequence that is at least 95% identical to SEQ ID NO:15 and comprises a VL region represented by an amino acid sequence that is at least 95% identical to SEQ ID NO:16.
24. The method according to claim 20,
wherein said first targeting domain that binds to Thrombin Activatable Fibrinolysis Inhibitor (TAFI) comprises a VH region represented by an amino acid sequence that is at least 98% identical to SEQ ID NO:13 and comprises a VL region represented by an amino acid sequence that is at least 98% identical to SEQ ID NO:14, and
wherein said second targeting domain that binds to Plasminogen Activator Inhibitor-1 (PAI-1) comprises a VH region represented by an amino acid sequence that is at least 98% identical to SEQ ID NO:15 and comprises a VL region represented by an amino acid sequence that is at least 98% identical to SEQ ID NO:16.
25. The method according to claim 20, wherein said bispecific antibody is humanized.
26. The method according to claim 20, for treating brain lesions in an acute thrombotic disorder.
27. The method according to claim 20, wherein the acute thrombotic disorder is selected from the group consisting of, acute peripheral arterial occlusion, middle cerebral artery occlusion (MCAO), and thromboembolism such as deep vein thromboembolism and lung embolism.
28. The method according to claim 20, in a combination treatment with tPA.
29. The method according to claim 20, wherein said treatment is performed without administration of tPA, prior, together of after the administration of the bispecific antibody.
30. The method according to claim 20, wherein said acute thrombotic disorder is characterized by presence of a platelet-rich blood clot.