Patent application title:

VARIANT THIOESTERASES AND METHODS OF USE

Publication number:

US20180171312A1

Publication date:
Application number:

15/809,973

Filed date:

2017-11-10

Abstract:

The present invention relates to variant thioesterases and their use in plants, e.g., to increase enzymatic activity and to promote increased production of mid-chain length fatty acids (e.g., 8 to 14 carbons) and at desired ratios. Further disclosed herein are methods of manufacturing renewable chemicals through the manufacture of novel triglyceride oils followed by chemical modification of the oils. Oils containing fatty acid chain lengths of C8, C10, C12 or C14 are also disclosed and are useful as feedstocks in the methods described herein.

Inventors:

Assignee:

Interested in similar patents?

Get notified when new applications in this technology area are published.

Classification:

C12P7/6463 »  CPC further

Preparation of oxygen-containing organic compounds; Fats; Fatty oils; Ester-type waxes; Higher fatty acids, i.e. having at least seven carbon atoms in an unbroken chain bound to a carboxyl group; Oxidised oils or fats; Fatty acid esters; Glycerides obtained from glyceride producing microorganisms, e.g. single cell oil

C12Y301/02014 »  CPC further

Hydrolases acting on ester bonds (3.1); Thioester hydrolases (3.1.2) Oleoyl-[acyl-carrier-protein] hydrolase (3.1.2.14), i.e. ACP-thioesterase

C12N9/16 »  CPC main

Enzymes; Proenzymes; Compositions thereof ; Processes for preparing, activating, inhibiting, separating or purifying enzymes; Hydrolases (3) acting on ester bonds (3.1)

C12N15/82 IPC

Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor; Recombinant DNA-technology; Introduction of foreign genetic material using vectors; Vectors; Use of hosts therefor; Regulation of expression; Vectors or expression systems specially adapted for eukaryotic hosts for plant cells, e.g. plant artificial chromosomes (PACs)

C12P7/64 IPC

Preparation of oxygen-containing organic compounds Fats; Fatty oils; Ester-type waxes; Higher fatty acids, i.e. having at least seven carbon atoms in an unbroken chain bound to a carboxyl group; Oxidised oils or fats

Description

CROSS-REFERENCE TO RELATED APPLICATIONS

This application is a continuation of U.S. application Ser. No. 14/167,908, filed on Jan. 29, 2014, and issued on Nov. 14, 2017 as U.S. Pat. No. 9,816,079, which claims the benefit under 35 U.S.C. § 119(e) of U.S. Provisional Application No. 61/758,223, filed on Jan. 29, 2013, and is a continuation-in-part of U.S. application Ser. No. 13/797,733, filed on Mar. 12, 2013, and issued on Feb. 14, 2017 as U.S. Pat. No. 9,567,615, all of which are hereby incorporated herein by reference in their entireties for all purposes.

FIELD

The present invention relates to variant acyl-ACP thioesterases and their use in oil-producing cells, e.g., to increase enzymatic activity toward certain acyl-ACP substrates and to promote increased production of oils with desired fatty acid profiles.

BACKGROUND

Today, fats and fatty acids primarily come from vegetable and animal sources, with the notable exception of commercial production of omega-3 fatty acids by fermentation of microbes for use in baby formula and nutritional supplements. Progress is being made however toward the commercial production of tailored oils using recombinant microalgae. See PCT Publications WO2008/151149, WO2010/06032, WO2011/150410, WO2011/150411, and international patent application PCT/US12/23696.

One method for producing a desired fatty acid profile in an oleaginous organism is to introduce an acyl-ACP thioesterase transgene; e.g., a transgene from a plant that produces a desired fatty acid.

By terminating fatty acid biosynthesis, the acyl-acyl carrier protein (ACP) thioesterase (TE) functionally determines the length and identity of the fatty acid end product (Salas et al., (2002) Archives of Biochemistry and Biophysics 403: 25-34). Based on amino acid sequence alignments, the plant TEs have been shown to cluster into two families, FatAs, which show marked preference for 18:1-ACP with minor activity towards 18:0- and 16:0-ACPs; and FatBs, which hydrolyze primarily saturated acyl-ACPs with chain lengths that vary between 8-16 carbons (Voelker, In Genetic Engineering Volume 18. Edited by: Setlow J K. New York, Plenum Press; 1996:111-133; Ginalski, et al., Nucl Acids Res (2003) 31:3291-3292; and Jones, et al., (1995) Plant Cell 7: 359-371). FatB TEs have a conserved hydrophobic 18-amino acid domain (Facciotti and Yuan (1998) European Journal of Lipid Science and Technology 100:167-172), and a conserved Asn-His-Cys catalytic triad in the C-terminal catalytic domain (Blatti, et al., PLoS ONE (2012) 7(9): e42949. doi:10.1371 and Mayer and Shanklin, BMC Plant Biology (2007) 7:1-11). Mayer and Shanklin, BMC Plant Biology (2007) 7:1-11, identify a C-terminal conserved acyl-ACP thioesterase catalytic domain characterized by a C-terminal hot dog fold encompassing the Cys-His-Asn catalytic triad. The conserved acyl-ACP TE catalytic domain is well-characterized and has been assigned conserved domain accession number pfam01643. The hot dog fold is also well-characterized and has been assigned conserved domain accession number cd03440 and is part of the hotdog superfamily assigned conserved domain accession number cl00509.

SUMMARY

In one aspect, provided are nucleic acid molecules encoding a variant acyl-ACP thioesterase comprising a C-terminal catalytic domain, and an N-terminal hydrophobic domain and specificity domain, wherein one or more of the hydrophobic domain and/or the specificity domain are heterologous to the catalytic domain. Generally, reading in the 5′ to 3′ direction, the N-terminal hydrophobic domain, the specificity domain and the catalytic domain are operably linked. In varying embodiments, one or more of the domains may abut one another.

In some embodiments, the nucleic acid molecule encodes a variant acyl-acyl carrier protein (ACP) thioesterase (TE) comprising:

i) the specificity domain from a C10:0 acyl-ACP preferring TE and a catalytic domain from a C12:0 acyl-ACP preferring TE;

ii) the specificity domain from a C12:0 acyl-ACP preferring TE and a catalytic domain from a C14:0 acyl-ACP preferring TE;

iii) the specificity domain from a C14:0 acyl-ACP preferring TE and a catalytic domain from a C12:0 acyl-ACP preferring TE;

iv) the specificity domain from a C12:0 acyl-ACP preferring TE and a catalytic domain from a C10:0 acyl-ACP preferring TE;

v) the specificity domain from a C10:0 acyl-ACP preferring TE and a catalytic domain from a C8:0 acyl-ACP preferring TE; and/or

vi) the specificity domain from a C8:0 acyl-ACP preferring TE and a catalytic domain from a C10:0 acyl-ACP preferring TE.

In some embodiments, the nucleic acid encodes a specificity domain that comprises:

a) amino acid residues of an acyl-ACP-TE corresponding to an amino acid sequence selected from the group consisting of amino acid residues 125-163 of SEQ ID NO:43; amino acid residues 125-163 of SEQ ID NO:44; amino acid residues 152-190 of SEQ ID NO:45; amino acid residues 139-177 of SEQ ID NO:46; amino acid residues 117-155 of SEQ ID NO:47; amino acid residues 158-196 of SEQ ID NO:60; and amino acid residues 156-194 of SEQ ID NO:61;

b) a motif comprising the amino acid sequence SI(V/L/E)(A/T)(V/L)MN(H/Y/M/I)(L/M/V/F)QE(T/A)(A/S/T)(L/I)N(H/Q)(A/V/C)(K/E/R) (S/I/T/N/C)(V/L/A/T/I/N)G(L/I)(L/S/M)(G/L/D/N/E)(D/N/E)G(F/L)G(T/E/R/S/A)(T/S)(L/P/R)(E/G)M(S/Y/F/C/T)(K/R/L)(R/K/N/M)(D/G/N)L(M/I/F); and/or

c) at least 60% sequence identity, e.g., at least 65%, 70%, 75%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% sequence identity, to an amino acid sequence selected from the group consisting of amino acid residues 125-163 of SEQ ID NO:43; amino acid residues 125-163 of SEQ ID NO:44; amino acid residues 152-190 of SEQ ID NO:45; amino acid residues 139-177 of SEQ ID NO:46; amino acid residues 117-155 of SEQ ID NO:47; amino acid residues 158-196 of SEQ ID NO:60; and amino acid residues 156-194 of SEQ ID NO:61.

In some embodiments, the nucleic acid encodes a specificity domain that promotes, increases and/or prefers the production of triglycerides with an altered fatty acid profile and comprises:

a) a motif comprising the amino acid sequence SI(V/L/E)(A/T)(V/L)MN(H/Y/M/I)(L/MN/F)QE(T/A)(A/S/T)(L/I)N(H/Q)(A/V/C)(K/E/R) (S/I/T/N/C)TGI(L/S/M)L(D/N/E)G(F/L)G(T/E/R/S/A)(T/S)L(E/G)M(S/Y/F/C/T)K(R/K/N/M)(D/G/N)L(M/I/F)WV(V/L)I(K/R)(M/T)(Q/H)(I/V)K;

b) at least 60% sequence identity, e.g., at least 65%, 70%, 75%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% sequence identity, to amino acid residues 156-203 of SEQ ID NO:61, wherein the amino acid residue at or corresponding to position 166 is Glutamine; the amino acid residue at or corresponding to position 175 is Threonine; the amino acid residue at or corresponding to position 177 is Isoleucine; the amino acid residue at or corresponding to position 179 is Leucine; the amino acid residue at or corresponding to position 186 is Leucine; the amino acid residue at or corresponding to position 190 is Lysine; the amino acid at or corresponding to position 198 is Isoleucine and the amino acid at or corresponding to position 203 is Lysine; and/or

c) SEQ ID NO:61.

In some embodiments, the nucleic acid encodes a specificity domain that promotes, increases and/or prefers the production of C12:0 fatty acids and comprises:

a) a motif comprising the amino acid sequence SIL(A/T)(V/L)MN(H/Y/M/I)MQE(T/A)T(L/I)N(H/Q)(A/V/C)(K/E/R)(S/I/T/N/C)(V/L/A/T/I/N)G(L/I)(L/S/M)(G/L/D/N/E)(D/N/E)G(F/L)G(T/E/R/S/A)(T/S)(L/P/R)(E/G)M(S/Y/F/C/T)(K/R/L)(R/K/N/M)(D/G/N)LM;

b) at least 60% sequence identity, e.g., at least 65%, 70%, 75%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% sequence identity, to an amino acid sequence selected from the group consisting of amino acid residues 125-163 of SEQ ID NO:43 and amino acid residues 125-163 of SEQ ID NO:44; wherein the amino acid residue at or corresponding to position 127 is Leucine, the amino acid residue at or corresponding to position 133 is Methionine, the amino acid residue at or corresponding to position 137 is Threonine and the amino acid residue at or corresponding to position 163 is Methionine; and/or

c) SEQ ID NO:43.

In some embodiments, the nucleic acid encodes a specificity domain that promotes, increases and/or prefers the production of C14:0 fatty acids and comprises:

a) a motif comprising the amino acid sequence SIV(A/T)(V/L)MN(H/Y/M/I)LQE(T/A)A(L/I)N(H/Q)(A/V/C)(K/E/R)(S/I/T/N/C)(V/L/A/T/I/N)G(L/I)(L/S/M)(G/L/D/N/E)(D/N/E)G(F/L)G(T/E/R/S/A)(T/S)(L/P/R)(E/G)M(S/Y/F/C/T)(K/R/L)(R/K/N/M)(D/G/N)LI;

b) at least 60% sequence identity, e.g., at least 65%, 70%, 75%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% sequence identity, to an amino acid sequence selected from the group consisting of amino acid residues 125-163 of SEQ ID NO:43 and amino acid residues 125-163 of SEQ ID NO:44; wherein the amino acid residue at or corresponding to position 127 is Valine, the amino acid residue at or corresponding to position 133 is Leucine, the amino acid residue at or corresponding to position 137 is Alanine and the amino acid residue at or corresponding to position 163 is Isoleucine; and/or

c) SEQ ID NO:44.

In some embodiments, the nucleic acid encodes a specificity domain that promotes, increases and/or prefers the production of C8:0-C:10 fatty acids and comprises:

a) a motif comprising the amino acid sequence SI(E/M)(T/A)(L/V)MN(H/Y)(L/V)Q(E/D)(T/A)(S/A)(L/I/R)N(H/Q)(C/A)(K/E)S(TN/L/I/A)G(I/L)L(L/N/D/H/G)DGFG(R/E)(T/S)(L/P)(E/G)M(C/S)(K/T)(R/N)DL;

b) at least 60% sequence identity, e.g., at least 65%, 70%, 75%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% sequence identity, to an amino acid sequence selected from the group consisting of amino acid residues 156-193 SEQ ID NO:61; wherein the amino acid residue at or corresponding to position 163 is Tyrosine, or the amino acid residue at or corresponding to position 186 is Proline; and/or

c) SEQ ID NO:84.

In some embodiments, the nucleic acid encodes a specificity domain that comprises at least 60% sequence identity, e.g., at least 65%, 70%, 75%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% sequence identity, to an amino acid sequence selected from the group consisting of amino acid residues 91-163 of SEQ ID NO:43 and amino acid residues 91-163 of SEQ ID NO:44 and wherein the amino acid residue at or corresponding to position 91 is Asparagine, the amino acid at or corresponding to position 92 is Proline and the amino acid position 102 is Proline.

In some embodiments, the nucleic acid encodes a specificity domain that comprises at least 60% sequence identity, e.g., at least 65%, 70%, 75%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% sequence identity, to an amino acid sequence selected from the group consisting of amino acid residues 91-163 of SEQ ID NO:43 and amino acid residues 91-163 of SEQ ID NO:44 and wherein the amino acid residue at or corresponding to position 91 is Asparagine, the amino acid at or corresponding to position 92 is Proline, the amino acid position 102 is Proline, the amino acid residue at or corresponding to position 127 is Valine, the amino acid residue at or corresponding to position 133 is Leucine, the amino acid residue at or corresponding to position 137 is Alanine and the amino acid residue at or corresponding to position 163 is Isoleucine.

In some embodiments, the nucleic acid encodes a specificity domain that comprises at least 60% sequence identity, e.g., at least 65%, 70%, 75%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% sequence identity, to an amino acid sequence selected from the group consisting of amino acid residues 91-163 of SEQ ID NO:43 and amino acid residues 91-163 of SEQ ID NO:44 and wherein the amino acid residue at or corresponding to position 91 is Asparagine, the amino acid at or corresponding to position 92 is Proline, the amino acid position 102 is Proline, the amino acid residue at or corresponding to position 127 is Leucine, the amino acid residue at or corresponding to position 133 is Methionine, the amino acid residue at or corresponding to position 137 is Threonine and the amino acid residue at or corresponding to position 163 is Methionine.

In some embodiments, the nucleic acid encodes a hydrophobic domain that comprises:

a) amino acid residues of an acyl-ACP-TE corresponding to an amino acid sequence selected from the group consisting of amino acid residues 61-77 of SEQ ID NO:43; amino acid residues 61-77 of SEQ ID NO:44; amino acid residues 85-101 of SEQ ID NO:45; amino acid residues 78-95 of SEQ ID NO:46; amino acid residues 50-66 of SEQ ID NO:47; amino acid residues 91-107 of SEQ ID NO:60; and amino acid residues 90-106 of SEQ ID NO:61;

b) a motif comprising the amino acid sequence (P/H)(G/D/V)(W/L)(S/N)(M/RN)(P/L/S)(L/F)(E/A/T/S)(L/A/K)(I/V)TT(I/V)F(S/L/V/G)(A/K/V)(A/P);

c) at least 60% sequence identity, e.g., at least 65%, 70%, 75%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% sequence identity, to an amino acid sequence selected from the group consisting of amino acid residues 61-77 of SEQ ID NO:43; amino acid residues 61-77 of SEQ ID NO:44; amino acid residues 85-101 of SEQ ID NO:45; amino acid residues 78-95 of SEQ ID NO:46; amino acid residues 50-66 of SEQ ID NO:47; amino acid residues 91-107 of SEQ ID NO:60; and amino acid residues 90-106 of SEQ ID NO:61; and/or

d) amino acid residues 61-77 of SEQ ID NO:43; amino acid residues 61-77 of SEQ ID NO:44; amino acid residues 85-101 of SEQ ID NO:45; amino acid residues 78-95 of SEQ ID NO:46; amino acid residues 50-66 of SEQ ID NO:47; amino acid residues 91-107 of SEQ ID NO:60; and/or amino acid residues 90-106 of SEQ ID NO:61. In some embodiments, the nucleic acid encodes a hydrophobic domain that comprises an N-terminal Leucine residue.

In some embodiments, the nucleic acid further encodes an N-terminal sequence encoding a plastid transit peptide. In some embodiments, the plastid transit peptide comprises a transit peptide subsequence from Chlorella protothecoides Stearoyl ACP Desaturase (SAD) protein. In some embodiments, the plastid transit peptide comprises an amino acid sequence having at least 60% sequence identity, e.g., at least 65%, 70%, 75%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% sequence identity, to an amino acid sequence selected from the group consisting of MATASTFSAFNARCGDLRRSAGSGPRRPARPLPVRGRA, SGPRRPARPLPVR, SGPRRPARPLPVRAAIASEVPVATTSPR, RPARPLPVRGRA, RPARPLPVRAAIASEVPVATTSPR, RCGDLRRSAGSGPRRPARPLPVRGRA, RCGDLRRSAGSGPRRPARPLPVRAAIASEVPVATTSPR, PARPLPVR, PARPLPVRAAIASEVPVATTSPR, RRPARPLPVR, and RRPARPLPVRAAIASEVPVATTSPR. In some embodiments, the plastid transit peptide comprises an amino acid sequence selected from the group consisting of MATASTFSAFNARCGDLRRSAGSGPRRPARPLPVRGRA, SGPRRPARPLPVR, SGPRRPARPLPVRAAIASEVPVATTSPR, RPARPLPVRGRA, RPARPLPVRAAIASEVPVATTSPR, RCGDLRRSAGSGPRRPARPLPVRGRA, RCGDLRRSAGSGPRRPARPLPVRAAIASEVPVATTSPR, PARPLPVR, PARPLPVRAAIASEVPVATTSPR, RRPARPLPVR, and RRPARPLPVRAAIASEVPVATTSPR.

In some embodiments, the nucleic acid further encodes a linker domain positioned N-terminal to the hydrophobic domain.

In some embodiments, the nucleic acid encodes a linker domain that comprises:

a) at least 5 amino acid residues, e.g., at least 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39 or 40 residues, extending from the C-terminus from an acyl-ACP-TE subsequence corresponding to residues selected from the group consisting of amino acid residues 43-59 of SEQ ID NO:43; amino acid residues 43-59 of SEQ ID NO:44; amino acid residues 49-83 of SEQ ID NO:45; amino acid residues 53-77 of SEQ ID NO:46; amino acid residues 15-48 of SEQ ID NO:47; amino acid residues 57-89 of SEQ ID NO:60; and amino acid residues 56-88 of SEQ ID NO:61;

b) at least 5 amino acid residues, e.g., at least 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39 or 40 residues, extending from the C-terminus from an acyl-ACP-TE subsequence comprising at least 60% sequence identity, e.g., at least 65%, 70%, 75%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% sequence identity, to an amino acid sequence selected from the group consisting of amino acid residues 43-59 of SEQ ID NO:43; amino acid residues 43-59 of SEQ ID NO:44; amino acid residues 49-83 of SEQ ID NO:45; amino acid residues 53-77 of SEQ ID NO:46; amino acid residues 15-48 of SEQ ID NO:47; amino acid residues 57-89 of SEQ ID NO:60; and amino acid residues 56-88 of SEQ ID NO:61;

c) at least 5 amino acid residues, e.g., at least 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39 or 40 residues, extending from the C-terminus from an acyl-ACP-TE subsequence selected from the group consisting of amino acid residues 43-59 of SEQ ID NO:43; amino acid residues 43-59 of SEQ ID NO:44; amino acid residues 49-83 of SEQ ID NO:45; amino acid residues 53-77 of SEQ ID NO:46; amino acid residues 15-48 of SEQ ID NO:47; amino acid residues 57-89 of SEQ ID NO:60; and amino acid residues 56-88 of SEQ ID NO:61; and/or

d) an amino acid sequence selected from the group consisting of SEQ ID NO:37, SEQ ID NO:38, SEQ ID NO:39, SEQ ID NO:40; SEQ ID NO:41 and SEQ ID NO:42.

In some embodiments, the nucleic acid encodes a variant acyl-ACP-TE comprising an amino acid sequence having at least 60% sequence identity, e.g., at least 65%, 70%, 75%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% sequence identity, to an amino acid sequence selected from the group consisting of SEQ ID NO:3, SEQ ID NO:5, SEQ ID NO:7, SEQ ID NO:9, SEQ ID NO:11, SEQ ID NO:13, SEQ ID NO:15; SEQ ID NO:18, SEQ ID NO:20, SEQ ID NO:22, SEQ ID NO:24, SEQ ID NO:26; SEQ ID NO:28; SEQ ID NO:30, SEQ ID NO:32; SEQ ID NO:34; SEQ ID NO:36; SEQ ID NO:49, SEQ ID NO:51; SEQ ID NO:53; SEQ ID NO:55; SEQ ID NO:57 and SEQ ID NO:59. In some embodiments, the nucleic acid encodes a variant acyl-ACP-TE comprising an amino acid sequence selected from the group consisting of SEQ ID NO:3, SEQ ID NO:5, SEQ ID NO:7, SEQ ID NO:9, SEQ ID NO:11, SEQ ID NO:13, SEQ ID NO:15; SEQ ID NO:18, SEQ ID NO:20, SEQ ID NO:22, SEQ ID NO:24, SEQ ID NO:26; SEQ ID NO:28; SEQ ID NO:30, SEQ ID NO:32; SEQ ID NO:34; SEQ ID NO:36; SEQ ID NO:49, SEQ ID NO:51; SEQ ID NO:53; SEQ ID NO:55; SEQ ID NO:57 and SEQ ID NO:59.

In varying embodiments, the nucleic acid sequence comprises codon bias for improved expression in an algal host cell.

In a further aspect, expression cassettes comprising a nucleic acid as described above and herein are provided.

In another aspect, vectors comprising a nucleic acid (e.g., a polynucleotide) and/or an expression cassette as described above and herein are provided.

In another aspect, a variant acyl-acyl carrier protein (ACP) thioesterase (TE) encoded by a nucleic acid as described above and herein is provided.

In a further aspect, host cells are provided that comprise a nucleic acid, an expression cassette, and/or a variant acyl-ACP-TE as described above and herein. In varying embodiments, the host cell is an oleaginous cell (e.g., a plant cell, an algae cell, a microalgae cell). In some embodiments, the algae cell is of the genus Prototheca, or a cell having a 23S rRNA sequence with at least 70% nucleic acid sequence identity to one or more of SEQ ID NOs: 62-70. In some embodiments, algae cell is selected from the group consisting of Prototheca moriformis, Prototheca krugani, Prototheca stagnora and Prototheca zopfii. In some embodiments, the host cell further comprises an exogenous lysophosphatidic acid acyltransferase gene encoding an active lysophosphatidic acid acyltransferase (LPAAT) that catalyzes the transfer of a mid-chain fatty-acyl group to the sn-2 position of a substituted acylglyceroester. In varying embodiments, the host cell produces an oil having at least 1% increased levels, e.g., at least about 1%, 2%, 3%, 4%, 5%, 6%, 7%, 8%, 9%, 10%, 15%, 20%, 30%, 40%, 50%, 60%, 70%, from 75-85%, from 70-90%, from 90-200%, from 200-300%, from 300-400%, from 400-500%, or greater than 500%, increased levels of C8:0, C10:0, C12:0 or C14:0 fatty acids in comparison to an untransformed host cell or a host cell transformed with a wild-type acyl-ACP TE.

In a further aspect, an oleaginous cell or organism (e.g, a plant, an algae, a microalgae) is provided comprising a nucleic acid, an expression cassette, a vector, and/or a variant acyl-ACP-TE, as described above and herein. In some embodiments, the algae is of the genus Prototheca. In some embodiments, the algae is selected from the group consisting of Prototheca moriformis, Prototheca krugani, Prototheca stagnora and Prototheca zopfii. In another aspect, an oil product produced by the plant, algae or microalgae is provided, or a chemical, material, or food product produced from that oil.

In another aspect, methods of producing a plant, algae or microalgae that produces an oil having a desired fatty acid profile are provided. In some embodiments, the methods comprise transforming the plant, algae or microalgae with a nucleic acid sequence as described above and herein, and cultivating the plant, algae or microalgae so as to produce the oil. In some embodiments, the plant, algae or microalgae produces at least about 1% increased levels of C8:0, C10:0, C12:0 and/or C14:0 fatty acids, e.g., at least about 1%, 2%, 3%, 4%, 5%, 6%, 7%, 8%, 9%, 10%, 15%, 20%, 30%, 40%, 50%, 60%, 70%, from 75-85%, from 70-90%, from 90-200%, from 200-300%, from 300-400%, from 400-500%, or greater than 500%, increased levels of C8:0, C10:0, C12:0 and/or C14:0 fatty acids in comparison to an untransformed plant, algae or microalgae or a plant, algae or microalgae transformed with a wild-type acyl-ACP TE.

In another aspect, methods of producing an oil are provided. In some embodiments the methods comprise transforming the plant, algae or microalgae with a nucleic acid molecule encoding a variant acyl-ACP TE as described above and herein, expressing the variant acyl-ACP TE to produce fatty acids, and recovering the oil produced by the plant, algae or microalgae comprising the fatty acids.

In another aspect, methods of producing an oil are provided. In some embodiments, the methods comprise culturing a plant, algae or microalgae comprising a nucleic acid molecule encoding a variant acyl-ACP TE as described above and herein, expressing the variant acyl-ACP TE to produce fatty acids, and recovering the oil produced by the plant, algae or microalgae comprising the fatty acids.

Definitions

An “acyl-ACP thioesterase” or “acyl-ACP TE” interchangeably refer to an enzyme that catalyzes the cleavage of a fatty acid from an acyl carrier protein (ACP) during lipid synthesis. Acyl-acyl carrier protein (ACP) thioesterases (TEs) hydrolyze acyl-ACP thioester bonds, releasing free fatty acids and ACP. By terminating fatty acid biosynthesis, the TE functionally determines the length and identity of the fatty acid end product. See, Salas, et al., Archives of Biochemistry and Biophysics (2002) 403: 25-34.

The term “catalytic domain” refers to the C-terminal portion of an acyl-ACP TE comprising the Cys-His-Asn catalytic triad and which catalyzes the reaction of hydrolyzing an acyl group on a fatty acid. Acyl-ACP TE catalytic domains are known in the art, and have been described, e.g., in Blatti, et al., PLoS ONE (2012) 7(9): e42949 and Mayer and Shanklin, BMC Plant Biology (2007) 7:1-11.

The term “hydrophobic domain” refers to a conserved hydrophobic 18-amino acid domain or subsequence thereof in an acyl-ACP TE. Hydrophobic domains have been described in the art and are believed to anchor a FatB acyl-ACP TE in a plastid membrane. See, e.g., Facciotti and Yuan Eur J Lipid Sci Tech (1998) 100:167-172; Blatti, et al., PLoS ONE (2012) 7(9): e42949; and Mayer and Shanklin, BMC Plant Biology (2007) 7:1-11.

The term “linker domain” refers to an amino acid subsequence of an acyl-ACP TE that is positioned N-terminal to the hydrophobic domain, and can link the hydrophobic domain to a transit peptide. Wild-type FatB acyl-ACP TEs contain a linker domain.

The term “heterologous” with respect to the N-terminus and N-terminal domains of an acyl-ACP TE (e.g., a transit peptide, a linker domain, a hydrophobic domain, a specificity domain), refers to amino acid subsequences that are not encoded by the naturally occurring gene encoding an acyl-ACP TE C-terminus and/or catalytic domain. With relation to the C-terminal region and/or catalytic domain of an acyl-ACP TE, a heterologous N-terminal region of an acyl-ACP TE can arise from exchanging or altering an N-terminal region of the acyl-ACP TE for an N-terminal region that is not encoded by the naturally occurring gene encoding an acyl-ACP TE C-terminus and/or C-terminal catalytic domain. This can be accomplished in any way known in the art, including, e.g., swapping of individual domains with an altered and/or non-naturally occurring domain, introduction of point mutations, introduction of altered or non-naturally occurring subsequences, or deletion of single amino acid residues, subsequences and/or domains.

The term “acyl-ACP preferring TE” refers to the fatty acyl-ACP substrate specificity of a TE. An acyl-ACP preferring TE preferentially liberates a particular fatty acid from an acyl-ACP substrate. For example, the acyl-ACP preferring TE can preferentially liberate a given fatty acid over all other fatty acids in the set of C8:0, C10:0, C12:0, C14:0, C16:0, C18:0, C18:1, and C18:2 fatty acids. The preference of the acyl-ACP preferring TE can be detected as a higher Vmax (a higher kcat, or a higher V/K) in comparison to other non-preferred fatty acid-ACP substrates. In the absence of a kinetic assay using purified protein, the preference can be inferred from changes in fatty acid profile of a cell genetically engineered to overexpress the acyl-ACP preferring TE relative to a control cell that does not overexpress the acyl-ACP preferring TE.

Numbering of a given amino acid polymer or nucleic acid polymer “corresponds to” or is “relative to” the numbering of a selected amino acid polymer or nucleic acid polymer when the position of any given polymer component (e.g., amino acid, nucleotide, also referred to generically as a “residue”) is designated by reference to the same or to an equivalent position (e.g., based on an optimal alignment or a consensus sequence) in the selected amino acid or nucleic acid polymer, rather than by the actual numerical position of the component in the given polymer.

A “variant” is a polypeptide comprising a sequence which differs in one or more amino acid position(s) from that of a parent polypeptide sequence (e.g., by substitution, deletion, or insertion). A variant may comprise a sequence which differs from the parent polypeptides sequence in up to 40% of the total number of residues of the parent polypeptide sequence, such as in up to 40%, 35%, 30%, 25%, 20%, 15%, 10%, 9%, 8%, 7%, 6%, 5%, 4%, 3% 2% or 1% of the total number of residues of the parent polypeptide sequence. For example, a variant of a 400 amino acid polypeptide sequence comprises a sequence which differs in up to 40% of the total number of residues of the parent polypeptide sequence, that is, in up to 160 amino acid positions within the 400 amino acid polypeptide sequence (such as in 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 34, 35, 36, 37, 38, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 51, 52, 53, 54, 55, 56, 57, 58, 59, 60, 61, 62, 63, 64, 65, 66, 67, 68, 69, 70, 71, 72, 73, 74, 75, 76, 78, 79, 80, 85, 90, 95, 100, 105, 110, 115, 120, 125, 130, 135, 140, 145, 150, 155, or 160 amino acid positions within the reference sequence (e.g., SEQ ID NO:3, SEQ ID NO:5, SEQ ID NO:7, SEQ ID NO:9, SEQ ID NO:11, SEQ ID NO:13, SEQ ID NO:15; SEQ ID NO:18, SEQ ID NO:20, SEQ ID NO:22, SEQ ID NO:24, SEQ ID NO:26; SEQ ID NO:28; SEQ ID NO:30, SEQ ID NO:32; SEQ ID NO:34; SEQ ID NO:36; SEQ ID NO:49, SEQ ID NO:51; SEQ ID NO:53; SEQ ID NO:55; SEQ ID NO:57 and SEQ ID NO:59).

“Naturally occurring” as applied to a composition that can be found in nature as distinct from being artificially produced by man. For example, a polypeptide or polynucleotide that is present in an organism (including viruses, bacteria, protozoa, insects, plants or mammalian tissue) that can be isolated from a source in nature and which has not been intentionally modified by man in the laboratory is naturally occurring. “Non-naturally occurring” (also termed “synthetic” or “artificial”) as applied to an object means that the object is not naturally-occurring—i.e., the object cannot be found in nature as distinct from being artificially produced by man.

A “natural oil” or “natural fat” refers to a predominantly triglyceride oil obtained from an organism, where the oil has not undergone blending with another natural or synthetic oil, or fractionation, or other process, so as to substantially alter the fatty acid profile of the triglyceride. In connection with an oil comprising triglycerides of a particular regiospecificity, the natural oil or natural fat has not been subjected to interesterification or other synthetic process to obtain that regiospecific triglyceride profile, rather the regiospecificity is produced naturally, by a cell or population of cells. In connection with a natural oil or natural fat, and as used generally throughout the present disclosure, the terms oil and fat are used interchangeably, except where otherwise noted. Thus, an “oil” or a “fat” can be liquid, solid, or partially solid at room temperature, depending on the makeup of the substance and other conditions. Here, the term “fractionation” means removing material from the oil in a way that changes its fatty acid profile relative to the profile produced by the organism, however accomplished. A natural oil encompasses such an oil obtained from an organism, where the oil has undergone minimal processing, including refining, bleaching and/or degumming, that does not substantially change its triglyceride profile. A natural oil can also be a “noninteresterified natural oil”, which means that the natural oil has not undergone a process in which fatty acids have been redistributed in their acyl linkages to glycerol and remain essentially in the same configuration as when recovered from the organism.

“Fatty acid profile” refers to the distribution of fatty acids in a cell or oil derived from a cell in terms of chain length and/or saturation pattern. In this context the saturation pattern can comprise a measure of saturated versus unsaturated acid or a more detailed analysis of the distribution of the positions of double bonds in the various fatty acids of a cell, and in particular cell triglycerides. A “fatty acid” in a fatty acid profile of a cell or oil triglyceride refers to a fatty acyl group of the cell or oil triglycerides.

In connection with an oil, a “profile” is the distribution of particular species or triglycerides or fatty acyl groups within the oil. A “fatty acid profile” is the distribution of fatty acyl groups in the triglycerides of the oil without reference to attachment to a glycerol backbone. An “sn-2 profile” is the distribution of fatty acids found at the sn-2 position of the triacylglycerides in the oil. A “regiospecific profile” is the distribution of triglycerides with reference to the positioning of acyl group attachment to the glycerol backbone without reference to stereospecificity. In other words, a regiospecific profile describes acyl group attachment at sn-1/3 vs. sn-2. Thus, in a regiospecific profile, POS and SOP are treated identically. A “stereospecific profile” describes the attachment of acyl groups at sn-1, sn-2 and sn-3. Unless otherwise indicated, triglycerides such as SOP and POS are to be considered equivalent. A “TAG profile” refers to the distribution of fatty acids found in the triglycerides with reference to connection to the glycerol backbone, but without reference to the regiospecific nature of the connections. Thus, in a TAG profile, the percent of SSO in the oil is the sum of SSO and SOS, while in a regiospecific profile, the percent of SSO is calculated without inclusion of SOS species in the oil.

“Microalgae” are microbial organisms that contain a chloroplast or plastid, and optionally that is capable of performing photosynthesis, or a prokaryotic microbial organism capable of performing photosynthesis. Microalgae include obligate photoautotrophs, which cannot metabolize a fixed carbon source as energy, as well as heterotrophs, which can live solely off of a fixed carbon source. Microalgae include unicellular organisms that separate from sister cells shortly after cell division, such as Chlamydomonas, as well as microbes such as, for example, Volvox, which is a simple multicellular photosynthetic microbe of two distinct cell types. Microalgae include cells such as Chlorella, Dunaliella, and Prototheca. Microalgae also include other microbial photosynthetic organisms that exhibit cell-cell adhesion, such as Agmenellum, Anabaena, and Pyrobotrys. Microalgae also include obligate heterotrophic microorganisms that have lost the ability to perform photosynthesis, such as certain dinoflagellate algae species and species of the genus Prototheca.

An “oleaginous” cell is a non-human cell capable of producing at least 20% lipid by dry cell weight, naturally or through recombinant or classical strain improvement. An “oleaginous microbe” or “oleaginous microorganism is a microbe, including a microalga that is oleaginous.

As used with respect to polypeptides or polynucleotides, the term “isolated” refers to a polypeptide or polynucleotide that has been separated from at least one other component that is typically present with the polypeptide or polynucleotide. Thus, a naturally occurring polypeptide is isolated if it has been purified away from at least one other component that occurs naturally with the polypeptide or polynucleotide. A recombinant polypeptide or polynucleotide is isolated if it has been purified away from at least one other component present when the polypeptide or polynucleotide is produced.

The terms “polypeptide” and “protein” are used interchangeably herein to refer a polymer of amino acids, and unless otherwise limited, include atypical amino acids that can function in a similar manner to naturally occurring amino acids.

The terms “amino acid” or “amino acid residue,” include naturally occurring L-amino acids or residues, unless otherwise specifically indicated. The commonly used one- and three-letter abbreviations for amino acids are used herein (Lehninger, A. L. (1975) Biochemistry, 2d ed., pp. 71-92, Worth Publishers, N.Y.). The terms “amino acid” and “amino acid residue” include D-amino acids as well as chemically modified amino acids, such as amino acid analogs, naturally occurring amino acids that are not usually incorporated into proteins, and chemically synthesized compounds having the characteristic properties of amino acids (collectively, “atypical” amino acids). For example, analogs or mimetics of phenylalanine or proline, which allow the same conformational restriction of the peptide compounds as natural Phe or Pro are included within the definition of “amino acid.”

Exemplary atypical amino acids, include, for example, those described in International Publication No. WO 90/01940 as well as 2-amino adipic acid (Aad) which can be substituted for Glu and Asp; 2-aminopimelic acid (Apm), for Glu and Asp; 2-aminobutyric acid (Abu), for Met, Leu, and other aliphatic amino acids; 2-aminoheptanoic acid (Ahe), for Met, Leu, and other aliphatic amino acids; 2-aminoisobutyric acid (Aib), for Gly; cyclohexylalanine (Cha), for Val, Leu, and Ile; homoarginine (Har), for Arg and Lys; 2,3-diaminopropionic acid (Dpr), for Lys, Arg, and His; N-ethylglycine (EtGly) for Gly, Pro, and Ala; N-ethylasparagine (EtAsn), for Asn and Gln; hydroxyllysine (Hyl), for Lys; allohydroxyllysine (Ahyl), for Lys; 3- (and 4-) hydoxyproline (3Hyp, 4Hyp), for Pro, Ser, and Thr; allo-isoleucine (Aile), for Ile, Leu, and Val; amidinophenylalanine, for Ala; N-methylglycine (MeGly, sarcosine), for Gly, Pro, and Ala; N-methylisoleucine (MeIle), for Ile; norvaline (Nva), for Met and other aliphatic amino acids; norleucine (Nle), for Met and other aliphatic amino acids; ornithine (Orn), for Lys, Arg, and His; citrulline (Cit) and methionine sulfoxide (MSO) for Thr, Asn, and Gln; N-methylphenylalanine (MePhe), trimethylphenylalanine, halo (F, Cl, Br, and I) phenylalanine, and trifluorylphenylalanine, for Phe.

The term “sequence”, as used in connection with a polypeptide or nucleic acid polymer refers to the order of monomers making up the polymer or the sub-polymer or fragment having that sequence.

A “subsequence” of an amino acid or nucleotide sequence is a portion of a larger sequence or the peptide or nucleic acid sub-polymer or fragment characterized by the portion of the larger sequence.

The terms “identical” or “percent identity,” in the context of two or more amino acid or nucleotide sequences, refer to two or more sequences or subsequences that are the same or have a specified percentage of amino acid residues or nucleotides that are the same, when compared and aligned for maximum correspondence, as measured using one of the following sequence comparison algorithms or by visual inspection.

For sequence comparison to determine percent nucleotide or amino acid identity, typically one sequence acts as a reference sequence, to which test sequences are compared. When using a sequence comparison algorithm, test and reference sequences are input into a computer, subsequence coordinates are designated, if necessary, and sequence algorithm program parameters are designated. The sequence comparison algorithm then calculates the percent sequence identity for the test sequence(s) relative to the reference sequence, based on the designated program parameters. Optimal alignment of sequences for comparison can be conducted using BLAST set to default parameters.

As used with reference to polypeptides, the term “wild-type” refers to any polypeptide having an amino acid sequence present in a polypeptide from a naturally occurring organism, regardless of the source of the molecule; i.e., the term “wild-type” refers to sequence characteristics, regardless of whether the molecule is purified from a natural source; expressed recombinantly, followed by purification; or synthesized.

The term “mutation” shall mean a change in a protein, polypeptide, or peptide sequence or subsequence produced by altering one or more nucleotides in a nucleotide coding for the protein, polypeptide, or peptide, however the alteration is obtained. For example, a mutation can be produced randomly, by PCR mutation, by synthesis of entire gene, or any other method.

The term “conservative amino acid substitution” is used herein to refer to the replacement of an amino acid with a functionally equivalent amino acid. Functionally equivalent amino acids are generally similar in size and/or character (e.g., charge or hydrophobicity) to the amino acids they replace. Amino acids of similar character can be grouped as follows:

(1) hydrophobic: His, Trp, Tyr, Phe, Met, Leu, Ile, Val, Ala;

(2) neutral hydrophobic: Cys, Ser, Thr;

(3) polar: Ser, Thr, Asn, Gln;

(4) acidic/negatively charged: Asp, Glu;

(5) charged: Asp, Glu, Arg, Lys, His;

(6) basic/positively charged: Arg, Lys, His;

(7) basic: Asn, Gln, His, Lys, Arg;

(8) residues that influence chain orientation: Gly, Pro; and

(9) aromatic: Trp, Tyr, Phe, His.

The following table shows exemplary and preferred conservative amino acid substitutions.

Exemplary Preferred
Original Conservative Conservative
Residue Substitution Substitution
Ala Val, Leu, Ile Val
Arg Lys, Gln, Asn Lys
Asn Gln, His, Lys, Arg Gln
Asp Glu Glu
Cys Ser Ser
Gln Asn Asn
Glu Asp Asp
Gly Pro Pro

Exemplary Preferred
Original Conservative Conservative
Residue Substitution Substitution
His Asn, Gln, Lys, Arg Asn
Ile Leu, Val, Met, Ala, Phe Leu
Leu Ile, Val, Met, Ala, Phe Ile
Lys Arg, Gln, Asn Arg
Met Leu, Phe, Ile Leu
Phe Leu, Val, Ile, Ala Leu
Pro Gly Gly
Ser Thr Thr
Thr Ser Ser
Trp Tyr Tyr
Tyr Trp, Phe, Thr, Ser Phe
Val Ile, Leu, Met, Phe, Ala Leu

The term “vector” is used herein to describe a DNA construct containing a polynucleotide. Such a vector can be propagated stably or transiently in a host cell. The vector can, for example, be a plasmid, a viral vector, or simply a potential genomic insert. Once introduced into a suitable host, the vector may replicate and function independently of the host genome, or may, in some instances, integrate into the host genome.

As used herein, the terms “expression vector” or “expression construct” refer to a nucleic acid construct, generated recombinantly or synthetically, with a series of specified nucleic acid elements that permit transcription of a particular nucleic acid in a host cell. The expression vector can be part of a plasmid, virus, or nucleic acid fragment. Typically, the expression vector includes a nucleic acid to be transcribed operably linked to a promoter.

“Exogenous gene” refers to a nucleic acid transformed into a cell. The exogenous gene may be from a different species (and so heterologous), or from the same species (and so homologous) relative to the cell being transformed. In the case of a homologous gene, it occupies a different location in the genome of the cell relative to the endogenous copy of the gene. The exogenous gene may be present in more than one copy in the cell. The exogenous gene may be maintained in a cell as an insertion into the genome or as an episomal molecule.

“Exogenously provided” describes a molecule provided to the culture media of a cell culture.

An “inducible promoter” is one that mediates transcription of an operably linked gene in response to a particular stimulus.

As used herein, the phrase “in operable linkage” refers to a functional linkage between two sequences, such a control sequence (typically a promoter) and the linked sequence. A promoter is in operable linkage with an exogenous gene if it can mediate transcription of the gene.

A “promoter” is defined as an array of nucleic acid control sequences that direct transcription of a nucleic acid. As used herein, a promoter includes necessary nucleic acid sequences near the start site of transcription, such as, in the case of a polymerase II type promoter, a TATA element. A promoter also optionally includes distal enhancer or repressor elements, which can be located as much as several thousand base pairs from the start site of transcription.

As used herein, the term “recombinant” when used with reference, e.g., to a cell, or nucleic acid, protein, or vector, indicates that the cell, nucleic acid, protein or vector, has been modified by the introduction of an exogenous nucleic acid or protein or the alteration of a native nucleic acid or protein, or that the cell is derived from a cell so modified. Thus, recombinant cells express genes that are not found within the native (non-recombinant) form of the cell or express native genes that are otherwise abnormally expressed, over-expressed, under-expressed or not expressed at all. “Recombinant nucleic acid” as used herein refers to nucleic acid molecules that are initially synthesized through the use of laboratory methods, thereby creating nucleic acid sequences that are not normally found in nature. By using laboratory methods, recombinant nucleic acid molecules in operable linkage with different sequences (e,g., promoter, targeting sequence, etc.) is achieved. Thus an isolated nucleic acid, in a linear form, or an expression vector formed in vitro by ligating DNA molecules that are not normally joined, are both considered recombinant for the purposes of this invention. It is understood that once a recombinant nucleic acid is made and reintroduced into a host cell or organism, it will replicate non-recombinantly, i.e., using the in vivo cellular machinery of the host cell rather than in vitro manipulations; however, such nucleic acids, once produced recombinantly, although subsequently replicated non-recombinantly, are still considered recombinant for the purposes of the invention. Similarly, a “recombinant protein” is a protein made using recombinant techniques, i.e., through the expression of a recombinant nucleic acid as depicted above.

A “transit peptide” is an amino acid sequence that directs the trafficking of a polypeptide fused to the signal sequence. In connection with plastidic cells expressing the polypeptide, the transit peptide may direct trafficking of the polypeptide to the plastid.

The term “polynucleotide” refers to a deoxyribonucleotide or ribonucleotide polymer, and unless otherwise limited, includes known analogs of natural nucleotides that can function in a similar manner to naturally occurring nucleotides. The term “polynucleotide” refers any form of DNA or RNA, including, for example, genomic DNA; complementary DNA (cDNA), which is a DNA representation of mRNA, usually obtained by reverse transcription of messenger RNA (mRNA) or amplification; DNA molecules produced synthetically or by amplification; and mRNA. The term “polynucleotide” encompasses double-stranded nucleic acid molecules, as well as single-stranded molecules. In double-stranded polynucleotides, the polynucleotide strands need not be coextensive (i.e., a double-stranded polynucleotide need not be double-stranded along the entire length of both strands).

The term “host cell” refers to a cell capable of maintaining a vector either transiently or stably. Host cells include, without limitation, bacterial cells, yeast cells, insect cells, algal cells (e.g., microalgal cells), plant cells and mammalian cells. Other host cells known in the art, or which become known, are also suitable for use in the invention.

As used herein, the term “complementary” refers to the capacity for precise pairing between two nucleotides. For example, if a nucleotide at a given position of a nucleic acid molecule is capable of hybridizing with a nucleotide of another nucleic acid molecule, then the two nucleic acid molecules are considered to be complementary to one another at that position. The term “substantially complementary” describes sequences that are sufficiently complementary to one another to allow for specific hybridization under stringent hybridization conditions.

The phrase “stringent hybridization conditions” generally refers to a temperature about 5° C. lower than the melting temperature (Tm) for a specific sequence at a defined ionic strength and pH. Exemplary stringent conditions suitable for achieving specific hybridization of most sequences are a temperature of at least about 60° C. and a salt concentration of about 0.2 molar at pH 7.0.

“Cellulosic material” means the products of digestion of cellulose, including glucose and xylose, and optionally additional compounds such as disaccharides, oligosaccharides, lignin, furfurals and other compounds. Nonlimiting examples of sources of cellulosic material include sugar cane bagasses, sugar beet pulp, corn stover, wood chips, sawdust and switchgrass.

BRIEF DESCRIPTION OF THE DRAWINGS

FIG. 1 illustrates Western blotting of whole cell lysates from P.

moriformis strains engineered to express the C-terminally FLAG epitope tagged Uc TE (F) or Cc TE (E) acyl-ACP thioesterase.

FIG. 2 illustrates a schematic cartoon of Umbellularia californica (Uc) TE, Cinnamomum camphora (Cc) TE and chimeric expression constructs. All constructs contained the same C. protothecoides SAD1 transit peptide, AscI linker and C-terminal FLAG epitope tag.

FIGS. 3A-C illustrate the nucleotide sequence of transforming DNA contained in plasmid pSZ2037. Construct D1022 [pSZ2037] was used to express the Cc-Uc TE chimera A within P. moriformis (UTEX 1435 strain A). Proceeding in the 5′ to 3′ direction, the C. reinhardtii β-tubulin promoter driving the expression of the Saccharomyces cerevisiae SUC2 gene (encoding sucrose hydrolyzing activity, thereby permitting the strain to grow on sucrose) is indicated by lowercase, boxed text. The initiator ATG and terminator TGA for SUC2 are indicated by uppercase italics, while the coding region is indicated with lowercase italics. The Chlorella vulgaris nitrate reductase (NR) gene 3′ UTR is indicated by lowercase text followed by a spacer segment (dotted underlined, lowercase) and a P. moriformis AMT3 promoter (indicated by boxed italicized text) driving the expression of the C. camphorum and U. californica chimeric fusion thioesterase. The C. protothecoides SAD1 transit peptide is indicated with uppercase, boxed text, while the C. camphorum and U. californica derived sequences with underlined italic and bold uppercase, respectively. The C-terminal FLAG epitope tag is noted with underlined lowercase. The C. vulgaris nitrate reductase 3′ UTR is again indicated by lowercase text followed by the A 6S genomic region indicated by bold, lowercase text.

FIG. 4 illustrates the nucleotide sequence of transforming DNA contained in plasmid pSZ2038. Construct D1023 [pSZ2038] was used to express the Uc-Cc TE chimera within P. moriformis (UTEX 1435 strain A). Cc TE derived sequence is noted with underlined italic while the Uc TE derived sequence is noted with bold uppercase text.

FIG. 5 illustrates the nucleotide sequence of transforming DNA contained in plasmid pSZ2231. Construct D1210 [pSZ2231] was used to express the Cc-Uc TE chimera B within P. moriformis (UTEX 1435 strain A). Cc TE derived sequence is noted with underlined italic while the Uc TE derived sequence is noted with bold uppercase text.

FIG. 6 illustrates the nucleotide sequence of transforming DNA contained in plasmid pSZ2232. Construct D1211 [pSZ2232] was used to express the Cc-Uc TE chimera C within P. moriformis (UTEX 1435 strain A). Cc TE derived sequence is noted with underlined italic while the Uc TE derived sequence is noted with bold uppercase text.

FIG. 7 illustrates the nucleotide sequence of transforming DNA contained in plasmid pSZ2233. Construct D1212 [pSZ2233] was used to express the Cc-Uc TE chimera D within P. moriformis (UTEX 1435 strain A). Cc TE derived sequence is noted with underlined italic while the Uc TE derived sequence is noted with bold uppercase text.

FIG. 8 illustrates the nucleotide sequence of transforming DNA contained in plasmid pSZ2234. Construct D1213 [pSZ2234] was used to express the Cc-Uc TE chimera E within P. moriformis (UTEX 1435 strain A). Cc TE derived sequence is noted with underlined italic while the Uc TE derived sequence is noted with bold uppercase text.

FIG. 9 illustrates a Western Blot comparing Strain A, Strain E and Strain F and representative derivative transgenic lines transformed with pSZ2037 (D1022, Cc-Uc TE chimera A) and pSZ2038 (D1023, Uc-Cc TE chimera) DNAs.

FIG. 10 illustrates a Western Blot comparing Strain A, Strain E and Strain F and representative derivative transgenic lines transformed with pSZ2231 (D1210, Cc-Uc TE chimera B) or pSZ2232 (D1211, Cc-Uc TE chimera C) DNAs.

FIG. 11 illustrates a Western Blot comparing Strain A, Strain E and Strain F and representative derivative transgenic lines transformed with pSZ2233 (D1212, Cc-Uc TE chimera D) or pSZ2234 (D1213, Cc-Uc TE chimera E) DNAs.

FIG. 12 illustrates amino acids identified from chimeric fusions between Cc TE and Uc TE required for efficient maturation of the nascent protein (Asn91, Pro92 and Pro102) and four Cc TE specific amino acids (Val127, Leu133, Ala137, and Ile163) which impart a novel 1:1 ratio of C12:0 to C14:0 when inserted into the context of an Uc TE backbone.

FIGS. 13A-B illustrate a sequence alignment of FATA and FATB thioesterase proteins. The N-terminus of FATBs exhibit a high degree of sequence conservation. The approximate regions for the transit peptide, a proline-rich domain and hydrophobic patch are boxed. Three amino acids shown to be important for the efficient processing of the Uc FATB2 (e.g., N91, P92 and P102) are noted with an underscore below row 14 and are located between the hydrophobic patch and start of the core enzyme domain.

FIGS. 14A-C illustrate the nucleotide sequence of construct D1056 [pSZ2084]. Construct D1056 [pSZ2084] was used to express the Uc TE containing an extended heterologous transit peptide from C. protothecoides within P. moriformis (UTEX 1435 strain A). Proceeding in the 5′ to 3′ direction, the C. reinhardtiiβ-tubulin promoter driving the expression of the Saccharomyces cerevisiae SUC2 gene (encoding sucrose hydrolyzing activity, thereby permitting the strain to grow on sucrose) is indicated by lowercase, boxed text. The initiator ATG and terminator TGA for SUC2 are indicated by uppercase italics, while the coding region is indicated with lowercase italics. The Chlorella vulgaris nitrate reductase (NR) gene 3′ UTR is indicated by lowercase text followed by a spacer segment (dotted underlined, lowercase) and a P. moriformis AMT3 promoter (indicated by boxed italicized text) driving the expression of the U. californica chimeric fusion thioesterase. The extended C. protothecoides SAD1 transit peptide is indicated with underlined uppercase, while the U. californica FATB2 derived sequence is noted with bold uppercase. The C-terminal FLAG epitope tag is noted with underlined lowercase. The C. vulgaris nitrate reductase 3′ UTR is again indicated by lowercase text followed by the A 6S genomic region indicated by bold, lowercase text.

FIG. 15 illustrates the nucleotide sequence of transforming DNA contained in plasmid pSZ2085. Construct D1057 [pSZ2085] was used to express the Uc FATB2ExtA within P. moriformis (UTEX 1435 strain A). The Uc FATB2 thioesterase extension is noted with underlined italic while the remaining Uc FATB2 sequence found in pSZ2084 is noted with bold uppercase text.

FIG. 16 illustrates the nucleotide sequence of transforming DNA contained in plasmid pSZ2086. Construct D1058 [pSZ2086] was used to express the Uc FATB2ExtB within P. moriformis (UTEX 1435 strain A). The Uc FATB2 thioesterase extension is noted with underlined italic while the remaining Uc FATB2 sequence found in pSZ2084 is noted with bold uppercase text.

FIGS. 17A-B illustrate that the N-terminus of the 12:0-ACP thioesterase Uc FATB2 impacts the enzyme activity when expressed in P. moriformis. Panel A illustrates the sequence differences between D448, D1056, D1057 and D1058 relative to the native protein. Panel B compares the fatty acid profiles between the four constructs upon transformation of P. moriformis. D1057 and D1058 exhibit an approximate two-fold increase in the average C12 fatty acid profiles relative to D448 and D1056. The fatty acid profiles for the wild-type strains (strain B and strain A) are indicated.

FIG. 18 illustrates the nucleotide sequence of transforming DNA contained in plasmid pSZ2450. Construct D1431 [pSZ2450] was used to express the Cc FATB1ExtA within P. moriformis (UTEX 1435 strain C). The Cc FATB1 thioesterase extension is noted with underlined italic while the remaining Cc FATB1 sequence is noted with bold uppercase text.

FIG. 19 illustrates the nucleotide sequence of transforming DNA contained in plasmid pSZ2451. Construct D1432 [pSZ2451] was used to express the Cc FATB1ExtB within P. moriformis (UTEX 1435 strain C). The Cc FATB1 thioesterase extension is noted with underlined italic while the remaining Cc FATB1 sequence is noted with bold uppercase text.

FIGS. 20A-B illustrate that the N-terminus of the 14:0-ACP thioesterase Cc FATB1 impacts the enzyme activity when expressed in P. moriformis. Panel A illustrates the sequence differences between D534, D1431, D1432 relative to the native protein. Panel B compares the fatty acid profiles between the three constructs upon transformation of P. moriformis. D1431 and D1432 exhibit an approximate two-fold increase in the average C12 fatty acid profiles relative to D534. The fatty acid profiles for the wild-type strain C is indicated.

FIG. 21 illustrates the nucleotide sequence of transforming DNA contained in plasmid pSZ2479. Construct D1481 [pSZ2479] was used to express the Cuphea palustris (Cpal) FATB2 ExtA within P. moriformis (UTEX 1435 strain C). The Cpal FATB2 thioesterase extension is noted with underlined italic while the remaining Cpal FATB2 sequence is noted with bold uppercase text and the FLAG epitope (pSZ2480) noted in lowercase text.

FIG. 22 illustrates the nucleotide sequence of transforming DNA contained in plasmid pSZ2480. Construct D1482 [pSZ2480] was used to express the Cpal FATB2 ExtA containing a C-terminal FLAG epitope tag within P. moriformis (UTEX 1435 strain C). The Cpal FATB2 thioesterase extension is noted with underlined italic while the remaining Cpal FATB2 sequence is noted with bold uppercase text and the FLAG epitope (pSZ2480) noted in lowercase text.

FIGS. 23A-B illustrate that the N-terminus of the 14:0-ACP thioesterase Cpal FATB2 impacts the enzyme activity when expressed in P. moriformis. Panel A illustrates the sequence differences between D280, D1481 and D1482 relative to the native protein. Panel B compares the fatty acid profiles between the three constructs upon transformation of P. moriformis. D1481 and D1482 exhibit an average C14 value of approximately 33%. The fatty acid profiles for the wild-type strain C and a Cc FATB2 expressing strain (Strain K) are indicated with arrows.

FIG. 24 illustrates the nucleotide sequence of transforming DNA contained in plasmid pSZ2477. Construct D1479 [pSZ2477] was used to express the Ulmus Americana (Ua) FATB1 ExtA within P. moriformis (UTEX 1435 strain C). The Ua FATB1 thioesterase sequence extension is noted with underlined italic while the remaining Ua FATB1 sequence is noted with bold uppercase text. The FLAG epitope in pSZ2478 is noted in lowercase text.

FIG. 25 illustrates the nucleotide sequence of transforming DNA contained in plasmid pSZ2478. Construct D1480 [pSZ2478] was used to express the Ua FATB1 ExtA containing a C-terminal FLAG epitope tag within P. moriformis (UTEX 1435 strain C). The Ua FATB1 thioesterase sequence extension is noted with underlined italic while the remaining Ua FATB1 sequence is noted with bold uppercase text. The FLAG epitope in pSZ2478 is noted in lowercase text.

FIGS. 26A-B illustrate that the N-terminus of the 10:0-14:0-16:0-ACP thioesterase Ua FATB1 impacts the enzyme activity when expressed in P. moriformis. Panel A illustrates the sequence differences between D449, D1479, D1480 relative to the native protein. Panel B compares the fatty acid profiles between the three constructs upon transformation of P. moriformis. D1479 and D1480 exhibit an approximate two-fold increase in the average C12 fatty acid profiles relative to D449. The fatty acid profiles for the wild-type strains B and C are indicated.

FIG. 27 illustrates the nucleotide sequence of transforming DNA contained in plasmid pSZ2231. Construct D1210 [pSZ2231] was used to express the Cc-Uc FATB2 ChimeraB within P. moriformis (UTEX 1435 strain A). The Cc-Uc FATB2 thioesterase sequence is indicated by bold uppercase text; the trimmed or extended C. protothecoides SAD1 transit peptide is indicated with underlined uppercase and the Uc FATB2 extension within D1429 is noted with underlined lowercase italic.

FIG. 28 illustrates the nucleotide sequence of transforming DNA contained in plasmid pSZ2448. Construct D1429 [pSZ2448] used to express the Cc-Uc FATB2 ExtA containing the extended C. protothecoides SAD1 transit peptide and a five amino acid N-terminal extension derived from the native Uc FATB2 sequence within P. moriformis (UTEX 1435 strain C). The Cc-Uc FATB2 thioesterase sequence is indicated by bold uppercase text; the trimmed or extended C. protothecoides SAD1 transit peptide is indicated with underlined uppercase and the Uc FATB2 extension within D1429 is noted with underlined lowercase italic.

FIGS. 29A-B illustrate that the N-terminus of the 12:0-ACP thioesterase Uc FATB2 improves the enzyme activity of the Cc-Uc FATB2 chimera B when expressed in P. moriformis. Panel A illustrates the sequence differences between D1210 and D1429 relative to the native protein. Panel B compares the fatty acid profiles between the two constructs upon transformation of P. moriformis. D1429 exhibits an approximate two-fold increase in the average C12 fatty acid profiles relative to D1210. The fatty acid profiles for the wild-type strains A and C are indicated. The relative C12:C14 activity within these chimeric TEs, is strikingly lowered, with a significant increase in C14:0 activity relative to the native UcTE enzyme (compare for example FIG. 18, D448 lines, with FIG. 30, D1210 and D1429 lines).

FIGS. 30A-B illustrate extensions of Cpal FATB2 and UaFATB1. A. CpalFATB2 (C14) extended to AHPK−/+FLAG Tag (psZ2479 (D1481) and psZ2480 (D1482)). B. UaFATB1 (C10-C16) extended to PPKL−/+FLAG Tag (psZ2477 (D1479) and psZ2478 (D1480)).

FIG. 31 illustrates the nucleic acid sequence of pSZ2609 (D1558) Cuphea hookeriana (Chook) and Cuphea wrightii (Cw) Chook-CwFATB ChimeraA. CwFATB transit peptide (underlined text), AscI linker (lowercase), CwFATB sequence (italic), Chook FATB sequence (bold), FLAG epitope tag (underlined lowercase).

FIG. 32 illustrates the nucleic acid sequence of pSZ2610 (D1559) Chook-CwFATB ChimeraB. CwFATB transit peptide (underlined text), AscI linker (lowercase), CwFATB sequence (italic), Chook FATB sequence (bold), FLAG epitope tag (underlined lowercase).

FIG. 33 illustrates the nucleic acid sequence of pSZ2611 (D1560) Chook-CwFATB ChimeraC. CwFATB transit peptide (underlined text), AscI linker (lowercase), CwFATB sequence (italic), Chook FATB sequence (bold), FLAG epitope tag (underlined lowercase).

FIG. 34 illustrates the nucleic acid sequence of pSZ2612 (D1561) Chook-CwFATB ChimeraD. CwFATB transit peptide (underlined text), AscI linker (lowercase), CwFATB sequence (italic), Chook FATB sequence (bold), FLAG epitope tag (underlined lowercase).

FIG. 35 illustrates the nucleic acid sequence of pSZ2613 (D1562) ChookFATB. CwFATB transit peptide (underlined text), AscI linker (lowercase), Chook FATB sequence (bold), FLAG epitope tag (underlined lowercase).

FIG. 36 illustrates the nucleic acid sequence of pSZ1954 (D965) CwFATB. CwFATB transit peptide (underlined text), AscI linker (lowercase), CwFATB sequence (italic), FLAG epitope tag (underlined lowercase).

FIG. 37 illustrates acyl-ACP TE FATB chimeras of Cuphea hookeriana (Chook) and Cuphea wrightii (Cw) (“Chook-CwFATB chimeras”).

FIGS. 38A-B illustrate primary lipid profiles of Chook-CwFATB chimeras.

FIGS. 39A-B illustrate a Western analysis of expression and summary of fatty acid profiles of Chook-CwFATB chimeras.

FIG. 40 illustrates residues within the specificity domains of ChookFATB2, CwFATB1, UcFATB2 and CcFATB that influence fatty acid-ACP substrate specificity of the TE. Residues influencing the fatty acid-ACP substrate specificity of ChookFATB2 include, e.g., E166, T175, I177, L179, L186, K190, I198 and K203 (residue numbering with reference to SEQ ID NO:61). Residues influencing the fatty acid-ACP substrate specificities of UcFATB2 and CcFATB include, e.g., L/V127, M/L133, T/A137, M/I163 and (residue numbering with reference to SEQ ID NO:43 and SEQ ID NO:44).

FIGS. 41A-C. FIG. 41A. Sequence alignment of the previously described N-terminal specificity domain derived from the Ch FATB2 (D3042), Umbellularia californica (Uc FatB2 accession M94159; D1058), Cinnamomum camphorum FATB1 (Cc FATB2, accession U31813; D1432) and the Uc FATB2 Chimera F (D1777). Boxes highlight the four amino acids that were altered within the N-terminal specificity domain of the Uc FATB2 to generate the Uc FATB2 Chimera F. FIG. 41B illustrates the C12:0 preferring fatty acid profile for D1058, the C14:0 fatty acid profile for D1432 and a novel hybrid C12:0-C14:0 profile for D1777. FIG. 41C. The four amino acid alterations which yielded D1777 are highlighted on a homology model of the native Uc FATB2. Also shown are the catalytic triad (Cys, His, and Asn) comprising the enzymatic core.

FIGS. 42A-B. FIG. 42A. Sequence alignment between Ch FATB2, Cuphea wrightii (Cw FATB2, accession U56103), Cuphea paucipetala (Cpau FATB1), Cuphea palustris (Cpal FATB1, accession AAC49179), Cuphea ignea (Cignea FATB1), Cuphea avigera (Ca FATB1), and Cinnamomum camphorum (Cc FATB4). The N-terminal specificity domain is highlighted relative to the transit peptide, catalytic triad and C-terminal FLAG epitope tag. FIG. 42B. Sequence alignment of the N-terminal specificity domain derived from the wild-type Ch FATB2 and the six Ch FATB2 chimeras. Residues identical the wild-type Ch FATB2 (D3042) are noted with dots, while alterations are noted with the amino acid letter. The FATB gene from which the substitutions were derived are the following: D3126 Cw FATB2; D3127 Cpau FATB1; D3128 Cpal FATB1; D3129 Cignea FATB1; D3130 Ca FATB1; and D3131 Cc FATB4.

FIGS. 43A-C. FIG. 43A. Sequence alignment of the N-terminal specificity domain derived from the Ch FATB2 (D3042), the Cw FATB2 (D965) and the Ch FATB2 Chimera Ver1 (D3126). Boxes highlight the six amino acids that were altered within the N-terminal specificity domain of the Ch FATB2 to generate the Ch FATB2 Chimera Ver1. FIG. 43B illustrates the C12:0-C14:0 preferring fatty acid profile for D965, the C8:0-C10:0 fatty acid profile for D3042 and the barely detectable C10:0 accumulation in strains expressing D3126. FIG. 43C. The six amino acid alterations which generated D3126 are highlighted on a homology model of the native Uc FATB2. Also shown are the catalytic triad (Cys, His, and Asn) comprising the enzymatic core.

FIGS. 44A-C. FIG. 44A. Sequence alignment of the N-terminal specificity domain derived from the Ch FATB2 (D3042), the Cpau FATB1 (D2506) and the Ch FATB2 Chimera Ver2 (D3127). Boxes highlight the seven amino acids that were altered within the N-terminal specificity domain of the Ch FATB2 to generate the Ch FATB2 Chimera Ver2. FIG. 44B illustrates the C10:0-C14:0 preferring fatty acid profile for D2506, the C8:0-C10:0 fatty acid profile for D3042 and the loss of all detectable C8:0-C10:0 accumulation in strains expressing D3127. FIG. 44C. The seven amino acid alterations which generated D3127 are highlighted on a homology model of the native Uc FATB2. Also shown are the catalytic triad (Cys, His, and Asn) comprising the enzymatic core.

FIGS. 45A-C. FIG. 45A. Sequence alignment of the N-terminal specificity domain derived from the Ch FATB2 (D3042), the Cpal FATB1 (D2839) and the Ch FATB2 Chimera Ver3 (D3128). Boxes highlight the eight amino acids that were altered within the N-terminal specificity domain of the Ch FATB2 to generate the Ch FATB2 Chimera Ver3. FIG. 45B illustrates the C8:0-C10:0 preferring fatty acid profile for D2839, the C8:0-C10:0 fatty acid profile for D3042 and the loss of all detectable C8:0-C10:0 accumulation in strains expressing D3128. FIG. 45C. The eight amino acid alterations which generated D3128 are highlighted on a homology model of the native Uc FATB2. Also shown are the catalytic triad (Cys, His, and Asn) comprising the enzymatic core.

FIGS. 46A-C. FIG. 46A. Sequence alignment of the N-terminal specificity domain derived from the Ch FATB2 (D3042), the Cignea FATB1 (D2676) and the Ch FATB2 Chimera Ver4 (D3129). Boxes highlight the three amino acids that were altered within the N-terminal specificity domain of the Ch FATB2 to generate the Ch FATB2 Chimera Ver4. FIG. 46B illustrates the C10:0-C14:0 preferring fatty acid profile for D2676, the C8:0-C10:0 fatty acid profile for D3042 and the barely detectable C10:0 accumulation in strains expressing D3129. FIG. 46C. The three amino acid alterations which generated D3129 are highlighted on a homology model of the native Uc FATB2. Also shown are the catalytic triad (Cys, His, and Asn) comprising the enzymatic core.

FIGS. 47A-C. FIG. 47A. Sequence alignment of the N-terminal specificity domain derived from the Ch FATB2 (D3042), the Ca FATB1 (D2800) and the Ch FATB2 Chimera Ver5 (D3130). Boxes highlight the two amino acids that were altered within the N-terminal specificity domain of the Ch FATB2 to generate the Ch FATB2 Chimera Ver5. FIG. 47B illustrates the C8:0-C12:0 preferring fatty acid profile for D2800, the C8:0-C10:0 fatty acid profile for D3042 and robust C8:0-C10:0 accumulation in strains expressing D3130. FIG. 47C. The two amino acid alterations which generated D3130 are highlighted on a homology model of the native Uc FATB2. Also shown are the catalytic triad (Cys, His, and Asn) comprising the enzymatic core as well as the published M230I substitution that has been shown to enhance the enzymatic activity of the Cpal FATB1.

FIGS. 48A-C. FIG. 48A. Sequence alignment of the N-terminal specificity domain derived from the Ch FATB2 (D3042), the Cc FATB4 (D1845) and the Ch FATB2 Chimera Ver6 (D3131). Boxes highlight the thirteen amino acids that were altered within the N-terminal specificity domain of the Ch FATB2 to generate the Ch FATB2 Chimera Ver6. FIG. 48B illustrates the C12:0-C14:0 preferring fatty acid profile for D1845, the C8:0-C10:0 fatty acid profile for D3042 and the lack of detectable C10:0 accumulation in strains expressing D3131. FIG. 48C. The thirteen amino acid alterations which generated D3131 are highlighted on a homology model of the native Uc FATB2. Also shown are the catalytic triad (Cys, His, and Asn) comprising the enzymatic core.

FIG. 49 illustrates the amino acid sequence of the Ch FATB2 (D3042; pSZ4243). The algal transit peptide from C. protothecoides is noted with lower case and the C-terminal FLAG epitope tag is highlighted with underlined uppercase. The Ch FATB2 is represented with bold uppercase and the N-terminal specificity domain is boxed.

DETAILED DESCRIPTION

I. Introduction

Provided are variant thioesterases that allow for finer control over acyl-ACP thioesterase substrate specificity in order to obtain more precisely defined fatty acid profiles in a lipid production organism.

Certain embodiments are based on the discoveries that a N-terminal hydrophobic domain of acyl-ACP thioesterase from plants is important in maturation and cell-activity of the thioesterases. Inclusion of this region has been found to increase activity and swapping of domains between plant thioesterases can be used to increase activity in less active thioesterases. Accordingly, certain embodiments comprise fusion proteins incorporating a more active hydrophobic domain into a thioesterase to increase its activity in a cell and thereby alter the fatty acid profile of the cell. It has also been found that in FATB thioesterases, certain amino acids play a role in increasing TE catalytic activity. In particular, the inclusion of one or more amino acid residues corresponding to Asn91, Pro92 and Pro102 of SEQ ID NO:43 or SEQ ID NO:44 can increase thioesterase activity.

In some embodiments, the hydrophobic domain can be linked to a transit peptide using a linker domain. Selection of the linker domain is described below, including the advantageous inclusion of proline residues.

In addition, inclusion of certain amino acid substitutions N-terminal to the catalytic domain of FATB can alter the fatty acid preference of the FATB enzyme and thereby shift the fatty acid profile of a cell expressing a gene with these amino acid substitutions. In particular, the inclusion of one or more amino acid residues corresponding to Val127, Leu133, Ala137, and Ile163 of SEQ ID NO:43 or SEQ ID NO:44 can shift the fatty acid preference of a FATB thioesterase.

These discoveries may be combined to create a variant acyl-ACP thioesterase having both increased activity due to domain swapping and/or mutation of the hydrophobic domain and also incorporating mutations at the newly discovered specificity-altering positions. Optionally, a variant linker domain is included in a variant acyl-ACP thioesterase having one or both of the variant hydrophobic domain and novel variant specificity mutations disclosed herein. The result is a thioesterase having improved activity or altered specificity.

When incorporated into an oleaginous cell (e.g., of an oilseed plant, algae (e.g., microalgae)) the variant thioesterases can alter the fatty acid profiles of the cell to produce novel or more economical high-value commercial products.

The embodiments also encompass the residual biomass from such cells after oil extraction, oleochemicals, fuels and food products made from the oils and methods of cultivating the cells. In varying embodiments, the cells are microalgal cells, including heterotrophic or obligate heterotrophic cells, and cells classified as Chlorophyta, Trebouxiophyceae, Chlorellales, Chlorellaceae, or Chlorophyceae. The cells can also be plant cells or cells of macroalgae. Host cells having a type II fatty acid synthesis pathway are preferred. Although the examples given below use the Trebouxiophyte Prototheca moriformis as a host cell, the genes, constructs and methods disclosed may also find use in oilseed crops. Methods for introducing these genes into such crops are known in the art; see, for example, U.S. Pat. Nos. 6,331,664, 5,512,482, 5,455,167, 5,667,997.

II. Variant Acyl-ACP Thioesterases

The variant TEs can be used in genetic constructs and genetically engineered oleaginous cells (e.g., plants, algae, microalgae) with one or more exogenous genes to produce fatty acids, acylglycerides, or derivatives thereof. For example, microalgae or oilseed crops that would naturally, or through genetic modification, produce high levels of lipids can be engineered (or further engineered) to express an exogenous variant fatty acyl-ACP thioesterase, which can facilitate the cleavage of fatty acids from acyl carrier protein (ACP) during fatty acid synthesis. The fatty acids synthesized may be incorporated into acyl glycerides including triacylglycerides (TAGs, triglycerides). The TAGs can be recovered or, through further enzymatic processing within the cell, or in vitro, yield other useful compounds.

In an embodiment, the variant fatty acyl-ACP thioesterases are designed based on the desired specificity for a growing (during fatty acid synthesis) fatty acyl group having a particular carbon chain length. A specificity domain is selected based on its preference for a particular fatty acyl ACP substrate and/or for its ability to influence, increase and/or promote the production of fatty acids of a desired carbon chain length. Generally, the variant fatty acyl-ACP thioesterases have preferential substrate specificity for mid-chain ACP-fatty acyl substrates (e.g., to liberate C8, C10, C12, and/or C14 fatty acids).

In varying embodiments, the specificity domain in the N-terminus of the acyl-ACP thioesterase is heterologous (e.g., due to point mutations and/or domain swapping) to the C-terminal catalytic domain. In certain embodiments, the fatty acid chain length substrate specificity and/or preference of the specificity domain and the catalytic domain is the same or within 1-2 carbons. For example, in varying embodiments, the variant acyl-acyl carrier protein (ACP) thioesterase (TE) comprises:

i) the specificity domain from a C10:0 acyl-ACP preferring TE and a catalytic domain from a C12:0 acyl-ACP preferring TE;

ii) the specificity domain from a C12:0 acyl-ACP preferring TE and a catalytic domain from a C14:0 acyl-ACP preferring TE;

iii) the specificity domain from a C14:0 acyl-ACP preferring TE and a catalytic domain from a C12:0 acyl-ACP preferring TE;

iv) the specificity domain from a C12:0 acyl-ACP preferring TE and a catalytic domain from a C10:0 acyl-ACP preferring TE;

v) the specificity domain from a C10:0 acyl-ACP preferring TE and a catalytic domain from a C8:0 acyl-ACP preferring TE; and/or

vi) the specificity domain from a C8:0 acyl-ACP preferring TE and a catalytic domain from a C10:0 acyl-ACP preferring TE.

In varying embodiments, the variant acyl-acyl carrier protein (ACP) thioesterase (TE) comprises:

i) the specificity domain from C. hookeriana acyl-ACP TE and a catalytic domain from a C. wrightii acyl-ACP TE preferring TE;

ii) the specificity domain from a Cinnamomum camphora acyl-ACP TE and a catalytic domain from a Umbellularia californica acyl-ACP preferring TE; and/or

iii) the specificity domain from a Umbellularia californica acyl-ACP preferring TE and a catalytic domain from a Cinnamomum camphora acyl-ACP TE preferring TE.

In varying embodiments, the specificity domain encompasses an amino acid subsequence within the N-terminal hot dog fold domain of an acyl-ACP TE, e.g., corresponding to amino acid residues 125-163 of SEQ ID NO:43; amino acid residues 125-163 of SEQ ID NO:44; amino acid residues 152-190 of SEQ ID NO:45; amino acid residues 139-177 of SEQ ID NO:46; amino acid residues 117-155 of SEQ ID NO:47; amino acid residues 158-196 of SEQ ID NO:60; or amino acid residues 156-194 of SEQ ID NO:61. In varying embodiments, the specificity domain comprises a motif comprising the amino acid sequence SI(V/L/E)(A/T)(V/L)MN(H/Y/M/I)(L/MN/F)QE(T/A)(A/S/T)(L/I)N(H/Q)(A/V/C)(K/E/R) (S/I/T/N/C)(V/L/A/T/I/N)G(L/I)(L/S/M)(G/L/D/N/E)(D/N/E)G(F/L)G(T/E/R/S/A)(T/S)(L/P/R)(E/G)M(S/Y/F/C/T)(K/R/L)(R/K/N/M)(D/G/N)L(M/I/F).

In varying embodiments, the variant acyl-acyl carrier protein (ACP) thioesterase (TE) comprises:

iv) a specificity domain comprising at least 60% sequence identity, e.g., at least 65%, 70%, 75%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% sequence identity to an amino acid sequence selected from the group consisting of amino acid residues 125-163 of SEQ ID NO:43 and amino acid residues 125-163 of SEQ ID NO:44; wherein the amino acid residue at or corresponding to position 127 is Valine, the amino acid residue at or corresponding to position 133 is Leucine, the amino acid residue at or corresponding to position 137 is Alanine and the amino acid residue at or corresponding to position 163 is Isoleucine, and a catalytic domain from a C10:0 acyl-ACP preferring TE or from a C12:0 acyl-ACP preferring TE;

v) a specificity domain comprising at least 60% sequence identity, e.g., at least 65%, 70%, 75%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% sequence identity to an amino acid sequence selected from the group consisting of amino acid residues 125-163 of SEQ ID NO:43 and amino acid residues 125-163 of SEQ ID NO:44; wherein the amino acid residue at or corresponding to position 127 is Leucine, the amino acid residue at or corresponding to position 133 is Methionine, the amino acid residue at or corresponding to position 137 is Threonine and the amino acid residue at or corresponding to position 163 is Methionine, and a catalytic domain from a C10:0 acyl-ACP preferring TE or from a C14:0 acyl-ACP preferring TE; and/or

vi) a specificity domain comprising at least 60% sequence identity, e.g., at least 65%, 70%, 75%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% sequence identity, to amino acid residues 156-203 of SEQ ID NO:61, wherein the amino acid residue at or corresponding to position 166 is Glutamine; the amino acid residue at or corresponding to position 175 is Threonine; the amino acid residue at or corresponding to position 177 is Isoleucine; the amino acid residue at or corresponding to position 179 is Leucine; the amino acid residue at or corresponding to position 186 is Leucine; the amino acid residue at or corresponding to position 190 is Lysine; the amino acid at or corresponding to position 198 is Isoleucine and the amino acid at or corresponding to position 203 is Lysine, and a catalytic domain from a C8:0 acyl-ACP preferring TE or from a C12:0 acyl-ACP preferring TE.

vii) a specificity domain comprising at least 60% sequence identity, e.g., at least 65%, 70%, 75%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% sequence identity, to amino acid residues 156-193 SEQ ID NO:61; wherein the amino acid residue at or corresponding to position 163 is Tyrosine, or the amino acid residue at or corresponding to position 186 is Proline; and a catalytic domain from a C8:0 acyl-ACP preferring TE, from a C10:0 acyl-ACP preferring TE or from a C12:0 acyl-ACP preferring TE.

In embodiments where the specificity domain comprises at least 60% sequence identity, e.g., at least 65%, 70%, 75%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% sequence identity, to an amino acid sequence selected from the group consisting of amino acid residues 125-163 of SEQ ID NO:43 and amino acid residues 125-163 of SEQ ID NO:44, cleavage to the mature form of the variant acyl-ACP thioesterase can be increased, promoted and/or facilitated when the amino acid residue at or corresponding to position 91 is Asparagine, the amino acid at or corresponding to position 92 is Proline and the amino acid position 102 is Proline.

Alternately, or in addition, to increase expression levels and/or increase enzymatic activity of the variant acyl-ACP thioesterase in a host cell, the variant acyl-ACP thioesterases can be expressed with a hydrophobic domain N-terminally positioned in relation to the specificity domain. In varying embodiments, the N-terminal amino acid residue of the hydrophobic domain is a Leucine. In varying embodiments, the N-terminal amino acid residue of the hydrophobic domain is a Proline. In one embodiment, the subsequence comprising the hydrophobic domain can be 15, 16, 17, or 18 amino acids in length as appropriate. In varying embodiments, the hydrophobic domain is an amino acid subsequence within the N-terminal half of an acyl-ACP TE corresponding to amino acid residues 61-77 of SEQ ID NO:43; amino acid residues 61-77 of SEQ ID NO:44; amino acid residues 85-101 of SEQ ID NO:45; amino acid residues 78-95 of SEQ ID NO:46; amino acid residues 50-66 of SEQ ID NO:47; amino acid residues 91-107 of SEQ ID NO:60; or amino acid residues 90-106 of SEQ ID NO:61. In varying embodiments, the hydrophobic domain comprises a motif comprising the amino acid sequence (L/-)(P/H)(G/D/V)(W/L)(S/N)(M/RN)(P/L/S)(L/F)(E/A/T/S)(L/A/K)(I/V)TT(I/V)F(S/L/V/G)(A/K/V)(A/P). As described and demonstrated herein, the hydrophobic domain can, but need not, comprise an N-terminal Leucine residue.

Yet another way has been found to increase the impact of a thioesterase on the fatty acid profile of a host cell. A variant acyl-ACP thioesterase can be expressed with a linker domain N-terminally positioned in relation to the hydrophobic domain. The linker domain can be rich in proline. The linker domain can be used alone or in combination with either or both of the variant hydrophobic domain and specificity-imparting variations discussed above. In embodiments where the variant acyl-ACP comprises a transit or signal peptide, e.g., a plastid transit peptide, the linker domain is C-terminally positioned in relation to the transit peptide (e.g., from N- to C-terminus, the linker domain is positioned between a transit peptide, when present and a hydrophobic domain). In varying embodiments, the acyl-ACP linker domains are proline rich and comprise 3, 4, 5, 6 or more proline residues. In varying embodiments, the linker domain encompasses an amino acid subsequence within the N-terminal half of an acyl-ACP TE corresponding to at least 5 amino acid residues, e.g, at least 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35 or 36 residues, extending N-terminally from the C-terminus from an acyl-ACP-TE subsequence and corresponding to residues selected from the group consisting of amino acid residues 43-59 of SEQ ID NO:43; amino acid residues 43-59 of SEQ ID NO:44; amino acid residues 49-83 of SEQ ID NO:45; amino acid residues 53-77 of SEQ ID NO:46; amino acid residues 15-48 of SEQ ID NO:47; amino acid residues 57-89 of SEQ ID NO:60; and amino acid residues 56-88 of SEQ ID NO:61.

In varying embodiments, subsequence comprising the linker domain comprises:

a) at least 5 amino acid residues, e.g., at least 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39 or 40 residues, extending from the C-terminus from an acyl-ACP-TE subsequence corresponding to residues selected from the group consisting of amino acid residues 43-59 of SEQ ID NO:43; amino acid residues 43-59 of SEQ ID NO:44; amino acid residues 49-83 of SEQ ID NO:45; amino acid residues 53-77 of SEQ ID NO:46; amino acid residues 15-48 of SEQ ID NO:47; amino acid residues 57-89 of SEQ ID NO:60; and amino acid residues 56-88 of SEQ ID NO:61;

b) at least 5 amino acid residues, e.g., at least 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39 or 40 residues, extending from the C-terminus from an acyl-ACP-TE subsequence comprising at least 60% sequence identity, e.g., at least 65%, 70%, 75%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% sequence identity, to an amino acid sequence selected from the group consisting of amino acid residues 43-59 of SEQ ID NO:43; amino acid residues 43-59 of SEQ ID NO:44; amino acid residues 49-83 of SEQ ID NO:45; amino acid residues 53-77 of SEQ ID NO:46; amino acid residues 15-48 of SEQ ID NO:47; amino acid residues 57-89 of SEQ ID NO:60; and amino acid residues 56-88 of SEQ ID NO:61;

c) at least 5 amino acid residues, e.g., at least 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39 or 40 residues, extending from the C-terminus from an acyl-ACP-TE subsequence selected from the group consisting of amino acid residues 43-59 of SEQ ID NO:43; amino acid residues 43-59 of SEQ ID NO:44; amino acid residues 49-83 of SEQ ID NO:45; amino acid residues 53-77 of SEQ ID NO:46; amino acid residues 15-48 of SEQ ID NO:47; amino acid residues 57-89 of SEQ ID NO:60; and amino acid residues 56-88 of SEQ ID NO:61; and/or

d) an amino acid sequence selected from the group consisting of SEQ ID NO:37, SEQ ID NO:38, SEQ ID NO:39, SEQ ID NO:40; SEQ ID NO:41 and SEQ ID NO:42.

In varying embodiments, the variant acyl-ACP thioesterases may further comprise a signal peptide or a transit peptide. In varying embodiments, the transit peptide directs the variant acyl-ACP thioesterase to a plastid, e.g., the chloroplast. In varying embodiments, the plastid transit peptide comprises an amino acid sequence selected from the group consisting of MATASTFSAFNARCGDLRRSAGSGPRRPARPLPVRGRA, SGPRRPARPLPVR, SGPRRPARPLPVRAAIASEVPVATTSPR, RPARPLPVRGRA, RPARPLPVRAAIASEVPVATTSPR, RCGDLRRSAGSGPRRPARPLPVRGRA, RCGDLRRSAGSGPRRPARPLPVRAAIASEVPVATTSPR, PARPLPVR, PARPLPVRAAIASEVPVATTSPR, RRPARPLPVR, and RRPARPLPVRAAIASEVPVATTSPR. Other plastid transit sequences are known in the art and described in further detail below.

In varying embodiments, the polynucleotide encodes a variant acyl-ACP thioesterase having an N-terminal region that is heterologous to the C-terminal region or to the catalytic domain and comprising a hydrophobic domain and/or a specificity domain from an acyl-ACP TE selected from the group consisting of Umbellularia californica fatty acyl-ACP thioesterase (e.g., GenBank Acc. Nos. AAC49001, Q41635, M94159), Cinnamomum camphora fatty acyl-ACP thioesterase (e.g., GenBank Acc. Nos. Q39473; U31813), Myristica fragrans fatty acyl-ACP thioesterase (e.g., GenBank Acc. Nos. AAB71729, AAB71730, AAB717291.1), Elaeis guineensis fatty acyl-ACP thioesterase (e.g., GenBank Acc. Nos. ABD83939, AAD42220, AAL15645), Populus tomentosa fatty acyl-ACP thioesterase (e.g., GenBank Acc. No. ABC47311), Arabidopsis thaliana fatty acyl-ACP thioesterase (e.g., GenBank Acc. Nos. NP_172327, CAA85387, CAA85388), Arabidopsis thaliana fatty acyl-ACP thioesterase (e.g., GenBank Acc. No.), Gossypium hirsutum fatty acyl-ACP thioesterase (e.g., GenBank Acc. Nos. AAD01982, Q9SQI3), Cuphea wrightii fatty acyl-ACP thioesterase (e.g., GenBank Acc. Nos. U56103, Q39663), Cuphea lanceolata fatty acyl-ACP thioesterase (e.g., GenBank Acc. Nos. CAA54060, CAB60830, CAC19933), Cuphea hookeriana fatty acyl-ACP thioesterase (e.g., GenBank Acc. Nos. AAC72882, U39834, Q39513, Q39514, AAC49269), Cuphea calophylla subsp. mesostemon fatty acyl-ACP thioesterase (e.g., GenBank Acc. No. ABB71581), Cuphea palustris fatty acyl-ACP thioesterase (e.g., GenBank Acc. Nos. AAC49180; AAC49179), Vitis vinifera fatty acyl-ACP thioesterase (e.g., GenBank Acc. No. CAN81819), Garcinia mangostana fatty acyl-ACP thioesterase (e.g., GenBank Acc. No. AAB51525), Brassica juncea fatty acyl-ACP thioesterase (e.g., GenBank Acc. No. ABI18986), Madhuca longifolia fatty acyl-ACP thioesterase (e.g., GenBank Acc. No. AAX51637), Brassica napus fatty acyl-ACP thioesterase (e.g., GenBank Acc. Nos. ABH11710; CAA52070.1), Oryza sativa (indica cultivar-group) fatty acyl-ACP thioesterase (e.g., GenBank Acc. No. EAY86877), Oryza sativa (japonica cultivar-group) fatty acyl-ACP thioesterase (e.g., GenBank Acc. No. NP_001068400), Oryza sativa (indica cultivar-group) fatty acyl-ACP thioesterase (e.g., GenBank Acc. No. EAY99617), Ulmus Americana fatty acyl-ACP thioesterase (e.g., GenBank Acc. No. AAB71731, 024420), Iris germanica fatty acyl-ACP thioesterase (e.g., GenBank Acc. Nos. AAG43858, AAG43858.1), Ricinus communis fatty acyl-ACP thioesterase (e.g., GenBank Acc. No. ABS30422.1), Helianthus annuus acyl-ACP thioesterase (e.g., GenBank Accession No. AAL79361.1), Jatropha curcas acyl-ACP thioesterase (e.g., GenBank Accession No. ABX82799.3), Zea mays oleoyl-acyl carrier protein thioesterase, (e.g., GenBank Accession No. ACG40089.1), and Haematococcus pluvialis fatty acyl-ACP thioesterase (e.g., GenBank Accession No. HM560034.1).

In particular embodiments, the variant acyl-ACP thioesterase comprises an amino acid sequence selected from the group consisting of SEQ ID NO:3, SEQ ID NO:5, SEQ ID NO:7, SEQ ID NO:9, SEQ ID NO:11, SEQ ID NO:13, SEQ ID NO:15; SEQ ID NO:18, SEQ ID NO:20, SEQ ID NO:22, SEQ ID NO:24, SEQ ID NO:26; SEQ ID NO:28; SEQ ID NO:30, SEQ ID NO:32; SEQ ID NO:34; SEQ ID NO:36; SEQ ID NO:49, SEQ ID NO:51; SEQ ID NO:53; SEQ ID NO:55; SEQ ID NO:57 and SEQ ID NO:59.

In particular embodiments, the variant acyl-ACP thioesterase is encoded by a nucleic acid sequence selected from the group consisting of SEQ ID NO:2, SEQ ID NO:4, SEQ ID NO:6, SEQ ID NO:8, SEQ ID NO:10, SEQ ID NO:12, SEQ ID NO:14; SEQ ID NO:17, SEQ ID NO:19, SEQ ID NO:21, SEQ ID NO:23, SEQ ID NO:25; SEQ ID NO:27; SEQ ID NO:29, SEQ ID NO:31; SEQ ID NO:33; SEQ ID NO:35; SEQ ID NO:48, SEQ ID NO:50; SEQ ID NO:52; SEQ ID NO:54; SEQ ID NO:56 and SEQ ID NO:58.

III. Microbe Engineering—Expression Cassettes and Vectors

Promoters, cDNAs, and 3′UTRs, as well as other elements of the vectors, can be generated through cloning techniques using fragments isolated from native sources (see for example Green and Sambrook, Molecular Cloning: A Laboratory Manual, 4th Edition, 2012, Cold Spring Harbor Press; and U.S. Pat. No. 4,683,202). Alternatively, elements can be generated synthetically using known methods (see for example Gene. 1995 Oct. 16; 164(1):49-53).

A. Codon-Optimization for Expression

DNA encoding a polypeptide to be expressed in a microorganism, e.g., a variant acyl-ACP thioesterase and selectable marker can be codon-optimized cDNA. Methods of recoding genes for expression in microalgae are described in U.S. Pat. No. 7,135,290. Additional information for codon optimization is available, e.g., at the Codon Usage Database at kazusa.or.jp/codon/. The table for Prototheca preferred codon usage is also provided in U.S. Patent Publ. No. 2012/0283460, hereby incorporated herein by reference in its entirety for all purposes.

B. Promoters

Many promoters are active in microalgae, including promoters that are endogenous to the microalgae being transformed, as well as promoters that are not endogenous to the algae being transformed (i.e., promoters from other algae, promoters from higher plants, and promoters from plant viruses or algae viruses). Exogenous and/or endogenous promoters that are active in microalgae, and antibiotic resistance genes functional in microalgae are described by e.g., Curr Microbiol. 1997 December; 35(6):356-62 (Chlorella vulgaris); Mar Biotechnol (NY). 2002 January; 4(1):63-73 (Chlorella ellipsoidea); Mol Gen Genet. 1996 Oct. 16; 252(5):572-9 (Phaeodactylum tricornutum); Plant Mol. Biol. 1996 April; 31(1):1-12 (Volvox carteri); Proc Natl Acad Sci USA. 1994 Nov. 22; 91(24):11562-6 (Volvox carteri); Falciatore A, Casotti R, Leblanc C, Abrescia C, Bowler C, PMID: 10383998, 1999 May; 1(3):239-251 (Laboratory of Molecular Plant Biology, Stazione Zoologica, VIIIa Comunale, 1-80121 Naples, Italy) (Phaeodactylum tricornutum and Thalassiosira weissflogii); Plant Physiol. 2002 May; 129(1):7-12. (Porphyridium sp.); Proc Natl Acad Sci USA. 2003 Jan. 21; 100(2):438-42. (Chlamydomonas reinhardtii); Proc Natl Acad Sci USA. 1990 February; 87(3):1228-32. (Chlamydomonas reinhardtii); Nucleic Acids Res. 1992 Jun. 25; 20(12):2959-65; Mar Biotechnol (NY). 2002 January; 4(1):63-73 (Chlorella); Biochem Mol Biol Int. 1995 August; 36(5):1025-35 (Chlamydomonas reinhardtii); J. Microbiol. 2005 August; 43(4):361-5 (Dunaliella); Yi Chuan Xue Bao. 2005 April; 32(4):424-33 (Dunaliella); Mar Biotechnol (NY). 1999 May; 1(3):239-251. (Thalassiosira and Phaedactylum); Koksharova, Appl Microbiol Biotechnol 2002 February; 58(2):123-37 (various species); Mol Genet Genomics. 2004 February; 271(1):50-9 (Thermosynechococcus elongates); J. Bacteriol. (2000), 182, 211-215; FEMS Microbiol Lett. 2003 Apr. 25; 221(2):155-9; Plant Physiol. 1994 June; 105(2):635-41; Plant Mol. Biol. 1995 December; 29(5):897-907 (Synechococcus PCC 7942); Mar Pollut Bull. 2002; 45(1-12):163-7 (Anabaena PCC 7120); Proc Natl Acad Sci USA. 1984 March; 81(5):1561-5 (Anabaena (various strains)); Proc Natl Acad Sci USA. 2001 Mar. 27; 98(7):4243-8 (Synechocystis); Wirth, Mol Gen Genet. 1989 March; 216(1):175-7 (various species); Mol Microbiol, 2002 June; 44(6):1517-31 and Plasmid, 1993 September; 30(2):90-105 (Fremyella diplosiphon); Hall et al. (1993) Gene 124: 75-81 (Chlamydomonas reinhardtii); Gruber et al. (1991). Current Micro. 22: 15-20; Jarvis et al. (1991) Current Genet. 19: 317-322 (Chlorella); for additional promoters see also table 1 from U.S. Pat. No. 6,027,900).

The promoter used to express an exogenous gene can be the promoter naturally linked to that gene or can be a heterologous gene. Some promoters are active in more than one species of microalgae. Other promoters are species-specific. Illustrative promoters include promoters such as RBCS2 from Chlamydomonas reinhardtii and viral promoters, such as cauliflower mosaic virus (CMV) and Chlorella virus, which have been shown to be active in multiple species of microalgae (see for example Plant Cell Rep. 2005 March; 23(10-11):727-35; J. Microbiol. 2005 August; 43(4):361-5; Mar Biotechnol (NY). 2002 January; 4(1):63-73). In other embodiments, the Botryococcus malate dehydrogenase promoter, or the Chlamydomonas reinhardtii RBCS2 promoter can be used. Optionally, at least 10, 20, 30, 40, 50, or 60 nucleotides or more of these sequences containing a promoter are used. In varying embodiments, the promoters used in the expression cassettes are endogenous to species of the genus Chlorella.

Promoters useful for expression of exogenous genes in Chlorella include the promoter of the Chlorella HUP 1 gene and the Chlorella ellipsoidea nitrate reductase promoter Chlorella virus promoters can also be used to express genes in Chlorella, described in U.S. Pat. No. 6,395,965. Additional promoters active in Chlorella can be found, for example, in Biochem Biophys Res Commun. 1994 Oct. 14; 204(1):187-94; Plant Mol. Biol. 1994 October; 26(1):85-93; Virology. 2004 Aug. 15; 326(1):150-9; and Virology. 2004 Jan. 5; 318(1):214-23.

C. Selectable Markers

Any of a wide variety of selectable markers can be employed in a transgene construct useful for transforming microalgae. Examples of suitable selectable markers include the sucrose invertase gene, nitrate reductase gene, the hygromycin phosphotransferase gene (HPT), the neomycin phosphotransferase gene, and the ble gene, which confers resistance to phleomycin. Methods of determining sensitivity of microalgae to antibiotics are well known. For example, Mol Gen Genet. 1996 Oct. 16; 252(5):572-9. Examples below illustrate the use of sucrose invertase as a selectable marker in strains of Prototheca.

D. Inducible Expression

The present invention also provides for the use of an inducible promoter to express a gene of interest. In particular, the use of an inducible promoter to express a variant acyl-ACP thioesterase gene permits production of the variant acyl-ACP thioesterase after growth of the microorganism when conditions have been adjusted.

Inducible promoters useful include those that mediate transcription of an operably linked gene in response to a stimulus, such as an exogenously provided small molecule (e.g., glucose), temperature (heat or cold), light, etc. Suitable promoters can activate transcription of an essentially silent gene or upregulate, e.g., substantially, transcription of an operably linked gene that is transcribed at a low level. In the latter case, the level of transcription of the acyl-ACP thioesterase does not significantly interfere with the growth of the microorganism in which it is expressed.

E. Expression of Two or More Exogenous Genes

Further, a genetically engineered microorganism, such as a microalgae, may comprise and express two or more exogenous genes, such as, for example, a variant fatty acyl-ACP thioesterase and a gene encoding a lysophosphatidic acid acyltransferase (LPAAT). One or both genes can be expressed using an inducible promoter, which allows the relative timing of expression of these genes to be controlled to enhance the lipid yield and conversion to fatty acid esters. Expression of the two or more exogenous genes may be under control of the same inducible promoter or under control of different inducible promoters. In the latter situation, expression of a first exogenous gene can be induced for a first period of time (during which expression of a second exogenous gene may or may not be induced) and expression of a second exogenous gene can be induced for a second period of time (during which expression of a first exogenous gene may or may not be induced). Provided herein are vectors and methods for engineering lipid-producing microbes to metabolize sucrose, which is an advantageous trait because it allows the engineered cells to convert sugar cane feedstocks into lipids.

Examples of further modifications suitable for use in the present invention are include genetically engineering strains of microalgae to express two or more exogenous genes, one encoding a transporter of a fixed carbon source (such as sucrose) and a second encoding a sucrose invertase enzyme. The resulting fermentable organisms produce hydrocarbons at lower manufacturing cost than what has been obtainable by previously known methods of biological hydrocarbon production. Insertion of the two exogenous genes described above can be combined with the disruption of polysaccharide biosynthesis through directed and/or random mutagenesis, which steers ever greater carbon flux into hydrocarbon production. Individually and in combination, trophic conversion, engineering to alter hydrocarbon production and treatment with exogenous enzymes alter the hydrocarbon composition produced by a microorganism. The alteration can be a change in the amount of hydrocarbons produced, the amount of one or more hydrocarbon species produced relative to other hydrocarbons, and/or the types of hydrocarbon species produced in the microorganism. For example, microalgae can be engineered to produce a higher amount and/or percentage of TAGs.

F. Compartmentalized Expression

The present invention also provides for compartmentalized expression of a gene of interest. In some embodiments, it may be desirable to target expression of the acyl-ACP thioesterase to one or more cellular compartments. Illustrative organelles for targeting are lipid bodies, plastids (including chloroplasts), mitochondria, and endoplasmic reticulum.

1. Expression and Targeting to Plastids

Proteins expressed in the nuclear genome of Prototheca can be targeted to the plastid using plastid targeting signals. Plastid targeting sequences endogenous to Chlorella are known, such as genes in the Chlorella nuclear genome that encode proteins that are targeted to the plastid; see for example GenBank Accession numbers AY646197 and AF499684, and in one embodiment, such control sequences are used in the vectors of the present invention to target expression of a protein to a Prototheca plastid.

The Examples below describe the use of algal plastid targeting sequences to target heterologous proteins to the correct compartment in the host cell. cDNA libraries were made using Prototheca moriformis and Chlorella protothecodies cells and are described in the Examples of U.S. Patent Publ. No. 2012/0283460 and in PCT Application No. PCT/US2009/066142. Amino acid sequences of the algal plastid targeting sequences identified from the cDNA libraries useful plastid targeting of recombinantly expressed variant acyl-ACP thioesterases are provided in U.S. Patent Publ. No. 2012/0283460 and herein. In varying embodiments, the plastid transit peptide comprises an amino acid sequence selected from the group consisting of MATASTFSAFNARCGDLRRSAGSGPRRPARPLPVRGRA, SGPRRPARPLPVR, SGPRRPARPLPVRAAIASEVPVATTSPR, RPARPLPVRGRA, RPARPLPVRAAIASEVPVATTSPR, RCGDLRRSAGSGPRRPARPLPVRGRA, RCGDLRRSAGSGPRRPARPLPVRAAIASEVPVATTSPR, PARPLPVR, PARPLPVRAAIASEVPVATTSPR, RRPARPLPVR, and RRPARPLPVRAAIASEVPVATTSPR.

In one embodiment of the present invention, the expression of a polypeptide in a microorganism is targeted to chloroplasts. Methods for targeting expression of a heterologous gene to the chloroplast are known and can be employed in the present invention. Methods for targeting gene products into chloroplasts are described in Shrier et al., EMBO J. (1985) 4:25 32. See also Tomai et al. Gen. Biol. Chem. (1988) 263:15104 15109 and U.S. Pat. No. 4,940,835 for the use of transit peptides for translocating nuclear gene products into the chloroplast. Methods for directing the transport of proteins to the chloroplast are also reviewed in Kenauf TIBTECH (1987) 5:40 47. Chloroplast targeting sequences endogenous to Chlorella are known, such as genes in the Chlorella nuclear genome that encode proteins that are targeted to the chloroplast; see for example GenBank Accession numbers AY646197 and AF499684.

Wageningen UR-Plant Research International sells an IMPACTVECTOR1.4 vector, which uses the secretion signal of the Chrysanthemum morifolium small subunit protein to deliver a heterologous protein into the chloroplast stroma (cytoplasmic) environment, shuttling across a double membrane system. The protein is fused to the first 11 amino acids of the mature rubisco protein in order to allow proper processing of the signal peptide (Wong et al., Plant Molecular Biology 20: 81-93 (1992)). The signal peptide contains a natural intron from the RbcS gene.

In another approach, the chloroplast genome is genetically engineered to express the heterologous protein. Stable transformation of chloroplasts of Chlamydomonas reinhardtii (a green alga) using bombardment of recipient cells with high-velocity tungsten microprojectiles coated with foreign DNA has been described. See, for example, Boynton et al., Science (1988) 240: 1534 1538; Blowers et al. Plant Cell (1989) 1:123 132 and Debuchy et al., EMBO J. (1989) 8: 2803 2809. The transformation technique, using tungsten microprojectiles, is described by Klein et al., Nature (London) (1987) 7:70 73. Other methods of chloroplast transformation for both plants and microalgae are known. See for example U.S. Pat. Nos. 5,693,507; 6,680,426; and Plant Physiol. 2002 May; 129(1):7-12; and Plant Biotechnol J. 2007 May; 5(3):402-12.

As described in U.S. Pat. No. 6,320,101 (issued Nov. 20, 2001 to Kaplan et al.; which is incorporated herein by reference), cells can be chemically treated so as to reduce the number of chloroplasts per cell to about one. Then, the heterologous nucleic acid can be introduced into the cells via particle bombardment with the aim of introducing at least one heterologous nucleic acid molecule into the chloroplasts. The heterologous nucleic acid is selected such that it is integratable into the chloroplast's genome via homologous recombination which is readily effected by enzymes inherent to the chloroplast. To this end, the heterologous nucleic acid includes, in addition to a gene of interest, at least one nucleic acid sequence that is derived from the chloroplast's genome. In addition, the heterologous nucleic acid typically includes a selectable marker. Further details relating to this technique are found in U.S. Pat. Nos. 4,945,050 and 5,693,507 which are incorporated herein by reference. A polypeptide can thus be produced by the protein expression system of the chloroplast.

U.S. Pat. No. 7,135,620 (issued Nov. 14, 2006 to Daniell et al.; incorporated herein by reference) describes chloroplast expression vectors and related methods. Typical expression cassettes include the following components: the 5′ untranslated region from a microorganism gene or chloroplast gene such as psbA which will provide for transcription and translation of a DNA sequence encoding a polypeptide of interest in the chloroplast; a DNA sequence encoding a polypeptide of interest; and a translational and transcriptional termination region, such as a 3′ inverted repeat region of a chloroplast gene that can stabilize RNA of introduced genes, thereby enhancing foreign gene expression. The cassette can optionally include an antibiotic resistance gene.

Typically, the expression cassette is flanked by convenient restriction sites for insertion into an appropriate genome. The expression cassette can be flanked by DNA sequences from chloroplast DNA to facilitate stable integration of the expression cassette into the chloroplast genome, particularly by homologous recombination. Alternatively, the expression cassette may remain unintegrated, in which case, the expression cassette typically includes a chloroplast origin of replication, which is capable of providing for replication of the heterologous DNA in the chloroplast.

The expression cassette generally includes a promoter region from a gene capable of expression in the chloroplast. The promoter region may include promoters obtainable from chloroplast genes, such as the psbA gene from spinach or pea, or the rbcL and atpB promoter region from maize and Rma promoters. Examples of promoters are described in Hanley-Bowdoin and Chua, TIBS (1987) 12:67 70; Mullet et al., Plant Molec Biol. (1985) 4: 39 54; Hanley-Bowdoin (1986) PhD. Dissertation, the Rockefeller University; Krebbers et al., Nucleic Acids Res. (1982) 10: 4985 5002; Zurawaki et al., Nucleic Acids Res. (1981) 9:3251 3270; and Zurawski et al., Proc. Nat'l Acad. Sci. U.S.A. (1982) 79: 7699 7703. Other promoters can be identified and the relative strength of promoters so identified evaluated, by placing a promoter of interest 5′ to a promoterless marker gene and observing its effectiveness relative to transcription obtained from, for example, the promoter from the psbA gene, a relatively strong chloroplast promoter. The efficiency of heterologous gene expression additionally can be enhanced by any of a variety of techniques. These include the use of multiple promoters inserted in tandem 5′ to the heterologous gente, for example a double psbA promoter, the addition of enhancer sequences and the like.

Numerous promoters active in the Chlorella chloroplast can be used for expression of exogenous genes in the Chlorella chloroplast, such as those found in GenBank accession number NC001865 (Chlorella vulgaris chloroplast, complete genome),

Where it is desired to provide for inducible expression of the heterologous gene, an inducible promoter and/or a 5′ untranslated region containing sequences which provide for regulation at the level of transcription and/or translation (at the 3′ end) may be included in the expression cassette. For example, the 5′ untranslated region can be from a gene wherein expression is regulatable by light. Similarly, 3′ inverted repeat regions could be used to stabilize RNA of heterologous genes. Inducible genes may be identified by enhanced expression in response to a particular stimulus of interest and low or absent expression in the absence of the stimulus. For example, a light-inducible gene can be identified where enhanced expression occurs during irradiation with light, while substantially reduced expression or no expression occurs in low or no light. Light regulated promoters from green microalgae are known (see for example Mol Genet Genomics. 2005 December; 274(6):625-36).

The termination region which is employed will be primarily one of convenience, since the termination region appears to be relatively interchangeable among chloroplasts and bacteria. The termination region may be native to the transcriptional initiation region, may be native to the DNA sequence of interest, or may be obtainable from another source. See, for example, Chen and Orozco, Nucleic Acids Res. (1988) 16:8411.

The expression cassettes may be transformed into a plant cell of interest by any of a number of methods. These methods include, for example, biolistic methods (See, for example, Sanford, Trends In Biotech. (1988) 6:299 302, U.S. Pat. No. 4,945,050; electroporation (Fromm et al., Proc. Nat'l. Acad. Sci. (USA) (1985) 82:5824 5828); use of a laser beam, microinjection or any other method capable of introducing DNA into a chloroplast.

Additional descriptions of chloroplast expression vectors suitable for use in microorganisms such as microalgae are found in U.S. Pat. No. 7,081,567 (issued Jul. 25, 2006 to Xue et al.); U.S. Pat. No. 6,680,426 (issued Jan. 20, 2004 to Daniell et al.); and U.S. Pat. No. 5,693,507 (issued Dec. 2, 1997 to Daniell et al.).

Proteins expressed in the nuclear genome of Chlorella can be targeted to the chloroplast using chloroplast targeting signals. Chloroplast targeting sequences endogenous to Chlorella are known, such as genes in the Chlorella nuclear genome that encode proteins that are targeted to the chloroplast; see for example GenBank Accession numbers AY646197 and AF499684. Proteins can also be expressed in the Chlorella chloroplast by insertion of genes directly into the chloroplast genome. Chloroplast transformation typically occurs through homologous recombination, and can be performed if chloroplast genome sequences are known for creation of targeting vectors (see for example the complete genome sequence of a Chlorella chloroplast; Genbank accession number NC001865).

G. Transformation

Cells can be transformed by any suitable technique including, e.g., biolistics, electroporation, glass bead transformation and silicon carbide whisker transformation.

Vectors for transformation of microorganisms in accordance with the present invention can be prepared by known techniques familiar to those skilled in the art. In one embodiment, an exemplary vector design for expression of an acyl-ACP thioesterase gene in a microorganism such as a microalgae contains a gene encoding an acyl-ACP thioesterase in operable linkage with a promoter active in microalgae. Alternatively, if the vector does not contain a promoter in operable linkage with the gene of interest, the gene can be transformed into the cells such that it becomes operably linked to an endogenous promoter at the point of vector integration. The promoterless method of transformation has been proven to work in microalgae (see for example Plant Journal 14:4, (1998), pp. 441-447). The vector can also contain a second gene that encodes a protein that, e.g., imparts resistance to an antibiotic or herbicide, i.e., a selectable marker. Optionally, one or both gene(s) is/are followed by a 3′ untranslated sequence containing a polyadenylation signal. Expression cassettes encoding the two genes can be physically linked in the vector or on separate vectors. Co-transformation of microalgae can also be used, in which distinct vector molecules are simultaneously used to transform cells (see for example Protist 2004 December; 155(4):381-93). The transformed cells can be optionally selected based upon the ability to grow in the presence of the antibiotic or other selectable marker under conditions in which cells lacking the resistance cassette would not grow.

IV. Host Cells—Oil- or Lipid-Producing Microorganisms

Any species of organism that produces suitable lipid and/or hydrocarbon can be used, although microorganisms that naturally produce high levels of suitable lipid and/or hydrocarbon are preferred. Production of hydrocarbons by microorganisms is reviewed by Metzger et al. Appl Microbiol Biotechnol (2005) 66: 486-496 and A Look Back at the U.S. Department of Energy's Aquatic Species Program: Biodiesel from Algae, NREUTP-580-24190, John Sheehan, Terri Dunahay, John Benemann and Paul Roessler (1998).

Considerations for the selection of microorganisms include, in addition to production of suitable lipids or hydrocarbons for production of oils, fuels, and oleochemicals: (1) high lipid content as a percentage of cell weight; (2) ease of growth; (3) ease of genetic engineering; and (4) ease of biomass processing. In particular embodiments, the wild-type or genetically engineered microorganism yields cells that are at least 40%, at least 45%, at least 50%, at least 55%, at least 60%, at least 65%, or at least 70% or more lipid. Preferred organisms grow heterotrophically (on sugars in the absence of light) or can be engineered to do so using, for example, methods disclosed herein. The ease of transformation and availability of selectable markers and promoters, constitutive or inducible, that are functional in the microorganism affect the ease of genetic engineering. Processing considerations can include, for example, the availability of effective means for lysing the cells.

A. Algae

In one embodiment of the present invention, the microorganism is a microalgae. Nonlimiting examples of microalgae that can be used for expression of variant acyl-ACP thioestesterases include, e.g., Achnanthes orientalis, Agmenellum, Amphiprora hyaline, Amphora coffeiformis, Amphora coffeiformis linea, Amphora coffeiformis punctata, Amphora coffeiformis taylori, Amphora coffeiformis tenuis, Amphora delicatissima, Amphora delicatissima capitata, Amphora sp., Anabaena, Ankistrodesmus, Ankistrodesmus falcatus, Boekelovia hooglandii, Borodinella sp., Botryococcus braunii, Botryococcus sudeticus, Bracteococcus minor, Bracteococcus medionucleatus, Carteria, Chaetoceros gracilis, Chaetoceros muelleri, Chaetoceros muelleri subsalsum, Chaetoceros sp., Chlorella anitrata, Chlorella Antarctica, Chlorella aureoviridis, Chlorella candida, Chlorella capsulate, Chlorella desiccate, Chlorella ellipsoidea, Chlorella emersonii, Chlorella fusca, Chlorella fusca var. vacuolata, Chlorella glucotropha, Chlorella infusionum, Chlorella infusionum var. actophila, Chlorella infusionum var. auxenophila, Chlorella kessleri, Chlorella lobophora (strain SAG 37.88), Chlorella luteoviridis, Chlorella luteoviridis var. aureoviridis, Chlorella luteoviridis var. lutescens, Chlorella miniata, Chlorella minutissima, Chlorella mutabilis, Chlorella nocturna, Chlorella ovalis, Chlorella parva, Chlorella photophila, Chlorella pringsheimii, Chlorella protothecoides (including any of UTEX strains 1806, 411, 264, 256, 255, 250, 249, 31, 29, 25), Chlorella protothecoides var. acidicola, Chlorella regularis, Chlorella regularis var. minima, Chlorella regularis var. umbricata, Chlorella reisiglii, Chlorella saccharophila, Chlorella saccharophila var. ellipsoidea, Chlorella salina, Chlorella simplex, Chlorella sorokiniana, Chlorella sp., Chlorella sphaerica, Chlorella stigmatophora, Chlorella vanniellii, Chlorella vulgaris, Chlorella vulgaris f. tertia, Chlorella vulgaris var. autotrophica, Chlorella vulgaris var. viridis, Chlorella vulgaris var. vulgaris, Chlorella vulgaris var. vulgaris f. tertia, Chlorella vulgaris var. vulgaris f. viridis, Chlorella xanthella, Chlorella zofingiensis, Chlorella trebouxioides, Chlorella vulgaris, Chlorococcum infusionum, Chlorococcum sp., Chlorogonium, Chroomonas sp., Chrysosphaera sp., Cricosphaera sp., Crypthecodinium cohnii, Cryptomonas sp., Cyclotella cryptica, Cyclotella meneghiniana, Cyclotella sp., Dunaliella sp., Dunaliella bardawil, Dunaliella bioculata, Dunaliella granulate, Dunaliella maritime, Dunaliella minuta, Dunaliella parva, Dunaliella peircei, Dunaliella primolecta, Dunaliella salina, Dunaliella terricola, Dunaliella tertiolecta, Dunaliella viridis, Dunaliella tertiolecta, Eremosphaera viridis, Eremosphaera sp., Ellipsoidon sp., Euglena, Franceia sp., Fragilaria crotonensis, Fragilaria sp., Gleocapsa sp., Gloeothamnion sp., Hymenomonas sp., Isochrysis aff galbana, Isochrysis galbana, Lepocinclis, Micractinium, Micractinium (UTEX LB 2614), Monoraphidium minutum, Monoraphidium sp., Nannochloris sp., Nannochloropsis salina, Nannochloropsis sp., Navicula acceptata, Navicula biskanterae, Navicula pseudotenelloides, Navicula pelliculosa, Navicula saprophila, Navicula sp., Nephrochloris sp., Nephroselmis sp., Nitschia communis, Nitzschia alexandrina, Nitzschia communis, Nitzschia dissipata, Nitzschia frustulum, Nitzschia hantzschiana, Nitzschia inconspicua, Nitzschia intermedia, Nitzschia microcephala, Nitzschia pusilla, Nitzschia pusilla elliptica, Nitzschia pusilla monoensis, Nitzschia quadrangular, Nitzschia sp., Ochromonas sp., Oocystis parva, Oocystis pusilla, Oocystis sp., Oscillatoria limnetica, Oscillatoria sp., Oscillatoria subbrevis, ParaChlorella kessleri, Pascheria acidophila, Pavlova sp., Phagus, Phormidium, Platymonas sp., Pleurochrysis carterae, Pleurochrysis dentate, Pleurochrysis sp., Prototheca wickerhamii, Prototheca stagnora, Prototheca portoricensis, Prototheca moriformis, Prototheca zopfii, PseudoChlorella aquatica, Pyramimonas sp., Pyrobotrys, Rhodococcus opacus, Sarcinoid chrysophyte, Scenedesmus armatus, Schizochytrium, Spirogyra, Spirulina platensis, Stichococcus sp., Synechococcus sp., Tetraedron, Tetraselmis sp., Tetraselmis suecica, Thalassiosira weissflogii, and Viridiella fridericiana.

Illustrative host cells feature oleaginous cells that produce altered fatty acid profiles and/or altered regiospecific distribution of fatty acids in glycerolipids, and products produced from the cells. Examples of oleaginous cells include microbial cells having a type II lipid biosynthesis pathway, including plastidic oleaginous cells such as those of oleaginous algae. Specific examples of cells include heterotrophic or obligate heterotophic microalgae of the phylum Chlorpophya, the class Trebouxiophytae, the order Chlorellales, or the family Chlorellacae. Examples of oleaginous microalgae are provided in Published PCT Patent Applications WO2008/151149, WO2010/06032, WO2011/150410, and WO2011/150411, including species of Chlorella and Prototheca, a genus comprising obligate heterotrophs. The oleaginous cells can be, for example, capable of producing 25, 30, 40, 50, 60, 70, 80, 85, or about 90% oil by cell weight, ±5%. The above mentioned publications also disclose methods for cultivating such cells and extracting oil, especially from microalgal cells; such methods are applicable to the cells disclosed herein. In any of the embodiments described herein, the cells can be heterotrophic cells comprising an exogenous invertase gene so as to allow the cells to produce oil from a sucrose feedstock.

1. Prototheca

In one embodiment, the microorganism is of the genus Prototheca. Naturally occurring and recombinant Prototheca strains find use for the production of lipid.

Prototheca is a remarkable microorganism for use in the production of lipid, because it can produce high levels of lipid, particularly lipids suitable for fuel and oleochemical production. The lipid produced by Prototheca has hydrocarbon chains of shorter chain length and a higher degree of saturation than that produced by other microalgae. Moreover, Prototheca lipid is generally free of pigment (low to undetectable levels of chlorophyll and certain carotenoids) and in any event contains much less pigment than lipid from other microalgae. Moreover, recombinant Prototheca cells provided by the invention can be used to produce lipid in greater yield and efficiency, and with reduced cost, relative to the production of lipid from other microorganisms. In addition, this microalgae grows heterotrophically and can be genetically engineered as Prototheca wickerhamii, Prototheca stagnora (including UTEX 327), Prototheca portoricensis, Prototheca moriformis (including UTEX strains 1441, 1435), and Prototheca zopfii. Species of the genus Prototheca are obligate heterotrophs.

Species of Prototheca for use in the invention can be identified by amplification of certain target regions of the genome. For example, identification of a specific Prototheca species or strain can be achieved through amplification and sequencing of nuclear and/or chloroplast DNA using primers and methodology using any region of the genome, for example using the methods described in Wu et al., Bot. Bull. Acad. Sin. (2001) 42:115-121 Identification of Chlorella spp. isolates using ribosomal DNA sequences. Well established methods of phylogenetic analysis, such as amplification and sequencing of ribosomal internal transcribed spacer (ITS1 and ITS2 rDNA), 23S rRNA, 18S rRNA, and other conserved genomic regions can be used by those skilled in the art to identify species of not only Prototheca, but other hydrocarbon and lipid producing organisms with similar lipid profiles and production capability. For examples of methods of identification and classification of algae also see for example Genetics, 2005 August; 170(4):1601-10 and RNA, 2005 April; 11(4):361-4.

Thus, genomic DNA comparison can be used to identify suitable species of microalgae to be used in the present invention. Regions of conserved genomic DNA, such as but not limited to DNA encoding for 23S rRNA, can be amplified from microalgal species and compared to consensus sequences in order to screen for microalgal species that are taxonomically related to the preferred microalgae used in the present invention. Examples of such DNA sequence comparison for species within the Prototheca genus are shown below. Genomic DNA comparison can also be useful to identify microalgal species that have been misidentified in a strain collection. Often a strain collection will identify species of microalgae based on phenotypic and morphological characteristics. The use of these characteristics may lead to miscategorization of the species or the genus of a microalgae. The use of genomic DNA comparison can be a better method of categorizing microalgae species based on their phylogenetic relationship.

Microalgae for use in the present invention typically have genomic DNA sequences encoding for 23S rRNA that have at least 99%, least 95%, at least 90%, or at least 85% nucleotide identity to at least one of the sequences listed in SEQ ID NOs: 62-70.

2. Chlorella

In one embodiment, the microorganism is of the genus Chlorella, for example, Chlorella protothecoides, Chlorella ellipsoidea, Chlorella minutissima, or Chlorella emersonii.

Chlorella is a genus of single-celled green algae, belonging to the phylum Chlorophyta. It is spherical in shape, about 2 to 10 μm in diameter, and is without flagella. Some species of Chlorella are naturally heterotrophic.

Chlorella, particularly Chlorella protothecoides, is one microorganism for use in expressing the variant acyl-ACP thioesterases because of its high composition of lipid, particularly long-chain lipid suitable for biodiesel. In addition, this microalgae grows heterotrophically and can be genetically engineered.

In one embodiment, the microorganism used for expression of a transgene is of the genus Chlorella, preferably, Chlorella protothecoides, Chlorella minutissima, or Chlorella emersonii. Examples of expression of transgenes in, e.g., Chlorella, can be found in the literature (see for example Current Microbiology Vol. 35 (1997), pp. 356-362; Sheng Wu Gong Cheng Xue Bao. 2000 July; 16(4):443-6; Current Microbiology Vol. 38 (1999), pp. 335-341; Appl Microbiol Biotechnol (2006) 72: 197-205; Marine Biotechnology 4, 63-73, 2002; Current Genetics 39:5, 365-370 (2001); Plant Cell Reports 18:9, 778-780, (1999); Biologia Plantarium 42(2): 209-216, (1999); Plant Pathol. J 21(1): 13-20, (2005)). Other lipid-producing microalgae can be engineered as well, including prokaryotic Microalgae (see Kalscheuer et al., Applied Microbiology and Biotechnology, Volume 52, Number 4/October, 1999).

3. Identification of Chlorella Species

Species of Chlorella for use in expressing variant acyl-ACP thioesterases can be identified by amplification of certain target regions of the genome. For example, identification of a specific Chlorella species or strain can be achieved through amplification and sequencing of nuclear and/or chloroplast DNA using primers and methodology using any region of the genome, for example using the methods described in Wu et al., Bot. Bull. Acad. Sin. (2001) 42:115-121 Identification of Chlorella spp. isolates using ribosomal DNA sequences. Well established methods of phylogenetic analysis, such as amplification and sequencing of ribosomal internal transcribed spacer (ITS1 and ITS2 rDNA), 18S rRNA, and other conserved genomic regions can be used by those skilled in the art to identify species of not only Chlorella, but other hydrocarbon and lipid producing organisms capable of using the methods disclosed herein. For examples of methods of identification and classification of algae also see for example Genetics, 2005 August; 170(4):1601-10 and RNA, 2005 April; 11(4):361-4.

Illustrative embodiments of host cells include recombinant oleaginous cells expressing one or more exogenous genes encoding fatty acid biosynthesis enzymes. As a result, some embodiments feature natural oils never before obtainable in a natural oil. In some cases, the natural oils were not obtainable from a non-plant or non-seed oil, or not obtainable at all.

The oleaginous cells produce a storage oil, which may be stored in storage vesicles of the cell. A raw oil may be obtained from the cells by disrupting the cells and isolating the oil. The oils produced may be refined, bleached and deodorized (RBD) as known in the art or as described in WO2010/120939. The raw or RBD oils may be used in a variety of food, chemical, and industrial products or processes. After recovery of the oil, a valuable residual biomass remains. Uses for the residual biomass include the production of paper, plastics, absorbents, adsorbents, as animal feed, for human nutrition, or for fertilizer.

Where a fatty acid profile of a triglyceride cell oil is given, it will be understood that this refers to a nonfractionated sample of the storage oil extracted from the cell analyzed under conditions in which phospholipids have been removed or with an analysis method that is substantially insensitive to the fatty acids of the phospholipids (e.g. using chromatography and mass spectrometry). Because the cells are oleaginous, in some cases the storage oil will constitute the bulk of all the TAGs in the cell.

In varying embodiments, the host cell is a plastidic cell, e.g., a heterotrophic microalgae of the phylum Chlorpophya, the class Trebouxiophytae, the order Chlorellales, or the family Chlorellacae. In varying embodiments, the cell is oleaginous and capable of accumulating at least 40% oil by dry cell weight. The cell can be an obligate heterotroph, such as a species of Prototheca, including Prototheca moriformis or Prototheca zopfii. The nucleic acid encoding the variant acyl-ACP TEs described herein can also be expressed in autotrophic algae or plants. Optionally, the cell is capable of using sucrose to produce oil and a recombinant invertase gene may be introduced to allow metabolism of sucrose, as described in PCT Publications WO2008/151149, WO2010/06032, WO2011/150410, WO2011/150411, and international patent application PCT/US12/23696. The invertase may be codon optimized and integrated into a chromosome of the cell, as may all of the genes mentioned here. Codon usage for different algal and plant species of interest is known in the art and can be found, e.g., on the internet at the Codon Usage Database at kazusa.or.jp/codon/.

The polynucleotides encoding the variant acyl-ACP TEs described herein further can be expressed in a wide variety of plant host cells. Of particular interest are plant cells of plants involved in the production of vegetable oils for edible and industrial uses, including e.g., temperate oilseed crops. Plants of interest include, but are not limited to, grapeseed (Canola and High Erucic Acid varieties), sunflower, safflower, cotton, Cuphea, soybean, peanut, coconut and oil palms, and corn.

V. Methods of Culturing Microorganisms

Microorganisms are cultured both for purposes of conducting genetic manipulations and for subsequent production of hydrocarbons (e.g., lipids, fatty acids, aldehydes, alcohols, and alkanes). The former type of culture is conducted on a small scale and initially, at least, under conditions in which the starting microorganism can grow. For example, if the starting microorganism is a photoautotroph the initial culture is conducted in the presence of light. The culture conditions can be changed if the microorganism is evolved or engineered to grow independently of light. Culture for purposes of hydrocarbon production is usually conducted on a large scale. Preferably a fixed carbon source is present. The culture can also be exposed to light some or all of the time.

Microalgae can be cultured in liquid media. The culture can be contained within a bioreactor. Optionally, the bioreactor does not allow light to enter. Alternatively, microalgae can also be cultured in photobioreactors that contain a fixed carbon source and allow light to strike the cells. Exposure of microalgae cells to light, even in the presence of a fixed carbon source that the cells transport and utilize (i.e., mixotrophic growth), nonetheless accelerates growth compared to culturing cells in the dark. Culture condition parameters can be manipulated to optimize total hydrocarbon production, the combination of hydrocarbon species produced, and/or production of a hydrocarbon species. In some instances it is preferable to culture cells in the dark, such as, for example, when using extremely large (e.g., 10,000 L, 40,000 L, 100,000 L 500,000 L, or larger, bioreactors) fermentors that do not allow light to strike the culture.

Microalgal culture media typically contains components such as a fixed nitrogen source, trace elements, optionally a buffer for pH maintenance, and phosphate. Other components can include a fixed carbon source such as acetate or glucose, and salts such as sodium chloride, particularly for seawater microalgae. Examples of trace elements include zinc, boron, cobalt, copper, manganese, and molybdenum in, for example, the respective forms of ZnCl2, H3BO3, CoCl26H2O, CuCl22H2O, MnCl24H2O and (NH4)6Mo7O24.4H2O.

For organisms able to grow on a fixed carbon source, the fixed carbon source can be, for example, glucose, fructose, sucrose, galactose, xylose, mannose, rhamnose, N-acetylglucosamine, glycerol, floridoside, and/or glucuronic acid. The one or more carbon source(s) can be supplied at a concentration of at least about 50 μM, at least about 100 μM, at least about 500 μM, at least about 5 mM, at least about 50 mM, and at least about 500 mM, of one or more exogenously provided fixed carbon source(s). Some microalgae species can grow by utilizing a fixed carbon source such as glucose or acetate in the absence of light. Such growth is known as heterotrophic growth. For Chlorella and/or Prototheca, for example, heterotrophic growth results in high production of biomass and accumulation of high lipid content in cells.

Some microorganisms naturally grow on or can be engineered to grow on a fixed carbon source that is a heterogeneous source of compounds such as municipal waste, secondarily treated sewage, wastewater, and other sources of fixed carbon and other nutrients such as sulfates, phosphates, and nitrates. The sewage component serves as a nutrient source in the production of hydrocarbons, and the culture provides an inexpensive source of hydrocarbons.

Other culture parameters can also be manipulated, such as the pH of the culture media, the identity and concentration of trace elements and other media constituents.

A. Photosynthetic Growth

Certain microalgae can be grown in the presence of light. The number of photons striking a culture of microalgae cells can be manipulated, as well as other parameters such as the wavelength spectrum and ratio of dark:light hours per day. Microalgae can also be cultured in natural light, as well as simultaneous and/or alternating combinations of natural light and artificial light. For example, certain species microalgae of the genus Chlorella and/or Prototheca can be cultured under natural light during daylight hours and under artificial light during night hours.

The gas content of a photobioreactor to grow microorganisms like microalgae can be manipulated. Part of the volume of a photobioreactor can contain gas rather than liquid. Gas inlets can be used to pump gases into the photobioreactor. Any gas can be pumped into a photobioreactor, including air, air/CO2 mixtures, noble gases such as argon and others. The rate of entry of gas into a photobioreactor can also be manipulated. Increasing gas flow into a photobioreactor increases the turbidity of a culture of microalgae. Placement of ports conveying gases into a photobioreactor can also affect the turbidity of a culture at a given gas flow rate. Air/CO2 mixtures can be modulated to generate optimal amounts of CO2 for maximal growth by a particular organism. Microalgae grow significantly faster in the light under, for example, 3% CO2/97% air than in 100% air. 3% CO2/97% air is approximately 100-fold more CO2 than found in air. For example, air:CO2 mixtures of about 99.75% air:0.25% CO2, about 99.5% air:0.5% CO2, about 99.0% air:1.00% CO2, about 98.0% air:2.0% CO2, about 97.0% air:3.0% CO2, about 96.0% air:4.0% CO2, and about 95.00% air:5.0% CO2 can be infused into a bioreactor or photobioreactor.

Microalgae cultures can also be subjected to mixing using devices such as spinning blades and impellers, rocking of a culture, stir bars, infusion of pressurized gas, and other instruments.

Photobioreactors can have ports allowing entry of gases, solids, semisolids and liquids into the chamber containing the microalgae. Ports are usually attached to tubing or other means of conveying substances. Gas ports, for example, convey gases into the culture. Pumping gases into a photobioreactor can serve to both feed cells CO2 and other gases and to aerate the culture and therefore generate turbidity. The amount of turbidity of a culture varies as the number and position of gas ports is altered. For example, gas ports can be placed along the bottom of a cylindrical polyethylene bag. Microalgae grow faster when CO2 is added to air and bubbled into a photobioreactor. For example, a 5% CO2:95% air mixture is infused into a photobioreactor containing Botryococcus cells (see for example J Agric Food Chem. 2006 Jun. 28; 54(13):4593-9; J Biosci Bioeng. 1999; 87(6):811-5; and J Nat. Prod. 2003 June; 66(6):772-8).

Photobioreactors can be exposed to one or more light sources to provide microalgae with light as an energy source via light directed to a surface of the photobioreactor. Preferably the light source provides an intensity that is sufficient for the cells to grow, but not so intense as to cause oxidative damage or cause a photoinhibitive response. In some instances a light source has a wavelength range that mimics or approximately mimics the range of the sun. In other instances a different wavelength range is used. Photobioreactors can be placed outdoors or in a greenhouse or other facility that allows sunlight to strike the surface. Preferred photon intensities for species of the genus Botryococcus are between 25 and 500 μE m−2 s−1 (see for example Photosynth Res. 2005 June; 84(1-3):21-7).

Photobioreactors preferably have one or more ports that allow media entry. It is not necessary that only one substance enter or leave a port. For example, a port can be used to flow culture media into the photobioreactor and then later can be used for sampling, gas entry, gas exit, or other purposes. In some instances a photobioreactor is filled with culture media at the beginning of a culture and no more growth media is infused after the culture is inoculated. In other words, the microalgal biomass is cultured in an aqueous medium for a period of time during which the microalgae reproduce and increase in number; however quantities of aqueous culture medium are not flowed through the photobioreactor throughout the time period. Thus in some embodiments, aqueous culture medium is not flowed through the photobioreactor after inoculation.

In other instances culture media can be flowed through the photobioreactor throughout the time period during which the microalgae reproduce and increase in number. In some embodiments media is infused into the photobioreactor after inoculation but before the cells reach a desired density. In other words, a turbulent flow regime of gas entry and media entry is not maintained for reproduction of microalgae until a desired increase in number of said microalgae has been achieved.

Photobioreactors preferably have one or more ports that allow gas entry. Gas can serve to both provide nutrients such as CO2 as well as to provide turbulence in the culture media. Turbulence can be achieved by placing a gas entry port below the level of the aqueous culture media so that gas entering the photobioreactor bubbles to the surface of the culture. One or more gas exit ports allow gas to escape, thereby preventing pressure buildup in the photobioreactor. Preferably a gas exit port leads to a “one-way” valve that prevents contaminating microorganisms from entering the photobioreactor. In some instances cells are cultured in a photobioreactor for a period of time during which the microalgae reproduce and increase in number, however a turbulent flow regime with turbulent eddies predominantly throughout the culture media caused by gas entry is not maintained for all of the period of time. In other instances a turbulent flow regime with turbulent eddies predominantly throughout the culture media caused by gas entry can be maintained for all of the period of time during which the microalgae reproduce and increase in number. In some instances a predetermined range of ratios between the scale of the photobioreactor and the scale of eddies is not maintained for the period of time during which the microalgae reproduce and increase in number. In other instances such a range can be maintained.

Photobioreactors preferably have at least one port that can be used for sampling the culture. Preferably a sampling port can be used repeatedly without altering compromising the axenic nature of the culture. A sampling port can be configured with a valve or other device that allows the flow of sample to be stopped and started. Alternatively a sampling port can allow continuous sampling. Photobioreactors preferably have at least one port that allows inoculation of a culture. Such a port can also be used for other purposes such as media or gas entry.

B. Heterotrophic Growth

As an alternative to photosynthetic growth of microorganisms, as described above, some microorganisms can be cultured under heterotrophic growth conditions in which a fixed carbon source provides energy for growth and lipid accumulation.

In one heterotrophic culture method in accordance with the invention, the cost of biodiesel production, crude, partially purified, or purified glycerol produced as a byproduct of lipid transesterification can be employed as a feedstock for fermenting, for example, lipid-producing microbial cultures. Thus, the invention encompasses culturing a microbe (e.g., a microalgae) in a first microbial culture; recovering microbial lipid from the culture; subjecting the microbial lipid to transesterification to produce fatty acid ester(s) and glycerol, as described above; and adding the glycerol to a second microbial culture as a feedstock. The first and second microbial cultures can, but need not, be cultures of the same microbe. If desired, a continuous system can be devised whereby glycerol produced from the lipid recovered from a culture can be fed back into the same culture.

The invention provides significantly improved culture parameters incorporating the use of glycerol for fermentation of multiple genera of both eukaryotic and prokaryotic microbes, including microbes of the genera Prototheca, Chlorella, Navicula, Scenedesmus, and Spirulina. As the Examples demonstrate, microbes of extremely divergent evolutionary lineages, including Prototheca, Chlorella, Navicula, Scenedesmus, and Spirulina as well as cultures of multiple distinct Prototheca and/or Chlorella species and strains grow very well on not only purified reagent-grade glycerol, but also on acidulated and non-acidulated glycerol byproduct from biodiesel transesterification. In some instances microalgae, such as Chlorella and/or Prototheca strains, undergo cell division faster in the presence of glycerol than in the presence of glucose. In these instances, two-stage growth processes in which cells are first fed glycerol to rapidly increase cell density, and are then fed glucose to accumulate lipids can improve the efficiency with which lipids are produced. The use of the glycerol byproduct of the transesterification process provides significant economic advantages when put back into the production process. Other feeding methods are provided as well, such as mixtures of glycerol and glucose. Feeding such mixtures also captures the same economic benefits. In addition, the invention provides methods of feeding alternative sugars to microalgae such as sucrose in various combinations with glycerol. These benefits provided by the invention have been demonstrated herein on microbes from extremely divergent evolutionary lineages, including both prokaryotes and eukaryotes, demonstrating the utility of the invention for microbial fermentation.

Standard methods for the growth and propagation of Chlorella and/or Prototheca are known (see for example Miao and Wu, J. Biotechnology, 2004, 11:85-93 and Miao and Wu, Biosource Technology (2006) 97:841-846). In addition, multiple species of Chlorella and/or Prototheca and multiple strains within a species can be grown in the presence of glycerol, including glycerol byproduct from biodiesel transesterification.

For hydrocarbon production, cells, including recombinant cells described herein, are preferably cultured or fermented in large quantities. The culturing may be in large liquid volumes, such as in suspension cultures as an example. Other examples include starting with a small culture of cells which expand into a large biomass in combination with cell growth and propagation as well as hydrocarbon production. Bioreactors or steel fermentors can be used to accommodate large culture volumes. A fermentor similar those used in the production of beer and/or wine is suitable, as are extremely large fermentors used in the production of ethanol.

Appropriate nutrient sources for culture in a fermentor are provided. These include raw materials such as one or more of the following: a fixed carbon source such as glucose, corn starch, depolymerized cellulosic material, sucrose, sugar cane, sugar beet, lactose, milk whey, or molasses; a fat source, such as fats or vegetable oils; a nitrogen source, such as protein, soybean meal, cornsteep liquor, ammonia (pure or in salt form), nitrate or nitrate salt, or molecular nitrogen; and a phosphorus source, such as phosphate salts. Additionally, a fermentor allows for the control of culture conditions such as temperature, pH, oxygen tension, and carbon dioxide levels. Optionally, gaseous components, like oxygen or nitrogen, can be bubbled through a liquid culture. Other starch (polymerized glucose) sources such as wheat, potato, rice, and sorghum. Other carbon sources include process streams such as technical grade glycerol, black liquor, organic acids such as acetate, and molasses. Carbon sources can also be provided as a mixture, such as a mixture of sucrose and depolymerized sugar beet pulp.

A fermentor can be used to allow cells to undergo the various phases of their growth cycle. As an example, an inoculum of hydrocarbon-producing cells can be introduced into a medium followed by a lag period (lag phase) before the cells begin growth. Following the lag period, the growth rate increases steadily and enters the log, or exponential, phase. The exponential phase is in turn followed by a slowing of growth due to decreases in nutrients and/or increases in toxic substances. After this slowing, growth stops, and the cells enter a stationary phase or steady state, depending on the particular environment provided to the cells.

Hydrocarbon production by cells disclosed herein can occur during the log phase or thereafter, including the stationary phase wherein nutrients are supplied, or still available, to allow the continuation of hydrocarbon production in the absence of cell division.

In varying embodiments, microorganisms grown using conditions described herein and comprise at least about 20% by weight of lipid, preferably at least about 40% by weight, at least about 50% by weight, and more preferably at least about 60% by weight, even more preferably at least about 70%, 75%, 80% or 85% by weight.

Multiple species, and multiple strains within a species of Chlorella and/or Prototheca perform better in the presence of glycerol byproduct from transesterification than in an equivalent amount of reagent grade glycerol. Glycerol byproduct from transesterification usually contains residual methanol and other contaminants in addition to glycerol. For example, strains of Chlorella and/or Prototheca species can exhibit better productivity on acidulated and non-acidulated glycerol byproduct from lipid transesterification reactions than when grown on pure reagent grade glycerol. Other microbes, such as Scenedesmus and Navicula microalgae can also perform better in the presence of glycerol byproduct from transesterification than in an equivalent amount of reagent grade glycerol. In varying embodiments, dry cell weight is higher on biodiesel glycerol byproduct than on pure glycerol. For example, dry cell weight per liter of Scenedesmus armatus and Navicula pelliculosa is higher on acidulated and non-acidulated biodiesel byproducts glycerol than on pure reagent grade glycerol. Furthermore, for multiple species of Chlorella and/or Prototheca and multiple strains within a species of Chlorella and/or Prototheca, lipid levels per liter are higher when the cells are cultured in the presence of biodiesel glycerol byproduct than when cultured in the presence of equivalent concentrations of pure reagent grade glycerol. Multiple species of Chlorella and/or Prototheca and multiple strains within a species of Chlorella and/or Prototheca, as well as Spirulina platens is, Navicula pelliculosa and Scenedesmus armatus accumulate a higher percentage of dry cell weight as lipid when cultured in the presence of biodiesel glycerol byproduct than when cultured in the presence of equivalent concentrations of pure reagent grade glycerol.

Another surprising result is that multiple species of microbes, including microalgae such as Chlorella and/or Prototheca and multiple strains within a species of Chlorella and/or Prototheca, and other microalgae such as Scenedesmus, Navicula, and Spirulina exhibit better characteristics as biodiesel producers in the presence of mixtures of glycerol and glucose than in the presence of only glucose.

Three different markers of productivity (dry cell weight per liter, grams per liter of lipid, and percentage of dry cell weight as lipid) in microbial lipid production are improved by the use of biodiesel byproduct and temporal separation of carbon sources. The invention therefore provides novel methods of generating higher quantities of lipid per unit time in multiple species of microbes from highly divergent areas of the evolutionary tree, including both prokaryotes and eukaryotes. The methods of manufacturing lipids and hydrocarbons disclosed herein using glycerol are not limited to microalgae, but can be used with any microbe capable of utilizing glycerol as an energy source.

In an alternate heterotrophic growth method in accordance with the present invention, microorganisms can be cultured using depolymerized cellulosic biomass as a feedstock. Cellulosic biomass (e.g., stover, such as corn stover) is inexpensive and readily available; however, attempts to use this material as a feedstock for yeast have failed. In particular, such feedstock has been found to be inhibitory to yeast growth, and yeast cannot use the 5-carbon sugars produced from cellulosic materials (e.g., xylose from hemicellulose). By contrast, microalgae can grow on processed cellulosic material. Accordingly, the invention provides a method of culturing a microalgae in the presence of a cellulosic material and/or a 5-carbon sugar. Cellulosic materials generally include as component percent dry weight 40-60% cellulose, 20-40% hemicellulose, and 10-30% lignin.

Suitable cellulosic materials include residues from herbaceous and woody energy crops, as well as agricultural crops, i.e., the plant parts, primarily stalks and leaves, not removed from the fields with the primary food or fiber product. Examples include agricultural wastes such as sugarcane bagasse, rice hulls, corn fiber (including stalks, leaves, husks, and cobs), wheat straw, rice straw, sugar beet pulp, citrus pulp, citrus peels; forestry wastes such as hardwood and softwood thinnings, and hardwood and softwood residues from timber operations; wood wastes such as saw mill wastes (wood chips, sawdust) and pulp mill waste; urban wastes such as paper fractions of municipal solid waste, urban wood waste and urban green waste such as municipal grass clippings; and wood construction waste. Additional cellulosics include dedicated cellulosic crops such as switchgrass, hybrid poplar wood, and miscanthus, fiber cane, and fiber sorghum. Five-carbon sugars that are produced from such materials include xylose.

Some species of Chlorella and/or Prototheca have been shown herein to exhibit higher levels of productivity when cultured on a combination of glucose and xylose than when cultured on either glucose or xylose alone. This synergistic effect provides a significant advantage in that it allows cultivation of Chlorella and/or Prototheca on combinations of xylose and glucose, such as cellulosic material.

In still another alternative heterotrophic growth method, which itself may optionally be used in combination with the methods described above, sucrose, produced by example from sugar cane or sugar beet, is used as a feedstock. As described in greater detail in the section entitled “Microbe Engineering” below, lipid production can be facilitated or made more efficient through the engineering of microbes such as Chlorella and/or Prototheca, to utilize sucrose as a carbon source. For example, expression of a sucrose transporter and a sucrose invertase allows Chlorella and/or Prototheca to transport sucrose into the cell from the culture media and hydrolyze sucrose to yield glucose and fructose. Optionally, a fructokinase can be expressed as well in instances where endogenous hexokinase activity is insufficient for maximum phosphorylation of fructose. Examples of suitable sucrose transporters are Genbank accession numbers CAD91334, CAB92307, and CAA53390. Examples of suitable sucrose invertases are Genbank accession numbers CAB95010, NP012104 and CAA06839. Examples of suitable fructokinases are Genbank accession numbers P26984, P26420 and CAA43322. Vectors for transformation of microalgae, including Chlorella and/or Prototheca, encoding one or more of such genes can be designed as described herein.

Secretion of a sucrose invertase can obviate the need for expression of a transporter that can transport sucrose into the cell. This is because a secreted invertase catalyzes the conversion of a molecule of sucrose into a molecule of glucose and a molecule of fructose, both of which can be transported and utilized by microbes disclosed herein. For example, expression of a sucrose invertase with a secretion signal generates invertase activity outside the cell. See Hawkins et al., Current Microbiology Vol. 38 (1999), pp. 335-341 for examples of secretion signals active in Chlorella and/or Prototheca. Expression of such a protein, as enabled by the genetic engineering methodology disclosed herein, allows cells already capable of utilizing extracellular glucose as an energy source to utilize sucrose as an extracellular energy source. Chlorella and/or Prototheca cells can use both extracellular fructose and extracellular glucose as an energy source, secretion of an invertase can provide the sole catalytic activity necessary for use of sucrose as an efficient, inexpensive energy source.

For example, Chlorella and/or Prototheca cells can be engineered with a sucrose invertase gene under the regulatory control of one of three promoters (Cauliflower mosaic virus 35S promoter (CMV), Chlorella virus promoter (CV), or Chlorella HUP1 promoter (HUP 1)). The sucrose invertase gene used in this example comprises a modification to the S. cerevisiae SUC2 gene to optimize for C. protothecoides codon usage. Expression of a secretable sucrose invertase, such as that described herein, permits the use of molasses, sugar cane juice, and other sucrose-containing feedstocks for cell fermentation.

The growth potential of microorganisms expressing an exogenous secretable sucrose invertase is illustrated by the addition of an invertase to the culture medium of Chlorella and/or Prototheca. Chlorella and/or Prototheca cells can grow as well on waste molasses from sugar cane processing as they do on pure reagent-grade glucose; the use of this low-value waste product of sugar cane processing can provide significant cost savings in the production of hydrocarbons and other oils. Molasses contains lignin and other cellulosic waste products that poison many microorganisms and retard their growth, however it was discovered that Chlorella and/or Prototheca cells thrive in the presence of such poisons.

Alternatively, a sucrose invertase can also be expressed intracellularly in cells that express a sucrose transporter, as well as in cells that express any carbohydrate transporter that allows sucrose to enter the cell.

Bioreactors can be employed for use in heterotrophic growth methods. As will be appreciated, provisions made to make light available to the cells in photosynthetic growth methods are unnecessary when using a fixed-carbon source in the heterotrophic growth methods described herein.

The specific examples of process conditions and heterotrophic growth methods described herein can be combined in any suitable manner to improve efficiencies of microbial growth and/or lipid production. In addition, the invention includes the selection and/or genetic engineering of microbes, such as microalgae, to produce microbes that are even more suitable for use in the above-described methods. For example, the microbes having a greater ability to utilize any of the above-described feedstocks for increased proliferation and/or lipid (e.g., fatty acid) production are within the scope of the invention.

C. Mixotrophic Growth

Mixotrophic growth is the use of both light and fixed carbon source(s) as energy sources for cells to grow and produce hydrocarbons. Mixotrophic growth can be conducted in a photobioreactor. Microalgae can be grown and maintained in closed photobioreactors made of different types of transparent or semitransparent material. Such material can include Plexiglas™ enclosures, glass enclosures, bags made from substances such as polyethylene, transparent or semitransparent pipes, and other materials. Microalgae can be grown and maintained in open photobioreactors such as raceway ponds, settling ponds, and other non-enclosed containers.

D. Growth Media

Microorganisms useful in accordance with the methods of the present invention are found in various locations and environments throughout the world. As a consequence of their isolation from other species and their resulting evolutionary divergence, the particular growth medium for optimal growth and generation of lipid and/or hydrocarbon constituents can be difficult to predict. In some cases, certain strains of microorganisms may be unable to grow on a particular growth medium because of the presence of some inhibitory component or the absence of some essential nutritional requirement required by the particular strain of microorganism.

Solid and liquid growth media are generally available from a wide variety of sources, and instructions for the preparation of particular media that is suitable for a wide variety of strains of microorganisms can be found, for example, online at utex.org/, a site maintained by the University of Texas at Austin for its culture collection of algae (UTEX). For example, various fresh water and salt water media are provided in U.S. Patent Publ. No. 2012/0288930, hereby incorporated herein by reference in its entirety for all purposes.

In a particular example, a medium suitable for culturing Chlorella and/or Prototheca cells comprises Proteose Medium. This medium is suitable for axenic cultures, and a 1 L volume of the medium (pH .about.6.8) can be prepared by addition of 1 g of proteose peptone to 1 liter of Bristol Medium. Bristol medium comprises 2.94 mM NaNO3, 0.17 mM CaCl22H2O, 0.3 mM MgSO47H2O, 0.43 mM, 1.29 mM KH2PO4, and 1.43 mM NaCl in an aqueous solution. For 1.5% agar medium, 15 g of agar can be added to 1 L of the solution. The solution is covered and autoclaved, and then stored at a refrigerated temperature prior to use.

Other suitable media for use with the methods described herein can be readily identified by consulting the URL identified above, or by consulting other organizations that maintain cultures of microorganisms, such as SAG, CCAP, or CCALA. SAG refers to the Culture Collection of Algae at the University of Gottingen (Gottingen, Germany), CCAP refers to the culture collection of algae and protozoa managed by the Scottish Association for Marine Science (Scotland, United Kingdom), and CCALA refers to the culture collection of algal laboratory at the Institute of Botany (T{hacek over (r)}ebo{hacek over (n)}, Czech Republic).

E. Increasing Yield of Lipids

Process conditions can be adjusted to increase the yield of lipids suitable for a particular use and/or to reduce production cost. For example, in certain embodiments, an oleaginous cell (e.g., a plant, an algae, a microalgae) is cultured in the presence of a limiting concentration of one or more nutrients, such as, for example, carbon and/or nitrogen, phosphorous, or sulfur, while providing an excess of fixed carbon energy such as glucose. Nitrogen limitation tends to increase microbial lipid yield over microbial lipid yield in a culture in which nitrogen is provided in excess. In particular embodiments, the increase in lipid yield is at least about: 10%, 20%, 30%, 40%, 50%, 75%, 100%, 200%, 300%, 400%, or 500%. The oleaginous cells (e.g., plant cells, algae cells, microalgae cells) can be cultured in the presence of a limiting amount of a nutrient for a portion of the total culture period or for the entire period. In particular embodiments, the nutrient concentration is cycled between a limiting concentration and a non-limiting concentration at least twice during the total culture period.

To increase lipid yield, acetic acid can be employed in the feedstock for a lipid-producing oleaginous cells or organism (e.g., plants, algae, microalgae). Acetic acid feeds directly into the point of metabolism that initiates fatty acid synthesis (i.e., acetyl-CoA); thus providing acetic acid in the culture can increase fatty acid production. Generally, the oleaginous cells or organism is cultured in the presence of a sufficient amount of acetic acid to increase microbial lipid yield, and/or microbial fatty acid yield, specifically, over microbial lipid (e.g., fatty acid) yield in the absence of acetic acid.

In another embodiment, lipid yield is increased by culturing a lipid-producing oleaginous cells or organism (e.g., plants, algae, microalgae) in the presence of one or more cofactor(s) for a lipid pathway enzyme (e.g., a fatty acid synthetic enzyme). Generally, the concentration of the cofactor(s) is sufficient to increase microbial lipid (e.g., fatty acid) yield over microbial lipid yield in the absence of the cofactor(s). In a particular embodiment, the cofactor(s) are provided to the culture by including in the culture oleaginous cells (e.g., plant cells, algae cells, microalgae cells) containing an exogenous gene encoding the cofactor(s). Alternatively, cofactor(s) may be provided to a culture by including an oleaginous cell (e.g., a plant, an algae, a microalgae) containing an exogenous gene that encodes a protein that participates in the synthesis of the cofactor. In certain embodiments, suitable cofactors include any vitamin required by a lipid pathway enzyme, such as, for example: biotin, pantothenate. Genes encoding cofactors suitable for use in the invention or that participate in the synthesis of such cofactors are well known and can be introduced into oleaginous cells (e.g., plant cells, algae cells, microalgae cells), using constructs and techniques such as those described above and herein.

In varying embodiments, the cells can be fully auxotrophic or partially auxotrophic (i.e., synthetic sickness or lethality) with respect to one or more types of fatty acid. The cells are cultured with supplementation of the fatty acid(s) so as to increase the cell number, then allowing the cells to accumulate oil (e.g., to at least 40% by dry cell weight). Alternatively, the cells comprise a regulatable fatty acid synthesis gene that can be switched in activity based on environmental conditions and the environmental conditions during a first, cell division, phase favor production of the fatty acid and the environmental conditions during a second, oil accumulation, phase disfavor production of the fatty acid.

As a result of applying either of these supplementation or regulation methods, a cell oil may be obtained from the cell that has low amounts of one or more fatty acids essential for optimal cell propagation. Specific examples of oils that can be obtained include those low in stearic, linoleic and/or linolenic acids. Optionally, the cells are oleaginous plastidic microbes such as those of the division Chlorphyta.

Accordingly, in some embodiments, provided are methods for producing an oil or fat. The method comprises cultivating a recombinant oleaginous cell in a growth phase under a first set of conditions that is permissive to cell division so as to increase the number of cells due to the presence of a fatty acid, cultivating the cell in an oil production phase under a second set of conditions that is restrictive to cell division but permissive to production of an oil that is depleted in the fatty acid, and extracting the oil from the cell, wherein the cell has a mutation or exogenous nucleic acids operable to suppress the activity of a fatty acid synthesis enzyme, the enzyme optionally being a stearoyl-ACP desaturase, delta 12 fatty acid desaturase, or a ketoacyl-ACP synthase. The fatty acid can be depleted in the oil by at least than 50, 60, 70, 80, or 90. The cell can be cultivated heterotrophically.

In varying embodiments, the cell can be a microalgal cell and may produce at least 40, 50, 60, 70, 80, or 90% oil by dry cell weight.

VI. Methods of Recovering Lipids and Hydrocarbons

Hydrocarbons (e.g., lipids, fatty acids, aldehydes, alcohols, and alkanes) produced by cells described herein can be harvested, or otherwise collected, by any convenient means. For example, hydrocarbons secreted from cells can be centrifuged to separate the hydrocarbons in a hydrophobic layer from contaminants in an aqueous layer and optionally from any solid materials as a precipitate in after centrifugation. Material containing cell or cell fractions can be treated with proteases to degrade contaminating proteins before or after centrifugation. In some instances the contaminating proteins are associated, possibly covalently, to hydrocarbons or hydrocarbon precursors which form hydrocarbons upon removal of the protein. In other instances the hydrocarbon molecules are in a preparation that also contains proteins. Proteases can be added to hydrocarbon preparations containing proteins to degrade proteins (for example, the protease from Streptomyces griseus can be used (SigmaAldrich catalog number P5147). After digestion, the hydrocarbons are preferably purified from residual proteins, peptide fragments, and amino acids. This purification can be accomplished, for example, by methods listed above such as centrifugation and filtration.

Extracellular hydrocarbons can also be extracted in vivo from living microalgae cells which are then returned to a bioreactor by exposure of the cells, in an otherwise sterile environment, to a non-toxic extraction solvent, followed by separation of the living cells and the hydrophobic fraction of extraction solvent and hydrocarbons, wherein the separated living cells are then returned to a culture container such as a stainless steel fermentor or photobioreactor (see Biotechnol Bioeng. 2004 Dec. 5; 88(5):593-600 and Biotechnol Bioeng. 2004 Mar. 5; 85(5):475-81).

Hydrocarbons can also be isolated by whole cell extraction. The cells are first disrupted, as described in the section entitled “Lysing Cells”, and then intracellular and cell membrane/cell wall-associated hydrocarbons as well as extracellular hydrocarbons can be collected from the whole cell mass, such as by use of centrifugation as described above.

Various methods are available for separating hydrocarbons and lipids from cellular lysates produced by the above methods. For example, hydrocarbons can be extracted with a hydrophobic solvent such as hexane (see Frenz et al. 1989, Enzyme Microb. Technol., 11:717). Hydrocarbons can also be extracted using liquefaction (see for example Sawayama et al. 1999, Biomass and Bioenergy 17:33-39 and Inoue et al. 1993, Biomass Bioenergy 6(4):269-274); oil liquefaction (see for example Minowa et al. 1995, Fuel 74(12):1735-1738); and supercritical CO2 extraction (see for example Mendes et al. 2003, Inorganica Chimica Acta 356:328-334).

A. Lysing Cells

Intracellular lipids and hydrocarbons produced in microorganisms are, in some embodiments, extracted after lysing the cells of the microorganism. Once extracted, the lipids or hydrocarbons can be further refined to produce oils, fuels, or oleochemicals.

After completion of culturing, the microorganisms can be separated from the fermentation broth. Optionally, the separation is effected by centrifugation to generate a concentrated paste. Centrifugation does not remove significant amounts of intracellular water from the microorganisms and is not a drying step. The biomass can then be washed with a washing solution (e.g., DI water) to get rid of the fermentation broth and debris. Optionally, the washed microbial biomass may also be dried (oven dried, lyophilized, etc.) prior to cell disruption. Alternatively, cells can be lysed without separation from some or all of the fermentation broth when the fermentation is complete. For example, the cells can be at a ratio of less than 1:1 v:v cells to extracellular liquid when the cells are lysed.

Microorganisms containing a lipid and/or hydrocarbon can be lysed to produce a lysate. As detailed herein, the step of lysing a microorganism (also referred to as cell lysis) can be achieved by any convenient means, including heat-induced lysis, adding a base, adding an acid, using enzymes such as proteases and polysaccharide degradation enzymes such as amylases, using ultrasound, mechanical lysis, using osmotic shock, infection with a lytic virus, and/or expression of one or more lytic genes. Lysis is performed to release intracellular molecules which have been produced by the microorganism. Each of these methods for lysing a microorganism can be used as a single method or in combination simultaneously or sequentially.

The extent of cell disruption can be observed by microscopic analysis. Using one or more of the methods described herein, typically more than 70% cell breakage is observed. Preferably, cell breakage is more than 80%, more preferably more than 90% and most preferred about 100%.

In particular embodiments, the microorganism is lysed after growth, for example to increase the exposure of cellular lipid and/or hydrocarbon for extraction or further processing. The timing of acyl-ACP thioesterase expression (e.g., via an inducible promoter) or cell lysis can be adjusted to optimize the yield of lipids and/or hydrocarbons. Below are described a number of lysis techniques. These techniques can be used individually or in combination.

1. Heat-Induced Lysis

In some embodiments, the step of lysing a microorganism comprises heating of a cellular suspension containing the microorganism. In this embodiment, the fermentation broth containing the microorganisms (or a suspension of microorganisms isolated from the fermentation broth) is heated until the microorganisms, i.e., the cell walls and membranes of microorganisms degrade or breakdown. Typically, temperatures applied are at least 50° C. Higher temperatures, such as, at least 30° C., at least 60° C., at least 70° C., at least 80° C., at least 90° C., at least 100° C., at least 110° C., at least 120° C., at least 130° C. or higher are used for more efficient cell lysis.

Lysing cells by heat treatment can be performed by boiling the microorganism. Alternatively, heat treatment (without boiling) can be performed in an autoclave. The heat treated lysate may be cooled for further treatment.

Cell disruption can also be performed by steam treatment, i.e., through addition of pressurized steam. Steam treatment of microalgae for cell disruption is described, for example, in U.S. Pat. No. 6,750,048.

2. Lysis Using a Base

In some embodiments, the step of lysing a microorganism comprises adding a base to a cellular suspension containing the microorganism.

The base should be strong enough to hydrolyze at least a portion of the proteinaceous compounds of the microorganisms used. Bases which are useful for solubilizing proteins are known in the art of chemistry. Exemplary bases which are useful in the methods of the present invention include, but are not limited to, hydroxides, carbonates and bicarbonates of lithium, sodium, potassium, calcium, and mixtures thereof. A preferred base is KOH. Base treatment of microalgae for cell disruption is described, for example, in U.S. Pat. No. 6,750,048.

3. Acidic Lysis

In some embodiments, the step of lysing a microorganism comprises adding an acid to a cellular suspension containing the microorganism. Acid lysis can be effected using an acid at a concentration of 10-500 nM or preferably 40-160 nM. Acid lysis is preferably performed at above room temperature (e.g., at 40-160° C., and preferably a temperature of 50-130° C. For moderate temperatures (e.g., room temperature to 100° C. and particularly room temperature to 65° C., acid treatment can usefully be combined with sonication or other cell disruption methods.

4. Lysing Cells Using Enzymes

In some embodiments, the step of lysing a microorganism comprises lysing the microorganism by using an enzyme. Preferred enzymes for lysing a microorganism are proteases and polysaccharide-degrading enzymes such as hemicellulase (e.g., hemicellulase from Aspergillus niger; Sigma Aldrich, St. Louis, Mo.; #H2125), pectinase (e.g., pectinase from Rhizopus sp.; Sigma Aldrich, St. Louis, Mo.; #P2401), Mannaway 4.0 L (Novozymes), cellulase (e.g., cellulose from Trichoderma viride; Sigma Aldrich, St. Louis, Mo.; #C9422), and driselase (e.g., driselase from Basidiomycetes sp.; Sigma Aldrich, St. Louis, Mo.; #D9515.

a) Cellulases

In an embodiment of the present invention, a cellulase for lysing a microorganism is a polysaccharide-degrading enzyme, optionally from Chlorella and/or Prototheca or a Chlorella and/or Prototheca virus.

b) Proteases

Proteases such as Streptomyces griseus protease, chymotrypsin, proteinase K, proteases listed in Degradation of Polylactide by Commercial Proteases, Oda Y et al., Journal of Polymers and the Environment, Volume 8, Number 1, January 2000, pp. 29-32(4), and other proteases can be used to lyse microorganisms. Other proteases that can be used include Alcalase 2.4 FG (Novozymes) and Flavourzyme 100 L (Novozymes).

c) Combinations

Any combination of a protease and a polysaccharide-degrading enzyme can also be used, including any combination of the preceding proteases and polysaccharide-degrading enzymes.

5. Lysing Cells Using Ultrasound

In another embodiment of the present invention, the step of lysing a microorganism is performed by using ultrasound, i.e., sonication. Thus, cells can also by lysed with high frequency sound. The sound can be produced electronically and transported through a metallic tip to an appropriately concentrated cellular suspension. This sonication (or ultrasonication) disrupts cellular integrity based on the creation of cavities in cell suspension.

6. Mechanical Lysis

In another embodiment of the present invention, the step of lysing a microorganism is performed by mechanical lysis. Cells can be lysed mechanically and optionally homogenized to facilitate hydrocarbon (e.g., lipid) collection. For example, a pressure disrupter can be used to pump a cell containing slurry through a restricted orifice valve. High pressure (up to 1500 bar) is applied, followed by an instant expansion through an exiting nozzle. Cell disruption is accomplished by three different mechanisms: impingement on the valve, high liquid shear in the orifice, and sudden pressure drop upon discharge, causing an explosion of the cell. The method releases intracellular molecules.

Alternatively, a ball mill can be used. In a ball mill, cells are agitated in suspension with small abrasive particles, such as beads. Cells break because of shear forces, grinding between beads, and collisions with beads. The beads disrupt the cells to release cellular contents. Cells can also be disrupted by shear forces, such as with the use of blending (such as with a high speed or Waring blender as examples), the french press, or even centrifugation in case of weak cell walls, to disrupt cells.

B. Extraction of Lipids and Hydrocarbons

Lipids and hydrocarbons generated by the microorganisms of the present invention can be recovered by extraction with an organic solvent. In some cases, the preferred organic solvent is hexane. Typically, the organic solvent is added directly to the lysate without prior separation of the lysate components. In one embodiment, the lysate generated by one or more of the methods described above is contacted with an organic solvent for a period of time sufficient to allow the lipid and/or hydrocarbon components to form a solution with the organic solvent. In some cases, the solution can then be further refined to recover specific desired lipid and/or hydrocarbon components. Hexane extraction methods are well known in the art.

Various methods are available for separating lipids from cellular lysates produced by the above methods. For example, lipids and lipid derivatives such as fatty aldehydes, fatty alcohols, and hydrocarbons such as alkanes can be extracted with a hydrophobic solvent such as hexane (see Frenz et al. 1989, Enzyme Microb. Technol., 11:717). Lipids and lipid derivatives can also be extracted using liquefaction (see for example Sawayama et al. 1999, Biomass and Bioenergy 17:33-39 and Inoue et al. 1993, Biomass Bioenergy 6(4):269-274); oil liquefaction (see for example Minowa et al. 1995, Fuel 74(12):1735-1738); and supercritical CO2 extraction (see for example Mendes et al. 2003, Inorganica Chimica Acta 356:328-334). Miao and Wu describe a protocol of the recovery of microalgal lipid from a culture of Chlorella prototheocoides in which the cells were harvested by centrifugation, washed with distilled water and dried by freeze drying. The resulting cell powder was pulverized in a mortar and then extracted with n-hexane. Miao and Wu, Biosource Technology (2006) 97:841-846.

Thus, lipids, lipid derivatives and hydrocarbons generated by the microorganisms of the present invention can be recovered by extraction with an organic solvent. In some cases, the preferred organic solvent is hexane. Typically, the organic solvent is added directly to the lysate without prior separation of the lysate components. In one embodiment, the lysate generated by one or more of the methods described above is contacted with an organic solvent for a period of time sufficient to allow the lipid and/or hydrocarbon components to form a solution with the organic solvent. In some cases, the solution can then be further refined to recover specific desired lipid and/or hydrocarbon components. Hexane extraction methods are well known in the art.

Lipids and lipid derivatives such as fatty aldehydes, fatty alcohols, and hydrocarbons such as alkanes produced by cells as described herein can be modified by the use of one or more enzymes, including a lipase, as described above. When the hydrocarbons are in the extracellular environment of the cells, the one or more enzymes can be added to that environment under conditions in which the enzyme modifies the hydrocarbon or completes its synthesis from a hydrocarbon precursor. Alternatively, the hydrocarbons can be partially, or completely, isolated from the cellular material before addition of one or more catalysts such as enzymes. Such catalysts are exogenously added, and their activity occurs outside the cell or in vitro.

Thus, lipids and hydrocarbons produced by cells in vivo, or enzymatically modified in vitro, as described herein can be optionally further processed by conventional means. The processing can include “cracking” to reduce the size, and thus increase the hydrogen:carbon ratio, of hydrocarbon molecules. Catalytic and thermal cracking methods are routinely used in hydrocarbon and triglyceride oil processing. Catalytic methods involve the use of a catalyst, such as a solid acid catalyst. The catalyst can be silica-alumina or a zeolite, which result in the heterolytic, or asymmetric, breakage of a carbon-carbon bond to result in a carbocation and a hydride anion. These reactive intermediates then undergo either rearrangement or hydride transfer with another hydrocarbon. The reactions can thus regenerate the intermediates to result in a self-propagating chain mechanism. Hydrocarbons can also be processed to reduce, optionally to zero, the number of carbon-carbon double, or triple, bonds therein. Hydrocarbons can also be processed to remove or eliminate a ring or cyclic structure therein. Hydrocarbons can also be processed to increase the hydrogen:carbon ratio. This can include the addition of hydrogen (“hydrogenation”) and/or the “cracking” of hydrocarbons into smaller hydrocarbons.

Thermal methods involve the use of elevated temperature and pressure to reduce hydrocarbon size. An elevated temperature of about 800° C. and pressure of about 700 kPa can be used. These conditions generate “light,” a term that is sometimes used to refer to hydrogen-rich hydrocarbon molecules (as distinguished from photon flux), while also generating, by condensation, heavier hydrocarbon molecules which are relatively depleted of hydrogen. The methodology provides homolytic, or symmetrical, breakage and produces alkenes, which may be optionally enzymatically saturated as described above.

Catalytic and thermal methods are standard in plants for hydrocarbon processing and oil refining. Thus hydrocarbons produced by cells as described herein can be collected and processed or refined via conventional means. See Hillen et al. (Biotechnology and Bioengineering, Vol. XXIV:193-205 (1982)) for a report on hydrocracking of microalgae-produced hydrocarbons. In alternative embodiments, the fraction is treated with another catalyst, such as an organic compound, heat, and/or an inorganic compound. For processing of lipids into biodiesel, a transesterification process is used.

Hydrocarbons produced via methods of the present invention are useful in a variety of industrial applications. For example, the production of linear alkylbenzene sulfonate (LAS), an anionic surfactant used in nearly all types of detergents and cleaning preparations, utilizes hydrocarbons generally comprising a chain of 10-14 carbon atoms. See, for example, U.S. Pat. Nos. 6,946,430; 5,506,201; 6,692,730; 6,268,517; 6,020,509; 6,140,302; 5,080,848; and 5,567,359. Surfactants, such as LAS, can be used in the manufacture of personal care compositions and detergents, such as those described in U.S. Pat. Nos. 5,942,479; 6,086,903; 5,833,999; 6,468,955; and 6,407,044.

VII. Oils with Non-Naturally Occurring Fatty Acid Profiles

Oils disclosed herein are distinct from other naturally occurring oils that are high in mid-chain fatty acids, such as palm oil, palm kernel oil, and coconut oil. For example, levels of contaminants such as carotenoids are far higher in palm oil and palm kernel oil than in the oils described herein. Palm and palm kernel oils in particular contain alpha and beta carotenes and lycopene in much higher amounts than is in the oils described herein. In addition, over 20 different carotenoids are found in palm and palm kernel oil, whereas the Examples demonstrate that the oils described herein contain very few carotenoids species and very low levels. In addition, the levels of vitamin E compounds such as tocotrienols are far higher in palm, palm kernel, and coconut oil than in the oils described herein.

Generally, Prototheca strains have very little or no fatty acids with the chain length C8-C14. For example, Prototheca strains Prototheca moriformis (UTEX 1435), Prototheca krugani (UTEX 329), Prototheca stagnora (UTEX 1442) and Prototheca zopfii (UTEX 1438) produce no (or undetectable amounts) C8 fatty acids, between 0-0.01% C10 fatty acids, between 0.03-2.1% C12 fatty acids and between 1.0-1.7% C14 fatty acids.

In some cases, the oleaginous cells (e.g, Prototheca strains) containing a transgene encoding a variant fatty acyl-ACP thioesterase has a fatty acid profile characterized by 5-10, 10-20, 20-30, 30-40, 40-50, 50-60, 60-70, 70-80, 80-90, or 90-99% C8, C10, C12, or C14 fatty acids. In other cases, the Prototheca strains containing a transgene encoding a fatty acyl-ACP thioesterase that has activity towards fatty acyl-ACP substrates of chain length C12 and C14 and produces fatty acids of the chain length C12 and the chain length C14 at a ratio of 1:1+/−20%.

In some instances, keeping the transgenic Prototheca strains under constant and high selective pressure to retain exogenous genes is advantageous due to the increase in the desired fatty acid of a specific chain length. High levels of exogenous gene retention can also be achieved by inserting exogenous genes into the nuclear chromosomes of the cells using homologous recombination vectors and methods disclosed herein. Recombinant cells containing exogenous genes integrated into nuclear chromosomes are also contemplated.

Microalgal oil can also include other constituents produced by the microalgae, or incorporated into the microalgal oil from the culture medium. These other constituents can be present in varying amount depending on the culture conditions used to culture the microalgae, the species of microalgae, the extraction method used to recover microalgal oil from the biomass and other factors that may affect microalgal oil composition. Non-limiting examples of such constituents include carotenoids, present from 0.1-0.4 micrograms/ml, chlorophyll present from 0-0.02 milligrams/kilogram of oil, gamma tocopherol present from 0.4-0.6 milligrams/100 grams of oil, and total tocotrienols present from 0.2-0.5 milligrams/gram of oil.

The other constituents can include, without limitation, phospholipids, tocopherols, tocotrienols, carotenoids (e.g., alpha-carotene, beta-carotene, lycopene, etc.), xanthophylls (e.g., lutein, zeaxanthin, alpha-cryptoxanthin and beta-crytoxanthin), and various organic or inorganic compounds.

In some cases, the oil extracted from Prototheca species comprises no more than 0.02 mg/kg chlorophyll. In some cases, the oil extracted from Prototheca species comprises no more than 0.4 mcg/ml total carotenoids. In some cases the Prototheca oil comprises between 0.40-0.60 milligrams of gamma tocopherol per 100 grams of oil. In other cases, the Prototheca oil comprises between 0.2-0.5 milligrams of total tocotrienols per gram of oil.

Oils produced from host cells expressing a variant acyl-ACP thioesterase will have an isotopic profile that distinguishes it, e.g., from blended oils from other sources. The stable carbon isotope value δ13C is an expression of the ratio of 13C/12C relative to a standard (e.g. PDB, carbonite of fossil skeleton of Belemnite americana from Peedee formation of South Carolina). The stable carbon isotope value δ13C (0/00) of the oils can be related to the δ13C value of the feedstock used. In some embodiments the oils are derived from oleaginous organisms heterotrophically grown on sugar derived from a C4 plant such as corn or sugarcane. In some embodiments, the δ13C (0/00) of the oil is from 10 to −17 0/00 or from 13 to −16 0/00.

In varying embodiments, a host cell expressing a variant acyl-ACP thioesterase comprising all or specificity-determining residues of a specificity domain from a C10-preferring acyl-ACP thioesterase (e.g., an acyl-ACP thioesterase from Cuphea hookeriana), and a catalytic domain from a C12-preferring acyl-ACP thioesterase (e.g., an acyl-ACP thioesterase from Cuphea wrightii or Umbellularia californica) produces an oil comprising at least about 10% C12:0 fatty acids, and at least about 10% C14:0 fatty acids.

In varying embodiments, a host cell expressing a variant acyl-ACP thioesterase comprising all or specificity-determining residues of a modified specificity domain of a first acyl-ACP thioesterase having one or both His163→Tyr or Leu186→Pro substitutions (or at positions corresponding to His163→Tyr or Leu186→Pro of SEQ ID NO:61), and a catalytic domain of a second acyl-ACP thioesterase produces an oil comprising at least about 5%, e.g., at least about 6%, 7%, 8%, 9%, 10%, 12%, 15%, or more, C8:0 fatty acids or at least about 5%, e.g., at least about 6%, 7%, 8%, 9%, 10%, 12%, 15%, or more, C10:0 fatty acids or a C8:0/C10:0 ratio that is at least about 5%, e.g., at least about 6%, 7%, 8%, 9%, 10%, 12%, 15%, or more. As appropriate, the specificity domain can be derived from a C8:0-, C10:0- or a C12:0-preferring acyl-ACP thioesterase and independently the catalytic domain can be derived from a C8:0-, C10:0- or a C12:0-preferring acyl-ACP thioesterase. The specificity domain and the catalytic domain can be from the same or different acyl-ACP thioesterases. In varying embodiments, a host cell expressing a variant acyl-ACP thioesterase comprising all or specificity-determining residues of a modified specificity domain from a C10-preferring acyl-ACP thioesterase (e.g., an acyl-ACP thioesterase from Cuphea hookeriana having one or both His163→Tyr or Leu186→Pro substitutions), and a catalytic domain from a C10-preferring acyl-ACP thioesterase (e.g., an acyl-ACP thioesterase from Cuphea hookeriana) produces an oil comprising at least about 5%, e.g., at least about 6%, 7%, 8%, 9%, 10%, 12%, 15%, or more, C8:0 fatty acids or at least about 5%, e.g., at least about 6%, 7%, 8%, 9%, 10%, 12%, 15%, or more, C10:0 fatty acids or a C8:0/C10:0 ratio that is at least about 5%, e.g., at least about 6%, 7%, 8%, 9%, 10%, 12%, 15%, or more.

In varying embodiments, a host cell expressing a variant acyl-ACP thioesterase comprising all or specificity-determining residues of a specificity domain from a C14-preferring acyl-ACP thioesterase (e.g., an acyl-ACP thioesterase from Cinnamomum camphorum), and a catalytic domain from a C12-preferring acyl-ACP thioesterase (e.g., an acyl-ACP thioesterase from Cuphea wrightii or Umbellularia californica) produces an oil comprising C12:0 fatty acids and C14:0 fatty acid at an approximate 1:1 ratio; e.g, a ratio of 1:1+/−20%.

Further, host cells expressing a variant acyl-ACP thioesterase comprising 5 or more amino acid residues extending from the C-terminus of a linker domain positioned N-terminal to the hydrophobic domain, produce an oil comprising relatively elevated mid-chain length fatty acids (e.g., C8:0, C10:0, C12:0, C14:0) in comparison to host cells expressing the same acyl-ACP thioesterase without a linker domain. In varying embodiments, host cells expressing a variant acyl-ACP thioesterase comprising 5 or more amino acid residues extending from the C-terminus of a linker domain positioned N-terminal to the hydrophobic domain, produce an oil comprising mid-chain length fatty acids increased by at least 1-fold, 2-fold, 3-fold, or more, in comparison to host cells expressing the same acyl-ACP thioesterase without a linker domain.

In a specific embodiment, a recombinant cell comprises nucleic acids operable to express a product of an exogenous gene encoding a variant acyl-ACP thioesterase exogenous gene encoding an active acyl-ACP thioesterase that catalyzes the cleavage of mid-chain fatty acids from ACP. As a result, in one embodiment, the oil produced can be characterized by a fatty acid profile elevated in C8, C10, C12, and/or C14 fatty acids and reduced in C16, C18, and C18:1 fatty acids as a result of expression of the recombinant nucleic acids. In varying embodiments, the increase in C8, C10, C12, and/or C14 fatty acids is greater than 1%, 2%, 3%, 4%, 5%, 6%, 7%, 8%, 9%, 10%, 20%, 30%, 40%, 50%, 60%, 70%, from 75-85%, from 70-90%, from 90-200%, from 200-300%, from 300-400%, from 400-500%, or greater than 500%.

In some embodiments, an additional genetic modification to increase the level of mid-chain fatty acids in the cell or oil of the cell includes the expression of an exogenous lysophosphatidic acid acyltransferase gene encoding an active lysophosphatidic acid acyltransferase (LPAAT) that catalyzes the transfer of a mid-chain fatty-acyl group to the sn-2 position of a substituted acylglyceroester. In a specific related embodiment, both an exogenous acyl-ACP thioesterase and LPAAT are stably expressed in the cell. As a result of introducing recombinant nucleic acids into an oleaginous cell (and especially into a plastidic microbial cell) an exogenous mid-chain-specific thioesterase and an exogenous LPAAT that catalyzes the transfer of a mid-chain fatty-acyl group to the sn-2 position of a substituted acylglyceroester, the cell can be made to increase the percent of a particular mid-chain fatty acid in the triacylglycerides (TAGs) that it produces by 10, 20 30, 40, 50, 60, 70, 80, 90-fold, or more. Introduction of the exogenous LPAAT can increase mid-chain fatty acids at the sn-2 position by 1, 2, 3, 4 fold or more compared to introducing an exogenous mid-chain preferring acyl-ACP thioesterase alone. In an embodiment, the mid-chain fatty acid is greater than 30, 40, 50 60, 70, 80, or 90% of the TAG fatty acids produced by the cell. In various embodiments, the mid-chain fatty acid is capric, caprylic, lauric, myristic, and/or palmitic.

In varying embodiments, the gene encoding an lysophosphatidic acid acyltransferase (LPAAT) is selected from the group consisting of Arabidopsis thaliana 1-acyl-sn-glycerol-3-phosphate acyltransferase (GenBank Accession No. AEE85783), Brassica juncea 1-acyl-sn-glycerol-3-phosphate acyltransferase (GenBank Accession No. ABQ42862), Brassica juncea 1-acyl-sn-glycerol-3-phosphate acyltransferase (GenBank Accession No. ABM92334), Brassica napus 1-acyl-sn-glycerol-3-phosphate acyltransferase (GenBank Accession No. CAB09138), Chlamydomonas reinhardtii lysophosphatidic acid acyltransferase (GenBank Accession No. EDP02300), Cocos nucifera lysophosphatidic acid acyltransferase (GenBank Acc. No. AAC49119), Limnanthes alba lysophosphatidic acid acyltransferase (GenBank Accession No. EDP02300), Limnanthes douglasii 1-acyl-sn-glycerol-3-phosphate acyltransferase (putative) (GenBank Accession No. CAA88620), Limnanthes douglasii acyl-CoA:sn-1-acylglycerol-3-phosphate acyltransferase (GenBank Accession No. ABD62751), Limnanthes douglasii 1-acylglycerol-3-phosphate O-acyltransferase (GenBank Accession No. CAA58239), Ricinus communis 1-acyl-sn-glycerol-3-phosphate acyltransferase (GenBank Accession No. EEF39377).

Alternately, or in addition to expression of an exogenous LPAAT, the cell may comprise recombinant nucleic acids that are operable to express an exogenous KASI or KASIV enzyme and optionally to decrease or eliminate the activity of a KASII, which is particularly advantageous when a mid-chain-preferring acyl-ACP thioesterase is expressed. Engineering of Prototheca cells to overexpress KASI and/or KASIV enzymes in conjunction with a mid-chain preferring acyl-ACP thioesterase can generate strains in which production of C10-C12 fatty acids is at least about 40% of total fatty acids, e.g., at least about 45%, 50%, 55%, 60% or more, of total fatty acids. Mid-chain production can also be increased by suppressing the activity of KASI and/or KASII (e.g., using a knockout or knockdown). Chromosomal knockout of different alleles of Prototheca moriformis (UTEX 1435) KASI in conjunction with overexpression of a mid-chain preferring acyl-ACP thioesterase can achieve fatty acid profiles that are at least about 60% C10-C14 fatty acids, e.g., at least about 65%, 70%, 75%, 80%, 85% or more C10-C14 fatty acids. Elevated mid-chain fatty acids can also be achieved as a result of expression of KASI RNA hairpin polynucleotides. In addition to any of these modifications, unsaturated or polyunsaturated fatty acid production can be suppressed (e.g., by knockout or knockdown) of a SAD or FAD enzyme.

In an embodiment, one of the above described high mid-chain producing cells is further engineered to produce a low polyunsaturated oil by knocking out or knocking down one or more fatty acyl desaturases. Accordingly, the oil produced has high stability.

The high mid-chain oils or fatty acids derived from hydrolysis of these oils may be particularly useful in food, fuel and oleochemical applications including the production of lubricants and surfactants. For example, fatty acids derived from the cells can be esterified, cracked, reduced to an aldehyde or alcohol, aminated, sulfated, sulfonated, or subjected to other chemical process known in the art.

VIII. Fuels and Chemicals Production

Increasing interest is directed to the use of hydrocarbon components of biological origin in fuels, such as biodiesel, renewable diesel, and jet fuel, since renewable biological starting materials that may replace starting materials derived from fossil fuels are available, and the use thereof is desirable. The present invention provides methods for production of biodiesel, renewable diesel, and jet fuel using the lipids generated by the methods described herein as a biological material to produce biodiesel, renewable diesel, and jet fuel.

Traditional diesel fuels are petroleum distillates rich in paraffinic hydrocarbons. They have boiling ranges as broad as 370° to 780° F., which are suitable for combustion in a compression ignition engine, such as a diesel engine vehicle. The American Society of Testing and Materials (ASTM) establishes the grade of diesel according to the boiling range, along with allowable ranges of other fuel properties, such as cetane number, cloud point, flash point, viscosity, aniline point, sulfur content, water content, ash content, copper strip corrosion, and carbon residue. Technically, any hydrocarbon distillate material derived from biomass or otherwise that meets the appropriate ASTM specification can be defined as diesel fuel (ASTM D975), jet fuel (ASTM D1655), or as biodiesel if it is a fatty acid methyl ester (ASTM D6751).

After extraction, lipid and/or hydrocarbon components recovered from the microbial biomass described herein can be subjected to chemical treatment to manufacture a fuel for use in diesel vehicles and jet engines.

Biodiesel is a liquid which varies in color—between golden and dark brown—depending on the production feedstock. It is practically immiscible with water, has a high boiling point and low vapor pressure. Biodiesel refers to a diesel-equivalent processed fuel for use in diesel-engine vehicles. Biodiesel is biodegradable and non-toxic. An additional benefit of biodiesel over conventional diesel fuel is lower engine wear. Typically, biodiesel comprises C14-C18 alkyl esters. Various processes convert biomass or a lipid produced and isolated as described herein to diesel fuels. A preferred method to produce biodiesel is by transesterification of a lipid as described herein. A preferred alkyl ester for use as biodiesel is a methyl ester or ethyl ester.

Biodiesel produced by a method described herein can be used alone or blended with conventional diesel fuel at any concentration in most modern diesel-engine vehicles. When blended with conventional diesel fuel (petroleum diesel), biodiesel may be present from about 0.1% to about 99.9%. Much of the world uses a system known as the “B” factor to state the amount of biodiesel in any fuel mix. For example, fuel containing 20% biodiesel is labeled B20. Pure biodiesel is referred to as B100.

Biodiesel can also be used as a heating fuel in domestic and commercial boilers. Existing oil boilers may contain rubber parts and may require conversion to run on biodiesel. The conversion process is usually relatively simple, involving the exchange of rubber parts for synthetic parts due to biodiesel being a strong solvent. Due to its strong solvent power, burning biodiesel will increase the efficiency of boilers. Biodiesel can be used as an additive in formulations of diesel to increase the lubricity of pure Ultra-Low Sulfur Diesel (ULSD) fuel, which is advantageous because it has virtually no sulfur content. Biodiesel is a better solvent than petrodiesel and can be used to break down deposits of residues in the fuel lines of vehicles that have previously been run on petrodiesel.

Biodiesel can be produced by transesterification of triglycerides contained in oil-rich biomass. Thus, in another aspect of the present invention a method for producing biodiesel is provided. In a preferred embodiment, the method for producing biodiesel comprises the steps of (a) cultivating a lipid-containing microorganism using methods disclosed herein (b) lysing a lipid-containing microorganism to produce a lysate, (c) isolating lipid from the lysed microorganism, and (d) transesterifying the lipid composition, whereby biodiesel is produced. Methods for growth of a microorganism, lysing a microorganism to produce a lysate, treating the lysate in a medium comprising an organic solvent to form a heterogeneous mixture and separating the treated lysate into a lipid composition have been described above and can also be used in the method of producing biodiesel.

The lipid profile of the biodiesel is usually highly similar to the lipid profile of the feedstock oil. Other oils provided by the methods and compositions described herein can be subjected to transesterification to yield biodiesel with lipid profiles including (a) at least 4% C8-C14; (b) at least 0.3% C8; (c) at least 2% C10; (d) at least 2% C12; and (3) at least 30% C8-C14.

Lipid compositions can be subjected to transesterification to yield long-chain fatty acid esters useful as biodiesel. Preferred transesterification reactions are outlined below and include base catalyzed transesterification and transesterification using recombinant lipases. In a base-catalyzed transesterification process, the triacylglycerides are reacted with an alcohol, such as methanol or ethanol, in the presence of an alkaline catalyst, typically potassium hydroxide. This reaction forms methyl or ethyl esters and glycerin (glycerol) as a byproduct.

Animal and plant oils are typically made of triglycerides which are esters of free fatty acids with the trihydric alcohol, glycerol. In transesterification, the glycerol in a triacylglyceride (TAG) is replaced with a short-chain alcohol such as methanol or ethanol.

In this reaction, the alcohol is deprotonated with a base to make it a stronger nucleophile. Commonly, ethanol or methanol is used in vast excess (up to 50-fold). Normally, this reaction will proceed either exceedingly slowly or not at all. Heat, as well as an acid or base can be used to help the reaction proceed more quickly. The acid or base are not consumed by the transesterification reaction, thus they are not reactants but catalysts. Almost all biodiesel has been produced using the base-catalyzed technique as it requires only low temperatures and pressures and produces over 98% conversion yield (provided the starting oil is low in moisture and free fatty acids).

Transesterification has also been carried out, as discussed above, using an enzyme, such as a lipase instead of a base. Lipase-catalyzed transesterification can be carried out, for example, at a temperature between the room temperature and 80° C., and a mole ratio of the TAG to the lower alcohol of greater than 1:1, preferably about 3:1. Lipases suitable for use in transesterification include, but are not limited to, those listed in Table 7. Other examples of lipases useful for transesterification are found in, e.g. U.S. Pat. Nos. 4,798,793; 4,940,845 5,156,963; 5,342,768; 5,776,741 and WO89/01032. Such lipases include, but are not limited to, lipases produced by microorganisms of Rhizopus, Aspergillus, Candida, Mucor, Pseudomonas, Rhizomucor, Candida, and Humicola and pancreas lipase.

Lipases suitable for use in transesterification include without limitation Aspergillus niger lipase ABG73614, Candida antarctica lipase B (novozym-435) CAA83122, Candida cylindracea lipase AAR24090, Candida lipolytica lipase (Lipase L; Amano Pharmaceutical Co., Ltd.), Candida rugosa lipase (e.g., Lipase-OF; Meito Sangyo Co., Ltd.), Mucor miehei lipase (Lipozyme IM 20), Pseudomonas fluorescens lipase AAA25882, Rhizopus japonicas lipase (Lilipase A-10FG) Q7M4U7_1, Rhizomucor miehei lipase B34959, Rhizopus oryzae lipase (Lipase F) AAF32408, Serratia marcescens lipase (SM Enzyme) ABI13521, Thermomyces lanuginosa lipase CAB58509, Lipase P (Nagase ChemteX Corporation), and Lipase QLM (Meito Sangyo Co., Ltd., Nagoya, Japan)

One challenge to using a lipase for the production of fatty acid esters suitable for biodiesel is that the price of lipase is much higher than the price of sodium hydroxide (NaOH) used by the strong base process. This challenge has been addressed by using an immobilized lipase, which can be recycled. However, the activity of the immobilized lipase must be maintained after being recycled for a minimum number of cycles to allow a lipase-based process to compete with the strong base process in terms of the production cost. Immobilized lipases are subject to poisoning by the lower alcohols typically used in transesterification. U.S. Pat. No. 6,398,707 (issued Jun. 4, 2002 to Wu et al.) describes methods for enhancing the activity of immobilized lipases and regenerating immobilized lipases having reduced activity. Some suitable methods include immersing an immobilized lipase in an alcohol having a carbon atom number not less than 3 for a period of time, preferably from 0.5-48 hours, and more preferably from 0.5-1.5 hours. Some suitable methods also include washing a deactivated immobilized lipase with an alcohol having a carbon atom number not less than 3 and then immersing the deactivated immobilized lipase in a vegetable oil for 0.5-48 hours.

In particular embodiments, a recombinant lipase is expressed in the same microorganisms that produce the lipid on which the lipase acts. Suitable recombinant lipases include those listed above and/or having GenBank Accession numbers listed above, or a polypeptide that has at least 70% amino acid identity with one of the lipases listed above and that exhibits lipase activity. In additional embodiments, the enzymatic activity is present in a sequence that has at least about 75%, at least about 80%, at least about 85%, at least about 90%, at least about 95%, or at least about 99% identity with one of the above described sequences, all of which are hereby incorporated by reference as if fully set forth. DNA encoding the lipase and selectable marker is preferably codon-optimized cDNA. Methods of recoding genes for expression in microalgae are described in U.S. Pat. No. 7,135,290.

The common international standard for biodiesel is EN 14214. ASTM D6751 is the most common biodiesel standard referenced in the United States and Canada. Germany uses DIN EN 14214 and the UK requires compliance with BS EN 14214. Basic industrial tests to determine whether the products conform to these standards typically include gas chromatography, HPLC, and others. Biodiesel meeting the quality standards is very non-toxic, with a toxicity rating (LD50) of greater than 50 mL/kg.

Although biodiesel that meets the ASTM standards has to be non-toxic, there can be contaminants which tend to crystallize and/or precipitate and fall out of solution as sediment. Sediment formation is particularly a problem when biodiesel is used at lower temperatures. The sediment or precipitates may cause problems such as decreasing fuel flow, clogging fuel lines, clogging filters, etc. Processes are well-known in the art that specifically deal with the removal of these contaminants and sediments in biodiesel in order to produce a higher quality product. Examples for such processes include, but are not limited to, pretreatment of the oil to remove contaminants such as phospholipids and free fatty acids (e.g., degumming, caustic refining and silica adsorbent filtration) and cold filtration. Cold filtration is a process that was developed specifically to remove any particulates and sediments that are present in the biodiesel after production. This process cools the biodiesel and filters out any sediments or precipitates that might form when the fuel is used at a lower temperature. Such a process is well known in the art and is described in US Patent Application Publication No. 2007-0175091. Suitable methods may include cooling the biodiesel to a temperature of less than about 38° C. so that the impurities and contaminants precipitate out as particulates in the biodiesel liquid. Diatomaceous earth or other filtering material may then added to the cooled biodiesel to form a slurry, which may then filtered through a pressure leaf or other type of filter to remove the particulates. The filtered biodiesel may then be run through a polish filter to remove any remaining sediments and diatomaceous earth, so as to produce the final biodiesel product.

U.S. Patent Publ. No. 2012/0283460 the production of biodiesel using triglyceride oil from Prototheca moriformis. The Cold Soak Filterability by the ASTM D6751 A1 method of the biodiesel produced was 120 seconds for a volume of 300 ml. This test involves filtration of 300 ml of B100, chilled to 40° F. for 16 hours, allowed to warm to room temp, and filtered under vacuum using 0.7 micron glass fiber filter with stainless steel support. Oils described herein can be transesterified to generate biodiesel with a cold soak time of less than 120 seconds, less than 100 seconds, and less than 90 seconds.

Subsequent processes may also be used if the biodiesel will be used in particularly cold temperatures. Such processes include winterization and fractionation. Both processes are designed to improve the cold flow and winter performance of the fuel by lowering the cloud point (the temperature at which the biodiesel starts to crystallize). There are several approaches to winterizing biodiesel. One approach is to blend the biodiesel with petroleum diesel. Another approach is to use additives that can lower the cloud point of biodiesel. Another approach is to remove saturated methyl esters indiscriminately by mixing in additives and allowing for the crystallization of saturates and then filtering out the crystals. Fractionation selectively separates methyl esters into individual components or fractions, allowing for the removal or inclusion of specific methyl esters. Fractionation methods include urea fractionation, solvent fractionation and thermal distillation.

Another valuable fuel provided by the methods of the present invention is renewable diesel, which comprises alkanes, such as C10:0, C12:0, C14:0, C16:0 and C18:0 and thus, are distinguishable from biodiesel. High quality renewable diesel conforms to the ASTM D975 standard. The lipids produced by the methods of the present invention can serve as feedstock to produce renewable diesel. Thus, in another aspect of the present invention, a method for producing renewable diesel is provided. Renewable diesel can be produced by at least three processes: hydrothermal processing (hydrotreating); hydroprocessing; and indirect liquefaction. These processes yield non-ester distillates. During these processes, triacylglycerides produced and isolated as described herein, are converted to alkanes.

In one embodiment, the method for producing renewable diesel comprises (a) cultivating a lipid-containing microorganism using methods disclosed herein (b) lysing the microorganism to produce a lysate, (c) isolating lipid from the lysed microorganism, and (d) deoxygenating and hydrotreating the lipid to produce an alkane, whereby renewable diesel is produced. Lipids suitable for manufacturing renewable diesel can be obtained via extraction from microbial biomass using an organic solvent such as hexane, or via other methods, such as those described in U.S. Pat. No. 5,928,696. Some suitable methods may include mechanical pressing and centrifuging.

In some methods, the microbial lipid is first cracked in conjunction with hydrotreating to reduce carbon chain length and saturate double bonds, respectively. The material is then isomerized, also in conjunction with hydrotreating. The naphtha fraction can then be removed through distillation, followed by additional distillation to vaporize and distill components desired in the diesel fuel to meet an ASTM D975 standard while leaving components that are heavier than desired for meeting the D975 standard. Hydrotreating, hydrocracking, deoxygenation and isomerization methods of chemically modifying oils, including triglyceride oils, are well known in the art. See for example European patent applications EP1741768 (A1); EP1741767 (A1); EP1682466 (A1); EP1640437 (A1); EP1681337 (A1); EP1795576 (A1); and U.S. Pat. Nos. 7,238,277; 6,630,066; 6,596,155; 6,977,322; 7,041,866; 6,217,746; 5,885,440; 6,881,873.

In one embodiment of the method for producing renewable diesel, treating the lipid to produce an alkane is performed by hydrotreating of the lipid composition. In hydrothermal processing, typically, biomass is reacted in water at an elevated temperature and pressure to form oils and residual solids. Conversion temperatures are typically 300° to 660° F., with pressure sufficient to keep the water primarily as a liquid, 100 to 170 standard atmosphere (atm). Reaction times are on the order of 15 to 30 minutes. After the reaction is completed, the organics are separated from the water. Thereby a distillate suitable for diesel is produced.

In some methods of making renewable diesel, the first step of treating a triglyceride is hydroprocessing to saturate double bonds, followed by deoxygenation at elevated temperature in the presence of hydrogen and a catalyst. In some methods, hydrogenation and deoxygenation occur in the same reaction. In other methods deoxygenation occurs before hydrogenation. Isomerization is then optionally performed, also in the presence of hydrogen and a catalyst. Naphtha components are preferably removed through distillation. For examples, see U.S. Pat. No. 5,475,160 (hydrogenation of triglycerides); U.S. Pat. No. 5,091,116 (deoxygenation, hydrogenation and gas removal); U.S. Pat. No. 6,391,815 (hydrogenation); and U.S. Pat. No. 5,888,947 (isomerization).

One suitable method for the hydrogenation of triglycerides includes preparing an aqueous solution of copper, zinc, magnesium and lanthanum salts and another solution of alkali metal or preferably, ammonium carbonate. The two solutions may be heated to a temperature of about 20° C. to about 85° C. and metered together into a precipitation container at rates such that the pH in the precipitation container is maintained between 5.5 and 7.5 in order to form a catalyst. Additional water may be used either initially in the precipitation container or added concurrently with the salt solution and precipitation solution. The resulting precipitate may then be thoroughly washed, dried, calcined at about 300° C. and activated in hydrogen at temperatures ranging from about 100° C. to about 400° C. One or more triglycerides may then be contacted and reacted with hydrogen in the presence of the above-described catalyst in a reactor. The reactor may be a trickle bed reactor, fixed bed gas-solid reactor, packed bubble column reactor, continuously stirred tank reactor, a slurry phase reactor, or any other suitable reactor type known in the art. The process may be carried out either batchwise or in continuous fashion. Reaction temperatures are typically in the range of from about 170° C. to about 250° C. while reaction pressures are typically in the range of from about 300 psig to about 2000 psig. Moreover, the molar ratio of hydrogen to triglyceride in the process of the present invention is typically in the range of from about 20:1 to about 700:1. The process is typically carried out at a weight hourly space velocity (WHSV) in the range of from about 0.1 hr−1 to about 5 hr−1. One skilled in the art will recognize that the time period required for reaction will vary according to the temperature used, the molar ratio of hydrogen to triglyceride, and the partial pressure of hydrogen. The products produced by the such hydrogenation processes include fatty alcohols, glycerol, traces of paraffins and unreacted triglycerides. These products are typically separated by conventional means such as, for example, distillation, extraction, filtration, crystallization, and the like.

Petroleum refiners use hydroprocessing to remove impurities by treating feeds with hydrogen. Hydroprocessing conversion temperatures are typically 300° to 700° F. Pressures are typically 40 to 100 atm. The reaction times are typically on the order of 10 to 60 minutes. Solid catalysts are employed to increase certain reaction rates, improve selectivity for certain products, and optimize hydrogen consumption.

Suitable methods for the deoxygenation of an oil includes heating an oil to a temperature in the range of from about 350° F. to about 550° F. and continuously contacting the heated oil with nitrogen under at least pressure ranging from about atmospheric to above for at least about 5 minutes.

Suitable methods for isomerization includes using alkali isomerization and other oil isomerization known in the art.

Hydrotreating and hydroprocessing ultimately lead to a reduction in the molecular weight of the triglyceride feed. The triglyceride molecule is reduced to four hydrocarbon molecules under hydroprocessing conditions: a propane molecule and three heavier hydrocarbon molecules, typically in the C8 to C18 range.

Thus, in one embodiment, the product of one or more chemical reaction(s) performed on lipid compositions described herein is an alkane mixture that comprises ASTM D975 renewable diesel. Production of hydrocarbons by microorganisms is reviewed by Metzger et al. Appl Microbiol Biotechnol (2005) 66: 486-496 and A Look Back at the U.S. Department of Energy's Aquatic Species Program: Biodiesel from Algae, NREL/TP-580-24190, John Sheehan, Terri Dunahay, John Benemann and Paul Roessler (1998).

The distillation properties of a diesel fuel is described in terms of T10-T90 (temperature at 10% and 90%, respectively, volume distilled). Renewable diesel was produced from Prototheca moriformis triglyceride oil. The T10-T90 of the material produced in Example 14 was 57.9° C. Methods of hydrotreating, isomerization, and other covalent modification of oils disclosed herein, as well as methods of distillation and fractionation (such as cold filtration) disclosed herein, can be employed to generate renewable diesel compositions with other T10-T90 ranges, such as 20, 25, 30, 35, 40, 45, 50, 60 and 65° C. using triglyceride oils produced according to the methods disclosed herein.

The T10 of the material produced was 242.1° C. Methods of hydrotreating, isomerization, and other covalent modification of oils disclosed herein, as well as methods of distillation and fractionation (such as cold filtration) disclosed herein, can be employed to generate renewable diesel compositions with other T10 values, such as T10 between 180 and 295, between 190 and 270, between 210 and 250, between 225 and 245, and at least 290.

The T90 of the material produced was 300° C. Methods of hydrotreating, isomerization, and other covalent modification of oils disclosed herein, as well as methods of distillation and fractionation (such as cold filtration) disclosed herein can be employed to generate renewable diesel compositions with other T90 values, such as T90 between 280 and 380, between 290 and 360, between 300 and 350, between 310 and 340, and at least 290.

The FBP of the material produced was 300° C. Methods of hydrotreating, isomerization, and other covalent modification of oils disclosed herein, as well as methods of distillation and fractionation (such as cold filtration) disclosed herein, can be employed to generate renewable diesel compositions with other FBP values, such as FBP between 290 and 400, between 300 and 385, between 310 and 370, between 315 and 360, and at least 300.

Other oils provided by the methods and compositions described herein can be subjected to combinations of hydrotreating, isomerization, and other covalent modification including oils with lipid profiles including (a) at least 4% C8-C14; (b) at least 0.3% C8; (c) at least 2% C10; (d) at least 2% C12; and (3) at least 30% C8-C14.

A traditional ultra-low sulfur diesel can be produced from any form of biomass by a two-step process. First, the biomass is converted to a syngas, a gaseous mixture rich in hydrogen and carbon monoxide. Then, the syngas is catalytically converted to liquids. Typically, the production of liquids is accomplished using Fischer-Tropsch (FT) synthesis. This technology applies to coal, natural gas, and heavy oils. Thus, in yet another preferred embodiment of the method for producing renewable diesel, treating the lipid composition to produce an alkane is performed by indirect liquefaction of the lipid composition.

The present invention also provides methods to produce jet fuel. Jet fuel is clear to straw colored. The most common fuel is an unleaded/paraffin oil-based fuel classified as Aeroplane A-1, which is produced to an internationally standardized set of specifications. Jet fuel is a mixture of a large number of different hydrocarbons, possibly as many as a thousand or more. The range of their sizes (molecular weights or carbon numbers) is restricted by the requirements for the product, for example, freezing point or smoke point. Kerosene-type Aeroplane fuel (including Jet A and Jet A-1) has a carbon number distribution between about 8 and 16 carbon numbers. Wide-cut or naphta-type Aeroplane fuel (including Jet B) typically has a carbon number distribution between about 5 and 15 carbons.

Both Aeroplanes (Jet A and Jet B) may contain a number of additives. Useful additives include, but are not limited to, antioxidants, antistatic agents, corrosion inhibitors, and fuel system icing inhibitor (FSII) agents. Antioxidants prevent gumming and usually, are based on alkylated phenols, for example, AO-30, AO-31, or AO-37. Antistatic agents dissipate static electricity and prevent sparking. Stadis 450 with dinonylnaphthylsulfonic acid (DINNSA) as the active ingredient, is an example. Corrosion inhibitors, e.g., DCI-4A is used for civilian and military fuels and DCI-6A is used for military fuels. FSII agents, include, e.g., Di-EGME.

In some embodiments, a jet fuel is produced by blending algal fuels with existing jet fuel. The lipids produced by the methods of the present invention can serve as feedstock to produce jet fuel. Thus, in another aspect of the present invention, a method for producing jet fuel is provided. Herewith two methods for producing jet fuel from the lipids produced by the methods of the present invention are provided: fluid catalytic cracking (FCC); and hydrodeoxygenation (HDO).

Fluid Catalytic Cracking (FCC) is one method which is used to produce olefins, especially propylene from heavy crude fractions. The lipids produced by the method of the present invention can be converted to olefins. The process involves flowing the lipids produced through an FCC zone and collecting a product stream comprised of olefins, which is useful as a jet fuel. The lipids produced are contacted with a cracking catalyst at cracking conditions to provide a product stream comprising olefins and hydrocarbons useful as jet fuel.

In one embodiment, the method for producing jet fuel comprises (a) cultivating a lipid-containing microorganism using methods disclosed herein, (b) lysing the lipid-containing microorganism to produce a lysate, (c) isolating lipid from the lysate, and (d) treating the lipid composition, whereby jet fuel is produced. In one embodiment of the method for producing a jet fuel, the lipid composition can be flowed through a fluid catalytic cracking zone, which, in one embodiment, may comprise contacting the lipid composition with a cracking catalyst at cracking conditions to provide a product stream comprising C2-C5 olefins.

In certain embodiments of this method, it may be desirable to remove any contaminants that may be present in the lipid composition. Thus, prior to flowing the lipid composition through a fluid catalytic cracking zone, the lipid composition is pretreated. Pretreatment may involve contacting the lipid composition with an ion-exchange resin. The ion exchange resin is an acidic ion exchange resin, such as Amberlyst™-15 and can be used as a bed in a reactor through which the lipid composition is flowed, either upflow or downflow. Other pretreatments may include mild acid washes by contacting the lipid composition with an acid, such as sulfuric, acetic, nitric, or hydrochloric acid. Contacting is done with a dilute acid solution usually at ambient temperature and atmospheric pressure.

The lipid composition, optionally pretreated, is flowed to an FCC zone where the hydrocarbonaceous components are cracked to olefins. Catalytic cracking is accomplished by contacting the lipid composition in a reaction zone with a catalyst composed of finely divided particulate material. The reaction is catalytic cracking, as opposed to hydrocracking, and is carried out in the absence of added hydrogen or the consumption of hydrogen. As the cracking reaction proceeds, substantial amounts of coke are deposited on the catalyst. The catalyst is regenerated at high temperatures by burning coke from the catalyst in a regeneration zone. Coke-containing catalyst, referred to herein as “coked catalyst”, is continually transported from the reaction zone to the regeneration zone to be regenerated and replaced by essentially coke-free regenerated catalyst from the regeneration zone. Fluidization of the catalyst particles by various gaseous streams allows the transport of catalyst between the reaction zone and regeneration zone. Methods for cracking hydrocarbons, such as those of the lipid composition described herein, in a fluidized stream of catalyst, transporting catalyst between reaction and regeneration zones, and combusting coke in the regenerator are well known by those skilled in the art of FCC processes. Exemplary FCC applications and catalysts useful for cracking the lipid composition to produce C2-C5 olefins are described in U.S. Pat. Nos. 6,538,169, 7,288,685, which are incorporated in their entirety by reference.

Suitable FCC catalysts generally comprise at least two components that may or may not be on the same matrix. In some embodiments, both two components may be circulated throughout the entire reaction vessel. The first component generally includes any of the well-known catalysts that are used in the art of fluidized catalytic cracking, such as an active amorphous clay-type catalyst and/or a high activity, crystalline molecular sieve. Molecular sieve catalysts may be preferred over amorphous catalysts because of their much-improved selectivity to desired products. In some preferred embodiments, zeolites may be used as the molecular sieve in the FCC processes. Preferably, the first catalyst component comprises a large pore zeolite, such as an Y-type zeolite, an active alumina material, a binder material, comprising either silica or alumina and an inert filler such as kaolin.

In one embodiment, cracking the lipid composition of the present invention, takes place in the riser section or, alternatively, the lift section, of the FCC zone. The lipid composition is introduced into the riser by a nozzle resulting in the rapid vaporization of the lipid composition. Before contacting the catalyst, the lipid composition will ordinarily have a temperature of about 149° C. to about 316° C. (300° F. to 600° F.). The catalyst is flowed from a blending vessel to the riser where it contacts the lipid composition for a time of abort 2 seconds or less.

The blended catalyst and reacted lipid composition vapors are then discharged from the top of the riser through an outlet and separated into a cracked product vapor stream including olefins and a collection of catalyst particles covered with substantial quantities of coke and generally referred to as “coked catalyst.” In an effort to minimize the contact time of the lipid composition and the catalyst which may promote further conversion of desired products to undesirable other products, any arrangement of separators such as a swirl arm arrangement can be used to remove coked catalyst from the product stream quickly. The separator, e.g. swirl arm separator, is located in an upper portion of a chamber with a stripping zone situated in the lower portion of the chamber. Catalyst separated by the swirl arm arrangement drops down into the stripping zone. The cracked product vapor stream comprising cracked hydrocarbons including light olefins and some catalyst exit the chamber via a conduit which is in communication with cyclones. The cyclones remove remaining catalyst particles from the product vapor stream to reduce particle concentrations to very low levels. The product vapor stream then exits the top of the separating vessel. Catalyst separated by the cyclones is returned to the separating vessel and then to the stripping zone. The stripping zone removes adsorbed hydrocarbons from the surface of the catalyst by counter-current contact with steam.

Low hydrocarbon partial pressure operates to favor the production of light olefins. Accordingly, the riser pressure is set at about 172 to 241 kPa (25 to 35 psia) with a hydrocarbon partial pressure of about 35 to 172 kPa (5 to 25 psia), with a preferred hydrocarbon partial pressure of about 69 to 138 kPa (10 to 20 psia). This relatively low partial pressure for hydrocarbon is achieved by using steam as a diluent to the extent that the diluent is 10 to 55 wt-% of lipid composition and preferably about 15 wt-% of lipid composition. Other diluents such as dry gas can be used to reach equivalent hydrocarbon partial pressures.

The temperature of the cracked stream at the riser outlet will be about 510° C. to 621° C. (950° F. to 1150° F.). However, riser outlet temperatures above 566° C. (1050° F.) make more dry gas and more olefins. Whereas, riser outlet temperatures below 566° C. (1050° F.) make less ethylene and propylene. Accordingly, it is preferred to run the FCC process at a preferred temperature of about 566° C. to about 630° C., preferred pressure of about 138 kPa to about 240 kPa (20 to 35 psia). Another condition for the process is the catalyst to lipid composition ratio which can vary from about 5 to about 20 and preferably from about 10 to about 15.

In one embodiment of the method for producing a jet fuel, the lipid composition is introduced into the lift section of an FCC reactor. The temperature in the lift section will be very hot and range from about 700° C. (1292° F.) to about 760° C. (1400° F.) with a catalyst to lipid composition ratio of about 100 to about 150. It is anticipated that introducing the lipid composition into the lift section will produce considerable amounts of propylene and ethylene.

In another embodiment of the method for producing a jet fuel using the lipid composition or the lipids produced as described herein, the structure of the lipid composition or the lipids is broken by a process referred to as hydrodeoxygenation (HDO). HDO means removal of oxygen by means of hydrogen, that is, oxygen is removed while breaking the structure of the material. Olefinic double bonds are hydrogenated and any sulphur and nitrogen compounds are removed. Sulphur removal is called hydrodesulphurization (HDS). Pretreatment and purity of the raw materials (lipid composition or the lipids) contribute to the service life of the catalyst.

Generally in the HDO/HDS step, hydrogen is mixed with the feed stock (lipid composition or the lipids) and then the mixture is pissed through a catalyst bed as a co-current flow, either as a single phase or a two phase feed stock. After the HDO/MDS step, the product fraction is separated and passed to a separate isomerization reactor. An isomerization reactor for biological starting material is described in the literature (FI 100 248) as a co-current reactor.

The process for producing a fuel by hydrogenating a hydrocarbon feed, e.g., the lipid composition or the lipids herein, can also be performed by passing the lipid composition or the lipids as a co-current flow with hydrogen gas through a first hydrogenation zone, and thereafter the hydrocarbon effluent is further hydrogenated in a second hydrogenation zone by passing hydrogen gas to the second hydrogenation zone as a counter-current flow relative to the hydrocarbon effluent. Exemplary HDO applications and catalysts useful for cracking the lipid composition to produce C2-C5 olefins are described in U.S. Pat. No. 7,232,935, which is incorporated in its entirety by reference.

Typically, in the hydrodeoxygenation step, the structure of the biological component, such as the lipid composition or lipids herein, is decomposed, oxygen, nitrogen, phosphorus and sulphur compounds, and light hydrocarbons as gas are removed, and the olefinic bonds are hydrogenated. In the second step of the process, i.e. in the so-called isomerization step, isomerization is carried out for branching the hydrocarbon chain and improving the performance of the paraffin at low temperatures.

In the first step, i.e. HDO step, of the cracking process, hydrogen gas and the lipid composition or lipids herein which are to be hydrogenated are passed to a HDO catalyst bed system either as co-current or counter-current flows, said catalyst bed system comprising one or more catalyst bed(s), preferably 1-3 catalyst beds. The HDO step is typically operated in a co-current manner. In case of a HDO catalyst bed system comprising two or more catalyst beds, one or more of the beds may be operated using the counter-current flow principle. In the HDO step, the pressure varies between 20 and 150 bar, preferably between 50 and 100 bar, and the temperature varies between 200 and 500° C., preferably in the range of 300-400° C. In the HDO step, known hydrogenation catalysts containing metals from Group VII and/or VIB of the Periodic System may be used. Preferably, the hydrogenation catalysts are supported Pd, Pt, Ni, NiMo and/or a CoMo catalysts, the support being alumina and/or silica. Typically, NiMo/Al2O3 and CoMo/Al2O3 catalysts are used.

Prior to the HDO step, the lipid composition or lipids herein may optionally be treated by prehydrogenation under milder conditions thus avoiding side reactions of the double bonds. Such prehydrogenation is carried out in the presence of a prehydrogenation catalyst at temperatures of 50 400° C. and at hydrogen pressures of 1 200 bar, preferably at a temperature between 150 and 250° C. and at a hydrogen pressure between 10 and 100 bar. The catalyst may contain metals from Group VIII and/or VIB of the Periodic System. Preferably, the prehydrogenation catalyst is a supported Pd, Pt, Ni, NiMo and/or a CoMo catalyst, the support being alumina and/or silica.

A gaseous stream from the HDO step containing hydrogen is cooled and then carbon monoxide, carbon dioxide, nitrogen, phosphorus and sulphur compounds, gaseous light hydrocarbons and other impurities are removed therefrom. After compressing, the purified hydrogen or recycled hydrogen is returned back to the first catalyst bed and/or between the catalyst beds to make up for the withdrawn gas stream. Water is removed from the condensed liquid. The liquid is passed to the first catalyst bed and/or between the catalyst beds.

After the HDO step, the product is subjected to an isomerization step. It is substantial for the process that the impurities are removed as completely as possible before the hydrocarbons are contacted with the isomerization catalyst. The isomerization step comprises an optional stripping step, wherein the reaction product from the HDO step may be purified by stripping with water vapour or a suitable gas such as light hydrocarbon, nitrogen or hydrogen. The optional stripping step is carried out in counter-current manner in a unit upstream of the isomerization catalyst, wherein the gas and liquid are contacted with each other, or before the actual isomerization reactor in a separate stripping unit utilizing counter-current principle.

After the stripping step the hydrogen gas and the hydrogenated lipid composition or lipids herein, and optionally an n-paraffin mixture, are passed to a reactive isomerization unit comprising one or several catalyst bed(s). The catalyst beds of the isomerization step may operate either in co-current or counter-current manner.

It is important for the process that the counter-current flow principle is applied in the isomerization step. In the isomerization step this is done by carrying out either the optional stripping step or the isomerization reaction step or both in counter-current manner. In the isomerization step, the pressure varies in the range of 20 150 bar, preferably in the range of 20 100 bar, the temperature being between 200 and 500° C., preferably between 300 and 400° C. In the isomerization step, isomerization catalysts known in the art may be used. Suitable isomerization catalysts contain molecular sieve or a metal from Group VII and/or a carrier. Preferably, the isomerization catalyst contains SAPO-11 or SAPO41 or ZSM-22 or ZSM-23 and/or ferrierite and Pt, Pd or Ni and Al2O3 and/or SiO2. Typical isomerization catalysts are, for example, Pt/SAPO-11/Al2O3, Pt/ZSM-22/Al2O3, Pt/ZSM-23/Al2O3 and Pt/SAPO-11/SiO2. The isomerization step and the HDO step may be carried out in the same pressure vessel or in separate pressure vessels. Optional prehydrogenation may be carried out in a separate pressure vessel or in the same pressure vessel as the HDO and isomerization steps.

Thus, in one embodiment, the product of the one or more chemical reactions is an alkane mixture that comprises ASTM D1655 jet fuel. In some embodiments, the composition conforming to the specification of ASTM 1655 jet fuel has a sulfur content that is less than 10 ppm. In other embodiments, the composition conforming to the specification of ASTM 1655 jet fuel has a T10 value of the distillation curve of less than 205° C. In another embodiment, the composition conforming to the specification of ASTM 1655 jet fuel has a final boiling point (FBP) of less than 300° C. In another embodiment, the composition conforming to the specification of ASTM 1655 jet fuel has a flash point of at least 38° C. In another embodiment, the composition conforming to the specification of ASTM 1655 jet fuel has a density between 775K/M3 and 840K/M3. In yet another embodiment, the composition conforming to the specification of ASTM 1655 jet fuel has a freezing point that is below −47° C. In another embodiment, the composition conforming to the specification of ASTM 1655 jet fuel has a net Heat of Combustion that is at least 42.8 MJ/K. In another embodiment, the composition conforming to the specification of ASTM 1655 jet fuel has a hydrogen content that is at least 13.4 mass %. In another embodiment, the composition conforming to the specification of ASTM 1655 jet fuel has a thermal stability, as tested by quantitative gravimetric JFTOT at 260° C., that is below 3 mm of Hg. In another embodiment, the composition conforming to the specification of ASTM 1655 jet fuel has an existent gum that is below 7 mg/dl.

Thus, the present invention discloses a variety of methods in which chemical modification of microalgal lipid is undertaken to yield products useful in a variety of industrial and other applications. Examples of processes for modifying oil produced by the methods disclosed herein include, but are not limited to, hydrolysis of the oil, hydroprocessing of the oil, and esterification of the oil. The modification of the microalgal oil produces basic oleochemicals that can be further modified into selected derivative oleochemicals for a desired function. In a manner similar to that described above with reference to fuel producing processes, these chemical modifications can also be performed on oils generated from the microbial cultures described herein. Examples of basic oleochemicals include, but are not limited to, soaps, fatty acids, fatty acid methyl esters, and glycerol. Examples of derivative oleochemicals include, but are not limited to, fatty nitriles, esters, dimer acids, quats, surfactants, fatty alkanolamides, fatty alcohol sulfates, resins, emulsifiers, fatty alcohols, olefins, and higher alkanes.

Hydrolysis of the fatty acid constituents from the glycerolipids produced by the methods described herein yields free fatty acids that can be derivatized to produce other useful chemicals. Hydrolysis occurs in the presence of water and a catalyst which may be either an acid or a base. The liberated free fatty acids can be derivatized to yield a variety of products, as reported in the following: U.S. Pat. No. 5,304,664 (Highly sulfated fatty acids); U.S. Pat. No. 7,262,158 (Cleansing compositions); U.S. Pat. No. 7,115,173 (Fabric softener compositions); U.S. Pat. No. 6,342,208 (Emulsions for treating skin); U.S. Pat. No. 7,264,886 (Water repellant compositions); U.S. Pat. No. 6,924,333 (Paint additives); U.S. Pat. No. 6,596,768 (Lipid-enriched ruminant feedstock); and U.S. Pat. No. 6,380,410 (Surfactants for detergents and cleaners).

With regard to hydrolysis, in some embodiments, a triglyceride oil is optionally first hydrolyzed in a liquid medium such as water or sodium hydroxide so as to obtain glycerol and soaps. There are various suitable triglyceride hydrolysis methods, including, but not limited to, saponification, acid hydrolysis, alkaline hydrolysis, enzymatic hydrolysis (referred herein as splitting), and hydrolysis using hot-compressed water. One skilled in the art will recognize that a triglyceride oil need not be hydrolyzed in order to produce an oleochemical; rather, the oil may be converted directly to the desired oleochemical by other known process. For example, the triglyceride oil may be directly converted to a methyl ester fatty acid through esterification.

In some embodiments, catalytic hydrolysis of the oil produced by methods disclosed herein occurs by splitting the oil into glycerol and fatty acids. As discussed above, the fatty acids may then be further processed through several other modifications to obtained derivative oleochemicals. For example, in one embodiment the fatty acids may undergo an amination reaction to produce fatty nitrogen compounds. In another embodiment, the fatty acids may undergo ozonolysis to produce mono- and dibasic-acids.

In other embodiments hydrolysis may occur via the, splitting of oils produced herein to create oleochemicals. In some embodiments, a triglyceride oil may be split before other processes is performed. One skilled in the art will recognize that there are many suitable triglyceride splitting methods, including, but not limited to, enzymatic splitting and pressure splitting.

Generally, enzymatic oil splitting methods use enzymes, lipases, as biocatalysts acting on a water/oil mixture. Enzymatic splitting then splits the oil or fat, respectively, is into glycerol and free fatty acids. The glycerol may then migrates into the water phase whereas the organic phase enriches with free fatty acids.

The enzymatic splitting reactions generally take place at the phase boundary between organic and aqueous phase, where the enzyme is present only at the phase boundary. Triglycerides that meet the phase boundary then contribute to or participate in the splitting reaction. As the reaction proceeds, the occupation density or concentration of fatty acids still chemically bonded as glycerides, in comparison to free fatty acids, decreases at the phase boundary so that the reaction is slowed down. In certain embodiments, enzymatic splitting may occur at room temperature. One of ordinary skill in the art would know the suitable conditions for splitting oil into the desired fatty acids.

By way of example, the reaction speed can be accelerated by increasing the interface boundary surface. Once the reaction is complete, free fatty acids are then separated from the organic phase freed from enzyme, and the residue which still contains fatty acids chemically bonded as glycerides is fed back or recycled and mixed with fresh oil or fat to be subjected to splitting. In this manner, recycled glycerides are then subjected to a further enzymatic splitting process. In some embodiments, the free fatty acids are extracted from an oil or fat partially split in such a manner. In that way, if the chemically bound fatty acids (triglycerides) are returned or fed back into the splitting process, the enzyme consumption can be drastically reduced.

The splitting degree is determined as the ratio of the measured acid value divided by the theoretically possible acid value which can be computed for a given oil or fat. Preferably, the acid value is measured by means of titration according to standard common methods. Alternatively, the density of the aqueous glycerol phase can be taken as a measure for the splitting degree.

In one embodiment, the slitting process as described herein is also suitable for splitting the mono-, di- and triglyceride that are contained in the so-called soap-stock from the alkali refining processes of the produced oils. In this manner, the soap-stock can be quantitatively converted without prior saponification of the neutral oils into the fatty acids. For this purpose, the fatty acids being chemically bonded in the soaps are released, preferably before splitting, through an addition of acid. In certain embodiments, a buffer solution is used in addition to water and enzyme for the splitting process.

In one embodiment, oils produced in accordance with the methods described herein can also be subjected to saponification as a method of hydrolysis Animal and plant oils are typically made of triacylglycerols (TAGs), which are esters of fatty acids with the trihydric alcohol, glycerol. In an alkaline hydrolysis reaction, the glycerol in a TAG is removed, leaving three carboxylic acid anions that can associate with alkali metal cations such as sodium or potassium to produce fatty acid salts. In this scheme, the carboxylic acid constituents are cleaved from the glycerol moiety and replaced with hydroxyl groups. The quantity of base (e.g., KOH) that is used in the reaction is determined by the desired degree of saponification. If the objective is, for example, to produce a soap product that comprises some of the oils originally present in the TAG composition, an amount of base insufficient to convert all of the TAGs to fatty acid salts is introduced into the reaction mixture. Normally, this reaction is performed in an aqueous solution and proceeds slowly, but may be expedited by the addition of heat. Precipitation of the fatty acid salts can be facilitated by addition of salts, such as water-soluble alkali metal halides (e.g., NaCl or KCl), to the reaction mixture. Preferably, the base is an alkali metal hydroxide, such as NaOH or KOH. Alternatively, other bases, such as alkanolamines, including for example triethanolamine and aminomethylpropanol, can be used in the reaction scheme. In some cases, these alternatives may be preferred to produce a clear soap product.

In some methods, the first step of chemical modification may be hydroprocessing to saturate double bonds, followed by deoxygenation at elevated temperature in the presence of hydrogen and a catalyst. In other methods, hydrogenation and deoxygenation may occur in the same reaction. In still other methods deoxygenation occurs before hydrogenation. Isomerization may then be optionally performed, also in the presence of hydrogen and a catalyst. Finally, gases and naphtha components can be removed if desired. For example, see U.S. Pat. No. 5,475,160 (hydrogenation of triglycerides); U.S. Pat. No. 5,091,116 (deoxygenation, hydrogenation and gas removal); U.S. Pat. No. 6,391,815 (hydrogenation); and U.S. Pat. No. 5,888,947 (isomerization).

In some embodiments, the triglyceride oils are partially or completely deoxygenated. The deoxygenation reactions form desired products, including, but not limited to, fatty acids, fatty alcohols, polyols, ketones, and aldehydes. In general, without being limited by any particular theory, the deoxygenation reactions involve a combination of various different reaction pathways, including without limitation: hydrogenolysis, hydrogenation, consecutive hydrogenation-hydrogenolysis, consecutive hydrogenolysis-hydrogenation, and combined hydrogenation-hydrogenolysis reactions, resulting in at least the partial removal of oxygen from the fatty acid or fatty acid ester to produce reaction products, such as fatty alcohols, that can be easily converted to the desired chemicals by further processing. For example, in one embodiment, a fatty alcohol may be converted to olefins through FCC reaction or to higher alkanes through a condensation reaction.

One such chemical modification is hydrogenation, which is the addition of hydrogen to double bonds in the fatty acid constituents of glycerolipids or of free fatty acids. The hydrogenation process permits the transformation of liquid oils into semi-solid or solid fats, which may be more suitable for specific applications.

Hydrogenation of oil produced by the methods described herein can be performed in conjunction with one or more of the methods and/or materials provided herein, as reported in the following: U.S. Pat. No. 7,288,278 (Food additives or medicaments); U.S. Pat. No. 5,346,724 (Lubrication products); U.S. Pat. No. 5,475,160 (Fatty alcohols); U.S. Pat. No. 5,091,116 (Edible oils); U.S. Pat. No. 6,808,737 (Structural fats for margarine and spreads); U.S. Pat. No. 5,298,637 (Reduced-calorie fat substitutes); U.S. Pat. No. 6,391,815 (Hydrogenation catalyst and sulfur adsorbent); U.S. Pat. Nos. 5,233,099 and 5,233,100 (Fatty alcohols); U.S. Pat. No. 4,584,139 (Hydrogenation catalysts); U.S. Pat. No. 6,057,375 (Foam suppressing agents); and U.S. Pat. No. 7,118,773 (Edible emulsion spreads).

One skilled in the art will recognize that various processes may be used to hydrogenate carbohydrates. One suitable method includes contacting the carbohydrate with hydrogen or hydrogen mixed with a suitable gas and a catalyst under conditions sufficient in a hydrogenation reactor to form a hydrogenated product. The hydrogenation catalyst generally can include Cu, Re Ni, Fe, Co, Ru, Pd, Rh, Pt, Os, Ir, and alloys or any combination thereof, either alone or with promoters such as W, Mo, Au, Ag, Cr, Zn, Mn, Sn, B, P, Bi, and alloys or any combination thereof. Other effective hydrogenation catalyst materials include either supported nickel or ruthenium modified with rhenium. In an embodiment, the hydrogenation catalyst also includes any one of the supports, depending on the desired functionality of the catalyst. The hydrogenation catalysts may be prepared by methods known to those of ordinary skill in the art.

In some embodiments the hydrogenation catalyst includes a supported Group VIII metal catalyst and a metal sponge material (e.g., a sponge nickel catalyst). Raney nickel provides an example of an activated sponge nickel catalyst suitable for use in this invention. In other embodiment, the hydrogenation reaction in the invention is performed using a catalyst comprising a nickel-rhenium catalyst or a tungsten-modified nickel catalyst. One example of a suitable catalyst for a hydrogenation reaction is a carbon-supported nickel-rhenium catalyst.

In an embodiment, a suitable Raney nickel catalyst may be prepared by treating an alloy of approximately equal amounts by weight of nickel and aluminum with an aqueous alkali solution, e.g., containing about 25 weight % of sodium hydroxide. The aluminum is selectively dissolved by the aqueous alkali solution resulting in a sponge shaped material comprising mostly nickel with minor amounts of aluminum. The initial alloy includes promoter metals (i.e., molybdenum or chromium) in the amount such that about 1 to 2 weight % remains in the formed sponge nickel catalyst. In another embodiment, the hydrogenation catalyst is prepared using a solution of ruthenium(III) nitrosylnitrate, ruthenium (III) chloride in water to impregnate a suitable support material. The solution is then dried to form a solid having a water content of less than about 1% by weight. The solid may then be reduced at atmospheric pressure in a hydrogen stream at 300° C. (uncalcined) or 400° C. (calcined) in a rotary ball furnace for 4 hours. After cooling and rendering the catalyst inert with nitrogen, 5% by volume of oxygen in nitrogen is passed over the catalyst for 2 hours.

In certain embodiments, the catalyst described includes a catalyst support. The catalyst support stabilizes and supports the catalyst. The type of catalyst support used depends on the chosen catalyst and the reaction conditions. Suitable supports for the invention include, but are not limited to, carbon, silica, silica-alumina, zirconia, titania, ceria, vanadia, nitride, boron nitride, heteropolyacids, hydroxyapatite, zinc oxide, chromia, zeolites, carbon nanotubes, carbon fullerene and any combination thereof.

The catalysts used in this invention can be prepared using conventional methods known to those in the art. Suitable methods may include, but are not limited to, incipient wetting, evaporative impregnation, chemical vapor deposition, wash-coating, magnetron sputtering techniques, and the like.

The conditions for which to carry out the hydrogenation reaction will vary based on the type of starting material and the desired products. One of ordinary skill in the art, with the benefit of this disclosure, will recognize the appropriate reaction conditions. In general, the hydrogenation reaction is conducted at temperatures of 80° C. to 250° C., and preferably at 90° C. to 200° C., and most preferably at 100° C. to 150° C. In some embodiments, the hydrogenation reaction is conducted at pressures from 500 KPa to 14000 KPa.

The hydrogen used in the hydrogenolysis reaction of the current invention may include external hydrogen, recycled hydrogen, in situ generated hydrogen, and any combination thereof. As used herein, the term “external hydrogen” refers to hydrogen that does not originate from the biomass reaction itself, but rather is added to the system from another source.

In some embodiments, it is desirable to convert the starting carbohydrate to a smaller molecule that will be more readily converted to desired higher hydrocarbons. One suitable method for this conversion is through a hydrogenolysis reaction. Various processes are known for performing hydrogenolysis of carbohydrates. One suitable method includes contacting a carbohydrate with hydrogen or hydrogen mixed with a suitable gas and a hydrogenolysis catalyst in a hydrogenolysis reactor under conditions sufficient to form a reaction product comprising smaller molecules or polyols. As used herein, the term “smaller molecules or polyols” includes any molecule that has a smaller molecular weight, which can include a smaller number of carbon atoms or oxygen atoms than the starting carbohydrate. In an embodiment, the reaction products include smaller molecules that include polyols and alcohols. Someone of ordinary skill in the art would be able to choose the appropriate method by which to carry out the hydrogenolysis reaction.

In some embodiments, a 5 and/or 6 carbon sugar or sugar alcohol may be converted to propylene glycol, ethylene glycol, and glycerol using a hydrogenolysis catalyst. The hydrogenolysis catalyst may include Cr, Mo, W, Re, Mn, Cu, Cd, Fe, Co, Ni, Pt, Pd, Rh, Ru, Ir, Os, and alloys or any combination thereof, either alone or with promoters such as Au, Ag, Cr, Zn, Mn, Sn, Bi, B, O, and alloys or any combination thereof. The hydrogenolysis catalyst may also include a carbonaceous pyropolymer catalyst containing transition metals (e.g., chromium, molybdemum, tungsten, rhenium, manganese, copper, cadmium) or Group VIII metals (e.g., iron, cobalt, nickel, platinum, palladium, rhodium, ruthenium, iridium, and osmium). In certain embodiments, the hydrogenolysis catalyst may include any of the above metals combined with an alkaline earth metal oxide or adhered to a catalytically active support. In certain embodiments, the catalyst described in the hydrogenolysis reaction may include a catalyst support as described above for the hydrogenation reaction.

The conditions for which to carry out the hydrogenolysis reaction will vary based on the type of starting material and the desired products. One of ordinary skill in the art, with the benefit of this disclosure, will recognize the appropriate conditions to use to carry out the reaction. In general, they hydrogenolysis reaction is conducted at temperatures of 110° C. to 300° C., and preferably at 170° C. to 220° C., and most preferably at 200° C. to 225° C. In some embodiments, the hydrogenolysis reaction is conducted under basic conditions, preferably at a pH of 8 to 13, and even more preferably at a pH of 10 to 12. In some embodiments, the hydrogenolysis reaction is conducted at pressures in a range between 60 KPa and 16500 KPa, and preferably in a range between 1700 KPa and 14000 KPa, and even more preferably between 4800 KPa and 11000 KPa.

The hydrogen used in the hydrogenolysis reaction of the current invention can include external hydrogen, recycled hydrogen, in situ generated hydrogen, and any combination thereof.

In some embodiments, the reaction products discussed above may be converted into higher hydrocarbons through a condensation reaction in a condensation reactor (shown schematically as condensation reactor 110 in FIG. 1). In such embodiments, condensation of the reaction products occurs in the presence of a catalyst capable of forming higher hydrocarbons. While not intending to be limited by theory, it is believed that the production of higher hydrocarbons proceeds through a stepwise addition reaction including the formation of carbon-carbon, or carbon-oxygen bond. The resulting reaction products include any number of compounds containing these moieties, as described in more detail below.

In certain embodiments, suitable condensation catalysts include an acid catalyst, a base catalyst, or an acid/base catalyst. As used herein, the term “acid/base catalyst” refers to a catalyst that has both an acid and a base functionality. In some embodiments the condensation catalyst can include, without limitation, zeolites, carbides, nitrides, zirconia, alumina, silica, aluminosilicates, phosphates, titanium oxides, zinc oxides, vanadium oxides, lanthanum oxides, yttrium oxides, scandium oxides, magnesium oxides, cerium oxides, barium oxides, calcium oxides, hydroxides, heteropolyacids, inorganic acids, acid modified resins, base modified resins, and any combination thereof. In some embodiments, the condensation catalyst can also include a modifier. Suitable modifiers include La, Y, Sc, P, B, Bi, Li, Na, K, Rb, Cs, Mg, Ca, Sr, Ba, and any combination thereof. In some embodiments, the condensation catalyst can also include a metal. Suitable metals include Cu, Ag, Au, Pt, Ni, Fe, Co, Ru, Zn, Cd, Ga, In, Rh, Pd, Ir, Re, Mn, Cr, Mo, W, Sn, Os, alloys, and any combination thereof.

In certain embodiments, the catalyst described in the condensation reaction may include a catalyst support as described above for the hydrogenation reaction. In certain embodiments, the condensation catalyst is self-supporting. As used herein, the term “self-supporting” means that the catalyst does not need another material to serve as support. In other embodiments, the condensation catalyst in used in conjunction with a separate support suitable for suspending the catalyst. In an embodiment, the condensation catalyst support is silica.

The conditions under which the condensation reaction occurs will vary based on the type of starting material and the desired products. One of ordinary skill in the art, with the benefit of this disclosure, will recognize the appropriate conditions to use to carry out the reaction. In some embodiments, the condensation reaction is carried out at a temperature at which the thermodynamics for the proposed reaction are favorable. The temperature for the condensation reaction will vary depending on the specific starting polyol or alcohol. In some embodiments, the temperature for the condensation reaction is in a range from 80° C. to 500° C., and preferably from 125° C. to 450° C., and most preferably from 125° C. to 250° C. In some embodiments, the condensation reaction is conducted at pressures in a range between 0 Kpa to 9000 KPa, and preferably in a range between 0 KPa and 7000 KPa, and even more preferably between 0 KPa and 5000 KPa.

The higher alkanes formed by the invention include, but are not limited to, branched or straight chain alkanes that have from 4 to 30 carbon atoms, branched or straight chain alkenes that have from 4 to 30 carbon atoms, cycloalkanes that have from 5 to 30 carbon atoms, cycloalkenes that have from 5 to 30 carbon atoms, aryls, fused aryls, alcohols, and ketones. Suitable alkanes include, but are not limited to, butane, pentane, pentene, 2-methylbutane, hexane, hexene, 2-methylpentane, 3-methylpentane, 2,2,-dimethylbutane, 2,3-dimethylbutane, heptane, heptene, octane, octene, 2,2,4-trimethylpentane, 2,3-dimethyl hexane, 2,3,4-trimethylpentane, 2,3-dimethylpentane, nonane, nonene, decane, decene, undecane, undecene, dodecane, dodecene, tridecane, tridecene, tetradecane, tetradecene, pentadecane, pentadecene, nonyldecane, nonyldecene, eicosane, eicosene, uneicosane, uneicosene, doeicosane, doeicosene, trieicosane, trieicosene, tetraeicosane, tetraeicosene, and isomers thereof. Some of these products may be suitable for use as fuels.

In some embodiments, the cycloalkanes and the cycloalkenes are unsubstituted. In other embodiments, the cycloalkanes and cycloalkenes are mono-substituted. In still other embodiments, the cycloalkanes and cycloalkenes are multi-substituted. In the embodiments comprising the substituted cycloalkanes and cycloalkenes, the substituted group includes, without limitation, a branched or straight chain alkyl having 1 to 12 carbon atoms, a branched or straight chain alkylene having 1 to 12 carbon atoms, a phenyl, and any combination thereof. Suitable cycloalkanes and cycloalkenes include, but are not limited to, cyclopentane, cyclopentene, cyclohexane, cyclohexene, methyl-cyclopentane, methyl-cyclopentene, ethyl-cyclopentane, ethyl-cyclopentene, ethyl-cyclohexane, ethyl-cyclohexene, isomers and any combination thereof.

In some embodiments, the aryls formed are unsubstituted. In another embodiment, the aryls formed are mono-substituted. In the embodiments comprising the substituted aryls, the substituted group includes, without limitation, a branched or straight chain alkyl having 1 to 12 carbon atoms, a branched or straight chain alkylene having 1 to 12 carbon atoms, a phenyl, and any combination thereof. Suitable aryls for the invention include, but are not limited to, benzene, toluene, xylene, ethyl benzene, para xylene, meta xylene, and any combination thereof.

The alcohols produced in the invention have from 4 to 30 carbon atoms. In some embodiments, the alcohols are cyclic. In other embodiments, the alcohols are branched. In another embodiment, the alcohols are straight chained. Suitable alcohols for the invention include, but are not limited to, butanol, pentanol, hexanol, heptanol, octanol, nonanol, decanol, undecanol, dodecanol, tridecanol, tetradecanol, pentadecanol, hexadecanol, heptyldecanol, octyldecanol, nonyldecanol, eicosanol, uneicosanol, doeicosanol, trieicosanol, tetraeicosanol, and isomers thereof.

The ketones produced in the invention have from 4 to 30 carbon atoms. In an embodiment, the ketones are cyclic. In another embodiment, the ketones are branched. In another embodiment, the ketones are straight chained. Suitable ketones for the invention include, but are not limited to, butanone, pentanone, hexanone, heptanone, octanone, nonanone, decanone, undecanone, dodecanone, tridecanone, tetradecanone, pentadecanone, hexadecanone, heptyldecanone, octyldecanone, nonyldecanone, eicosanone, uneicosanone, doeicosanone, trieicosanone, tetraeicosanone, and isomers thereof.

Another such chemical modification is interesterification. Naturally produced glycerolipids do not have a uniform distribution of fatty acid constituents. In the context of oils, interesterification refers to the exchange of acyl radicals between two esters of different glycerolipids. The interesterification process provides a mechanism by which the fatty acid constituents of a mixture of glycerolipids can be rearranged to modify the distribution pattern. Interesterification is a well-known chemical process, and generally comprises heating (to about 200° C.) a mixture of oils for a period (e.g, 30 minutes) in the presence of a catalyst, such as an alkali metal or alkali metal alkylate (e.g., sodium methoxide). This process can be used to randomize the distribution pattern of the fatty acid constituents of an oil mixture, or can be directed to produce a desired distribution pattern. This method of chemical modification of lipids can be performed on materials provided herein, such as microbial biomass with a percentage of dry cell weight as lipid at least 20%.

Directed interesterification, in which a specific distribution pattern of fatty acids is sought, can be performed by maintaining the oil mixture at a temperature below the melting point of some TAGs which might occur. This results in selective crystallization of these TAGs, which effectively removes them from the reaction mixture as they crystallize. The process can be continued until most of the fatty acids in the oil have precipitated, for example. A directed interesterification process can be used, for example, to produce a product with a lower calorie content via the substitution of longer-chain fatty acids with shorter-chain counterparts. Directed interesterification can also be used to produce a product with a mixture of fats that can provide desired melting characteristics and structural features sought in food additives or products (e.g., margarine) without resorting to hydrogenation, which can produce unwanted trans isomers.

Interesterification of oils produced by the methods described herein can be performed in conjunction with one or more of the methods and/or materials, or to produce products, as reported in the following: U.S. Pat. No. 6,080,853 (Nondigestible fat substitutes); U.S. Pat. No. 4,288,378 (Peanut butter stabilizer); U.S. Pat. No. 5,391,383 (Edible spray oil); U.S. Pat. No. 6,022,577 (Edible fats for food products); U.S. Pat. No. 5,434,278 (Edible fats for food products); U.S. Pat. No. 5,268,192 (Low calorie nut products); U.S. Pat. No. 5,258,197 (Reduce calorie edible compositions); U.S. Pat. No. 4,335,156 (Edible fat product); U.S. Pat. No. 7,288,278 (Food additives or medicaments); U.S. Pat. No. 7,115,760 (Fractionation process); U.S. Pat. No. 6,808,737 (Structural fats); U.S. Pat. No. 5,888,947 (Engine lubricants); U.S. Pat. No. 5,686,131 (Edible oil mixtures); and U.S. Pat. No. 4,603,188 (Curable urethane compositions).

In one embodiment in accordance with the invention, transesterification of the oil, as described above, is followed by reaction of the transesterified product with polyol, as reported in U.S. Pat. No. 6,465,642, to produce polyol fatty acid polyesters. Such an esterification and separation process may comprise the steps as follows: reacting a lower alkyl ester with polyol in the presence of soap; removing residual soap from the product mixture; water-washing and drying the product mixture to remove impurities; bleaching the product mixture for refinement; separating at least a portion of the unreacted lower alkyl ester from the polyol fatty acid polyester in the product mixture; and recycling the separated unreacted lower alkyl ester.

Transesterification can also be performed on microbial biomass with short chain fatty acid esters, as reported in U.S. Pat. No. 6,278,006. In general, transesterification may be performed by adding a short chain fatty acid ester to an oil in the presence of a suitable catalyst and heating the mixture. In some embodiments, the oil comprises about 5% to about 90% of the reaction mixture by weight. In some embodiments, the short chain fatty acid esters can be about 10% to about 50% of the reaction mixture by weight. Non-limiting examples of catalysts include base catalysts, sodium methoxide, acid catalysts including inorganic acids such as sulfuric acid and acidified clays, organic acids such as methane sulfonic acid, benzenesulfonic acid, and toluenesulfonic acid, and acidic resins such as Amberlyst 15. Metals such as sodium and magnesium, and metal hydrides also are useful catalysts.

Another such chemical modification is hydroxylation, which involves the addition of water to a double bond resulting in saturation and the incorporation of a hydroxyl moiety. The hydroxylation process provides a mechanism for converting one or more fatty acid constituents of a glycerolipid to a hydroxy fatty acid. Hydroxylation can be performed, for example, via the method reported in U.S. Pat. No. 5,576,027. Hydroxylated fatty acids, including castor oil and its derivatives, are useful as components in several industrial applications, including food additives, surfactants, pigment wetting agents, defoaming agents, water proofing additives, plasticizing agents, cosmetic emulsifying and/or deodorant agents, as well as in electronics, pharmaceuticals, paints, inks, adhesives, and lubricants. One example of how the hydroxylation of a glyceride may be performed is as follows: fat may be heated, preferably to about 30-50° C. combined with heptane and maintained at temperature for thirty minutes or more; acetic acid may then be added to the mixture followed by an aqueous solution of sulfuric acid followed by an aqueous hydrogen peroxide solution which is added in small increments to the mixture over one hour; after the aqueous hydrogen peroxide, the temperature may then be increased to at least about 60° C. and stirred for at least six hours; after the stirring, the mixture is allowed to settle and a lower aqueous layer formed by the reaction may be removed while the upper heptane layer formed by the reaction may be washed with hot water having a temperature of about 60° C.; the washed heptane layer may then be neutralized with an aqueous potassium hydroxide solution to a pH of about 5 to 7 and then removed by distillation under vacuum; the reaction product may then be dried under vacuum at 100° C. and the dried product steam-deodorized under vacuum conditions and filtered at about 50° to 60° C. using diatomaceous earth.

Hydroxylation of microbial oils produced by the methods described herein can be performed in conjunction with one or more of the methods and/or materials, or to produce products, as reported in the following: U.S. Pat. No. 6,590,113 (Oil-based coatings and ink); U.S. Pat. No. 4,049,724 (Hydroxylation process); U.S. Pat. No. 6,113,971 (Olive oil butter); U.S. Pat. No. 4,992,189 (Lubricants and lube additives); U.S. Pat. No. 5,576,027 (Hydroxylated milk); and U.S. Pat. No. 6,869,597 (Cosmetics).

Hydroxylated glycerolipids can be converted to estolides. Estolides consist of a glycerolipid in which a hydroxylated fatty acid constituent has been esterified to another fatty acid molecule. Conversion of hydroxylated glycerolipids to estolides can be carried out by warming a mixture of glycerolipids and fatty acids and contacting the mixture with a mineral acid, as described by Isbell et al., JAOCS 71(2):169-174 (1994). Estolides are useful in a variety of applications, including without limitation those reported in the following: U.S. Pat. No. 7,196,124 (Elastomeric materials and floor coverings); U.S. Pat. No. 5,458,795 (Thickened oils for high-temperature applications); U.S. Pat. No. 5,451,332 (Fluids for industrial applications); U.S. Pat. No. 5,427,704 (Fuel additives); and U.S. Pat. No. 5,380,894 (Lubricants, greases, plasticizers, and printing inks).

Other chemical reactions that can be performed on microbial oils include reacting triacylglycerols with a cyclopropanating agent to enhance fluidity and/or oxidative stability, as reported in U.S. Pat. No. 6,051,539; manufacturing of waxes from triacylglycerols, as reported in U.S. Pat. No. 6,770,104; and epoxidation of triacylglycerols, as reported in “The effect of fatty acid composition on the acrylation kinetics of epoxidized triacylglycerols”, Journal of the American Oil Chemists' Society, 79:1, 59-63, (2001) and Free Radical Biology and Medicine, 37:1, 104-114 (2004).

The generation of oil-bearing microbial biomass for fuel and chemical products as described above results in the production of delipidated biomass meal. Delipidated meal is a byproduct of preparing algal oil and is useful as animal feed for farm animals, e.g., ruminants, poultry, swine and aquaculture. The resulting meal, although of reduced oil content, still contains high quality proteins, carbohydrates, fiber, ash, residual oil and other nutrients appropriate for an animal feed. Because the cells are predominantly lysed by the oil separation process, the delipidated meal is easily digestible by such animals. Delipidated meal can optionally be combined with other ingredients, such as grain, in an animal feed. Because delipidated meal has a powdery consistency, it can be pressed into pellets using an extruder or expander or another type of machine, which are commercially available.

The invention, having been described in detail above, is exemplified in the following examples, which are offered to illustrate, but not to limit, the claimed invention.

EXAMPLES

The following examples are offered to illustrate, but not to limit the claimed invention.

Example 1

Altering the Specificity of a 12:0-Acyl-Acyl Carrier Protein (ACP) Thioesterase

This example demonstrates altering the specificity of a 12:0-Acyl ACP Thioesterase (TE), using Prototheca moriformis as a host.

In the present example, we demonstrate the ability to alter the substrate specificity as well as enhance the maturation of the 12:0-acyl-acyl carrier protein (ACP) thioesterase from California bay tree (Umbellularia californica,“Uc”) (Uc FatB2/Uc TE, accession M94159). This was achieved by replacing the N-terminal portion of Uc TE with the corresponding region from the closely related 14:0-ACP thioesterase from camphor tree (Cinnamomum camphorum, “Cc”) (Cc FATB1/Cc TE, accession U31813).

Both Uc TE and Cc TE are nuclear encoded proteins, which must be trafficked to the plastid to perform their respective activities in microalgae. This transport occurs through the recognition of a transit peptide located at the N-terminus of the nascent thioesterase by the plastid transporter complex. Once inside the plastid, the transit peptide is cleaved, liberating the mature thioesterase. This maturation process can be tracked by Western blotting of total cell lysates due to a discernible difference in mobility between the nascent and the mature protein. As shown in FIG. 1, we found a significant difference in the overall efficiency of maturation between Uc TE and Cc TE within P. moriformis. This finding is surprising, as both proteins contain the same heterologous transit peptide from the Chlorella protothecoides Stearoyl ACP Desaturase (SAD) protein and exhibit greater than 90% amino acid identity between the mature proteins.

We then investigated whether one or more of the nine non-overlapping amino acids within the N-terminus of the Cc TE (as compared to the corresponding aligned Uc TE sequence) was critical for the efficient maturation observed for this thioesterase. Therefore, we decided to test the impact of replacing the N-terminus of the Uc TE with the corresponding region from Cc TE. Yuan et al. (Proc Natl Acad Sci USA. (1995) 92(23):10639-43), concluded that acyl-ACP thioesterase specificity was not impacted by the N-terminal 178 amino acids of Uc TE or Cc TE as assessed in E. coli. In Yuan, et al., Leu84 was the start of the mature protein for expression in E. coli. In contrast, Pro61 is the first residue after the C. protothecoides SAD transit peptide for the present Cc TE and Uc TE expression constructs. Trp179 was the fusion point for the Uc TE and Cc TE thioesterase chimeras of Yuan, et al.

We used Trp179 as the fusion point for the construction of six Cc-Uc TE chimeras in which different segments of the Cc TE gene were used to replace the corresponding region of the Uc TE (FIG. 3). The constructs were transformed into a classically mutagenized derivative of Prototheca moriformis strain UTEX 1435 that we term strain A. Transformations, cell culture, lipid production and quantification were all carried out as previously described, e.g., in PCT Publications WO2008/151149, WO2010/06032, WO2011/150410, and WO2011/150411. The impact on maturation of each chimeric thioesterase was compared to the wild-type Cc TE and Uc TE via Western blotting of total cell lysates.

As described below, we discovered three amino acids (Asn91, Pro92 and Pro102) unique to Cc TE that enabled efficient maturation when grafted onto Uc TE. The more efficient maturation may allow for greater shifts in the fatty acid profile of an oil produced by a cell expressing an exogenous acyl-ACP TE having variant amino acids at those positions. Moreover, we discovered four Cc TE specific amino acids (Val127, Leu133, Ala137, and Ile163) that imparted a novel, dual 12:0 and 14:0 ACP activities when grafted onto Uc TE. When acyl-ACP TEs variants in these amino acid positions are expressed in an oleaginous cell, the cell may produce triglycerides with desirable or even novel fatty acid profiles.

Example 2

Cc-Uc Thioesterase Chimera Constructs

Construct D1022 [pSZ2037] Used to Express the Cc-Uc FATB TE Chimera a within P. moriformis (UTEX 1435 Strain A).

In this example, A strains, transformed with the construct pSZ2037, were generated which express sucrose invertase (allowing for their selection and growth on medium containing sucrose) and a chimeric fusion between Cc TE and Uc TE. Construct pSZ2037 introduced for expression in strain A can be written as 6SA::Cr(btub)-syn(yINV)-Cv(nr):Pm(amt03)-Cp(SAD1tp)-Cc(TE2)-Uc(TE2)-chimeraA-Cv(nr)::6sB.

The sequence of the transforming DNA is provided in FIG. 4. Relevant restriction sites in the construct are indicated with underlined lowercase, and are from 5′-3′ BspQI, KpnI, AscI, MfeI, EcoRI, SpeI, AscI, XhoI, SacI, BspQI, respectively. BspQI sites delimit the 5′ and 3′ ends of the transforming DNA. Bold, lowercase sequences represent genomic DNA from A that permit targeted integration at the 6S locus via homologous recombination. Proceeding in the 5′ to 3′ direction, the C. reinhardtii β-tubulin promoter driving the expression of the Saccharomyces cerevisiae SUC2 gene (encoding sucrose hydrolyzing activity, thereby permitting the strain to grow on sucrose) is indicated by lowercase, boxed text. The initiator ATG and terminator TGA for SUC2 are indicated by uppercase italics, while the coding region is indicated with lowercase italics. The Chlorella vulgaris nitrate reductase (NR) gene 3′-UTR is indicated by lowercase text followed by a spacer segment (dotted underlined, lowercase) and a P. moriformis AMT3 promoter (indicated by boxed italicized text) driving the expression of the C. camphorum and U. californica chimeric fusion thioesterase. The C. protothecoides SAD1 transit peptide is indicated with uppercase, boxed text, while the C. camphorum and U. californica derived sequences with underlined italic and bold uppercase, respectively. The C-terminal FLAG epitope tag is noted with underlined lowercase. The C. vulgaris nitrate reductase 3′-UTR is again indicated by lowercase text followed by the A 6S genomic region indicated by bold, lowercase text. The final construct was sequenced to ensure correct reading frames and targeting sequences.

Constructs Used for the Expression of an Uc-Cc TE Chimera and Four Additional Cc-Uc TE Chimeras (Chimeras B-E) in A

In addition to the Cc-UC TE chimera A, five additional chimeric thioesterase expression constructs were designed. These constructs can be described as:

pSZ2038—6SA::Cr(btub)-syn(INV)-Cv(nr):Pm(amt03)-Cp(SAD1tp)-Uc(TE2)-Cc(TE2)-Cv(nr)::6sB

pSZ2231—6SA::Cr(btub)-syn(yINV)-Cv(nr):Pm(amt03)-Cp(SAD1tp)-Cc(TE2)-Uc(TE2)-chimeraB-Cv(nr)::6sB

DSZ2232—6SA::Cr(btub)-syn(yINV)-Cv(nr):Pm(amt03)-Cp(SAD1tp)-Cc(TE2)-Uc(TE2)-chimeraC-Cv(nr)::6sB

pSZ2233—6SA::Cr(btub)-syn(yINV)-Cv(nr):Pm(amt03)-Cp(SAD1tp)-Cc(TE2)-Uc(TE2)-chimeraD-Cv(nr)::6sB

pSZ2234—6SA::Cr(btub)-syn(yINV)-Cv(nr):Pm(amt03)-Cp(SAD1tp)-Cc(TE2)-Uc(TE2)-chimeraE-Cv(nr)::6sB

All of these constructs have the same vector backbone; selectable marker, promoter, plastid transit peptide, FLAG epitope tag and 3′-UTR as pSZ2037, differing only in the respective Cc-Uc chimeric thioesterase. Relevant restriction sites in these constructs are also the same as in pSZ2037. FIGS. 5-9 indicate the appropriate chimeric thioesterase sequence wherein the Cc TE derived sequence is noted with underlined italic while the Uc TE derived sequence is noted with bold uppercase text.

Expression of heterologous thioesterase variants in P. moriformis resulted in unique specific fatty acid profiles of interest. Strain D, which expresses a Cuphea wrightii thioesterase (accession U56103) with its endogenous plastid transit peptide, gave elevated levels of C10:0, C12:0 and C14:0 fatty acids with approximately a 1:6:3 ratio (C10:C12:C14). Expression of the Cc TE (accession U31813) in strain E with the Chlorella protothecoides SAD transit peptide, resulted in elevated C12:0 and C14:0 fatty acids at a 1:10 ratio of C12:C14. Expression of the Uc TE (accession M94159) in strain F, also containing the Chlorella protothecoides SAD transit peptide, resulted in elevated C12:0 and C14:0 fatty acids at a 7:1 ratio of C12:C14. Strain A represents the base strain of P. moriformis. Data is shown in Table 1 in biological replicates (A and B) for each strain.

TABLE 1
Sample ID C8:0 C10:0 C12:0 C14:0 C16:0 C18:0 C18:1 C18:2
Strain D-A 0.03 5.59 32.11 15.59 12.73 1.14 24.59 6.98
Strain D-C 0.03 5.89 32.79 15.61 12.58 1.16 24.01 6.63
Strain E-A 0.00 0.03 2.47 23.90 23.95 1.72 35.93 10.32
Strain E-B 0.00 0.04 2.50 25.02 23.06 1.69 36.91 9.28
Strain F-A 0.00 0.25 29.59 4.00 11.51 0.84 36.86 14.91
Strain F-B 0.00 0.22 27.16 4.20 13.50 1.06 37.30 14.42
Strain A-A 0.00 0.00 0.03 1.28 28.88 2.92 59.91 5.32
Strain A-A 0.00 0.01 0.04 1.35 30.23 2.89 58.38 5.44

Table 2 and FIG. 10 illustrate a comparison of fatty acid (FA) profiles for representative derivative transgenic lines transformed with pSZ2037 (D1022, Cc-Uc TE chimera A) and pSZ2038 (D1023, Uc-Cc TE chimera) DNAs (see FIG. 3), and, as a reference, expression in Strain A. Replacing the N-terminus of Uc TE with the corresponding region from Cc TE (pSZ2037; D1022) resulted in a novel FA profile exhibiting elevated C12:0 and C14:0 at an approximate 1:1 ratio. Moreover, these strains exhibit increased steady state levels of mature protein as compared to the wild-type Uc TE (represented in strain F). In contrast, replacing the N-terminus of Cc TE with the corresponding region from Uc TE (pSZ2038; D1023) resulted in poor expression and limited processing of the nascent protein into the mature form.

TABLE 2
Sample ID C10:0 C12:0 C14:0 C16:0
ctrl A 0.01 0.04 1.37 29.62
T289; D1023-36 0.01 0.04 1.52 29.98
T289; D1023-27 0.01 0.04 1.39 26.97
T289; D1023-20 0.01 0.04 1.43 27.18
T289; D1023-11 0.01 0.04 1.45 29.11
T289; D1023-10 0.01 0.04 1.40 28.38
T289; D1022-33 0.02 2.34 3.09 24.81
T289; D1022-27 0.08 14.43 10.92 20.21
T289; D1022-17 0.02 1.8 2.7 25.07
T289; D1022-12 0.03 3.27 3.72 23.75
T289; D1022-8 0.02 1.54 2.47 25.92

Table 3 and FIG. 11 illustrate a comparison of FA profiles for expression in Strain A versus representative derivative transgenic lines transformed with pSZ2231 (D1210, Cc-Uc TE chimera B) or pSZ2232 (D1211, Cc-Uc TE chimera C) DNAs. While strains expressing the Cc-Uc TE chimera B (pSZ2231; D1210) exhibited FA profiles with C12:0 and C14:0 levels at an approximate 1:1 ratio; the Cc-Uc TE chimera C (pSZ2232; D1211) results in an approximate 4:1 ratio of C12:0 to C14:0.

TABLE 3
Sample ID C8:0 C10:0 C12:0 C14:0 C16:0
ctrl A 0.00 0.01 0.04 1.48 28.70
T326; D1211-48 0.00 0.03 5.73 1.88 22.07
T326; D1211-36 0.00 0.05 8.22 2.19 20.16
T326; D1211-34 0.00 0.04 6.75 2.00 21.85
T326; D1211-12 0.00 0.06 10.89 2.48 20.12
T326; D1211-2 0.00 0.06 11.24 2.50 18.90
T326; D1210-46 0.00 0.05 7.85 6.65 19.71
T326; D1210-32 0.00 0.05 7.35 6.36 19.92
T326; D1210-23 0.00 0.08 12.48 8.91 19.24
T326; D1210-20 0.00 0.08 12.58 9.12 18.12
T326; D1210-17 0.00 0.05 8.12 6.70 20.43

Importantly, strains expressing either construct exhibited increased steady state levels of mature protein as compared to the wild-type Uc TE (represented in strain F).

Table 4 and FIG. 12 illustrate a comparison of FA profiles for expression in Strain A versus representative derivative transgenic lines transformed with pSZ2233 (D1212, Cc-Uc TE chimera D) or pSZ2234 (D1213, Cc-Uc TE chimera E) DNAs (see FIG. 3). Strains expressing the Cc-Uc TE chimera D (pSZ2233; D1212) exhibited FA profiles with C12:0 and C14:0 levels at an approximate 4:1 ratio, similar to that for the native Uc TE enzyme. In contrast, strains expressing the Cc-Uc TE chimera E (pSZ2234; D1213) exhibited FA profiles in an approximate 1:1 ratio of C12:0 to C14:0. Furthermore, strains expressing either construct exhibited a moderate increase in steady state levels of mature protein as compared to the wild-type Uc TE (represented in strain F).

TABLE 4
Sample ID C8:0 C10:0 C12:0 C14:0 C16:0
ctrl A 0.00 0.01 0.04 1.48 28.70
T326; D1213-22 0.00 0.04 5.05 5.02 21.32
T326; D1213-21 0.00 0.05 6.84 6.28 20.23
T326; D1213-16 0.00 0.05 7.98 6.82 19.88
T326; D1213-9 0.00 0.04 4.66 4.72 21.55
T326; D1213-4 0.00 0.07 10.62 8.34 18.39
T326; D1212-36 0.00 0.03 5.09 1.82 21.31
T326; D1212-24 0.00 0.05 7.34 2.21 15.83
T326; D1212-18 0.00 0.05 8.96 2.32 23.03
T326; D1212-16 0.00 0.04 4.84 1.82 21.95
T326; D1212-13 0.00 0.06 11.43 2.44 20.36

Amino acids identified from chimeric fusions between Cc TE and Uc TE required for efficient maturation of the nascent protein (Asn91, Pro92 and Pro102) and the four Cc TE specific amino acids (Val127, Leu133, Ala137, and Ile163) which impart a novel 1:1 ratio of C12:0 to C14:0 when inserted into the context of an Uc TE backbone are depicted in FIG. 13. Accordingly, mutation of a FATB2 gene to have one or more or Asn91, Pro92 and Pro102 can increase the activity of the gene product encoded by the gene when expressed in an oleaginous cell, and especially a microalgal algal or plant cell having a type 2 fatty acid synthesis pathway. Likewise, mutation of a FATB2 gene to have one or more or Val127, Leu133, Ala137, and Ile163 can increase the activity of the gene product encoded by the gene when expressed in an oleaginous cell, and especially a microalgal algal or plant cell having a type 2 fatty acid synthesis pathway.

Example 3

Conserved Domains Immediately Downstream of the Predicted Plastid Transit Peptide Enhance the Activity of FATB Thioesterases

In the present example, we demonstrate the ability to enhance the activity of FATB thioesterases by including conserved domains immediately downstream of the predicted plastid transit peptide. No function for these domains was previously known and so they may have been thought of as merely linkers between the enzyme and its plastid transit peptide. We show that including these domains with a native or heterologous transit peptide significantly improves the overall enzyme activity of a FATB acyl-ACP thioesterase overexpressed in Prototheca moriformis, as manifested in shifted fatty acid profiles. Moreover, we determined that fusing this region from a highly active thioesterase such as the 14:0-acyl-acyl carrier protein (ACP) thioesterase from Cuphea palustris (Cpal FATB2, accession AAC49180) or Cuphea wrightii (Cw FATB2, accession U56103) enhanced the activity of less functional thioesterases such as the FATB2 protein from Umbellularia californica (Uc FatB2/Uc TE, accession M94159).

We observed that several FATB proteins consistently exhibited an elevated specific activity when expressed in P. moriformis. As part of an effort to determine the reason for this difference, we investigated whether the N-terminal region of the FATB thioesterase contributed to the enzyme activity. Sequence alignment of plant thioesterases illustrates a striking degree of conservation at the extreme N-termini of FATB proteins (FIG. 14). This region overlaps the predicted plastid transit peptide and includes a Proline rich domain and a hydrophobic patch. Based on the assumption that the major function of the N-terminal region was to provide proper targeting of the nascent protein into the plastid, this portion of the thioesterase was generally replaced with a heterologous transit peptide for expression within P. moriformis.

Surprisingly, we noted the FATB thioesterase expression constructs with the highest degree of activity included most or all of the native N-termini, and that activity could be improved by varying the hydrophobic patch or proline-rich domain. As described below, we improved the specific activity of several thioesterases (e.g., Uc FATB2, accession M94159; Cinnamomum camphorum FATB1, accession U31813; Cpal FATB2, accession AAC49180; Ulmus Americana FATB1, accession 024420 and the herein-described Cc-Uc FATB chimera B (construct D1210)) by extending their N-termini to include the hydrophobic patch as well as all or part of the Proline-rich domain. These results demonstrate the importance of the N-terminal region for maximal FATB thioesterase activity. Moreover, these results demonstrate the ability to improve the activity of an underperforming FATB thioesterase by replacing its N-terminus with that of a highly active thioesterase.

Construct D1056

Construct D1056 [pSZ2084] was used to express the Uc FATB2 containing an extended heterologous transit peptide from C. protothecoides within P. moriformis (UTEX 1435 strain A).

A strains, transformed with the construct pSZ2084, were generated which express sucrose invertase (allowing for their selection and growth on medium containing sucrose) and an Uc FATB2 expression construct derived from pSZ1118 in which the heterologous transit peptide from C. protothecoides is extended to include 15 additional amino acids from the SAD1 transit peptide and flanking region. Construct pSZ2084 introduced for expression in Strain A can be written as 6SA::CrTUB2-ScSUC2-CvNR:PmAMT3-CpSAD1tpExt-UcFATB2-CvNR::6SB.

The sequence of the transforming DNA is provided in FIGS. 15A-C. Relevant restriction sites in the construct are indicated with underlined lowercase, and are from 5′-3′ BspQI, KpnI, AscI, MfeI, EcoRI, SpeI, XhoI, SacI, BspQI, respectively. BspQI sites delimit the 5′ and 3′ ends of the transforming DNA. Bold, lowercase sequences represent genomic DNA from A that permit targeted integration at the 6S locus via homologous recombination. Proceeding in the 5′ to 3′ direction, the C. reinhardtii tubulin promoter driving the expression of the Saccharomyces cerevisiae SUC2 gene (encoding sucrose hydrolyzing activity, thereby permitting the strain to grow on sucrose) is indicated by lowercase, boxed text. The initiator ATG and terminator TGA for SUC2 are indicated by uppercase italics, while the coding region is indicated with lowercase italics. The Chlorella vulgaris nitrate reductase (NR) gene 3′-UTR is indicated by lowercase text followed by a spacer segment (dotted underlined, lowercase) and a P. moriformis AMT3 promoter (indicated by boxed italicized text) driving the expression of the U. californica chimeric fusion thioesterase. The extended C. protothecoides SAD1 transit peptide is indicated with underlined uppercase, while the U. californica FATB2 derived sequence is noted with bold uppercase. The C-terminal FLAG epitope tag is noted with underlined lowercase. The C. vulgaris nitrate reductase 3′-UTR is again indicated by lowercase text followed by the A 6S genomic region indicated by bold, lowercase text. The final construct was sequenced to ensure correct reading frames and targeting sequences.

Constructs D1057 and D1058

Constructs D1057 and D1058 were used for the expression of Uc FATB2 with 5 or 15 amino acid N-terminal extension (Uc FATB2 Ext A and Uc FATB2 Ext B, respectively) in Strain A.

In addition to the pSZ2084, two additional Uc FATB2 thioesterase expression constructs were designed. These constructs can be described as:

pSZ2085—6SA::CrTUB2-ScSUC2-CvNR:PmAMT3-CpSAD1tpExt-UcFATB2ExtA-CvNR::6SB

pSZ2086—6SA::CrTUB2-ScSUC2-CvNR:PmAMT3-CpSAD1 tpExt-UcFATB2ExtB-CvNR::6SB

These constructs have the same vector backbone; selectable marker, promoter, plastid transit peptide, FLAG epitope tag and 3′-UTR as pSZ2084, differing only in the respective Uc FATB2 thioesterase coding sequence. Relevant restriction sites in these constructs are also the same as in pSZ2084. FIGS. 16-17 indicate the appropriate extended Uc FATB2 thioesterase sequence wherein the extension is noted with underlined italic while the remaining Uc FATB2 sequence found in pSZ2084 is noted with bold uppercase text.

Constructs D1431 and D1432

Constructs D1431 and D1432 [pSZ2450 and pSZ2451] were used to express the 14:0-ACP thioesterase, Cinnamomum camphorum (Cc FATB1/Cc TE, accession U31813) containing an extended heterologous transit peptide from C. protothecoides and a five amino acid N-terminal extension derived from Uc FATB2 or Cc FATB1 (D1431 or D1432, respectively) within P. moriformis (UTEX 1435 strain C). These constructs can be described as:

pSZ2450—6SA::CrTUB2-ScSUC2-CvNR:PmAMT3-CpSAD1tpExt-CcFATB1ExtA-CvNR::6SB

pSZ2451—6SA::CrTUB2-ScSUC2-CvNR:PmAMT3-CpSAD1 tpExt-CcFATB1ExtB-CvNR::6SB

Both of these constructs have the same vector backbone; selectable marker, promoter, plastid transit peptide, FLAG epitope tag and 3′-UTR as pSZ2084, differing only in the respective Cc FATB1 thioesterase coding sequence. Relevant restriction sites in these constructs are also the same as in pSZ2084. FIGS. 19-20 indicate the appropriate extended Cc FATB1 thioesterase sequence wherein the extension is noted with underlined italic while the remaining Cc FATB1 sequence is noted with bold uppercase text.

Constructs D1481 and D1482

Constructs D1481 and D1482 [pSZ2479 and pSZ2480] were used to express the 14:0-ACP thioesterase, Cuphea palustris (Cpal FATB2, accession AAC49180) containing an extended heterologous transit peptide from C. protothecoides and a 41 amino acid N-terminal extension derived from the native Cpal FATB2 sequence within P. moriformis (UTEX 1435 strain C). These constructs can be described as:

pSZ2479—6SA::CrTUB2-ScSUC2-CvNR:PmAMT3-CpSAD1tpExt-CpalFATB2ExtA-CvNR::6SB

pSZ2480—6SA::CrTUB2-ScSUC2-CvNR:PmAMT3-CpSAD1tpExt-CpalFATB2ExtA3 xFLAG-CvNR::6SB

Both of these constructs have the same vector backbone; selectable marker, promoter, plastid transit peptide, and 3′ UTR as pSZ2084, differing only in the respective Cpal FATB2 thioesterase coding sequence and the presence or absence of a FLAG epitope tag. Relevant restriction sites in these constructs are also the same as in pSZ2084. FIGS. 22-23 indicate the appropriate extended Cpal FATB2 thioesterase sequence wherein the extension is noted with underlined italic while the remaining Cpal FATB2 sequence is noted with bold uppercase text and the FLAG epitope (pSZ2480) noted in lowercase text.

Constructs D1479 and D1480

Constructs D1479 and D1480 [pSZ2477 and pSZ2478] were used to express the Ulmus Americana 10:0-16:0-ACP thioesterase (Ua FATB1, accession 024420) containing an extended heterologous transit peptide from C. protothecoides and a 34 amino acid N-terminal extension derived from the native Ua FATB1 sequence within P. moriformis (UTEX 1435 strain C). These constructs can be described as:

pSZ2477—6SA::CrTUB2-ScSUC2-CvNR:PmAMT3-CpSAD1 tpExt-UaFATB1ExtA-CvNR::6SB

pSZ2478—6SA::CrTUB2-ScSUC2-CvNR:PmAMT3-CpSAD1 tpExt-UaFATB1ExtA3xFLAG-CvNR::6SB

Both of these constructs have the same vector backbone; selectable marker, promoter, plastid transit peptide, and 3′ UTR as pSZ2084, differing only in the respective Ua FATB1 thioesterase and the presence or absence of a C-terminal FLAG epitope tag. Relevant restriction sites in these constructs are also the same as in pSZ2084. FIGS. 25-26 indicate the appropriate extended Ua FATB1 thioesterase sequence wherein the extension is noted with underlined italic while the remaining Ua FATB1 sequence is noted with bold uppercase text. The FLAG epitope in pSZ2478 is noted in lowercase text.

Constructs D1210 and D1429

Constructs D1210 and D1429 [pSZ2231 and pSZ2448] were used to express the Cc-Uc FATB chimera B 12:0-14:0-ACP thioesterase within P. moriformis (UTEX 1435 strain C). The Cc-Uc chimera B (construct D1210, previously described) was generated by replacing the N-terminal portion of the Umbellularia californica (Uc FatB2/Uc TE, accession M94159) with the corresponding region from the closely related 14:0-ACP thioesterase, Cinnamomum camphorum (Cc FATB1/Cc TE, accession U31813). Construct D1429 contained an extended heterologous transit peptide from C. protothecoides and a five amino acid N-terminal extension derived from the native Uc FATB2 sequence. These constructs can be described as:

pSZ2231—6SA::CrTUB2-ScSUC2-CvNR:PmAMT3-CpSAD1 tp-CcFATB1-UcFATB2-ChimeraB-CvNR::6SB

pSZ2448—6SA::CrTUB2-ScSUC2-CvNR:PmAMT3-CpSAD1tpExt-CcFATB1-UcFATB2-ChimeraB-ExtA-CvNR::6SB

Both of these constructs have the same vector backbone; selectable marker, promoter, C-terminal FLAG epitope and 3′ UTR as pSZ2084, differing only in the respective Cc-Uc FATB2 chimeric thioesterase and plastid transit peptide. Relevant restriction sites in these constructs are also the same as in pSZ2084. FIGS. 28-29 indicate the appropriate Cc-Uc FATB2 thioesterase sequence (bold uppercase text) wherein the trimmed or extended C. protothecoides SAD1 transit peptide is indicated with underlined uppercase and the Uc FATB2 extension within D1429 is noted with underlined lowercase italic.

Example 4

Modifying Activity and Specificity of the Cuphea Hookeriana FATB Thioesterase

In this example, we demonstrate the ability to modify the activity and specificity of the Cuphea hookeriana FATB thioesterase (Ch FATB2, accession U39834) through mutagenesis of specific amino acids. Certain variant FATB are modified in the N-terminal specificity domain, which we described above as influencing the enzymatic fatty acid specificity (FIG. 41). Certain of these mutations are useful in generating natural oils enriched in C8 or C10 fatty acids (e.g. having a fatty acid profile with at least 10% C8, 10% C10, or 10% C8/C10). For example, use of the variants can at least double the C8, C10 percentage or C8/C10 ratio in a natural oil produced by a cell population, as compared to a wildtype FATB.

Based on the ability to generate a novel C12:0-C14:0 thioesterase through mutagenesis of the N-terminal specificity domain, a similar approach was followed to alter the activity of the C8:0-C10 Ch FATB2 thioesterase. Variant FATB genes were cloned into P. moriformis via homologous recombination as described in previous examples. FIG. 42A illustrates the sequence alignment of six unique FATB thioesterases relative to the Ch FATB2. Six chimeric FATBs were generated in which the highlighted N-terminal specificity domain of the Ch FATB2 was mutated to match the same region from each of the six alternative FATB sequences. This resulted in Ch FATB2 chimeras with as few as two, to as many 13 amino acid substitutions (FIG. 42B). The activity of each Ch FATB2 chimera was tested by expression within Prototheca moriformis. The fatty acid profiles of each chimera were compared to the expression of the wild-type FATB thioesterases (FIGS. 43-48).

Interestingly, P. moriformis strains expressing D3126-D3129, or D3131 had little or no C8:0-C10:0 fatty acid accumulation above non-transformed strains. However, P. moriformis strains expressing D3130 exhibited significant accumulation of C8:0-C10:0 fatty acids. In fact, the degree of C8:0-C10:0 accumulation for the D3130 chimera was greater than what was observed in strains expressing the wild-type D3042 Ch FATB2 (19.6% versus 9.7% C8:0-C10:0 sum, respectively). Moreover, the ratio of C8:0-C10:0 within D3130 strains was higher than what was observed in wild-type D3042 Ch FATB2 (0.49 versus 0.26 C8:0/C10:0, respectively) strains. These results suggest the D3130 Ch FATB2 chimera exhibits improved enzymatic activity as well as an altered specificity relative to the wild-type D3042 Ch FATB2.

The D3130 chimera contains two amino acid substitutions relative to the wild-type D3042 Ch FATB2. Both amino acid substitutions are located on helixes within the model structure. The His163-Tyr substitution is found within the same helix which contained three of the four amino acid substitutions present in the D1777 Uc FATB2 Chimera F. The Leu186-Pro substitution appears to be across from a published Met230-Iso substitution that improves the enzymatic activity of the C. palustris FATB1. Therefore, it is possible that the His163-Tyr substitution is responsible for the altered C8:0-C10 ratio while the Leu186-Pro substitution improves the accumulation of total C8:0-C10:0 fatty acids. These variations can be used synergistically. For example, a strain with both H163Y and L186P variations increased C8 from 1.8% to 6.5%, increased C10 from 7.44% to 13.11% and increased the C8/C10 ratio from 0.23 to 0.51.

It is understood that the examples and embodiments described herein are for illustrative purposes only and that various modifications or changes in light thereof will be suggested to persons skilled in the art and are to be included within the spirit and purview of this application and scope of the appended claims. All publications, patents, and patent applications cited herein are hereby incorporated by reference in their entirety for all purposes.

INFORMAL SEQUENCE LISTING

Sequence ID No: 1-Construct D1022 [pSZ2037], also written as
6SA::Cr(btub)-syn(yINV)-Cv(nr):Pm(amt03)-Cp(SAD1tp)-Cc(TE2)-
Uc(TE2)-chimeraA-Cv(nr)::6sB.
gctcttcgccgccgccactcctgctcgagcgcgcccgcgcgtgcgccgccagcgccttggccttttc
gccgcgctcgtgcgcgtcgctgatgtccatcaccaggtccatgaggtCtgccttgcgccggctgagc
cactgcttcgtccgggcggccaagaggagcatgagggaggactcctggtccagggtcctgacgtggt
cgcggctctgggagcgggccagcatcatctggctctgccgcaccgaggcCgcctccaactggtcctc
cagcagccgcagtcgccgccgaccctggcagaggaagacaggtgaggggtgtatgaattgtacagaa
caaccacgagccttgtctaggcagaatccctaccagtcatggctttacctggatgacggcctgcgaa
cagctgtccagcgaccctcgctgccgccgcttctcccgcacgCttctttccagcaccgtgatggcgc
gagccagcgccgcacgctggcgctgcgcttcgccgatctgaggacagtcggggaactctgatcagtc
taaacccccttgcgcgttagtgttgccatcctttgcagaccggtgagagccgacttgttgtgcgcca
ccccccacaccacctcctcccagaccaattctgtcacctttttggcgaaggcatcggcctcggcctg
cagagaggacagcagtgcccagccgctgggggttggcggatgcacgCtCaggtaccctttcttgcgc
tatgacacttccagcaaaaggtagggcgggctgcgagacggcttcccggcgctgcatgcaacaccga
tgatgcttcgaccccccgaagctccttcggggctgcatgggcgctccgatgccgctccagggcgagc
gctgtttaaatagccaggcccccgattgcaaagacattatagcgagctaccaaagccatattcaaac
acctagatcactaccacttctacacaggccactcgagCttgtgatcgcactccgctaagggggcgcc
tcttcctcttcgtttcagtcacaacccgcaaacggcgcgccATGctgctgcaggccttcctgttcct
gctggccggcttcgccgccaagatcagcgcctccatgacgaacgagacgtccgaccgccccctggtg
cacttcacccccaacaagggctggatgaacgaccccaacggcctgtggtacgacgagaaggacgcca
agtggcacctgtacttccagtacaacccgaacgacaccgtctgggggacgcccttgttctggggcca
cgccacgtccgacgacctgaccaactgggaggaccagcccatcgccatcgccccgaagcgcaacgac
tccggcgccttctccggctccatggtggtggactacaacaacacctccggcttcttcaacgacacca
tcgacccgcgccagcgctgcgtggccatctggacctacaacaccccggagtccgaggagcagtacat
ctcctacagcctggacggcggctacaccttcacCgagtaccagaagaaccccgtgctggccgccaac
tccacccagttccgcgacccgaaggtcttctggtacgagccctcccagaagtggatcatgaccgcgg
ccaagtcccaggactacaagatcgagatctactcctccgacgacctgaagtcctggaagctggagtc
cgcgttcgccaacgagggcttcctcggctaccagtacgagtgccccggcctgatcgaggtccccacc
gagcaggaccccagcaagtcctactgggtgatgttcatctccatcaaccccggcgccccggccggcg
gctccttcaaccagtacttcgtcggcagcttcaacggcacccacttcgaggccttcgacaaccagtc
ccgcgtggtggacttcggcaaggactactacgccctgcagaccttcttcaacaccgacccgacctac
gggagcgccctgggcatcgcgtgggcctccaactgggagtactccgccttcgtgcccaccaacccct
ggcgctcctccatgtccctcgtgcgcaagttctccctcaacaccgagtaccaggccaacccggagac
ggagctgatcaacctgaaggccgagccgatcctgaacatcagcaacgccggcccctggagccggttc
gccaccaacaccacgttgacgaaggccaacagctacaacgtcgacctgtccaacagcaccggcaccc
tggagttcgagctggtgtacgccgtcaacaccacccagacgatctccaagtccgtgttcgcggacct
ctccctctggttcaagggcctggaggaccccgaggagtacctccgcatgggcttcgaggtgtccgcg
tcctccttcttcctggaccgcgggaacagcaaggtgaagttcgtgaaggagaacccctacttcacca
accgcatgagcgtgaacaaccagcccttcaagagCgagaacgacctgtcctactacaaggtgtacgg
cttgctggaccagaacatcctggagctgtacttcaacgacggcgacgtcgtgtccaccaacacctac
ttcatgaccaccgggaacgccctgggctccgtgaacatgacgacgggggtggacaacctgttctaca
tcgacaagttccaggtgcgcgaggtcaagTGAcaattggcagcagcagctcggatagtatcgacaca
ctctggacgctggtcgtgtgatggactgttgccgccacacttgctgccttgacctgtgaatatccct
gccgcttttatcaaacagcctcagtgtgtttgatcttgtgtgtacgcgcttttgcgagttgctagct
gcttgtgctatttgcgaataccacccccagcatccccttccctcgtttcatatcgcttgcatcccaa
ccgcaacttatctacgctgtcctgctatccctcagcgctgctcctgctcctgctcactgcccctcgc
acagccttggtttgggctccgcctgtattctcctggtactgcaacctgtaaaccagcactgcaatgc
tgatgcacgggaagtagtgggatgggaacacaaatggaggatcccgcgtctcgaacagagcgcgcag
aggaacgctgaaggtctcgcctctgtcgcacctcagcgcggcatacaccacaataaccacctgacga
atgcgcttggttcttcgtccattagcgaagcgtccggttcacacacgtgccacgttggcgaggtggc
aggtgacaatgatcggtggagctgatggtcgaaacgttcacagcctagggatatcgaattcGGCCGA
CAGGACGCGCGTCAAAGGTGCTGGTCGTGTATGCCCTGGCCGGCAGGTCGTTGCTGCTGCTGGTTAG
TGATTCCGCAACCCTGATTTTGGCGTCTTATTTTGGCGTGGCAAACGCTGGCGCCCGCGAGCCGGGC
CGGCGGCGATGCGGTGCCCCACGGCTGCCGGAATCCAAGGGAGGCAAGAGCGCCCGGGTCAGTTGAA
GGGCTTTACGCGCAAGGTACAGCCGCTCCTGCAAGGCTGCGTGGTGGAATTGGACGTGCAGGTCCTG
CTGAAGTTCCTCCACCGCCTCACCAGCGGACAAAGCACCGGTGTATCAGGTCCGTGTCATCCACTCT
AAAGAGCTCGACTACGACCTACTGATGGCCCTAGATTCTTCATCAAAAACGCCTGAGACACTTGCCC
AGGATTGAAACTCCCTGAAGGGACCACCAGGGGCCCTGAGTTGTTCCTTCCCCCCGTGGCGAGCTGC
CAGCCAGGCTGTACCTGTGATCGAGGCTGGCGGGAAAATAGGCTTCGTGTGCTCAGGTCATGGGAGG
TGCAGGACAGCTCATGAAACGCCAACAATCGCACAATTCATGTCAAGCTAATCAGCTATTTCCTCTT
CACGAGCTGTAATTGTCCCAAAATTCTGGTCTACCGGGGGTGATCCTTCGTGTACGGGCCCTTCCCT
CAACCCTAGGTATGCGCGCATGCGGTCGCCGCGCAACTCGCGCGAGGGCCGAGGGTTTGGGACGGGC
CGTCCCGAAATGCAGTTGCACCCGGATGCGTGGCACCTTTTTTGCGATAATTTATGCAATGGACTGC
TCTGCAAAATTCTGGCTCTGTCGCCAACCCTAGGATCAGCGGCGTAGGATTTCGTAATCATTCGTCC
TGATGGGGAGCTACCGACTACCCTAATATCAGCCCGACTGCCTGACGCCAGCGTCCACTTTTGTGCA
CACATTCCATTCGTGCCCAAGACATTTCATTGTGGTGCGAAGCGTCCCCAGTTACGCTCACCTGTTT
CCCGACCTCCTTACTGTTCTGTCGACAGAGCGGGCCCACAGGCCGGTCGCAGCCactagtAACAATG
GCCACCGCATCCACTTTCTCGGCGTTCAATGCCCGCTGCGGCGACCTGCGTCGCTCGGCGGGCTCCG
GGCCCCGGCGCCCAGCGAGGCCCCTCCCCGTGCGCGggcgcgccCCCGACTGGTCCATGCTGTTCGC
CGTGATCACCACCATCTTCTCCGCCGCCGAGAAGCAGTGGACCAACCTGGAGTGGAAGCCCAAGCCC
AACCCCCCCCAGCTGCTGGACGACCACTTCGGCCCCCACGGCCTGGTGTTCCGCCGCACCTTCGCCA
TCCGCAGCTACGAGGTGGGCCCCGACCGCTCCACCAGCATCGTGGCCGTGATGAACCACCTGCAGGA
GGCCGCCCTGAACCACGCCAAGTCCGTGGGCATCCTGGGCGACGGCTTCGGCACCACCCTGGAGATG
TCCAAGCGCGACCTGATCTGGGTGGTGAAGCGCACCCACGTGGCCGTGGAGCGCTACCCCGCCTGGG
GCGACACCGTGGAGGTGGAGTGCTGGATCGGCGCCAGCGGCAACAACGGCATGCGCCGCGACTTCCT
GGTGCGCGACTGCAAGACCGGCGAGATCCTGACCCGCTGCACCTCCCTGAGCGTGCTGATGAACACC
CGCACCCGCCGCCTGAGCACCATCCCCGACGAGGTGCGCGGCGAGATCGGCCCCGCCTTCATCGACA
ACGTGGCCGTGAAGGACGACGAGATCAAGAAGCTGCAGAAGCTGAACGACTCCACCGCCGACTACAT
CCAGGGCGGCCTGACCCCCCGCTGGAACGACCTGGACGTGAACCAGCACGTGAACAACCTGAAGTAC
GTGGCCTGGGTGTTCGAGACCGTGCCCGACAGCATCTTCGAGTCCCACCACATCAGCTCCTTCACCC
TGGAGTACCGCCGCGAGTGCACCCGCGACTCCGTGCTGCGCAGCCTGACCACCGTGAGCGGCGGCAG
CTCCGAGGCCGGCCTGGTGTGCGACCACCTGCTGCAGCTGGAGGGCGGCAGCGAGGTGCTGCGCGCC
CGCACCGAGTGGCGCCCCAAGCTGACCGACTCCTTCCGCGGCATCAGCGTGATCCCCGCCGAGCCCC
GCGTGatggactacaaggaccacgacggcgactacaaggaccacgacatcgactacaaggacgacga
cgacaagtgactcgaggcagcagcagctcggatagtatcgacacactctggacgctggtcgtgtgat
ggactgttgccgccacacttgctgCcttgacctgtgaatatccctgccgcttttatcaaacagcctc
agtgtgtttgatcttgtgtgtacgcgcttttgcgagttgctagctgcttgtgctatttgcgaatacc
acccccagcatccccttccctcgtttcatatcgcttgcatcccaaccgcaacttatctacgctgtcc
tgctatccctcagcgctgctcctgctcctgctcactgcccctcgcacagccttggtttgggctccgc
ctgtattctcctggtactgcaacctgtaaaccagcactgcaatgctgatgcacgggaagtagtggga
tgggaacacaaatggaaagcttgagctcttgttttccagaaggagttgctccttgagcctttcattc
tcagcctcgataacctccaaagccgCtctaattgtggagggggttcgaatttaaaagcttggaatgt
tggttcgtgcgtctggaacaagcccagacttgttgctcactgggaaaaggaccatcagctccaaaaa
acttgccgctcaaaccgcgtacctCtgctttcgcgcaatctgccctgttgaaatcgccaccacattc
atattgtgacgcttgagcagtctgtaattgcctcagaatgtggaatcatctgccccctgtgcgagcc
catgccaggcatgtcgcgggcgaggacacccgccactcgtacagcagaccattatgctacctcacaa
tagttcataacagtgaccatatttctcgaagctccccaacgagcacctccatgctctgagtggccac
cccccggccctggtgcttgcggagggcaggtcaaccggcatggggctaccgaaatccccgaccggat
cccaccacccccgcgatgggaagaatctctccccgggatgtgggcccaccaccagcacaacctgctg
gcccaggcgagcgtcaaaccataccacacaaatatccttggcatcggccctgaattccttctgccgc
tctgctacccggtgcttctgtccgaagcaggggttgctagggatcgctccgagtccgcaaacccttg
tcgcgtggcggggcttgttcgagCttgaagagc
Sequence ID No: 2-nucleic acid sequence of C. protothecoides
SAD1 transit peptide followed by C. camphorum and U. californica
chimeric thioesterase in Construct D1022 [pSZ2037].
ATGGCCACCGCATCCACTTTCTCGGCGTTCAATGCCCGCTGCGGCGACCTGCGTCGCTCGGCGGGCT
CCGGGCCCCGGCGCCCAGCGAGGCCCCTCCCCGTGCGCGggcgcgccCCCGACTGGTCCATGCTGTT
CGCCGTGATCACCACCATCTTCTCCGCCGCCGAGAAGCAGTGGACCAACCTGGAGTGGAAGCCCAAG
CCCAACCCCCCCCAGCTGCTGGACGACCACTTCGGCCCCCACGGCCTGGTGTTCCGCCGCACCTTCG
CCATCCGCAGCTACGAGGTGGGCCCCGACCGCTCCACCAGCATCGTGGCCGTGATGAACCACCTGCA
GGAGGCCGCCCTGAACCACGCCAAGTCCGTGGGCATCCTGGGCGACGGCTTCGGCACCACCCTGGAG
ATGTCCAAGCGCGACCTGATCTGGGTGGTGAAGCGCACCCACGTGGCCGTGGAGCGCTACCCCGCCT
GGGGCGACACCGTGGAGGTGGAGTGCTGGATCGGCGCCAGCGGCAACAACGGCATGCGCCGCGACTT
CCTGGTGCGCGACTGCAAGACCGGCGAGATCCTGACCCGCTGCACCTCCCTGAGCGTGCTGATGAAC
ACCCGCACCCGCCGCCTGAGCACCATCCCCGACGAGGTGCGCGGCGAGATCGGCCCCGCCTTCATCG
ACAACGTGGCCGTGAAGGACGACGAGATCAAGAAGCTGCAGAAGCTGAACGACTCCACCGCCGACTA
CATCCAGGGCGGCCTGACCCCCCGCTGGAACGACCTGGACGTGAACCAGCACGTGAACAACCTGAAG
TACGTGGCCTGGGTGTTCGAGACCGTGCCCGACAGCATCTTCGAGTCCCACCACATCAGCTCCTTCA
CCCTGGAGTACCGCCGCGAGTGCACCCGCGACTCCGTGCTGCGCAGCCTGACCACCGTGAGCGGCGG
CAGCTCCGAGGCCGGCCTGGTGTGCGACCACCTGCTGCAGCTGGAGGGCGGCAGCGAGGTGCTGCGC
GCCCGCACCGAGTGGCGCCCCAAGCTGACCGACTCCTTCCGCGGCATCAGCGTGATCCCCGCCGAGC
CCCGCGTG
Sequence ID No: 3-amino acid sequence of C. protothecoides SAD1
transit peptide followed by C. camphorum and U. californica
chimeric thioesterase encoded by Construct D1022 [pSZ2037].
MATASTFSAFNARCGDLRRSAGSGPRRPARPLPVRGRAPDWSMLFAVITTIFSAAEKQWTNLEWKPK
PNPPQLLDDHFGPHGLVFRRTFAIRSYEVGPDRSTSIVAVMNHLQEAALNHAKSVGILGDGFGTTLE
MSKRDLIWVVKRTHVAVERYPAWGDTVEVECWIGASGNNGMRRDFLVRDCKTGEILTRCTSLSVLMN
TRTRRLSTIPDEVRGEIGPAFIDNVAVKDDEIKKLQKLNDSTADYIQGGLTPRWNDLDVNQHVNNLK
YVAWVFETVPDSIFESHHISSFTLEYRRECTRDSVLRSLTTVSGGSSEAGLVCDHLLQLEGGSEVLR
ARTEWRPKLTDSFRGISVIPAEPRV
Sequence ID No: 4-nucleic acid sequence of C. camphorum and U.
californica chimeric thioesterase in Construct D1022 [pSZ203].
CCCGACTGGTCCATGCTGTTCGCCGTGATCACCACCATCTTCTCCGCCGCCGAGAAGCAGTGGACCA
ACCTGGAGTGGAAGCCCAAGCCCAACCCCCCCCAGCTGCTGGACGACCACTTCGGCCCCCACGGCCT
GGTGTTCCGCCGCACCTTCGCCATCCGCAGCTACGAGGTGGGCCCCGACCGCTCCACCAGCATCGTG
GCCGTGATGAACCACCTGCAGGAGGCCGCCCTGAACCACGCCAAGTCCGTGGGCATCCTGGGCGACG
GCTTCGGCACCACCCTGGAGATGTCCAAGCGCGACCTGATCTGGGTGGTGAAGCGCACCCACGTGGC
CGTGGAGCGCTACCCCGCCTGGGGCGACACCGTGGAGGTGGAGTGCTGGATCGGCGCCAGCGGCAAC
AACGGCATGCGCCGCGACTTCCTGGTGCGCGACTGCAAGACCGGCGAGATCCTGACCCGCTGCACCT
CCCTGAGCGTGCTGATGAACACCCGCACCCGCCGCCTGAGCACCATCCCCGACGAGGTGCGCGGCGA
GATCGGCCCCGCCTTCATCGACAACGTGGCCGTGAAGGACGACGAGATCAAGAAGCTGCAGAAGCTG
AACGACTCCACCGCCGACTACATCCAGGGCGGCCTGACCCCCCGCTGGAACGACCTGGACGTGAACC
AGCACGTGAACAACCTGAAGTACGTGGCCTGGGTGTTCGAGACCGTGCCCGACAGCATCTTCGAGTC
CCACCACATCAGCTCCTTCACCCTGGAGTACCGCCGCGAGTGCACCCGCGACTCCGTGCTGCGCAGC
CTGACCACCGTGAGCGGCGGCAGCTCCGAGGCCGGCCTGGTGTGCGACCACCTGCTGCAGCTGGAGG
GCGGCAGCGAGGTGCTGCGCGCCCGCACCGAGTGGCGCCCCAAGCTGACCGACTCCTTCCGCGGCAT
CAGCGTGATCCCCGCCGAGCCCCGCGTG
Sequence ID No: 5-amino acid sequence of C. camphorum and U.
californica chimeric thioesterase encoded by Construct D1022
PDWSMLFAVITTIFSAAEKQWTNLEWKPKPNPPQLLDDHFGPHGLVFRRTFAIRSYEVGP
DRSTSIVAVMNHLQEAALNHAKSVGILGDGFGTTLEMSKRDLIWVVKRTHVAVERYPAWG
DTVEVECWIGASGNNGMRRDFLVRDCKTGEILTRCTSLSVLMNTRTRRLSTIPDEVRGEI
GPAFIDNVAVKDDEIKKLQKLNDSTADYIQGGLTPRWNDLDVNQHVNNLKYVAWVFETVP
OSIFESHHISSFTLEYRRECTRDSVLRSLTTVSGGSSEAGLVCDHLLQLEGGSEVLRART
IEWRPKLTDSFRGISVIPAEPRV
Sequence ID No: 6-nucleic acid sequence of C. camphorum and U.
californica chimeric thioesterase in Construct D1023 [pSZ2038]
CCCGACTGGTCCATGCTGTTCGCCGTGATCACCACCATCTTCAGCGCCGCCGAGAAGCAGTGGACCA
ACCTGGAGTGGAAGCCCAAGCCCAAGCTGCCCCAGCTGCTGGACGACCACTTCGGCCTGCACGGCCT
GGTGTTCCGCCGCACCTTCGCCATCCGCTCCTACGAGGTGGGCCCCGACCGCAGCACCTCCATCCTG
GCCGTGATGAACCACATGCAGGAGGCCACCCTGAACCACGCCAAGAGCGTGGGCATCCTGGGCGACG
GCTTCGGCACCACCCTGGAGATGTCCAAGCGCGACCTGATGTGGGTGGTGCGCCGCACCCACGTGGC
CGTGGAGCGCTACCCCACCTGGGGCGACACCGTGGAGGTGGAGTGCTGGGTGGGCGCCTCCGGCAAC
AACGGCCGCCGCCACGACTTCCTGGTGCGCGACTGCAAGACCGGCGAGATCCTGACCCGCTGCACCT
CCCTGAGCGTGATGATGAACACCCGCACCCGCCGCCTGAGCAAGATCCCCGAGGAGGTGCGCGGCGA
GATCGGCCCCGCCTTCATCGACAACGTGGCCGTGAAGGACGAGGAGATCAAGAAGCCCCAGAAGCTG
AACGACTCCACCGCCGACTACATCCAGGGCGGCCTGACCCCCCGCTGGAACGACCTGGACATCAACC
AGCACGTGAACAACATCAAGTACGTGGACTGGATCCTGGAGACCGTGCCCGACAGCATCTTCGAGAG
CCACCACATCTCCTCCTTCACCATCGAGTACCGCCGCGAGTGCACCATGGACAGCGTGCTGCAGTCC
CTGACCACCGTGAGCGGCGGCTCCTCCGAGGCCGGCCTGGTGTGCGAGCACCTGCTGCAGCTGGAGG
GCGGCAGCGAGGTGCTGCGCGCCAAGACCGAGTGGCGCCCCAAGCTGACCGACTCCTTCCGCGGCAT
CAGCGTGATCCCCGCCGAGTCCAGCGTG
Sequence ID No: 7-amino acid sequence of C. camphorum and U.
californica chimeric thioesterase encoded by Construct D1023
PDWSMLFAVITTIFSAAEKQWTNLEWKPKPKLPQLLDDHFGLHGLVFRRTFAIRSYEVGP
DRSTSILAVMNHMQEATLNHAKSVGILGDGFGTTLEMSKRDLMWVVRRTHVAVERYPTWG
DTVEVECWVGASGNNGRRHDFLVRDCKTGEILTRCTSLSVMMNTRTRRLSKIPEEVRGEI
GPAFIDNVAVKDEEIKKPQKLNDSTADYIQGGLTPRWNDLDINQHVNNIKYVDWILETVP
DSIFESHHISSFTIEYRRECTMDSVLQSLTTVSGGSSEAGLVCEHLLQLEGGSEVLRAKT
EWRPKLTDSFRGISVIPAESSV
Sequence ID No: 8-nucleic acid sequence of C. camphorum and U.
californica chimeric thioesterase B in Construct D1210 [pSZ2231]
CCCGACTGGTCCATGCTGTTCGCCGTGATCACCACCATCTTCTCCGCCGCCGAGAAGCAGTGGACCA
ACCTGGAGTGGAAGCCCAAGCCCAACCCCCCCCAGCTGCTGGACGACCACTTCGGCCCCCACGGCCT
GGTGTTCCGCCGCACCTTCGCCATCCGCAGCTACGAGGTGGGCCCCGACCGCTCCACCAGCATCGTG
GCCGTGATGAACCACCTGCAGGAGGCCGCCCTGAACCACGCCAAGTCCGTGGGCATCCTGGGCGACG
GCTTCGGCACCACCCTGGAGATGTCCAAGCGCGACCTGATCTGGGTGGTGCGCCGCACCCACGTGGC
CGTGGAGCGCTACCCCACCTGGGGCGACACCGTGGAGGTGGAGTGCTGGATCGGCGCCAGCGGCAAC
AACGGCATGCGCCGCGACTTCCTGGTGCGCGACTGCAAGACCGGCGAGATCCTGACCCGCTGCACCT
CCCTGAGCGTGCTGATGAACACCCGCACCCGCCGCCTGAGCACCATCCCCGACGAGGTGCGCGGCGA
GATCGGCCCCGCCTTCATCGACAACGTGGCCGTGAAGGACGACGAGATCAAGAAGCTGCAGAAGCTG
AACGACTCCACCGCCGACTACATCCAGGGCGGCCTGACCCCCCGCTGGAACGACCTGGACGTGAACC
AGCACGTGAACAACCTGAAGTACGTGGCCTGGGTGTTCGAGACCGTGCCCGACAGCATCTTCGAGTC
CCACCACATCAGCTCCTTCACCCTGGAGTACCGCCGCGAGTGCACCCGCGACTCCGTGCTGCGCAGC
CTGACCACCGTGAGCGGCGGCAGCTCCGAGGCCGGCCTGGTGTGCGACCACCTGCTGCAGCTGGAGG
GCGGCAGCGAGGTGCTGCGCGCCCGCACCGAGTGGCGCCCCAAGCTGACCGACTCCTTCCGCGGCAT
CAGCGTGATCCCCGCCGAGCCCCGCGTG
Sequence ID No: 9-amino acid sequence of C. camphorum and U.
californica chimeric thioesterase B encoded by Construct D1210
PDWSMLFAVITTIFSAAEKQWTNLEWKPKPNPPQLLDDHFGPHGLVFRRTFAIRSYEVGP
DRSTSIVAVMNHLQEAALNHAKSVGILGDGFGTTLEMSKRDLIWVVRRTHVAVERYPTWG
DTVEVECWIGASGNNGMRRDFLVRDCKTGEILTRCTSLSVLMNTRTRRLSTIPDEVRGEI
GPAFIDNVAVKDDEIKKLQKLNDSTADYIQGGLTPRWNDLDVNQHVNNLKYVAWVFETVP
DSIFESHHISSFTLEYRRECTRDSVLRSLTTVSGGSSEAGLVCDHLLQLEGGSEVLRART
EWRPKLTDSFRGISVIPAEPRV
Sequence ID No: 10-nucleic acid sequence of C. camphorum and U.
californica chimeric thioesterase C in Construct D1211 [pSZ2232]
CCCGACTGGTCCATGCTGTTCGCCGTGATCACCACCATCTTCTCCGCCGCCGAGAAGCAGTGGACCA
ACCTGGAGTGGAAGCCCAAGCCCAACCCCCCCCAGCTGCTGGACGACCACTTCGGCCCCCACGGCCT
GGTGTTCCGCCGCACCTTCGCCATCCGCAGCTACGAGGTGGGCCCCGACCGCTCCACCTCCATCCTG
GCCGTGATGAACCACATGCAGGAGGCCACCCTGAACCACGCCAAGAGCGTGGGCATCCTGGGCGACG
GCTTCGGCACCACCCTGGAGATGTCCAAGCGCGACCTGATGTGGGTGGTGCGCCGCACCCACGTGGC
CGTGGAGCGCTACCCCACCTGGGGCGACACCGTGGAGGTGGAGTGCTGGATCGGCGCCAGCGGCAAC
AACGGCATGCGCCGCGACTTCCTGGTGCGCGACTGCAAGACCGGCGAGATCCTGACCCGCTGCACCT
CCCTGAGCGTGCTGATGAACACCCGCACCCGCCGCCTGAGCACCATCCCCGACGAGGTGCGCGGCGA
GATCGGCCCCGCCTTCATCGACAACGTGGCCGTGAAGGACGACGAGATCAAGAAGCTGCAGAAGCTG
AACGACTCCACCGCCGACTACATCCAGGGCGGCCTGACCCCCCGCTGGAACGACCTGGACGTGAACC
AGCACGTGAACAACCTGAAGTACGTGGCCTGGGTGTTCGAGACCGTGCCCGACAGCATCTTCGAGTC
CCACCACATCAGCTCCTTCACCCTGGAGTACCGCCGCGAGTGCACCCGCGACTCCGTGCTGCGCAGC
CTGACCACCGTGAGCGGCGGCAGCTCCGAGGCCGGCCTGGTGTGCGACCACCTGCTGCAGCTGGAGG
GCGGCAGCGAGGTGCTGCGCGCCCGCACCGAGTGGCGCCCCAAGCTGACCGACTCCTTCCGCGGCAT
CAGCGTGATCCCCGCCGAGCCCCGCGTG
Sequence ID No: 11-amino acid sequence of C. camphorum and U.
californica chimeric thioesterase C encoded by Construct D1211
PDWSMLFAVITTIFSAAEKQWTNLEWKPKPNPPQLLDDHFGPHGLVFRRTFAIRSYEVGP
DRSTSILAVMNHMQEATLNHAKSVGILGDGFGTTLEMSKRDLMWVVRRTHVAVERYPTWG
DTVEVECWIGASGNNGMRRDFLVRDCKTGEILTRCTSLSVLMNTRTRRLSTIPDEVRGEI
GPAFIDNVAVKDDEIKKLQKLNDSTADYIQGGLTPRWNDLDVNQHVNNLKYVAWVFETVP
DSIFESHHISSFTLEYRRECTRDSVLRSLTTVSGGSSEAGLVCDHLLQLEGGSEVLRART
EWRPKLTDSFRGISVIPAEPRV
Sequence ID No: 12-nucleic acid sequence of C. camphorum and U.
californica chimeric thioesterase D in Construct D1212 [pSZ2233]
CCCGACTGGTCCATGCTGTTCGCCGTGATCACCACCATCTTCTCCGCCGCCGAGAAGCAGTGGACCA
ACCTGGAGTGGAAGCCCAAGCCCAAGCTGCCCCAGCTGCTGGACGACCACTTCGGCCTGCACGGCCT
GGTGTTCCGCCGCACCTTCGCCATCCGCTCCTACGAGGTGGGCCCCGACCGCAGCACCTCCATCCTG
GCCGTGATGAACCACATGCAGGAGGCCACCCTGAACCACGCCAAGAGCGTGGGCATCCTGGGCGACG
GCTTCGGCACCACCCTGGAGATGTCCAAGCGCGACCTGATGTGGGTGGTGCGCCGCACCCACGTGGC
CGTGGAGCGCTACCCCACCTGGGGCGACACCGTGGAGGTGGAGTGCTGGATCGGCGCCAGCGGCAAC
AACGGCATGCGCCGCGACTTCCTGGTGCGCGACTGCAAGACCGGCGAGATCCTGACCCGCTGCACCT
CCCTGAGCGTGCTGATGAACACCCGCACCCGCCGCCTGAGCACCATCCCCGACGAGGTGCGCGGCGA
GATCGGCCCCGCCTTCATCGACAACGTGGCCGTGAAGGACGACGAGATCAAGAAGCTGCAGAAGCTG
AACGACTCCACCGCCGACTACATCCAGGGCGGCCTGACCCCCCGCTGGAACGACCTGGACGTGAACC
AGCACGTGAACAACCTGAAGTACGTGGCCTGGGTGTTCGAGACCGTGCCCGACAGCATCTTCGAGTC
CCACCACATCAGCTCCTTCACCCTGGAGTACCGCCGCGAGTGCACCCGCGACTCCGTGCTGCGCAGC
CTGACCACCGTGAGCGGCGGCAGCTCCGAGGCCGGCCTGGTGTGCGACCACCTGCTGCAGCTGGAGG
GCGGCAGCGAGGTGCTGCGCGCCCGCACCGAGTGGCGCCCCAAGCTGACCGACTCCTTCCGCGGCAT
CAGCGTGATCCCCGCCGAGCCCCGCGTG
Sequence ID No: 13-amino acid sequence of C. camphorum and U.
californica chimeric thioesterase D encoded by Construct D1212
PDWSMLFAVITTIFSAAEKQWTNLEWKPKPKLPQLLDDHFGLHGLVFRRTFAIRSYEVGP
DRSTSILAVMNHMQEATLNHAKSVGILGDGFGTTLEMSKRDLMWVVRRTHVAVERYPTWG
DTVEVECWIGASGNNGMRRDFLVRDCKTGEILTRCTSLSVLMNTRTRRLSTIPDEVRGEI
GPAFIDNVAVKDDEIKKLQKLNDSTADYIQGGLTPRWNDLDVNQHVNNLKYVAWVFETVP
DSIFESHHISSFTLEYRRECTRDSVLRSLTTVSGGSSEAGLVCDHLLQLEGGSEVLRART
EWRPKLTDSFRGISVIPAEPRV
Sequence ID No: 14-nucleic acid sequence of C. camphorum and U.
californica chimeric thioesterase E in Construct D1213 [pSZ2234]
CCCGACTGGTCCATGCTGTTCGCCGTGATCACCACCATCTTCTCCGCCGCCGAGAAGCAGTGGACCA
ACCTGGAGTGGAAGCCCAAGCCCAAGCTGCCCCAGCTGCTGGACGACCACTTCGGCCTGCACGGCCT
GGTGTTCCGCCGCACCTTCGCCATCCGCTCCTACGAGGTGGGCCCCGACCGCAGCACCAGCATCGTG
GCCGTGATGAACCACCTGCAGGAGGCCGCCCTGAACCACGCCAAGTCCGTGGGCATCCTGGGCGACG
GCTTCGGCACCACCCTGGAGATGTCCAAGCGCGACCTGATCTGGGTGGTGCGCCGCACCCACGTGGC
CGTGGAGCGCTACCCCACCTGGGGCGACACCGTGGAGGTGGAGTGCTGGATCGGCGCCAGCGGCAAC
AACGGCATGCGCCGCGACTTCCTGGTGCGCGACTGCAAGACCGGCGAGATCCTGACCCGCTGCACCT
CCCTGAGCGTGCTGATGAACACCCGCACCCGCCGCCTGAGCACCATCCCCGACGAGGTGCGCGGCGA
GATCGGCCCCGCCTTCATCGACAACGTGGCCGTGAAGGACGACGAGATCAAGAAGCTGCAGAAGCTG
AACGACTCCACCGCCGACTACATCCAGGGCGGCCTGACCCCCCGCTGGAACGACCTGGACGTGAACC
AGCACGTGAACAACCTGAAGTACGTGGCCTGGGTGTTCGAGACCGTGCCCGACAGCATCTTCGAGTC
CCACCACATCAGCTCCTTCACCCTGGAGTACCGCCGCGAGTGCACCCGCGACTCCGTGCTGCGCAGC
CTGACCACCGTGAGCGGCGGCAGCTCCGAGGCCGGCCTGGTGTGCGACCACCTGCTGCAGCTGGAGG
GCGGCAGCGAGGTGCTGCGCGCCCGCACCGAGTGGCGCCCCAAGCTGACCGACTCCTTCCGCGGCAT
CAGCGTGATCCCCGCCGAGCCCCGCGTG
Sequence ID No: 15-amino acid sequence of C. camphorum and U.
californica chimeric thioesterase E encoded by Construct D1213
PDWSMLFAVITTIFSAAEKQWTNLEWKPKPKLPQLLDDHFGLHGLVFRRTFAIRSYEVGP
DRSTSIVAVMNHLQEAALNHAKSVGILGDGFGTTLEMSKRDLIWVVRRTHVAVERYPTWG
DTVEVECWIGASGNNGMRRDFLVRDCKTGEILTRCTSLSVLMNTRTRRLSTIPDEVRGEI
GPAFIDNVAVKDDEIKKLQKLNDSTADYIQGGLTPRWNDLDVNQHVNNLKYVAWVFETVP
DSIFESHHISSFTLEYRRECTRDSVLRSLTTVSGGSSEAGLVCDHLLQLEGGSEVLRART
EWRPKLTDSFRGISVIPAEPRV
Sequence ID No: 16-Construct pSZ2084, also written as
6SA::CrTUB2-ScSUC2-CvNR:PmAMT3-CpSAD1tpExt-UcFATB2-CvNR::6SB,
comprising an extended heterologous transit peptide from C.
protothecoides extended to include 15 additional amino acids from
the SAD1 transit peptide and flanking region
gctcttcgccgccgccactcctgctcgagcgcgcccgcgcgtgcgccgccagcgccttggccttttc
gccgcgctcgtgcgcgtcgctgatgtccatcaccaggtccatgaggtctgccttgcgccggctgagc
cactgcttcgtccgggcggccaagaggagcatgagggaggactCCtggtccagggtcctgacgtggt
cgcggctctgggagcgggccagcatcatctggctctgccgcaccgaggccgcctccaactggtcctc
cagcagccgcagtcgccgccgaccctggcagaggaagacaggtgaggggtgtatgaattgtacagaa
caaccacgagccttgtctaggcagaatccctaCCagtcatggctttacctggatgacggcctgcgaa
cagctgtccagcgaccctcgctgccgccgcttctcccgcacgcttctttccagcaccgtgatggcgc
gagccagcgccgcacgctggcgctgcgcttcgccgatctgaggacagtcggggaactctgatcagtc
taaacccccttgcgcgttagtgttgccatcctttgcagaccggtgagagccgacttgttgtgcgcca
ccccccacaccacctcctcccagaccaattctgtcacctttttggcgaaggcatcggcctcggcctg
cagagaggacagcagtgcccagccgctgggggttggcggatgcacgctcaggtaccctttcttgcgc
tatgacacttccagcaaaaggtagggcgggctgcgagacggcttcccggcgctgcatgcaacaccga
tgatgcttcgaccccccgaagctccttcggggctgcatgggcgctccgatgccgctccagggcgagc
gctgtttaaatagccaggcccccgattgcaaagacattatagcgagctaccaaagccatattcaaac
acctagatcactaccacttctacacaggccactcgagcttgtgatcgcactccgctaagggggcgcc
tcttcctcttcgtttcagtcacaacccgcaaacggcgcgccATGctgctgcaggccttcctgttcct
gctggccggcttcgccgccaagatcagcgCCtccatgacgaacgagacgtccgaccgccccctggtg
cacttcacccccaacaagggctggatgaacgaccccaacggcctgtggtacgacgagaaggacgcca
agtggcacctgtacttccagtacaacccgaacgacaccgtctgggggacgcccttgttctggggcca
cgccacgtccgacgacctgaccaactgggaggaccagcccatcgccatcgccccgaagcgcaacgac
tccggcgccttctccggctccatggtggtggactacaacaacacctccggcttcttcaacgacacca
tcgacccgcgccagcgctgcgtggccatctggacctacaacaccccggagtccgaggagcagtacat
ctcctacagcctggacggcggctacaccttcaccgagtaccagaagaaccccgtgctggccgccaac
tccacccagttccgcgacccgaaggtCttctggtacgagccctcccagaagtggatcatgaccgcgg
ccaagtcccaggactacaagatcgagatctactcctccgacgacctgaagtcctggaagctggagtc
cgcgttcgccaacgagggcttcctcggctaccagtacgagtgccccggcctgatcgaggtccccacc
gagcaggaccccagcaagtcctactgggtgatgttcatctccatcaaccccggcgccccggccggcg
gctccttcaaccagtacttcgtcggcagcttcaacggcacccacttcgaggccttcgacaaccagtc
ccgcgtggtggacttcggcaaggactactacgccctgcagaccttcttcaacaccgacccgacctac
gggagcgccctgggcatcgcgtgggcctccaactgggagtactccgccttcgtgcccaccaacccct
ggcgctcctccatgtccctcgtgcgcaagttctccctcaacaccgagtaccaggccaacccggagac
ggagctgatcaacctgaaggccgagccgatcctgaacatcagcaacgccggcccctggagccggttc
gccaccaacaccacgttgacgaaggccaacagctacaacgtcgacctgtccaacagcaccggcaccc
tggagttcgagctggtgtacgccgtcaacaccacccagacgatctccaagtccgtgttcgcggacct
ctccctctggttcaagggcctggaggaccccgaggagtacctccgcatgggcttcgaggtgtccgcg
tcctccttcttcctggaccgcgggaaCagcaaggtgaagttcgtgaaggagaacccctacttcacca
accgcatgagcgtgaacaaccagcccttcaagagcgagaacgacctgtcctactacaaggtgtacgg
cttgctggaccagaacatcctggagctgtacttcaacgacggcgacgtcgtgtccaccaacacctac
ttcatgaccaccgggaacgccctgggctccgtgaacatgacgacgggggtggacaacctgttctaca
tcgacaagttccaggtgcgcgaggtcaagTGAcaattggcagcagcagctcggatagtatcgacaca
ctctggacgctggtcgtgtgatggactgttgccgccacacttgctgccttgacctgtgaatatccct
gccgcttttatcaaacagcctcagtgtgtttgatcttgtgtgtacgcgcttttgcgagttgctagct
gcttgtgctatttgcgaataccacccccagCatccccttccctcgtttcatatcgcttgcatcccaa
ccgcaacttatctacgctgtcctgctatccctcagcgctgctcctgctcctgctcactgcccctcgc
acagccttggtttgggctccgcctgtattctcctggtactgcaacctgtaaaccagcactgcaatgc
tgatgcacgggaagtagtgggatgggaaCacaaatggaggatcccgcgtctcgaacagagcgcgcag
aggaacgctgaaggtctcgcctctgtcgCacctcagcgcggcatacaccacaataaccacctgacga
atgcgcttggttcttcgtccattagcgaagcgtccggttcacacacgtgccacgttggcgaggtggc
aggtgacaatgatcggtggagctgatggtcgaaacgttcacagcctagggatatcgaattcGGCCGA
CAGGACGCGCGTCAAAGGTGCTGGTCGTGTATGCCCTGGCCGGCAGGTCGTTGCTGCTGCTGGTTAG
TGATTCCGCAACCCTGATTTTGGCGTCTTATTTTGGCGTGGCAAACGCTGGCGCCCGCGAGCCGGGC
CGGCGGCGATGCGGTGCCCCACGGCTGCCGGAATCCAAGGGAGGCAAGAGCGCCCGGGTCAGTTGAA
GGGCTTTACGCGCAAGGTACAGCCGCTCCTGCAAGGCTGCGTGGTGGAATTGGACGTGCAGGTCCTG
CTGAAGTTCCTCCACCGCCTCACCAGCGGACAAAGCACCGGTGTATCAGGTCCGTGTCATCCACTCT
AAAGAGCTCGACTACGACCTACTGATGGCCCTAGATTCTTCATCAAAAACGCCTGAGACACTTGCCC
AGGATTGAAACTCCCTGAAGGGACCACCAGGGGCCCTGAGTTGTTCCTTCCCCCCGTGGCGAGCTGC
CAGCCAGGCTGTACCTGTGATCGAGGCTGGCGGGAAAATAGGCTTCGTGTGCTCAGGTCATGGGAGG
TGCAGGACAGCTCATGAAACGCCAACAATCGCACAATTCATGTCAAGCTAATCAGCTATTTCCTCTT
CACGAGCTGTAATTGTCCCAAAATTCTGGTCTACCGGGGGTGATCCTTCGTGTACGGGCCCTTCCCT
CAACCCTAGGTATGCGCGCATGCGGTCGCCGCGCAACTCGCGCGAGGGCCGAGGGTTTGGGACGGGC
CGTCCCGAAATGCAGTTGCACCCGGATGCGTGGCACCTTTTTTGCGATAATTTATGCAATGGACTGC
TCTGCAAAATTCTGGCTCTGTCGCCAACCCTAGGATCAGCGGCGTAGGATTTCGTAATCATTCGTCC
TGATGGGGAGCTACCGACTACCCTAATATCAGCCCGACTGCCTGACGCCAGCGTCCACTTTTGTGCA
CACATTCCATTCGTGCCCAAGACATTTCATTGTGGTGCGAAGCGTCCCCAGTTACGCTCACCTGTTT
CCCGACCTCCTTACTGTTCTGTCGACAGAGCGGGCCCACAGGCCGGTCGCAGCCactagtAACAATG
GCCACCGCATCCACTTTCTCGGCGTTCAATGCCCGCTGCGGCGACCTGCGTCGCTCGGCGGGCTCCG
GGCCCCGGCGCCCAGCGAGGCCCCTCCCCGTGCGCGCTGCCATCGCCAGCGAGGTCCCCGTGGCCAC
CACCTCCCCCCGGCCCGACTGGTCCATGCTGTTCGCCGTGATCACCACCATCTTCAGCGCCGCCGAG
AAGCAGTGGACCAACCTGGAGTGGAAGCCCAAGCCCAAGCTGCCCCAGCTGCTGGACGACCACTTCG
GCCTGCACGGCCTGGTGTTCCGCCGCACCTTCGCCATCCGCTCCTACGAGGTGGGCCCCGACCGCAG
CACCTCCATCCTGGCCGTGATGAACCACATGCAGGAGGCCACCCTGAACCACGCCAAGAGCGTGGGC
ATCCTGGGCGACGGCTTCGGCACCACCCTGGAGATGTCCAAGCGCGACCTGATGTGGGTGGTGCGCC
GCACCCACGTGGCCGTGGAGCGCTACCCCACCTGGGGCGACACCGTGGAGGTGGAGTGCTGGATCGG
CGCCAGCGGCAACAACGGCATGCGCCGCGACTTCCTGGTGCGCGACTGCAAGACCGGCGAGATCCTG
ACCCGCTGCACCTCCCTGAGCGTGCTGATGAACACCCGCACCCGCCGCCTGAGCACCATCCCCGACG
AGGTGCGCGGCGAGATCGGCCCCGCCTTCATCGACAACGTGGCCGTGAAGGACGACGAGATCAAGAA
GCTGCAGAAGCTGAACGACTCCACCGCCGACTACATCCAGGGCGGCCTGACCCCCCGCTGGAACGAC
CTGGACGTGAACCAGCACGTGAACAACCTGAAGTACGTGGCCTGGGTGTTCGAGACCGTGCCCGACA
GCATCTTCGAGTCCCACCACATCAGCTCCTTCACCCTGGAGTACCGCCGCGAGTGCACCCGCGACTC
CGTGCTGCGCAGCCTGACCACCGTGAGCGGCGGCAGCTCCGAGGCCGGCCTGGTGTGCGACCACCTG
CTGCAGCTGGAGGGCGGCAGCGAGGTGCTGCGCGCCCGCACCGAGTGGCGCCCCAAGCTGACCGACT
CCTTCCGCGGCATCAGCGTGATCCCCGCCGAGCCCCGCGTGatggactacaaggaccacgacggcga
ctacaaggaccacgacatcgactacaaggacgacgacgacaagtgactcgaggcagcagcagctcgg
atagtatcgacacactctggacgctggtcgtgtgatggactgttgccgccacacttgctgccttgac
ctgtgaatatccctgccgcttttatcaaacagcctcagtgtgtttgatcttgtgtgtacgcgctttt
gcgagttgctagctgcttgtgctatttgcgaataccacccccagcatccccttccctcgtttcatat
cgcttgcatcccaaccgCaaCttatctacgctgtcctgctatccctcagcgctgctcctgctcctgc
tcactgcccctcgcacagccttggtttgggctccgcctgtattctcctggtactgcaacctgtaaac
cagcactgcaatgctgatgcacgggaagtagtgggatgggaacacaaatggaaagcttgagctcttg
ttttccagaaggagttgctccttgagcctttcattctcagcctcgataacctccaaagccgctctaa
ttgtggagggggttcgaatttaaaagcttggaatgttggttcgtgcgtctggaacaagcccagactt
gttgctcactgggaaaaggaccatcagctccaaaaaacttgccgctcaaaccgcgtacctctgcttt
cgcgcaatctgccctgttgaaatcgccaccacattcatattgtgacgcttgagcagtctgtaattgc
ctcagaatgtggaatcatctgccccctgtgcgagcccatgccaggcatgtcgcgggcgaggacaccc
gccactcgtacagcagaccattatgctacctcacaatagttcataacagtgaccatatttctcgaag
ctccccaacgagcacctccatgctctgagtggccaccccccggccctggtgcttgcggagggcaggt
caaccggcatggggctaccgaaatccccgaccggatcccaccacccccgcgatgggaagaatctctc
cccgggatgtgggcccaccaccagcacaacctgctggcccaggcgagcgtcaaaccataccacacaa
atatccttggcatcggccctgaattccttctgccgctctgctacccggtgcttctgtccgaagcagg
ggttgctagggatcgctccgagtcCgcaaacccttgtcgcgtggcggggcttgttcgagcttgaaga
gc
Sequence ID No: 17-nucleic acid sequence of extended C.
protothecoides SAD1 transit peptide fused to U. californica FATB2
derived sequence in construct D1056 [pSZ2084].
ATGGCCACCGCATCCACTTTCTCGGCGTTCAATGCCCGCTGCGGCGACCTGCGTCGCTCGGCGGGCT
CCGGGCCCCGGCGCCCAGCGAGGCCCCTCCCCGTGCGCGCTGCCATCGCCAGCGAGGTCCCCGTGGC
CACCACCTCCCCCCGGCCCGACTGGTCCATGCTGTTCGCCGTGATCACCACCATCTTCAGCGCCGCC
GAGAAGCAGTGGACCAACCTGGAGTGGAAGCCCAAGCCCAAGCTGCCCCAGCTGCTGGACGACCACT
TCGGCCTGCACGGCCTGGTGTTCCGCCGCACCTTCGCCATCCGCTCCTACGAGGTGGGCCCCGACCG
CAGCACCTCCATCCTGGCCGTGATGAACCACATGCAGGAGGCCACCCTGAACCACGCCAAGAGCGTG
GGCATCCTGGGCGACGGCTTCGGCACCACCCTGGAGATGTCCAAGCGCGACCTGATGTGGGTGGTGC
GCCGCACCCACGTGGCCGTGGAGCGCTACCCCACCTGGGGCGACACCGTGGAGGTGGAGTGCTGGAT
CGGCGCCAGCGGCAACAACGGCATGCGCCGCGACTTCCTGGTGCGCGACTGCAAGACCGGCGAGATC
CTGACCCGCTGCACCTCCCTGAGCGTGCTGATGAACACCCGCACCCGCCGCCTGAGCACCATCCCCG
ACGAGGTGCGCGGCGAGATCGGCCCCGCCTTCATCGACAACGTGGCCGTGAAGGACGACGAGATCAA
GAAGCTGCAGAAGCTGAACGACTCCACCGCCGACTACATCCAGGGCGGCCTGACCCCCCGCTGGAAC
GACCTGGACGTGAACCAGCACGTGAACAACCTGAAGTACGTGGCCTGGGTGTTCGAGACCGTGCCCG
ACAGCATCTTCGAGTCCCACCACATCAGCTCCTTCACCCTGGAGTACCGCCGCGAGTGCACCCGCGA
CTCCGTGCTGCGCAGCCTGACCACCGTGAGCGGCGGCAGCTCCGAGGCCGGCCTGGTGTGCGACCAC
CTGCTGCAGCTGGAGGGCGGCAGCGAGGTGCTGCGCGCCCGCACCGAGTGGCGCCCCAAGCTGACCG
ACTCCTTCCGCGGCATCAGCGTGATCCCCGCCGAGCCCCGCGTG
Sequence ID No: 18-amino acid sequence of extended C.
protothecoides SAD1 transit peptide fused to U. californica FATB2
derived sequence encoded by construct D1056 [pSZ2084].
MATASTFSAFNARCGDLRRSAGSGPRRPARPLPVRAAIASEVPVATTSPRPDWSMLFAVI
TTIFSAAEKQWTNLEWKPKPKLPQLLDDHFGLHGLVFRRTFAIRSYEVGPDRSTSILAVM
NHMQEATLNHAKSVGILGDGFGTTLEMSKRDLMWVVRRTHVAVERYPTWGDTVEVECWIG
ASGNNGMRRDFLVRDCKTGEILTRCTSLSVLMNTRTRRLSTIPDEVRGEIGPAFIDNVAV
KDDEIKKLQKLNDSTADYIQGGLTPRWNDLDVNQHVNNLKYVAWVFETVPDSIFESHHIS
SFTLEYRRECTRDSVLRSLTTVSGGSSEAGLVCDHLLQLEGGSEVLRARTEWRPKLTDSF
RGISVIPAEPRV
Sequence ID No: 19-nucleic acid sequence encoding Uc FATB2 with 5
amino acid N-terminal extension in Construct D1057 [pSZ2085
AGCCTGAAGCGCCTGCCCGACTGGTCCATGCTGTTCGCCGTGATCACCACCATCTTCAGCGCCGCCG
AGAAGCAGTGGACCAACCTGGAGTGGAAGCCCAAGCCCAAGCTGCCCCAGCTGCTGGACGACCACTT
CGGCCTGCACGGCCTGGTGTTCCGCCGCACCTTCGCCATCCGCTCCTACGAGGTGGGCCCCGACCGC
AGCACCTCCATCCTGGCCGTGATGAACCACATGCAGGAGGCCACCCTGAACCACGCCAAGAGCGTGG
GCATCCTGGGCGACGGCTTCGGCACCACCCTGGAGATGTCCAAGCGCGACCTGATGTGGGTGGTGCG
CCGCACCCACGTGGCCGTGGAGCGCTACCCCACCTGGGGCGACACCGTGGAGGTGGAGTGCTGGATC
GGCGCCAGCGGCAACAACGGCATGCGCCGCGACTTCCTGGTGCGCGACTGCAAGACCGGCGAGATCC
TGACCCGCTGCACCTCCCTGAGCGTGCTGATGAACACCCGCACCCGCCGCCTGAGCACCATCCCCGA
CGAGGTGCGCGGCGAGATCGGCCCCGCCTTCATCGACAACGTGGCCGTGAAGGACGACGAGATCAAG
AAGCTGCAGAAGCTGAACGACTCCACCGCCGACTACATCCAGGGCGGCCTGACCCCCCGCTGGAACG
ACCTGGACGTGAACCAGCACGTGAACAACCTGAAGTACGTGGCCTGGGTGTTCGAGACCGTGCCCGA
CAGCATCTTCGAGTCCCACCACATCAGCTCCTTCACCCTGGAGTACCGCCGCGAGTGCACCCGCGAC
TCCGTGCTGCGCAGCCTGACCACCGTGAGCGGCGGCAGCTCCGAGGCCGGCCTGGTGTGCGACCACC
TGCTGCAGCTGGAGGGCGGCAGCGAGGTGCTGCGCGCCCGCACCGAGTGGCGCCCCAAGCTGACCGA
CTCCTTCCGCGGCATCAGCGTGATCCCCGCCGAGCCCCGCGTG
Sequence ID No: 20-amino acid sequence of Uc FATB2 with 5 amino
acid N-terminal extension encoded by Construct D1057 [pSZ2085
SLKRLPDWSMLFAVITTIFSAAEKQWTNLEWKPKPKLPQLLDDHFGLHGLVFRRTFAIRS
YEVGPDRSTSILAVMNHMQEATLNHAKSVGILGDGFGTTLEMSKRDLMWVVRRTHVAVER
YPTWGDTVEVECWIGASGNNGMRRDFLVRDCKTGEILTRCTSLSVLMNTRTRRLSTIPDE
VRGEIGPAFIDNVAVKDDEIKKLQKLNDSTADYIQGGLTPRWNDLDVNQHVNNLKYVAWV
FETVPDSIFESHHISSFTLEYRRECTRDSVLRSLTTVSGGSSEAGLVCDHLLQLEGGSEV
LRARTEWRPKLTDSFRGISVIPAEPRV
Sequence ID No: 21-nucleic acid sequence encoding Uc FATB2 with
15 amino acid N-terminal extension in Construct D1058 [pSZ2086
ATCAACGGCACCAAGTTCAGCTACACCGAGAGCCTGAAGCGCCTGCCCGACTGGTCCATGCTGTTCG
CCGTGATCACCACCATCTTCAGCGCCGCCGAGAAGCAGTGGACCAACCTGGAGTGGAAGCCCAAGCC
CAAGCTGCCCCAGCTGCTGGACGACCACTTCGGCCTGCACGGCCTGGTGTTCCGCCGCACCTTCGCC
ATCCGCTCCTACGAGGTGGGCCCCGACCGCAGCACCTCCATCCTGGCCGTGATGAACCACATGCAGG
AGGCCACCCTGAACCACGCCAAGAGCGTGGGCATCCTGGGCGACGGCTTCGGCACCACCCTGGAGAT
GTCCAAGCGCGACCTGATGTGGGTGGTGCGCCGCACCCACGTGGCCGTGGAGCGCTACCCCACCTGG
GGCGACACCGTGGAGGTGGAGTGCTGGATCGGCGCCAGCGGCAACAACGGCATGCGCCGCGACTTCC
TGGTGCGCGACTGCAAGACCGGCGAGATCCTGACCCGCTGCACCTCCCTGAGCGTGCTGATGAACAC
CCGCACCCGCCGCCTGAGCACCATCCCCGACGAGGTGCGCGGCGAGATCGGCCCCGCCTTCATCGAC
AACGTGGCCGTGAAGGACGACGAGATCAAGAAGCTGCAGAAGCTGAACGACTCCACCGCCGACTACA
TCCAGGGCGGCCTGACCCCCCGCTGGAACGACCTGGACGTGAACCAGCACGTGAACAACCTGAAGTA
CGTGGCCTGGGTGTTCGAGACCGTGCCCGACAGCATCTTCGAGTCCCACCACATCAGCTCCTTCACC
CTGGAGTACCGCCGCGAGTGCACCCGCGACTCCGTGCTGCGCAGCCTGACCACCGTGAGCGGCGGCA
GCTCCGAGGCCGGCCTGGTGTGCGACCACCTGCTGCAGCTGGAGGGCGGCAGCGAGGTGCTGCGCGC
CCGCACCGAGTGGCGCCCCAAGCTGACCGACTCCTTCCGCGGCATCAGCGTGATCCCCGCCGAGCCC
CGCGTG
Sequence ID No: 22-amino acid sequence of Uc FATB2 with 15 amino
acid N-terminal extension encoded by Construct D1058 [pSZ2086]
INGTKFSYTESLKRLPDWSMLFAVITTIFSAAEKQWTNLEWKPKPKLPQLLDDHFGLHGL
VFRRTFAIRSYEVGPDRSTSILAVMNHMQEATLNHAKSVGILGDGFGTTLEMSKRDLMWV
VRRTHVAVERYPTWGDTVEVECWIGASGNNGMRRDFLVRDCKTGEILTRCTSLSVLMNTR
TRRLSTIPDEVRGEIGPAFIDNVAVKDDEIKKLQKLNDSTADYIQGGLTPRWNDLDVNQH
VNNLKYVAWVFETVPDSIFESHHISSFTLEYRRECTRDSVLRSLTTVSGGSSEAGLVCDH
LLQLEGGSEVLRARTEWRPKLTDSFRGISVIPAEPRV
Sequence ID No: 23-nucleic acid sequence of Cinnamomumcamphorum
14:0-ACP thioesterase (Cc FATB1/Cc TE, accession U31813) containing
a five amino acid N-terminal extension derived from Uc FATB2 in
Construct D1431 [pSZ2450]
AGCCTGAAGCGCCTGCCCGACTGGTCCATGCTGTTCGCCGTGATCACCACCATCTTCTCCGCCGCCG
AGAAGCAGTGGACCAACCTGGAGTGGAAGCCCAAGCCCAACCCCCCCCAGCTGCTGGACGACCACTT
CGGCCCCCACGGCCTGGTGTTCCGCCGCACCTTCGCCATCCGCAGCTACGAGGTGGGCCCCGACCGC
TCCACCAGCATCGTGGCCGTGATGAACCACCTGCAGGAGGCCGCCCTGAACCACGCCAAGTCCGTGG
GCATCCTGGGCGACGGCTTCGGCACCACCCTGGAGATGTCCAAGCGCGACCTGATCTGGGTGGTGAA
GCGCACCCACGTGGCCGTGGAGCGCTACCCCGCCTGGGGCGACACCGTGGAGGTGGAGTGCTGGGTG
GGCGCCTCCGGCAACAACGGCCGCCGCCACGACTTCCTGGTGCGCGACTGCAAGACCGGCGAGATCC
TGACCCGCTGCACCTCCCTGAGCGTGATGATGAACACCCGCACCCGCCGCCTGAGCAAGATCCCCGA
GGAGGTGCGCGGCGAGATCGGCCCCGCCTTCATCGACAACGTGGCCGTGAAGGACGAGGAGATCAAG
AAGCCCCAGAAGCTGAACGACTCCACCGCCGACTACATCCAGGGCGGCCTGACCCCCCGCTGGAACG
ACCTGGACATCAACCAGCACGTGAACAACATCAAGTACGTGGACTGGATCCTGGAGACCGTGCCCGA
CAGCATCTTCGAGAGCCACCACATCTCCTCCTTCACCATCGAGTACCGCCGCGAGTGCACCATGGAC
AGCGTGCTGCAGTCCCTGACCACCGTGAGCGGCGGCTCCTCCGAGGCCGGCCTGGTGTGCGAGCACC
TGCTGCAGCTGGAGGGCGGCAGCGAGGTGCTGCGCGCCAAGACCGAGTGGCGCCCCAAGCTGACCGA
CTCCTTCCGCGGCATCAGCGTGATCCCCGCCGAGTCCAGCGTG
Sequence ID No: 24-amino acid sequence of Cinnamomumcamphorum
14:0-ACP thioesterase (Cc FATB1/Cc TE, accession U31813) containing
a five amino acid N-terminal extension derived from Uc FATB2
encoded by Construct D1431 [pSZ2450]
SLKRLPDWSMLFAVITTIFSAAEKQWTNLEWKPKPNPPQLLDDHFGPHGLVFRRTFAIRS
YEVGPDRSTSIVAVMNHLQEAALNHAKSVGILGDGFGTTLEMSKRDLIWVVKRTHVAVER
YPAWGDTVEVECWVGASGNNGRRHDFLVRDCKTGEILTRCTSLSVMMNTRTRRLSKIPEE
VRGEIGPAFIDNVAVKDEEIKKPQKLNDSTADYIQGGLTPRWNDLDINQHVNNIKYVDWI
LETVPDSIFESHHISSFTIEYRRECTMDSVLQSLTTVSGGSSEAGLVCEHLLQLEGGSEV
LRAKTEWRPKLTDSFRGISVIPAESSV
Sequence ID No: 25-nucleic acid sequence of Cinnamomumcamphorum
14:0-ACP thioesterase (Cc FATB1/Cc TE, accession U31813) containing
a five amino acid N-terminal extension derived from Cc FATB1 in
Construct D1432 [pSZ2451]
AGCCTGAAGAAGCTGCCCGACTGGTCCATGCTGTTCGCCGTGATCACCACCATCTTCTCCGCCGCCG
AGAAGCAGTGGACCAACCTGGAGTGGAAGCCCAAGCCCAACCCCCCCCAGCTGCTGGACGACCACTT
CGGCCCCCACGGCCTGGTGTTCCGCCGCACCTTCGCCATCCGCAGCTACGAGGTGGGCCCCGACCGC
TCCACCAGCATCGTGGCCGTGATGAACCACCTGCAGGAGGCCGCCCTGAACCACGCCAAGTCCGTGG
GCATCCTGGGCGACGGCTTCGGCACCACCCTGGAGATGTCCAAGCGCGACCTGATCTGGGTGGTGAA
GCGCACCCACGTGGCCGTGGAGCGCTACCCCGCCTGGGGCGACACCGTGGAGGTGGAGTGCTGGGTG
GGCGCCTCCGGCAACAACGGCCGCCGCCACGACTTCCTGGTGCGCGACTGCAAGACCGGCGAGATCC
TGACCCGCTGCACCTCCCTGAGCGTGATGATGAACACCCGCACCCGCCGCCTGAGCAAGATCCCCGA
GGAGGTGCGCGGCGAGATCGGCCCCGCCTTCATCGACAACGTGGCCGTGAAGGACGAGGAGATCAAG
AAGCCCCAGAAGCTGAACGACTCCACCGCCGACTACATCCAGGGCGGCCTGACCCCCCGCTGGAACG
ACCTGGACATCAACCAGCACGTGAACAACATCAAGTACGTGGACTGGATCCTGGAGACCGTGCCCGA
CAGCATCTTCGAGAGCCACCACATCTCCTCCTTCACCATCGAGTACCGCCGCGAGTGCACCATGGAC
AGCGTGCTGCAGTCCCTGACCACCGTGAGCGGCGGCTCCTCCGAGGCCGGCCTGGTGTGCGAGCACC
TGCTGCAGCTGGAGGGCGGCAGCGAGGTGCTGCGCGCCAAGACCGAGTGGCGCCCCAAGCTGACCGA
CTCCTTCCGCGGCATCAGCGTGATCCCCGCCGAGTCCAGCGTG
Sequence ID No: 26-amino acid sequence of Cinnamomumcamphorum
14:0-ACP thioesterase (Cc FATB1/Cc TE, accession U31813) containing
a five amino acid N-terminal extension derived from Cc FATB1
encoded by Construct D1432 [pSZ2451]
SLKKLPDWSMLFAVITTIFSAAEKQWTNLEWKPKPNPPQLLDDHFGPHGLVFRRTFAIRS
YEVGPDRSTSIVAVMNHLQEAALNHAKSVGILGDGFGTTLEMSKRDLIWVVKRTHVAVER
YPAWGDTVEVECWVGASGNNGRRHDFLVRDCKTGEILTRCTSLSVMMNTRTRRLSKIPEE
VRGEIGPAFIDNVAVKDEEIKKPQKLNDSTADYIQGGLTPRWNDLDINQHVNNIKYVDWI
LETVPDSIFESHHISSFTIEYRRECTMDSVLQSLTTVSGGSSEAGLVCEHLLQLEGGSEV
LRAKTEWRPKLTDSFRGISVIPAESSV
Sequence ID No: 27-nucleic acid sequence encoding 14:0-ACP
thioesterase, Cupheapalustris (Cpal FATB2, accession AAC49180)
containing an extended heterologous transit peptide from C.
protothecoides and a 41 amino acid N-terminal extension derived
from the native Cpal FATB2 sequence in construct D1481 [pSZ2479]
GCGCACCCCAAGGCGAACGGCAGCGCGGTGTCGCTGAAGTCGGGCTCCCTGGAGACCCAGGAGGACA
AGACGAGCAGCTCGTCCCCCCCCCCCCGCACGTTCATCAACCAGCTGCCCGTGTGGAGCATGCTGCT
GTCGGCGGTGACCACGGTCTTCGGCGTGGCCGAGAAGCAGTGGCCCATGCTGGACCGCAAGTCCAAG
CGCCCCGACATGCTGGTCGAGCCCCTGGGCGTGGACCGCATCGTCTACGACGGCGTGAGCTTCCGCC
AGTCGTTCTCCATCCGCAGCTACGAGATCGGCGCCGACCGCACCGCCTCGATCGAGACGCTGATGAA
CATGTTCCAGGAGACCTCCCTGAACCACTGCAAGATCATCGGCCTGCTGAACGACGGCTTCGGCCGC
ACGCCCGAGATGTGCAAGCGCGACCTGATCTGGGTCGTGACCAAGATGCAGATCGAGGTGAACCGCT
ACCCCACGTGGGGCGACACCATCGAGGTCAACACGTGGGTGAGCGCCTCGGGCAAGCACGGCATGGG
CCGCGACTGGCTGATCTCCGACTGCCACACCGGCGAGATCCTGATCCGCGCGACGAGCGTCTGGGCG
ATGATGAACCAGAAGACCCGCCGCCTGTCGAAGATCCCCTACGAGGTGCGCCAGGAGATCGAGCCCC
AGTTCGTCGACTCCGCCCCCGTGATCGTGGACGACCGCAAGTTCCACAAGCTGGACCTGAAGACGGG
CGACAGCATCTGCAACGGCCTGACCCCCCGCTGGACGGACCTGGACGTGAACCAGCACGTCAACAAC
GTGAAGTACATCGGCTGGATCCTGCAGTCGGTCCCCACCGAGGTGTTCGAGACGCAGGAGCTGTGCG
GCCTGACCCTGGAGTACCGCCGCGAGTGCGGCCGCGACTCCGTGCTGGAGAGCGTCACGGCCATGGA
CCCCTCGAAGGAGGGCGACCGCTCCCTGTACCAGCACCTGCTGCGCCTGGAGGACGGCGCGGACATC
GTGAAGGGCCGCACCGAGTGGCGCCCCAAGAACGCCGGCGCCAAGGGCGCCATCCTGACGGGCAAGA
CCAGCAACGGCAACTCGATCTCCTGA
Sequence ID No: 28-amino acid sequence of 14:0-ACP thioesterase,
Cupheapalustris (Cpal FATB2, accession AAC49180) containing an
extended heterologous transit peptide from C. protothecoides and a
41 amino acid N-terminal extension derived from the native Cpal
FATB2 sequence encoded by construct D1481 [pSZ2479]
AHPKANGSAVSLKSGSLETQEDKTSSSSPPPRTFINQLPVWSMLLSAVTTVFGVAEKQWP
MLDRKSKRPDMLVEPLGVDRIVYDGVSFRQSFSIRSYEIGADRTASIETLMNMFQETSLN
HCKIIGLLNDGFGRTPEMCKRDLIWVVTKMQIEVNRYPTWGDTIEVNTWVSASGKHGMGR
DWLISDCHTGEILIRATSVWAMMNQKTRRLSKIPYEVRQEIEPQFVDSAPVIVDDRKFHK
LDLKTGDSICNGLTPRWTDLDVNQHVNNVKYIGWILQSVPTEVFETQELCGLTLEYRREC
GRDSVLESVTAMDPSKEGDRSLYQHLLRLEDGADIVKGRTEWRPKNAGAKGAILTGKTSN
GNSIS
Sequence ID No: 29-nucleic acid sequence encoding 14:0-ACP
thioesterase, Cupheapalustris (Cpal FATB2, accession AAC49180)
containing an extended heterologous transit peptide from C.
protothecoides, a 41 amino acid N-terminal extension derived from
the native Cpal FATB2 sequence,and a C-terminal FLAG epitope tag in
construct D1482 [pSZ2480]
GCGCACCCCAAGGCGAACGGCAGCGCGGTGTCGCTGAAGTCGGGCTCCCTGGAGACCCAGGAGGACA
AGACGAGCAGCTCGTCCCCCCCCCCCCGCACGTTCATCAACCAGCTGCCCGTGTGGAGCATGCTGCT
GTCGGCGGTGACCACGGTCTTCGGCGTGGCCGAGAAGCAGTGGCCCATGCTGGACCGCAAGTCCAAG
CGCCCCGACATGCTGGTCGAGCCCCTGGGCGTGGACCGCATCGTCTACGACGGCGTGAGCTTCCGCC
AGTCGTTCTCCATCCGCAGCTACGAGATCGGCGCCGACCGCACCGCCTCGATCGAGACGCTGATGAA
CATGTTCCAGGAGACCTCCCTGAACCACTGCAAGATCATCGGCCTGCTGAACGACGGCTTCGGCCGC
ACGCCCGAGATGTGCAAGCGCGACCTGATCTGGGTCGTGACCAAGATGCAGATCGAGGTGAACCGCT
ACCCCACGTGGGGCGACACCATCGAGGTCAACACGTGGGTGAGCGCCTCGGGCAAGCACGGCATGGG
CCGCGACTGGCTGATCTCCGACTGCCACACCGGCGAGATCCTGATCCGCGCGACGAGCGTCTGGGCG
ATGATGAACCAGAAGACCCGCCGCCTGTCGAAGATCCCCTACGAGGTGCGCCAGGAGATCGAGCCCC
AGTTCGTCGACTCCGCCCCCGTGATCGTGGACGACCGCAAGTTCCACAAGCTGGACCTGAAGACGGG
CGACAGCATCTGCAACGGCCTGACCCCCCGCTGGACGGACCTGGACGTGAACCAGCACGTCAACAAC
GTGAAGTACATCGGCTGGATCCTGCAGTCGGTCCCCACCGAGGTGTTCGAGACGCAGGAGCTGTGCG
GCCTGACCCTGGAGTACCGCCGCGAGTGCGGCCGCGACTCCGTGCTGGAGAGCGTCACGGCCATGGA
CCCCTCGAAGGAGGGCGACCGCTCCCTGTACCAGCACCTGCTGCGCCTGGAGGACGGCGCGGACATC
GTGAAGGGCCGCACCGAGTGGCGCCCCAAGAACGCCGGCGCCAAGGGCGCCATCCTGACGGGCAAGA
CCAGCAACGGCAACTCGATCTCCatggactacaaggaccacgacggcgactacaaggaccacgacat
cgactacaaggacgacgacgacaagtga
Sequence ID No: 30-amino acid sequence of 14:0-ACP thioesterase,
Cupheapalustris (Cpal FATB2, accession AAC49180) containing an
extended heterologous transit peptide from C. pxotothecoides, a 41
amino acid N-terminal extension derived from the native Cpal FATB2
sequence,and a C-terminal FLAG epitope tag encoded by construct
D1482 [pSZ2480]
AHPKANGSAVSLKSGSLETQEDKTSSSSPPPRTFINQLPVWSMLLSAVTTVFGVAEKQWP
MLDRKSKRPDMLVEPLGVDRIVYDGVSFRQSFSIRSYEIGADRTASIETLMNMFQETSLN
HCKIIGLLNDGFGRTPEMCKRDLIWVVTKMQIEVNRYPTWGDTIEVNTWVSASGKHGMGR
DWLISDCHTGEILIRATSVWAMMNQKTRRLSKIPYEVRQEIEPQFVDSAPVIVDDRKFHK
LDLKTGDSICNGLTPRWTDLDVNQHVNNVKYIGWILQSVPTEVFETQELCGLTLEYRREC
GRDSVLESVTAMDPSKEGDRSLYQHLLRLEDGADIVKGRTEWRPKNAGAKGAILTGKTSN
GNSISMDYKDHDGDYKDHDIDYKDDDDK
Sequence ID No: 31-nucleic acid sequence encoding UlmusAmericana
10:0-16:0-ACP thioesterase (Ua FATB1, accession 024420) containing
an extended heterologous transit peptide from C. protothecoides
and a 34 amino acid N-terminal extension derived from the native Ua
FATB1 sequence in construct D1479 [pSZ2477]
CCCCCCAAGCTGAACGGCTCCAACGTGGGCCTGGTGAAGTCCTCCCAGATCGTGAAGAAGGGCGACG
ACACCACCTCCCCCCCCGCCCGCACCTTCATCAACCAGCTGCCCGACTGGAGCATGCTGCTGGCCGC
GATCACCACCCTGTTCCTGGCGGCCGAGAAGCAGTGGATGATGCTGGACTGGAAGCCCAAGCGCCCC
GACATGCTGGTGGACCCCTTCGGCCTGGGCCGCTTCGTGCAGGACGGCCTGGTGTTCCGCAACAACT
TCAGCATCCGCAGCTACGAGATCGGCGCGGACCGCACCGCCAGCATCGAGACCCTGATGAACCACCT
GCAGGAGACCGCCCTGAACCACGTGAAGAGTGTGGGCCTGCTGGAGGACGGCCTGGGCAGCACCCGC
GAGATGAGCCTGCGCAACCTGATCTGGGTGGTGACCAAGATGCAGGTGGCGGTGGACCGCTACCCCA
CCTGGGGCGACGAGGTGCAGGTGAGCAGCTGGGCGACCGCCATCGGCAAGAACGGCATGCGCCGCGA
GTGGATCGTGACCGACTTCCGCACCGGCGAGACCCTGCTGCGCGCCACCAGCGTGTGGGTGATGATG
AACAAGCTGACCCGCCGCATCAGCAAGATCCCCGAGGAGGTGTGGCACGAGATCGGCCCCAGCTTCA
TCGACGCGCCCCCCCTGCCCACCGTGGAGGACGACGGCCGCAAGCTGACCCGCTTCGACGAGAGCAG
CGCCGACTTCATCCGCAAGGGCCTGACCCCCCGCTGGAGCGACCTGGACATCAACCAGCACGTGAAC
AACGTGAAGTACATCGGCTGGCTGCTGGAGAGCGCGCCCCCCGAGATCCACGAGAGCCACGAGATCG
CCAGCCTGACCCTGGAGTACCGCCGCGAGTGCGGCCGCGACAGCGTGCTGAACAGCGCCACCAAGGT
GAGCGACAGCAGCCAGCTGGGCAAGAGCGCCGTGGAGTGCAACCACCTGGTGCGCCTGCAGAACGGC
GGCGAGATCGTGAAGGGCCGCACCGTGTGGCGCCCCAAGCGCCCCCTGTACAACGACGGCGCCGTGG
TGGACGTGCCCGCCAAGACCAGCTGA
Sequence ID No: 32-amino acid sequence of UlmusAmericana 10:0-
16:0-ACP thioesterase (Ua FATB1, accession 024420) containing an
extended heterologous transit peptide from C. protothecoides and a
34 amino acid N-terminal extension derived from the native Ua FATB1
sequence encoded by construct D1479 [pSZ2477]
PPKLNGSNVGLVKSSQIVKKGDDTTSPPARTFINQLPDWSMLLAAITTLFLAAEKQWMML
DWKPKRPDMLVDPFGLGRFVQDGLVFRNNFSIRSYEIGADRTASIETLMNHLUTALNHV
KSVGLLEDGLGSTREMSLRNLIWVVTKMQVAVDRYPTWGDEVQVSSWATAIGKNGMRREW
IVTDFRTGETLLRATSVWVMMNKLTRRISKIPEEVWHEIGPSFIDAPPLPTVEDDGRKLT
RFDESSADFIRKGLTPRWSDLDINQHVNNVKYIGWLLESAPPEIHESHEIASLTLEYRRE
CGRDSVLNSATKVSDSSQLGKSAVECNHLVRLQNGGEIVKGRTVWRPKRPLYNDGAVVDV
PAKTS
Sequence ID No: 33-nucleic acid sequence encoding UlmusAmericana
10:0-16:0-ACP thioesterase (Ua FATB1, accession 024420) containing
an extended heterologous transit peptide from C. protothecoides, a
34 amino acid N-terminal extension derived from the native Ua FATB1
sequence,and a C-terminal FLAG epitope tag in construct D1480
CCCCCCAAGCTGAACGGCTCCAACGTGGGCCTGGTGAAGTCCTCCCAGATCGTGAAGAAGGGCGACG
ACACCACCTCCCCCCCCGCCCGCACCTTCATCAACCAGCTGCCCGACTGGAGCATGCTGCTGGCCGC
GATCACCACCCTGTTCCTGGCGGCCGAGAAGCAGTGGATGATGCTGGACTGGAAGCCCAAGCGCCCC
GACATGCTGGTGGACCCCTTCGGCCTGGGCCGCTTCGTGCAGGACGGCCTGGTGTTCCGCAACAACT
TCAGCATCCGCAGCTACGAGATCGGCGCGGACCGCACCGCCAGCATCGAGACCCTGATGAACCACCT
GCAGGAGACCGCCCTGAACCACGTGAAGAGTGTGGGCCTGCTGGAGGACGGCCTGGGCAGCACCCGC
GAGATGAGCCTGCGCAACCTGATCTGGGTGGTGACCAAGATGCAGGTGGCGGTGGACCGCTACCCCA
CCTGGGGCGACGAGGTGCAGGTGAGCAGCTGGGCGACCGCCATCGGCAAGAACGGCATGCGCCGCGA
GTGGATCGTGACCGACTTCCGCACCGGCGAGACCCTGCTGCGCGCCACCAGCGTGTGGGTGATGATG
AACAAGCTGACCCGCCGCATCAGCAAGATCCCCGAGGAGGTGTGGCACGAGATCGGCCCCAGCTTCA
TCGACGCGCCCCCCCTGCCCACCGTGGAGGACGACGGCCGCAAGCTGACCCGCTTCGACGAGAGCAG
CGCCGACTTCATCCGCAAGGGCCTGACCCCCCGCTGGAGCGACCTGGACATCAACCAGCACGTGAAC
AACGTGAAGTACATCGGCTGGCTGCTGGAGAGCGCGCCCCCCGAGATCCACGAGAGCCACGAGATCG
CCAGCCTGACCCTGGAGTACCGCCGCGAGTGCGGCCGCGACAGCGTGCTGAACAGCGCCACCAAGGT
GAGCGACAGCAGCCAGCTGGGCAAGAGCGCCGTGGAGTGCAACCACCTGGTGCGCCTGCAGAACGGC
GGCGAGATCGTGAAGGGCCGCACCGTGTGGCGCCCCAAGCGCCCCCTGTACAACGACGGCGCCGTGG
TGGACGTGCCCGCCAAGACCAGCatggactacaaggaccacgacggcgactacaaggaccacgacat
cgactacaaggacgacgacgacaagtga
Sequence ID No: 34-amino acid sequence of UlmusAmericana 10:0-
16:0-ACP thioesterase (Ua FATB1, accession 024420) containing an
extended heterologous transit peptide from C. protothecoides, a 34
amino acid N-terminal extension derived from the native Ua FATB1
sequence,and a C-terminal FLAG epitope tag encoded by construct
D1480 [pSZ2478]
PPKLNGSNVGLVKSSQIVKKGDDTTSPPARTFINQLPDWSMLLAAITTLFLAAEKQWMML
DWKPKRPDMLVDPFGLGRFVQDGLVFRNNFSIRSYEIGADRTASIETLMNHLQETALNHV
KSVGLLEDGLGSTREMSLRNLIWVVTKMQVAVDRYPTWGDEVQVSSWATAIGKNGMRREW
IVTDFRTGETLLRATSVWVMMNKLTRRISKIPEEVWHEIGPSFIDAPPLPTVEDDGRKLT
RFDESSADFIRKGLTPRWSDLDINQHVNNVKYIGWLLESAPPEIHESHEIASLTLEYRRE
CGRDSVLNSATKVSDSSQLGKSAVECNHLVRLQNGGEIVKGRTVWRPKRPLYNDGAVVDV
PAKTSMDYKDHDGDYKDHDIDYKDDDDK
Sequence ID No: 35-nucleic acid sequence encoding Cc-Uc FATB
chimera B 12:0-14:0-ACP thioesterase containing an extended
heterologous transit peptide from C. protothecoides and a five
amino acid N-terminal extension derived from the native Uc FATB2
sequence in construct D1429 [pSZ2448]
ATGGCCACCGCATCCACTTTCTCGGCGTTCAATGCCCGCTGCGGCGACCTGCGTCGCTCGGCGGGCT
CCGGGCCCCGGCGCCCAGCGAGGCCCCTCCCCGTGCGCGCTGCCATCGCCAGCGAGGTCCCCGTGGC
CACCACCTCCCCCCGGagcctgaagcgcctgCCCGACTGGTCCATGCTGTTCGCCGTGATCACCACC
ATCTTCTCCGCCGCCGAGAAGCAGTGGACCAACCTGGAGTGGAAGCCCAAGCCCAACCCCCCCCAGC
TGCTGGACGACCACTTCGGCCCCCACGGCCTGGTGTTCCGCCGCACCTTCGCCATCCGCAGCTACGA
GGTGGGCCCCGACCGCTCCACCAGCATCGTGGCCGTGATGAACCACCTGCAGGAGGCCGCCCTGAAC
CACGCCAAGTCCGTGGGCATCCTGGGCGACGGCTTCGGCACCACCCTGGAGATGTCCAAGCGCGACC
TGATCTGGGTGGTGCGCCGCACCCACGTGGCCGTGGAGCGCTACCCCACCTGGGGCGACACCGTGGA
GGTGGAGTGCTGGATCGGCGCCAGCGGCAACAACGGCATGCGCCGCGACTTCCTGGTGCGCGACTGC
AAGACCGGCGAGATCCTGACCCGCTGCACCTCCCTGAGCGTGCTGATGAACACCCGCACCCGCCGCC
TGAGCACCATCCCCGACGAGGTGCGCGGCGAGATCGGCCCCGCCTTCATCGACAACGTGGCCGTGAA
GGACGACGAGATCAAGAAGCTGCAGAAGCTGAACGACTCCACCGCCGACTACATCCAGGGCGGCCTG
ACCCCCCGCTGGAACGACCTGGACGTGAACCAGCACGTGAACAACCTGAAGTACGTGGCCTGGGTGT
TCGAGACCGTGCCCGACAGCATCTTCGAGTCCCACCACATCAGCTCCTTCACCCTGGAGTACCGCCG
CGAGTGCACCCGCGACTCCGTGCTGCGCAGCCTGACCACCGTGAGCGGCGGCAGCTCCGAGGCCGGC
CTGGTGTGCGACCACCTGCTGCAGCTGGAGGGCGGCAGCGAGGTGCTGCGCGCCCGCACCGAGTGGC
GCCCCAAGCTGACCGACTCCTTCCGCGGCATCAGCGTGATCCCCGCCGAGCCCCGCGTG
Sequence ID No: 36-amino acid sequence of Cc-Uc FATB chimera B
12:0-14:0-ACP thioesterase containing an extended heterologous
transit peptide from C. pxotothecoides and a five amino acid
N-terminal extension derived from the native Uc FATB2 sequence
encoded by construct D1429 [pSZ2448]
MATASTFSAFNARCGDLRRSAGSGPRRPARPLPVRAAIASEVPVATTSPRSLKRLPDWSM
LFAVITTIFSAAEKQWTNLEWKPKPNPPQLLDDHFGPHGLVFRRTFAIRSYEVGPDRSTS
IVAVMNHLQEAALNHAKSVGILGDGFGTTLEMSKRDLIWVVRRTHVAVERYPTWGDTVEV
ECWIGASGNNGMRRDFLVRDCKTGEILTRCTSLSVLMNTRTRRLSTIPDEVRGEIGPAFI
DNVAVKDDEIKKLQKLNDSTADYIQGGLTPRWNDLDVNQHVNNLKYVAWVFETVPDSIFE
SHHISSFTLEYRRECTRDSVLRSLTTVSGGSSEAGLVCDHLLQLEGGSEVLRARTEWRPK
LTDSFRGISVIPAEPRV
Sequence ID No: 37-5 amino acid Uc/Cc FATB N-terminal extension
SLK(R/K)
Sequence ID No: 38-15 amino acid Uc/Cc FATB N-terminal extension
INGTKFSYTESLK(R/K)
Sequence ID No: 39-N-terminal extension derived from the native
Cpal FATB2 sequence
AHPKANGSAVSLKSGSLETQEDKTSSSSPPPRTFINQ
Sequence ID No: 40-N-terminal extension derived from the native
Ua FATB1 sequence
PPKLNGSNVGLVKSSQIVKKGDDTTSPPARTFINQ
Sequence ID No: 41-N-terminal extension derived from the native
Cw FATB1 sequence
AHPKANGSAVNLKSGSLETPPRSFINQ
Sequence ID No: 42-N-terminal extension derived from the native
Cw FATB2 sequence (GenBank accession Q39663)
PHPKANGSAVSLKSGSLNTLEDPPSSPPPRTFLNQ
Sequence ID No: 43-wild-type California Bay Tree acyl-ACP
thioesterase (GenBank Accession No. M94159.1)
MATTSLASAFCSMKAVMLARDGRGMKPRSSDLQLRAGNAPTSLKMINGTKFSYTESLKRLPDWSMLF
AVITTIFSAAEKQWTNLEWKPKPKLPQLLDDHFGLHGLVFRRTFAIRSYEVGPDRSTSILAVMNHMQ
EATLNHAKSVGILGDGFGTTLEMSKRDLMWVVRRTHVAVERYPTWGDTVEVECWIGASGNNGMRRDF
LVRDCKTGEILTRCTSLSVLMNTRTRRLSTIPDEVRGEIGPAFIDNVAVKDDEIKKLQKLNDSTADY
IQGGLTPRWNDLDVNQHVNNLKYVAWVFETVPDSIFESHHISSFTLEYRRECTRDSVLRSLTTVSGG
SSEAGLVCDHLLQLEGGSEVLRARTEWRPKLTDSFRGISVIPAEPRV
Sequence ID No: 44-wild-type Cinnamomumcamphora acyl-ACP
thioesterase (GenBank Accession No. U31813.1)
MATTSLASAFCSMKAVMLARDGRGMKPRSSDLQLRAGNAQTSLKMINGTKFSYTESLKKLPDWSMLF
AVITTIFSAAEKQWTNLEWKPKPNPPQLLDDHFGPHGLVFRRTFAIRSYEVGPDRSTSIVAVMNHLQ
EAALNHAKSVGILGDGFGTTLEMSKRDLIWVVKRTHVAVERYPAWGDTVEVECWVGASGNNGRRHDF
LVRDCKTGEILTRCTSLSVMMNTRTRRLSKIPEEVRGEIGPAFIDNVAVKDEEIKKPQKLNDSTADY
IQGGLTPRWNDLDINQHVNNIKYVDWILETVPDSIFESHHISSFTIEYRRECTMDSVLQSLTTVSGG
SSEAGLVCEHLLQLEGGSEVLRAKTEWRPKLTDSFRGISVIPAESSV
Sequence ID No: 45-wild-type Cupheapalustris (Cpal) acyl-ACP
thioesterase (GenBank Accession No. AAC49180)
MVAAAASAAFFSVATPRTNISPSSLSVPFKPKSNHNGGFQVKANASAHPKANGSAVSLKSGSLETQE
DKTSSSSPPPRTFINQLPVWSMLLSAVTTVFGVAEKQWPMLDRKSKRPDMLVEPLGVDRIVYDGVSF
RQSFSIRSYEIGADRTASIETLMNMFQETSLNHCKIIGLLNDGFGRTPEMCKRDLIWVVTKMQIEVN
RYPTWGDTIEVNTWVSASGKHGMGRDWLISDCHTGEILIRATSVWAMMNQKTRRLSKIPYEVRQEIE
PQFVDSAPVIVDDRKFHKLDLKTGDSICNGLTPRWTDLDVNQHVNNVKYIGWILQSVPTEVFETQEL
CGLTLEYRRECGRDSVLESVTAMDPSKEGDRSLYQHLLRLEDGADIVKGRTEWRPKNAGAKGAILTG
KTSNGNSIS
Sequence ID No: 46-wild-type Cupheawrightii (Cw) acyl-ACP
thioesterase FATB1 (GenBank Accession No. U56103)
MVAAAASSAFFSVPTPGTSPKPGKFGNWPSSLSVPFKPDNGGFHVKANASAHPKANGSAVNLKSGSL
ETPPRSFINQLPDLSMLLSKITTVFGAAEKQWKRPGMLVEPFGVDRIFQDGVFFRQSFSIRSYEIGV
DRTASIETLMNIFQETSLNHCKSIGLLNDGFGRTPEMCKRDLIWVVTKIQVEVNRYPTWGDTIEVNT
WVSESGKNGMGRDWLISDCRTGEILIRATSVWAMMNQNTRRLSKFPYEVRQEIAPHFVDSAPVIEDD
RKLHKLDVKTGDSIRDGLTPRWNDLDVNQHVNNVKYIGWILKSVPIEVFETQELCGVTLEYRRECGR
DSVLESVTTMDPAKEGDRCVYQHLLRLEDGADITIGRTEWRPKNAGANGAISSGKTSNGNSVS
Sequence ID No: 47-wild-type UlmusAmericana acyl-ACP
thioesterase (GenBank Accession No. 024420)
GSGALQVKASSQAPPKLNGSNVGLVKSSQIVKKGDDTTSPPARTFINQLPDWSMLLAAITTLFLAAE
KQWMMLDWKPKRPDMLVDPFGLGRFVQDGLVFRNNFSIRSYEIGADRTASIETLMNHLQETALNHVK
SVGLLEDGLGSTREMSLRNLIWVVTKMQVAVDRYPTWGDEVQVSSWATAIGKNGMRREWIVTDFRTG
ETLLRATSVWVMMNKLTRRISKIPEEVWHEIGPSFIDAPPLPTVEDDGRKLTRFDESSADFIRXGLT
PRWSDLDINQHVNNVKYIGWLLESAPPEIHESHEIASLTLEYRRECGRDSVLNSATKVSDSSQLGKS
AVECNHLVRLQNGGEIVKGRTVWRPKRPLYNDGAVVDVXAKTS
Sequence ID No: 48-nucleic acid sequence of pSZ2609 (D1558)
Chook-CwFATB ChimeraA
ATGGTGGTGGCCGCCGCCGCCAGCAGCGCCTTCTTCCCCGTGCCCGCCCCCCGCCCCACCCCCAAGC
CCGGCAAGTTCGGCAACTGGCCCAGCAGCCTGAGCCAGCCCTTCAAGCCCAAGAGCAACCCCAACGG
CCGCTTCCAGGTGAAGGCCAACGTGAGCCCCCACgggcgcgccCCCAAGGCCAACGGCAGCGCCGTG
AGCCTGAAGTCCGGCAGCCTGAACACCCTGGAGGACCCCCCCAGCAGCCCCCCCCCCCGCACCTTCC
TGAACCAGCTGCCCGACTGGAGCCGCCTGCTGACCGCCATCACCACCGTGTTCGTGAAGTCCAAGCG
CCCCGACATGCACGACCGCAAGTCCAAGCGCCCCGACATGCTGGTGGACAGCTTCGGCCTGGAGTCC
ACCGTGCAGGACGGCCTGGTGTTCCGCCAGTCCTTCTCCATCCGCTCCTACGAGATCGGCACCGACC
GCACCGCCAGCATCGAGACCCTGATGAACCACCTGCAGGAGACCTCCCTGAACCACTGCAAGAGCAC
CGGCATCCTGCTGGACGGCTTCGGCCGCACCCTGGAGATGTGCAAGCGCGACCTGATCTGGGTGGTG
ATTAAGATGCAGATCAAGGTGAACCGCTACCCCACCTGGGGCGACACCGTGGAGATCAACAGCTGGT
TCAGCCAGAGCGGCAAGATCGGCATGGGCCGCGAGTGGCTGATCAGCGACTGCAACACCGGCGAGAT
CCTGGTGCGCGCCACCAGCGCCTGGGCCATGATGAACCAGAAGACCCGCCGCTTCAGCAAGCTGCCC
TGCGAGGTGCGCCAGGAGATCGCCCCCCACTTCGTGGACGCCCCCCCCGTGATCGAGGACAACGACC
GCAAGCTGCACAAGTTCGACGTGAAGACCGGCGACAGCATCTGCAAGGGCCTGACCCCCGGCTGGAA
CGACTTCGACGTGAACCAGCACGTGAGCAACGTGAAGTACATCGGCTGGATTCTGGAGAGCATGCCC
ACCGAGGTGCTGGAGACCCAGGAGCTGTGCAGCCTGACCCTGGAGTACCGCCGCGAGTGCGGCCGCG
AGAGCGTGGTGGAGAGCGTGACCAGCATGAACCCCAGCAAGGTGGGCGACCGCAGCCAGTACCAGCA
CCTGCTGCGCCTGGAGGACGGCGCCGACATCATGAAGGGCCGCACCGAGTGGCGCCCCAAGAACGCC
GGCACCAACCGCGCCATCAGCACCatggactacaaggaccacgacggcgactacaaggaccacgaca
tcgactacaaggacgacgacgacaagtga
Sequence ID No: 49-amino acid sequence encoded by pSZ2609 (D1558)
Chook-CwFATB ChimeraA
MVVAAAASSAFFPVPAPRPTPKPGKFGNWPSSLSQPFKPKSNPNGRFQVKANVSPHGRAP
KANGSAVSLKSGSLNTLEDPPSSPPPRTFLNQLPDWSRLLTAITTVFVKSKRPDMHDRKS
KRPDMLVDSFGLESTVQDGLVFRQSFSIRSYEIGTDRTASIETLMNHLQETSLNHCKSTG
ILLDGFGRTLEMCKRDLIWVVIKMQIKVNRYPTWGDTVEINSWFSQSGKIGMGREWLISD
CNTGEILVRATSAWAMMNQKTRRFSKLPCEVRQEIAPHFVDAPPVIEDNDRKLHKFDVKT
GDSICKGLTPGWNDFDVNQHVSNVKYIGWILESMPTEVLETQELCSLTLEYRRECGRESV
VESVTSMNPSKVGDRSQYQHLLRLEDGADIMKGRTEWRPKNAGTNRAISTMDYKDHDGDY
KDHDIDYKDDDDK
Sequence ID No: 50-nucleic acid sequence of pSZ2610 (D1559)
Chook-CwFATB ChimeraB
ATGGTGGTGGCCGCCGCCGCCAGCAGCGCCTTCTTCCCCGTGCCCGCCCCCCGCCCCACCCCCAAGC
CCGGCAAGTTCGGCAACTGGCCCAGCAGCCTGAGCCAGCCCTTCAAGCCCAAGAGCAACCCCAACGG
CCGCTTCCAGGTGAAGGCCAACGTGAGCCCCCACgggcgcgccCCCAAGGCCAACGGCAGCGCCGTG
AGCCTGAAGTCCGGCAGCCTGAACACCCTGGAGGACCCCCCCAGCAGCCCCCCCCCCCGCACCTTCC
TGAACCAGCTGCCCGACTGGAGCCGCCTGCGCACCGCCATCACCACCGTGTTCGTGGCCGCCGAGAA
GCAGTTCACCCGCCTGGACCGCAAGAGCAAGCGCCCCGACATGCTGGTGGACTGGTTCGGCAGCGAG
ACCATCGTGCAGGACGGCCTGGTGTTCCGCGAGCGCTTCAGCATCCGCAGCTACGAGATCGGCGCCG
ACCGCACCGCCAGCATCGAGACCCTGATGAACCACCTGCAGGAGACCTCCCTGAACCACTGCAAGAG
CACCGGCATCCTGCTGGACGGCTTCGGCCGCACCCTGGAGATGTGCAAGCGCGACCTGATCTGGGTG
GTGATTAAGATGCAGATCAAGGTGAACCGCTACCCCACCTGGGGCGACACCGTGGAGATCAACAGCT
GGTTCAGCCAGAGCGGCAAGATCGGCATGGGCCGCGAGTGGCTGATCAGCGACTGCAACACCGGCGA
GATCCTGGTGCGCGCCACCAGCGCCTGGGCCATGATGAACCAGAAGACCCGCCGCTTCAGCAAGCTG
CCCTGCGAGGTGCGCCAGGAGATCGCCCCCCACTTCGTGGACGCCCCCCCCGTGATCGAGGACAACG
ACCGCAAGCTGCACAAGTTCGACGTGAAGACCGGCGACAGCATCTGCAAGGGCCTGACCCCCGGCTG
GAACGACTTCGACGTGAACCAGCACGTGAGCAACGTGAAGTACATCGGCTGGATTCTGGAGAGCATG
CCCACCGAGGTGCTGGAGACCCAGGAGCTGTGCAGCCTGACCCTGGAGTACCGCCGCGAGTGCGGCC
GCGAGAGCGTGGTGGAGAGCGTGACCAGCATGAACCCCAGCAAGGTGGGCGACCGCAGCCAGTACCA
GCACCTGCTGCGCCTGGAGGACGGCGCCGACATCATGAAGGGCCGCACCGAGTGGCGCCCCAAGAAC
GCCGGCACCAACCGCGCCATCAGCACCatggactacaaggaccacgacggcgactacaaggaccacg
acatcgactacaaggacgacgacgacaagtga
Sequence ID No: 51-amino acid sequence encoded by pSZ2610 (D1559)
Chook-CwFATB ChimeraB
MVVAAAASSAFFPVPAPRPTPKPGKFGNWPSSLSQPFKPKSNPNGRFQVKANVSPHGRAP
KANGSAVSLKSGSLNTLEDPPSSPPPRTFLNQLPDWSRLRTAITTVFVAAEKQFTRLDRK
SKRPDMLVDWFGSETIVQDGLVFRERFSIRSYEIGADRTASIETLMNHLQETSLNHCKST
GILLDGFGRTLEMCKRDLIWVVIKMQIKVNRYPTWGDTVEINSWFSQSGKIGMGREWLIS
DCNTGEILVRATSAWAMMNQKTRRFSKLPCEVRQEIAPHFVDAPPVIEDNDRKLHKFDVK
TGDSICKGLTPGWNDFDVNQHVSNVKYIGWILESMPTEVLETQELCSLTLEYRRECGRES
VVESVTSMNPSKVGDRSQYQHLLRLEDGADIMKGRTEWRPKNAGTNRAISTMDYKDHDGD
YKDHDIDYKDDDDK
Sequence ID No: 52-nucleic acid sequence of pSZ2611 (D1560)
Chook-CwFATB ChimeraC
ATGGTGGTGGCCGCCGCCGCCAGCAGCGCCTTCTTCCCCGTGCCCGCCCCCCGCCCCACCCCCAAGC
CCGGCAAGTTCGGCAACTGGCCCAGCAGCCTGAGCCAGCCCTTCAAGCCCAAGAGCAACCCCAACGG
CCGCTTCCAGGTGAAGGCCAACGTGAGCCCCCACgggcgcgccCCCAAGGCCAACGGCAGCGCCGTG
AGCCTGAAGTCCGGCAGCCTGAACACCCTGGAGGACCCCCCCAGCAGCCCCCCCCCCCGCACCTTCC
TGAACCAGCTGCCCGACTGGAGCCGCCTGCTGACCGCCATCACCACCGTGTTCGTGAAGTCCAAGCG
CCCCGACATGCACGACCGCAAGTCCAAGCGCCCCGACATGCTGGTGGACAGCTTCGGCCTGGAGTCC
ACCGTGCAGGACGGCCTGGTGTTCCGCCAGTCCTTCTCCATCCGCTCCTACGAGATCGGCACCGACC
GCACCGCCAGCATCGAGACCCTGATGAACCACCTGCAGGACACCAGCCTGAACCACTGCAAGAGCGT
GGGCCTGCTGAACGACGGCTTCGGCCGCACCCCCGAGATGTGCACCCGCGACCTGATCTGGGTGCTG
ACCAAGATGCAGATCGTGGTGAACCGCTACCCCACCTGGGGCGACACCGTGGAGATCAACAGCTGGT
TCAGCCAGAGCGGCAAGATCGGCATGGGCCGCGAGTGGCTGATCAGCGACTGCAACACCGGCGAGAT
CCTGGTGCGCGCCACCAGCGCCTGGGCCATGATGAACCAGAAGACCCGCCGCTTCAGCAAGCTGCCC
TGCGAGGTGCGCCAGGAGATCGCCCCCCACTTCGTGGACGCCCCCCCCGTGATCGAGGACAACGACC
GCAAGCTGCACAAGTTCGACGTGAAGACCGGCGACAGCATCTGCAAGGGCCTGACCCCCGGCTGGAA
CGACTTCGACGTGAACCAGCACGTGAGCAACGTGAAGTACATCGGCTGGATTCTGGAGAGCATGCCC
ACCGAGGTGCTGGAGACCCAGGAGCTGTGCAGCCTGACCCTGGAGTACCGCCGCGAGTGCGGCCGCG
AGAGCGTGGTGGAGAGCGTGACCAGCATGAACCCCAGCAAGGTGGGCGACCGCAGCCAGTACCAGCA
CCTGCTGCGCCTGGAGGACGGCGCCGACATCATGAAGGGCCGCACCGAGTGGCGCCCCAAGAACGCC
GGCACCAACCGCGCCATCAGCACCatggactacaaggaccacgacggcgactacaaggaccacgaca
tcgactacaaggacgacgacgacaagtga
Sequence ID No: 53-amino acid sequence encoded by pSZ2611 (D1560)
Chook-CwFATB ChimeraC
MVVAAAASSAFFPVPAPRPTPKPGKFGNWPSSLSQPFKPKSNPNGRFQVKANVSPHGRAP
KANGSAVSLKSGSLNTLEDPPSSPPPRTFLNQLPDWSRLLTAITTVFVKSKRPDMHDRKS
KRPDMLVDSFGLESTVQDGLVFRQSFSIRSYEIGTDRTASIETLMNHLQDTSLNHCKSVG
LLNDGFGRTPEMCTRDLIWVLTKMQIVVNRYPTWGDTVEINSWFSQSGKIGMGREWLISD
CNTGEILVRATSAWAMMNQKTRRFSKLPCEVRQEIAPHFVDAPPVIEDNDRKLHKFDVKT
GDSICKGLTPGWNDFDVNQHVSNVKYIGWILESMPTEVLETQELCSLTLEYRRECGRESV
VESVTSMNPSKVGDRSQYQHLLRLEDGADIMKGRTEWRPKNAGTNRAISTMDYKDHDGDY
KDHDIDYKDDDDK
Sequence ID No: 54-nucleic acid sequence of pSZ2612 (D1561)
Chook-CwFATB ChimeraD
ATGGTGGTGGCCGCCGCCGCCAGCAGCGCCTTCTTCCCCGTGCCCGCCCCCCGCCCCACCCCCAAGC
CCGGCAAGTTCGGCAACTGGCCCAGCAGCCTGAGCCAGCCCTTCAAGCCCAAGAGCAACCCCAACGG
CCGCTTCCAGGTGAAGGCCAACGTGAGCCCCCACgggcgcgccCCCAAGGCCAACGGCTCCGCCGTG
AGCCTGAAGAGCGGCAGCCTGAACACCCAGGAGGACACCTCCTCCAGCCCCCCCCCCCGCACCTTCC
TGCACCAGCTGCCCGACTGGAGCCGCCTGCTGACCGCCATCACCACCGTGTTCGTGAAGTCCAAGCG
CCCCGACATGCACGACCGCAAGTCCAAGCGCCCCGACATGCTGGTGGACAGCTTCGGCCTGGAGTCC
ACCGTGCAGGACGGCCTGGTGTTCCGCCAGTCCTTCTCCATCCGCTCCTACGAGATCGGCACCGACC
GCACCGCCAGCATCGAGACCCTGATGAACCACCTGCAGGAGACCTCCCTGAACCACTGCAAGAGCAC
CGGCATCCTGCTGGACGGCTTCGGCCGCACCCTGGAGATGTGCAAGCGCGACCTGATCTGGGTGGTG
ATTAAGATGCAGATCAAGGTGAACCGCTACCCCACCTGGGGCGACACCGTGGAGATCAACAGCTGGT
TCAGCCAGAGCGGCAAGATCGGCATGGGCCGCGAGTGGCTGATCAGCGACTGCAACACCGGCGAGAT
CCTGGTGCGCGCCACCAGCGCCTGGGCCATGATGAACCAGAAGACCCGCCGCTTCAGCAAGCTGCCC
TGCGAGGTGCGCCAGGAGATCGCCCCCCACTTCGTGGACGCCCCCCCCGTGATCGAGGACAACGACC
GCAAGCTGCACAAGTTCGACGTGAAGACCGGCGACAGCATCTGCAAGGGCCTGACCCCCGGCTGGAA
CGACTTCGACGTGAACCAGCACGTGAGCAACGTGAAGTACATCGGCTGGATTCTGGAGAGCATGCCC
ACCGAGGTGCTGGAGACCCAGGAGCTGTGCAGCCTGACCCTGGAGTACCGCCGCGAGTGCGGCCGCG
AGAGCGTGGTGGAGAGCGTGACCAGCATGAACCCCAGCAAGGTGGGCGACCGCAGCCAGTACCAGCA
CCTGCTGCGCCTGGAGGACGGCGCCGACATCATGAAGGGCCGCACCGAGTGGCGCCCCAAGAACGCC
GGCACCAACCGCGCCATCAGCACCatggactacaaggaccacgacggcgactacaaggaccacgaca
tcgactacaaggacgacgacgacaagtga
Sequence ID No: 55-amino acid sequence encoded by pSZ2612 (D1561)
Chook-CwFATB ChimeraD
MVVAAAASSAFFPVPAPRPTPKPGKFGNWPSSLSQPFKPKSNPNGRFQVKANVSPHGRAP
KANGSAVSLKSGSLNTQEDTSSSPPPRTFLHQLPDWSRLLTAITTVFVKSKRPDMHDRKS
KRPDMLVDSFGLESTVQDGLVFRQSFSIRSYEIGTDRTASIETLMNHLQETSLNHCKSTG
ILLDGFGRTLEMCKRDLIWVVIKMQIKVNRYPTWGDTVEINSWFSQSGKIGMGREWLISD
CNTGEILVRATSAWAMMNQKTRRFSKLPCEVRQEIAPHFVDAPPVIEDNDRKLHKFDVKT
GDSICKGLTPGWNDFDVNQHVSNVKYIGWILESMPTEVLETQELCSLTLEYRRECGRESV
VESVTSMNPSKVGDRSQYQHLLRLEDGADIMKGRTEWRPKNAGTNRAISTMDYKDHDGDY
KDHDIDYKDDDDK
Sequence ID No: 56-nucleic acid sequence of pSZ2613 (D1562)
ChookFATB
ATGGTGGTGGCCGCCGCCGCCAGCAGCGCCTTCTTCCCCGTGCCCGCCCCCCGCCCCACCCCCAAGC
CCGGCAAGTTCGGCAACTGGCCCAGCAGCCTGAGCCAGCCCTTCAAGCCCAAGAGCAACCCCAACGG
CCGCTTCCAGGTGAAGGCCAACGTGAGCCCCCACgggcgcgccCCCAAGGCCAACGGCTCCGCCGTG
AGCCTGAAGAGCGGCAGCCTGAACACCCAGGAGGACACCTCCTCCAGCCCCCCCCCCCGCACCTTCC
TGCACCAGCTGCCCGACTGGAGCCGCCTGCTGACCGCCATCACCACCGTGTTCGTGAAGTCCAAGCG
CCCCGACATGCACGACCGCAAGTCCAAGCGCCCCGACATGCTGGTGGACAGCTTCGGCCTGGAGTCC
ACCGTGCAGGACGGCCTGGTGTTCCGCCAGTCCTTCTCCATCCGCTCCTACGAGATCGGCACCGACC
GCACCGCCAGCATCGAGACCCTGATGAACCACCTGCAGGAGACCTCCCTGAACCACTGCAAGAGCAC
CGGCATCCTGCTGGACGGCTTCGGCCGCACCCTGGAGATGTGCAAGCGCGACCTGATCTGGGTGGTG
ATCAAGATGCAGATCAAGGTGAACCGCTACCCCGCCTGGGGCGACACCGTGGAGATCAACACCCGCT
TCAGCCGCCTGGGCAAGATCGGCATGGGCCGCGACTGGCTGATCTCCGACTGCAACACCGGCGAGAT
CCTGGTGCGCGCCACCAGCGCCTACGCCATGATGAACCAGAAGACCCGCCGCCTGTCCAAGCTGCCC
TACGAGGTGCACCAGGAGATCGTGCCCCTGTTCGTGGACAGCCCCGTGATCGAGGACTCCGACCTGA
AGGTGCACAAGTTCAAGGTGAAGACCGGCGACAGCATCCAGAAGGGCCTGACCCCCGGCTGGAACGA
CCTGGACGTGAACCAGCACGTGTCCAACGTGAAGTACATCGGCTGGATCCTGGAGAGCATGCCCACC
GAGGTGCTGGAGACCCAGGAGCTGTGCTCCCTGGCCCTGGAGTACCGCCGCGAGTGCGGCCGCGACT
CCGTGCTGGAGAGCGTGACCGCCATGGACCCCAGCAAGGTGGGCGTGCGCTCCCAGTACCAGCACCT
GCTGCGCCTGGAGGACGGCACCGCCATCGTGAACGGCGCCACCGAGTGGCGCCCCAAGAACGCCGGC
GCCAACGGCGCCATCTCCACCGGCAAGACCAGCAACGGCAACTCCGTGTCCatggactacaaggacc
acgacggcgactacaaggaccacgacatcgactacaaggacgacgacgacaagtga
Sequence ID No: 57-amino acid sequence encoding pSZ2613 (D1562)
ChookFATB
MVVAAAASSAFFPVPAPRPTPKPGKFGNWPSSLSQPFKPKSNPNGRFQVKANVSPHGRAP
KANGSAVSLKSGSLNTQEDTSSSPPPRTFLHQLPDWSRLLTAITTVFVKSKRPDMHDRKS
KRPDMLVDSFGLESTVQDGLVFRQSFSIRSYEIGTDRTASIETLMNHLQETSLNHCKSTG
ILLDGFGRTLEMCKRDLIWVVIKMQIKVNRYPAWGDTVEINTRFSRLGKIGMGRDWLISD
CNTGEILVRATSAYAMMNQKTRRLSKLPYEVHQEIVPLFVDSPVIEDSDLKVHKFKVKTG
DSIQKGLTPGWNDLDVNQHVSNVKYIGWILESMPTEVLETQELCSLALEYRRECGRDSVL
ESVTAMDPSKVGVRSQYQHLLRLEDGTAIVNGATEWRPKNAGANGAISTGKTSNGNSVSM
DYKDHDGDYKDHDIDYKDDDDK
Sequence ID No: 58-nucleic acid sequence of pSZ1954 (D965) CwFATB
ATGGTGGTGGCCGCCGCCGCCAGCAGCGCCTTCTTCCCCGTGCCCGCCCCCCGCCCCACCCCCAAGC
CCGGCAAGTTCGGCAACTGGCCCAGCAGCCTGAGCCAGCCCTTCAAGCCCAAGAGCAACCCCAACGG
CCGCTTCCAGGTGAAGGCCAACGTGAGCCCCCACgggcgcgccCCCAAGGCCAACGGCAGCGCCGTG
AGCCTGAAGTCCGGCAGCCTGAACACCCTGGAGGACCCCCCCAGCAGCCCCCCCCCCCGCACCTTCC
TGAACCAGCTGCCCGACTGGAGCCGCCTGCGCACCGCCATCACCACCGTGTTCGTGGCCGCCGAGAA
GCAGTTCACCCGCCTGGACCGCAAGAGCAAGCGCCCCGACATGCTGGTGGACTGGTTCGGCAGCGAG
ACCATCGTGCAGGACGGCCTGGTGTTCCGCGAGCGCTTCAGCATCCGCAGCTACGAGATCGGCGCCG
ACCGCACCGCCAGCATCGAGACCCTGATGAACCACCTGCAGGACACCAGCCTGAACCACTGCAAGAG
CGTGGGCCTGCTGAACGACGGCTTCGGCCGCACCCCCGAGATGTGCACCCGCGACCTGATCTGGGTG
CTGACCAAGATGCAGATCGTGGTGAACCGCTACCCCACCTGGGGCGACACCGTGGAGATCAACAGCT
GGTTCAGCCAGAGCGGCAAGATCGGCATGGGCCGCGAGTGGCTGATCAGCGACTGCAACACCGGCGA
GATCCTGGTGCGCGCCACCAGCGCCTGGGCCATGATGAACCAGAAGACCCGCCGCTTCAGCAAGCTG
CCCTGCGAGGTGCGCCAGGAGATCGCCCCCCACTTCGTGGACGCCCCCCCCGTGATCGAGGACAACG
ACCGCAAGCTGCACAAGTTCGACGTGAAGACCGGCGACAGCATCTGCAAGGGCCTGACCCCCGGCTG
GAACGACTTCGACGTGAACCAGCACGTGAGCAACGTGAAGTACATCGGCTGGATTCTGGAGAGCATG
CCCACCGAGGTGCTGGAGACCCAGGAGCTGTGCAGCCTGACCCTGGAGTACCGCCGCGAGTGCGGCC
GCGAGAGCGTGGTGGAGAGCGTGACCAGCATGAACCCCAGCAAGGTGGGCGACCGCAGCCAGTACCA
GCACCTGCTGCGCCTGGAGGACGGCGCCGACATCATGAAGGGCCGCACCGAGTGGCGCCCCAAGAAC
GCCGGCACCAACCGCGCCATCAGCACCgactacaaggacgacgacgacaagtga
Sequence ID No: 59-amino acid sequence encoded by pSZ1954 (D965)
CwFATB
MVVAAAASSAFFPVPAPRPTPKPGKFGNWPSSLSQPFKPKSNPNGRFQVKANVSPHGRAP
KANGSAVSLKSGSLNTLEDPPSSPPPRTFLNQLPDWSRLRTAITTVFVAAEKQFTRLDRK
SKRPDMLVDWFGSETIVQDGLVFRERFSIRSYEIGADRTASIETLMNHLQDTSLNHCKSV
GLLNDGFGRTPEMCTRDLIWVLTKMQIVVNRYPTWGDTVEINSWFSQSGKIGMGREWLIS
DCNTGEILVRATSAWAMMNQKTRRFSKLPCEVRQEIAPHFVDAPPVIEDNDRKLHKFDVK
TGDSICKGLTPGWNDFDVNQHVSNVKYIGWILESMPTEVLETQELCSLTLEYRRECGRES
VVESVTSMNPSKVGDRSQYQHLLRLEDGADIMKGRTEWRPKNAGTNRAISTDYKDDDDK
Sequence ID No: 60-wild-type Cupheawrightii (Cw) acyl-ACP
thioesterase FATB2 (GenBank Accession Nos. U56104.1 (RNA); Q39663
(Protein))
MVVAAAASSAFFPVPAPRPTPKPGKFGNWPSSLSQPFKPKSNPNGRFQVKANVSPHPKANGSAVSLK
SGSLNTLEDPPSSPPPRTFLNQLPDWSRLRTAITTVFVAAEKQFTRLDRKSKRPDMLVDWFGSETIV
QDGLVFRERFSIRSYEIGADRTASIETLMNHLQDTSLNHCKSVGLLNDGFGRTPEMCTRDLIWVLTK
MQIVVNRYPTWGDTVEINSWFSQSGKIGMGREWLISDCNTGEILVRATSAWAMMNQKTRRFSKLPCE
VRQEIAPHFVDAPPVIEDNDRKLHKFDVKTGDSICKGLTPGWNDFDVNQHVSNVKYIGWILESMPTE
VLETQELCSLTLEYRRECGRESVVESVTSMNPSKVGDRSQYQHLLRLEDGADIMKGRTEWRPKNAGT
NRAIST
Sequence ID No: 61-wild-type Cupheahookeriana (Chook) acyl-ACP
thioesterase (GenBank Accession Nos. U39834.1 (RNA); Q39514
(Protein))
MVAAAASSAFFPVPAPGASPKPGKFGNWPSSLSPSFKPKSIPNGGFQVKANDSAHPKANGSAVSLKS
GSLNTQEDTSSSPPPRTFLHQLPDWSRLLTAITTVFVKSKRPDMHDRKSKRPDMLVDSFGLESTVQD
GLVFRQSFSIRSYEIGTDRTASIETLMNHLQETSLNHCKSTGILLDGFGRTLEMCKRDLIWVVIKMQ
IKVNRYPAWGDTVEINTRFSRLGKIGMGRDWLISDCNTGEILVRATSAYAMMNQKTRRLSKLPYEVH
QEIVPLFVDSPVIEDSDLKVHKFKVKTGDSIQKGLTPGWNDLDVNQHVSNVKYIGWILESMPTEVL
ETQELCSLALEYRRECGRDSVLESVTAMDPSKVGVRSQYQHLLRLEDGTAIVNGATEWRPKNAGANG
AISTGKTSNGNSVS
SEQ ID NO: 62-Protothecakruegani 23S rRNA
tgttgaagaa tgagccggcg agttaaaaag agtggcatgg ttaaagaaaa tactctggag
ccatagcgaa agcaagttta gtaagcttag gtcattcttt ttagacccga aaccgagtga
tctacccatg atcagggtga agtgttagta aaataacatg gaggcccgaa ccgactaatg
ttgaaaaatt agcggatgaa ttgtgggtag gggcgaaaaa ccaatcgaac tcggagttag
ctggttctcc ccgaaatgcg tttaggcgca gcagtagcag tacaaataga ggggtaaagc
actgtttctt ttgtgggctt cgaaagttgt acctcaaagt ggcaaactct gaatactcta
tttagatatc tactagtgag accttggggg ataagctcct tggtcaaaag ggaaacagcc
cagatcacca gttaaggccc caaaatgaaa atgatagtga ctaaggatgt gggtatgtca
aaacctccag caggttagct tagaagcagc aatcctttca agagtgcgta atagctcact
g
SEQ ID NO: 63-Protothecawickerhamii 23S rRNA
tgttgaagaa tgagccggcg acttaaaata aatggcaggc taagagattt aataactcga
aacctaagcg aaagcaagtc ttaatagggc gtcaatttaa caaaacttta aataaattat
aaagtcattt attttagacc cgaacctgag tgatctaacc atggtcagga tgaaacttgg
gtgacaccaa gtggaagtcc gaaccgaccg atgttgaaaa atcggcggat gaactgtggt
tagtggtgaa ataccagtcg aactcagagc tagctggttc tccccgaaat gcgttgaggc
gcagcaatat atctcgtcta tctaggggta aagcactgtt tcggtgcggg ctatgaaaat
ggtaccaaat cgtggcaaac tctgaatact agaaatgacg atatattagt gagactatgg
gggataagct ccatagtcga gagggaaaca gcccagacca ccagttaagg ccccaaaatg
ataatgaagt ggtaaaggag gtgaaaatgc aaatacaacc aggaggttgg cttagaagca
gccatccttt aaagagtgcg taatagctca ctg
SEQ ID NO: 64-Protothecastagnora 23S rRNA
tgttgaagaa tgagccggcg agttaaaaaa aatggcatgg ttaaagatat ttctctgaag
ccatagcgaa agcaagtttt acaagctata gtcatttttt ttagacccga aaccgagtga
tctacccatg atcagggtga agtgttggtc aaataacatg gaggcccgaa ccgactaatg
gtgaaaaatt agcggatgaa ttgtgggtag gggcgaaaaa ccaatcgaac tcggagttag
ctggttctcc ccgaaatgcg tttaggcgca gcagtagcaa cacaaataga ggggtaaagc
actgtttctt ttgtgggctt cgaaagttgt acctcaaagt ggcaaactct gaatactcta
tttagatatc tactagtgag accttggggg ataagctcct tggtcaaaag ggaaacagcc
cagatcacca gttaaggccc caaaatgaaa atgatagtga ctaaggacgt gagtatgtca
aaacctccag caggttagct tagaagcagc aatcctttca agagtgcgta atagctcact
g
SEQ ID NO: 65-Protothecamoriformis 23S rRNA
tgttgaagaa tgagccggcg agttaaaaag agtggcatgg ttaaagataa ttctctggag
ccatagcgaa agcaagttta acaagctaaa gtcacccttt ttagacccga aaccgagtga
tctacccatg atcagggtga agtgttggta aaataacatg gaggcccgaa ccgactaatg
gtgaaaaatt agcggatgaa ttgtgggtag gggcgaaaaa ccaatcgaac tcggagttag
ctggttctcc ccgaaatgcg tttaggcgca gcagtagcaa cacaaataga ggggtaaagc
actgtttctt ttgtgggctt cgaaagttgt acctcaaagt ggcaaactct gaatactcta
tttagatatc tactagtgag accttggggg ataagctcct tggtcaaaag ggaaacagcc
cagatcacca gttaaggccc caaaatgaaa atgatagtga ctaaggatgt gggtatgtta
aaacctccag caggttagct tagaagcagc aatcctttca agagtgcgta atagctcact
g
SEQ ID NO: 66-Protothecamoriformis 23S rRNA
tgttgaagaa tgagccggcg acttaaaata aatggcaggc taagagaatt aataactcga
aacctaagcg aaagcaagtc ttaatagggc gctaatttaa caaaacatta aataaaatct
aaagtcattt attttagacc cgaacctgag tgatctaacc atggtcagga tgaaacttgg
gtgacaccaa gtggaagtcc gaaccgaccg atgttgaaaa atcggcggat gaactgtggt
tagtggtgaa ataccagtcg aactcagagc tagctggttc tccccgaaat gcgttgaggc
gcagcaatat atctcgtcta tctaggggta aagcactgtt tcggtgcggg ctatgaaaat
ggtaccaaat cgtggcaaac tctgaatact agaaatgacg atatattagt gagactatgg
gggataagct ccatagtcga gagggaaaca gcccagacca ccagttaagg ccccaaaatg
ataatgaagt ggtaaaggag gtgaaaatgc aaatacaacc aggaggttgg cttagaagca
gccatccttt aaagagtgcg taatagctca ctg
SEQ ID NO: 67-Protothecawickerhamii 23S rRNA
tgttgaagaa tgagccgtcg acttaaaata aatggcaggc taagagaatt aataactcga
aacctaagcg aaagcaagtc ttaatagggc gctaatttaa caaaacatta aataaaatct
aaagtcattt attttagacc cgaacctgag tgatctaacc atggtcagga tgaaacttgg
gtgacaccaa gtggaagtcc gaaccgaccg atgttgaaaa atcggcggat gaactgtggt
tagtggtgaa ataccagtcg aactcagagc tagctggttc tccccgaaat gcgttgaggc
gcagcaatat atctcgtcta tctaggggta aagcactgtt tcggtgcggg ctatgaaaat
ggtaccaaat cgtggcaaac tctgaatact agaaatgacg atatattagt gagactatgg
gggataagct ccatagtcga gagggaaaca gcccagacca ccagttaagg ccccaaaatg
ataatgaagt ggtaaaggag gtgaaaatgc aaatacaacc aggaggttgg cttagaagca
gccatccttt aaagagtgcg taatagctca ctg
SEQ ID NO: 68-Protothecamoriformis 23S rRNA
tgttgaagaa tgagccggcg agttaaaaag agtggcgtgg ttaaagaaaa ttctctggaa
ccatagcgaa agcaagttta acaagcttaa gtcacttttt ttagacccga aaccgagtga
tctacccatg atcagggtga agtgttggta aaataacatg gaggcccgaa ccgactaatg
gtgaaaaatt agcggatgaa ttgtgggtag gggcgaaaaa ccaatcgaac tcggagttag
ctggttctcc ccgaaatgcg tttaggcgca gcagtagcaa cacaaataga ggggtaaagc
actgtttctt ttgtgggctc cgaaagttgt acctcaaagt ggcaaactct gaatactcta
tttagatatc tactagtgag accttggggg ataagctcct tggtcgaaag ggaaacagcc
cagatcacca gttaaggccc caaaatgaaa atgatagtga ctaaggatgt gagtatgtca
aaacctccag caggttagct tagaagcagc aatcctttca agagtgcgta atagctcact
g
SEQ ID NO: 69-Protothecazopfii 23S rRNA
tgttgaagaa tgagccggcg agttaaaaag agtggcatgg ttaaagaaaa ttctctggag
ccatagcgaa agcaagttta acaagcttaa gtcacttttt ttagacccga aaccgagtga
tctacccatg atcagggtga agtgttggta aaataacatg gaggcccgaa ccgactaatg
gtgaaaaatt agcggatgaa ttgtgggtag gggcgaaaaa ccaatcgaac tcggagttag
ctggttctcc ccgaaatgcg tttaggcgca gcagtagcaa cacaaataga ggggtaaagc
actgtttctt tcgtgggctt cgaaagttgt acctcaaagt ggcaaactct gaatactcta
tttagatatc tactagtgag accttggggg ataagctcct tggtcaaaag ggaaacagcc
cagatcacca gttaaggccc caaaatgaaa atgatagtga ctaaggatgt gagtatgtca
aaacctccag caggttagct tagaagcagc aatcctttca agagtgcgta atagctcact
g
SEQ ID NO: 70-Protothecamoriformis rRNA
tgttgaagaa tgagccggcg acttagaaaa ggtggcatgg ttaaggaaat attccgaagc
cgtagcaaaa gcgagtctga atagggcgat aaaatatatt aatatttaga atctagtcat
tttttctaga cccgaacccg ggtgatctaa ccatgaccag gatgaagctt gggtgatacc
aagtgaaggt ccgaaccgac cgatgttgaa aaatcggcgg atgagttgtg gttagcggtg
aaataccagt cgaacccgga gctagctggt tctccccgaa atgcgttgag gcgcagcagt
acatctagtc tatctagggg taaagcactg tttcggtgcg ggctgtgaga acggtaccaa
atcgtggcaa actctgaata ctagaaatga cgatgtagta gtgagactgt gggggataag
ctccattgtc aagagggaaa cagcccagac caccagctaa ggccccaaaa tggtaatgta
gtgacaaagg aggtgaaaat gcaaatacaa ccaggaggtt ggcttagaag cagccatcct
ttaaagagtg cgtaatagct cactg
SEQ ID NO: 71-nucleic acid sequence for D3042 (pSZ4243) (wild-
type); Algal transit peptide represented with lower case, FLAG
epitope tag with underline
atggccaccgcatccactttctcggcgttcaatgcccgctgcggcgacctgcgtcgctcggcgggct
ccgggccccggcgcccagcgaggcccctccccgtgcgcgggcgcgccTCCAGCCTGAGCCCCTCCTT
CAAGCCCAAGTCCATCCCCAACGGCGGCTTCCAGGTGAAGGCCAACGACAGCGCCCACCCCAAGGCC
AACGGCTCCGCCGTGAGCCTGAAGAGCGGCAGCCTGAACACCCAGGAGGACACCTCCTCCAGCCCCC
CCCCCCGCACCTTCCTGCACCAGCTGCCCGACTGGAGCCGCCTGCTGACCGCCATCACCACCGTGTT
CGTGAAGTCCAAGCGCCCCGACATGCACGACCGCAAGTCCAAGCGCCCCGACATGCTGGTGGACAGC
TTCGGCCTGGAGTCCACCGTGCAGGACGGCCTGGTGTTCCGCCAGTCCTTCTCCATCCGCTCCTACG
AGATCGGCACCGACCGCACCGCCAGCATCGAGACCCTGATGAACCACCTGCAGGAGACCTCCCTGAA
CCACTGCAAGAGCACCGGCATCCTGCTGGACGGCTTCGGCCGCACCCTGGAGATGTGCAAGCGCGAC
CTGATCTGGGTGGTGATCAAGATGCAGATCAAGGTGAACCGCTACCCCGCCTGGGGCGACACCGTGG
AGATCAACACCCGCTTCAGCCGCCTGGGCAAGATCGGCATGGGCCGCGACTGGCTGATCTCCGACTG
CAACACCGGCGAGATCCTGGTGCGCGCCACCAGCGCCTACGCCATGATGAACCAGAAGACCCGCCGC
CTGTCCAAGCTGCCCTACGAGGTGCACCAGGAGATCGTGCCCCTGTTCGTGGACAGCCCCGTGATCG
AGGACTCCGACCTGAAGGTGCACAAGTTCAAGGTGAAGACCGGCGACAGCATCCAGAAGGGCCTGAC
CCCCGGCTGGAACGACCTGGACGTGAACCAGCACGTGTCCAACGTGAAGTACATCGGCTGGATCCTG
GAGAGCATGCCCACCGAGGTGCTGGAGACCCAGGAGCTGTGCTCCCTGGCCCTGGAGTACCGCCGCG
AGTGCGGCCGCGACTCCGTGCTGGAGAGCGTGACCGCCATGGACCCCAGCAAGGTGGGCGTGCGCTC
CCAGTACCAGCACCTGCTGCGCCTGGAGGACGGCACCGCCATCGTGAACGGCGCCACCGAGTGGCGC
CCCAAGAACGCCGGCGCCAACGGCGCCATCTCCACCGGCAAGACCAGCAACGGCAACTCCGTGTCCA
TGGACTACAAGGACCACGACGGCGACTACAAGGACCACGACATCGACTACAAGGACGACGACGACAA
GTGA
SEQ ID NO: 72-amino acid sequence for D3042; pSZ4243 (wild-type);
Algal transit peptide represented with lower case, FLAG epitope tag
with underline
matastfsafnarcgdlrrsagsgprrparpliwrgraSSLSPSFKPKSIPNGGFQVKANDSAHPKA
NGSAVSLKSGSLNTQEDTSSSPPPRTFLHQLPDWSRLLTAITTVFVKSKRPDMHDRKSKRPDMLVDS
FGLESTVQDGLVFRQSFSIRSYEIGTDRTASIETLMNHLQETSLNHCKSTGILLDGFGRTLEMCKRD
LIWVVIKMQIKVNRYPAWGDTVEINTRFSRLGKIGMGRDWLISDCNTGEILVRATSAYAMMNQKTRR
LSKLPYEVHQEIVPLFVDSPVIEDSDLKVHKFKVKTGDSIQKGLTPGWNDLDVNQHVSNVKYIGWIL
ESMPTEVLETQELCSLALEYRRECGRDSVLESVTAMDPSKVGVRSQYQHLLRLEDGTAIVNGATEWR
PKNAGANGAISTGKTSNGNSVSMDYKDHDGDYKDHDIDYKDDDDK
SEQ ID NO: 73-nucleic acid sequence for D3126 (pSZ4331); Algal
transit peptide represented with lower case, FLAG epitope tag with
underline and the portion of N-terminal specificity domain that was
mutated relative to the wild-type ChFATB2 (D3042, pSZ4243)
highlighted with bolded text
atggccaccgcatccactttctcggcgttcaatgcccgctgcggcgacctgcgtcgctcggcgggct
ccgggccccggcgcccagcgaggcccctccccgtgcgcgggcgcgccTCCAGCCTGAGCCCCTCCTT
CAAGCCCAAGTCCATCCCCAACGGCGGCTTCCAGGTGAAGGCCAACGACAGCGCCCACCCCAAGGCC
AACGGCTCCGCCGTGAGCCTGAAGAGCGGCAGCCTGAACACCCAGGAGGACACCTCCTCCAGCCCCC
CCCCCCGCACCTTCCTGCACCAGCTGCCCGACTGGAGCCGCCTGCTGACCGCCATCACCACCGTGTT
CGTGAAGTCCAAGCGCCCCGACATGCACGACCGCAAGTCCAAGCGCCCCGACATGCTGGTGGACAGC
TTCGGCCTGGAGTCCACCGTGCAGGACGGCCTGGTGTTCCGCCAGTCCTTCTCCATCCGCTCCTACG
AGATCGGCACCGACCGCACCGCCAGCATCGAGACCCTGATGAACCACCTGCAGGACACCAGCCTGAA
CCACTGCAAGAGCGTGGGCCTGCTGAACGACGGCTTCGGCCGCACCCCCGAGATGTGCACCCGCGAC
CTGATCTGGGTGGTGATCAAGATGCAGATCAAGGTGAACCGCTACCCCGCCTGGGGCGACACCGTGG
AGATCAACACCCGCTTCAGCCGCCTGGGCAAGATCGGCATGGGCCGCGACTGGCTGATCTCCGACTG
CAACACCGGCGAGATCCTGGTGCGCGCCACCAGCGCCTACGCCATGATGAACCAGAAGACCCGCCGC
CTGTCCAAGCTGCCCTACGAGGTGCACCAGGAGATCGTGCCCCTGTTCGTGGACAGCCCCGTGATCG
AGGACTCCGACCTGAAGGTGCACAAGTTCAAGGTGAAGACCGGCGACAGCATCCAGAAGGGCCTGAC
CCCCGGCTGGAACGACCTGGACGTGAACCAGCACGTGTCCAACGTGAAGTACATCGGCTGGATCCTG
GAGAGCATGCCCACCGAGGTGCTGGAGACCCAGGAGCTGTGCTCCCTGGCCCTGGAGTACCGCCGCG
AGTGCGGCCGCGACTCCGTGCTGGAGAGCGTGACCGCCATGGACCCCAGCAAGGTGGGCGTGCGCTC
CCAGTACCAGCACCTGCTGCGCCTGGAGGACGGCACCGCCATCGTGAACGGCGCCACCGAGTGGCGC
CCCAAGAACGCCGGCGCCAACGGCGCCATCTCCACCGGCAAGACCAGCAACGGCAACTCCGTGTCCA
TGGACTACAAGGACCACGACGGCGACTACAAGGACCACGACATCGACTACAAGGACGACGACGACAA
GTGA
SEQ ID NO: 74-amino acid sequence for for D3126 (pSZ4331); Algal
transit peptide represented with lower case, FLAG epitope tag with
underline and the portion of N-terminal specificity domain that was
mutated relative to the wild-type ChFATB2 (D3042, pSZ4243)
highlighted with bolded text
matastfsafnarcgdlrrsagsgprrparplpyrgraSSLSPSFKPKSIPNGGFQVKANDSAHPKA
NGSAVSLKSGSLNTQEDTSSSPPPRTFLHQLPDWSRLLTAITTVFVKSKRPDMHDRKSKRPDMLVDS
FGLESTVQDGLVFRQSFSIRSYEIGTDRTASIETLMNHLQDTSLNHCKSVGLLNDGFGRTPEMCTRD
LIWVVIKMQIKVNRYPAWGDTVEINTRFSRLGKIGMGRDWLISDCNTGEILVRATSAYAMMNQKTRR
LSKLPYEVHQEIVPLFVDSPVIEDSDLKVHKFKVKTGDSIQKGLTPGWNDLDVNQHVSNVKYIGWIL
ESMPTEVLETQELCSLALEYRRECGRDSVLESVTAMDPSKVGVRSQYQHLLRLEDGTAIVNGATEWR
PKNAGANGAISTGKTSNGNSVSMDYKDHDGDYKDHDIDYKDDDDK
SEQ ID NO:75-nucleic acid sequence for D3127 (pSZ4332); Algal
transit peptide represented with lower case, FLAG epitope tag with
underline and the portion of N-terminal specificity domain that was
mutated relative to the wild-type ChFATB2 (D3042, pSZ4243)
highlighted with bolded text
atggccaccgcatccactttctcggCgttcaatgcccgctgcggcgacctgcgtcgctcggcgggct
ccgggccccggcgcccagcgaggcccctccccgtgcgcgggcgcgccTCCAGCCTGAGCCCCTCCTT
CAAGCCCAAGTCCATCCCCAACGGCGGCTTCCAGGTGAAGGCCAACGACAGCGCCCACCCCAAGGCC
AACGGCTCCGCCGTGAGCCTGAAGAGCGGCAGCCTGAACACCCAGGAGGACACCTCCTCCAGCCCCC
CCCCCCGCACCTTCCTGCACCAGCTGCCCGACTGGAGCCGCCTGCTGACCGCCATCACCACCGTGTT
CGTGAAGTCCAAGCGCCCCGACATGCACGACCGCAAGTCCAAGCGCCCCGACATGCTGGTGGACAGC
TTCGGCCTGGAGTCCACCGTGCAGGACGGCCTGGTGTTCCGCCAGTCCTTCTCCATCCGCTCCTACG
AGATCGGCACCGACCGCACCGCCAGCATCGAGACCCTGATGAACCACCTGCAGGAGACCTCCATCAA
CCACTGCAAGTCCCTGGGCCTGCTGAACGACGGCTTCGGCCGCACCCCCGGCATGTGCAAGAACGAC
CTGATCTGGGTGGTGATCAAGATGCAGATCAAGGTGAACCGCTACCCCGCCTGGGGCGACACCGTGG
AGATCAACACCCGCTTCAGCCGCCTGGGCAAGATCGGCATGGGCCGCGACTGGCTGATCTCCGACTG
CAACACCGGCGAGATCCTGGTGCGCGCCACCAGCGCCTACGCCATGATGAACCAGAAGACCCGCCGC
CTGTCCAAGCTGCCCTACGAGGTGCACCAGGAGATCGTGCCCCTGTTCGTGGACAGCCCCGTGATCG
AGGACTCCGACCTGAAGGTGCACAAGTTCAAGGTGAAGACCGGCGACAGCATCCAGAAGGGCCTGAC
CCCCGGCTGGAACGACCTGGACGTGAACCAGCACGTGTCCAACGTGAAGTACATCGGCTGGATCCTG
GAGAGCATGCCCACCGAGGTGCTGGAGACCCAGGAGCTGTGCTCCCTGGCCCTGGAGTACCGCCGCG
AGTGCGGCCGCGACTCCGTGCTGGAGAGCGTGACCGCCATGGACCCCAGCAAGGTGGGCGTGCGCTC
CCAGTACCAGCACCTGCTGCGCCTGGAGGACGGCACCGCCATCGTGAACGGCGCCACCGAGTGGCGC
CCCAAGAACGCCGGCGCCAACGGCGCCATCTCCACCGGCAAGACCAGCAACGGCAACTCCGTGTCCA
TGGACTACAAGGACCACGACGGCGACTACAAGGACCACGACATCGACTACAAGGACGACGACGACAA
GTGA
SEQ ID NO:76-amino acid sequence for D3127 (pSZ4332); Algal
transit peptide represented with lower case, FLAG epitope tag with
underline and the portion of N-terminal specificity domain that was
mutated relative to the wild-type ChFATB2 (D3042, pSZ4243)
highlighted with bolded text
matastfsafnarcgdlrrsagsgprrparplpyrgraSSLSPSFKPKSIPNGGFQVKANDSAHPKA
NGSAVSLKSGSLNTQEDTSSSPPPRTFLHQLPDWSRLLTAITTVFVKSKRPDMHDRKSKRPDMLVDS
FGLESTVQDGLVFRQSFSIRSYEIGTDRTASIETLMNHLQETSINHCKSLGLLNDGFGRTPGMCKND
LIWVVIKMQIKVNRYPAWGDTVEINTRFSRLGKIGMGRDWLISDCNTGEILVRATSAYAMMNQKTRR
LSKLPYEVHQEIVPLFVDSPVIEDSDLKVHKFKVKTGDSIQKGLTPGWNDLDVNQHVSNVKYIGWIL
ESMPTEVLETQELCSLALEYRRECGRDSVLESVTAMDPSKVGVRSQYQHLLRLEDGTAIVNGATEWR
PKNAGANGAISTGKTSNGNSVSMDYKDHDGDYKDHDIDYKDDDDK
SEQ ID NO: 77-nucleic acid sequence for D3128 (pSZ4333); Algal
transit peptide represented with lower case, FLAG epitope tag with
underline and the portion of N-terminal specificity domain that was
mutated relative to the wild-type ChFATB2 (D3042, pSZ4243)
highlighted with bolded text
atggccaccgcatccactttctcggcgttcaatgcccgctgcggcgacctgcgtcgctcggcgggct
ccgggccccggcgcccagcgaggcccctccccgtgcgcgggcgcgccTCCAGCCTGAGCCCCTCCTT
CAAGCCCAAGTCCATCCCCAACGGCGGCTTCCAGGTGAAGGCCAACGACAGCGCCCACCCCAAGGCC
AACGGCTCCGCCGTGAGCCTGAAGAGCGGCAGCCTGAACACCCAGGAGGACACCTCCTCCAGCCCCC
CCCCCCGCACCTTCCTGCACCAGCTGCCCGACTGGAGCCGCCTGCTGACCGCCATCACCACCGTGTT
CGTGAAGTCCAAGCGCCCCGACATGCACGACCGCAAGTCCAAGCGCCCCGACATGCTGGTGGACAGC
TTCGGCCTGGAGTCCACCGTGCAGGACGGCCTGGTGTTCCGCCAGTCCTTCTCCATCCGCTCCTACG
AGATCGGCACCGACCGCACCGCCAGCATCGAGACCGTGATGAACCACGTCCAGGAGACCTCGCTGAA
CCAGTGCAAGTCCATCGGCCTGCTGGACGACGGCTTCGGCCGCAGCCCCGAGATGTGCAAGCGCGAC
CTGATCTGGGTGGTGATCAAGATGCAGATCAAGGTGAACCGCTACCCCGCCTGGGGCGACACCGTGG
AGATCAACACCCGCTTCAGCCGCCTGGGCAAGATCGGCATGGGCCGCGACTGGCTGATCTCCGACTG
CAACACCGGCGAGATCCTGGTGCGCGCCACCAGCGCCTACGCCATGATGAACCAGAAGACCCGCCGC
CTGTCCAAGCTGCCCTACGAGGTGCACCAGGAGATCGTGCCCCTGTTCGTGGACAGCCCCGTGATCG
AGGACTCCGACCTGAAGGTGCACAAGTTCAAGGTGAAGACCGGCGACAGCATCCAGAAGGGCCTGAC
CCCCGGCTGGAACGACCTGGACGTGAACCAGCACGTGTCCAACGTGAAGTACATCGGCTGGATCCTG
GAGAGCATGCCCACCGAGGTGCTGGAGACCCAGGAGCTGTGCTCCCTGGCCCTGGAGTACCGCCGCG
AGTGCGGCCGCGACTCCGTGCTGGAGAGCGTGACCGCCATGGACCCCAGCAAGGTGGGCGTGCGCTC
CCAGTACCAGCACCTGCTGCGCCTGGAGGACGGCACCGCCATCGTGAACGGCGCCACCGAGTGGCGC
CCCAAGAACGCCGGCGCCAACGGCGCCATCTCCACCGGCAAGACCAGCAACGGCAACTCCGTGTCCA
TGGACTACAAGGACCACGACGGCGACTACAAGGACCACGACATCGACTACAAGGACGACGACGACAA
GTGA
SEQ ID NO: 78-amino acid sequence for D3128 (pSZ4333); Algal
transit peptide represented with lower case, FLAG epitope tag with
underline and the portion of N-terminal specificity domain that was
mutated relative to the wild-type ChFATB2 (D3042, pSZ4243)
highlighted with bolded text
matastfsafnarcgdlrrsagsgprrparpliwrgraSSLSPSFKPKSIPNGGFQVKANDSAHPKA
NGSAVSLKSGSLNTQEDTSSSPPPRTFLHQLPDWSRLLTAITTVFVKSKRPDMHDRKSKRPDMLVDS
FGLESTVQDGLVFRQSFSIRSYEIGTDRTASIETVMNHVQETSLNQCKSIGLLDDGFGRSPEMCKRD
LIWVVIKMQIKVNRYPAWGDTVEINTRFSRLGKIGMGRDWLISDCNTGEILVRATSAYAMMNQKTRR
LSKLPYEVHQEIVPLFVDSPVIEDSDLKVHKFKVKTGDSIQKGLTPGWNDLDVNQHVSNVKYIGWIL
ESMPTEVLETQELCSLALEYRRECGRDSVLESVTAMDPSKVGVRSQYQHLLRLEDGTAIVNGATEWR
PKNAGANGAISTGKTSNGNSVSMDYKDHDGDYKDHDIDYKDDDDK
SEQ ID NO: 79-nucleic acid sequence for D3129 (pSZ4334); Algal
transit peptide represented with lower case, FLAG epitope tag with
underline and the portion of N-terminal specificity domain that was
mutated relative to the wild-type ChFATB2 (D3042, pSZ4243)
highlighted with bolded text
atggccaccgcatccactttctcggcgttcaatgcccgctgcggcgacctgcgtcgctcggcgggct
ccgggccccggcgcccagcgaggcccctccccgtgcgcgggcgcgccTCCAGCCTGAGCCCCTCCTT
CAAGCCCAAGTCCATCCCCAACGGCGGCTTCCAGGTGAAGGCCAACGACAGCGCCCACCCCAAGGCC
AACGGCTCCGCCGTGAGCCTGAAGAGCGGCAGCCTGAACACCCAGGAGGACACCTCCTCCAGCCCCC
CCCCCCGCACCTTCCTGCACCAGCTGCCCGACTGGAGCCGCCTGCTGACCGCCATCACCACCGTGTT
CGTGAAGTCCAAGCGCCCCGACATGCACGACCGCAAGTCCAAGCGCCCCGACATGCTGGTGGACAGC
TTCGGCCTGGAGTCCACCGTGCAGGACGGCCTGGTGTTCCGCCAGTCCTTCTCCATCCGCTCCTACG
AGATCGGCACCGACCGCACCGCCAGCATCGAGACCCTGATGAACCACCTGCAGGAGACCTCCCTGAA
CCAGTGCAAGTCCGCCGGCATCCTGCACGACGGCTTCGGCCGCACCCTGGAGATGTGCAAGCGCGAC
CTGATCTGGGTGGTGATCAAGATGCAGATCAAGGTGAACCGCTACCCCGCCTGGGGCGACACCGTGG
AGATCAACACCCGCTTCAGCCGCCTGGGCAAGATCGGCATGGGCCGCGACTGGCTGATCTCCGACTG
CAACACCGGCGAGATCCTGGTGCGCGCCACCAGCGCCTACGCCATGATGAACCAGAAGACCCGCCGC
CTGTCCAAGCTGCCCTACGAGGTGCACCAGGAGATCGTGCCCCTGTTCGTGGACAGCCCCGTGATCG
AGGACTCCGACCTGAAGGTGCACAAGTTCAAGGTGAAGACCGGCGACAGCATCCAGAAGGGCCTGAC
CCCCGGCTGGAACGACCTGGACGTGAACCAGCACGTGTCCAACGTGAAGTACATCGGCTGGATCCTG
GAGAGCATGCCCACCGAGGTGCTGGAGACCCAGGAGCTGTGCTCCCTGGCCCTGGAGTACCGCCGCG
AGTGCGGCCGCGACTCCGTGCTGGAGAGCGTGACCGCCATGGACCCCAGCAAGGTGGGCGTGCGCTC
CCAGTACCAGCACCTGCTGCGCCTGGAGGACGGCACCGCCATCGTGAACGGCGCCACCGAGTGGCGC
CCCAAGAACGCCGGCGCCAACGGCGCCATCTCCACCGGCAAGACCAGCAACGGCAACTCCGTGTCCA
TGGACTACAAGGACCACGACGGCGACTACAAGGACCACGACATCGACTACAAGGACGACGACGACAA
GTGA
SEQ ID NO: 80-amino acid sequence for D3129 (pSZ4334); Algal
transit peptide represented with lower case, FLAG epitope tag with
underline and the portion of N-terminal specificity domain that was
mutated relative to the wild-type ChFATB2 (D3042, pSZ4243)
highlighted with bolded text
matastfsafnarcgdlrrsagsgprrparplinirgraSSLSPSFKPKSIPNGGFQVKANDSAHPKA
NGSAVSLKSGSLNTQEDTSSSPPPRTFLHQLPDWSRLLTAITTVFVKSKRPDMHDRKSKRPDMLVDS
FGLESTVQDGLVFRQSFSIRSYEIGTDRTASIETLMNHLQETSLNQCKSAGILHDGFGRTLEMCKRD
LIWVVIKMQIKVNRYPAWGDTVEINTRFSRLGKIGMGRDWLISDCNTGEILVRATSAYAMMNQKTRR
LSKLPYEVHQEIVPLFVDSPVIEDSDLKVHKFKVKTGDSIQKGLTPGWNDLDVNQHVSNVKYIGWIL
ESMPTEVLETQELCSLALEYRRECGRDSVLESVTAMDPSKVGVRSQYQHLLRLEDGTAIVNGATEWR
PKNAGANGAISTGKTSNGNSVSMDYKDHDGDYKDHDIDYKDDDDK
SEQ ID NO:81-nucleic acid sequence for D3130 (pSZ4335); Algal
transit peptide represented with lower case, FLAG epitope tag with
underline and the portion of N-terminal specificity domain that was
mutated relative to the wild-type ChFATB2 (D3042, pSZ4243)
highlighted with bolded text
atggccaccgcatccactttctcggcgttcaatgcccgctgcggcgacctgcgtcgctcggcgggct
ccgggccccggcgcccagcgaggcccctccccgtgcgcgggcgcgccTCCAGCCTGAGCCCCTCCTT
CAAGCCCAAGTCCATCCCCAACGGCGGCTTCCAGGTGAAGGCCAACGACAGCGCCCACCCCAAGGCC
AACGGCTCCGCCGTGAGCCTGAAGAGCGGCAGCCTGAACACCCAGGAGGACACCTCCTCCAGCCCCC
CCCCCCGCACCTTCCTGCACCAGCTGCCCGACTGGAGCCGCCTGCTGACCGCCATCACCACCGTGTT
CGTGAAGTCCAAGCGCCCCGACATGCACGACCGCAAGTCCAAGCGCCCCGACATGCTGGTGGACAGC
TTCGGCCTGGAGTCCACCGTGCAGGACGGCCTGGTGTTCCGCCAGTCCTTCTCCATCCGCTCCTACG
AGATCGGCACCGACCGCACCGCCAGCATCGAGACCCTGATGAACTACCTGCAGGAGACCTCCCTGAA
CCACTGCAAGTCCACCGGCATCCTGCTGGACGGCTTCGGCCGCACCCCCGAGATGTGCAAGCGCGAC
CTGATCTGGGTGGTGATCAAGATGCAGATCAAGGTGAACCGCTACCCCGCCTGGGGCGACACCGTGG
AGATCAACACCCGCTTCAGCCGCCTGGGCAAGATCGGCATGGGCCGCGACTGGCTGATCTCCGACTG
CAACACCGGCGAGATCCTGGTGCGCGCCACCAGCGCCTACGCCATGATGAACCAGAAGACCCGCCGC
CTGTCCAAGCTGCCCTACGAGGTGCACCAGGAGATCGTGCCCCTGTTCGTGGACAGCCCCGTGATCG
AGGACTCCGACCTGAAGGTGCACAAGTTCAAGGTGAAGACCGGCGACAGCATCCAGAAGGGCCTGAC
CCCCGGCTGGAACGACCTGGACGTGAACCAGCACGTGTCCAACGTGAAGTACATCGGCTGGATCCTG
GAGAGCATGCCCACCGAGGTGCTGGAGACCCAGGAGCTGTGCTCCCTGGCCCTGGAGTACCGCCGCG
AGTGCGGCCGCGACTCCGTGCTGGAGAGCGTGACCGCCATGGACCCCAGCAAGGTGGGCGTGCGCTC
CCAGTACCAGCACCTGCTGCGCCTGGAGGACGGCACCGCCATCGTGAACGGCGCCACCGAGTGGCGC
CCCAAGAACGCCGGCGCCAACGGCGCCATCTCCACCGGCAAGACCAGCAACGGCAACTCCGTGTCCA
TGGACTACAAGGACCACGACGGCGACTACAAGGACCACGACATCGACTACAAGGACGACGACGACAA
GTGA
SEQ ID NO: 82-nucleic acid sequence for D3130 (pSZ4335); Algal
transit peptide represented with lower case, FLAG epitope tag with
underline and the portion of N-terminal specificity domain that was
mutated relative to the wild-type ChFATB2 (D3042, pSZ4243)
highlighted with bolded text
matastfsafnarcgdlrrsagsgprrparplpyrgraSSLSPSFKPKSIPNGGFQVKANDSAHPKA
NGSAVSLKSGSLNTQEDTSSSPPPRTFLHQLPDWSRLLTAITTVFVKSKRPDMHDRKSKRPDMLVDS
FGLESTVQDGLVFRQSFSIRSYEIGTDRTASIETLMNYLQETSLNHCKSTGILLDGFGRTPEMCKRD
LIWVVIKMQIKVNRYPAWGDTVEINTRFSRLGKIGMGRDWLISDCNTGEILVRATSAYAMMNQKTRR
LSKLPYEVHQEIVPLFVDSPVIEDSDLKVHKFKVKTGDSIQKGLTPGWNDLDVNQHVSNVKYIGWIL
ESMPTEVLETQELCSLALEYRRECGRDSVLESVTAMDPSKVGVRSQYQHLLRLEDGTAIVNGATEWR
PKNAGANGAISTGKTSNGNSVSMDYKDHDGDYKDHDIDYKDDDDK
SEQ ID NO: 83-amino acid sequence for D3131 (pSZ4336); Algal
transit peptide represented with lower case, FLAG epitope tag with
underline and the portion of N-terminal specificity domain that was
mutated relative to the wild-type ChFATB2 (D3042, pSZ4243)
highlighted with bolded text
atggccaccgcatccactttctcggcgttcaatgcccgctgcggcgacctgcgtcgctcggcgggct
ccgggccccggcgcccagcgaggcccctccccgtgcgcgggcgcgccTCCAGCCTGAGCCCCTCCTT
CAAGCCCAAGTCCATCCCCAACGGCGGCTTCCAGGTGAAGGCCAACGACAGCGCCCACCCCAAGGCC
AACGGCTCCGCCGTGAGCCTGAAGAGCGGCAGCCTGAACACCCAGGAGGACACCTCCTCCAGCCCCC
CCCCCCGCACCTTCCTGCACCAGCTGCCCGACTGGAGCCGCCTGCTGACCGCCATCACCACCGTGTT
CGTGAAGTCCAAGCGCCCCGACATGCACGACCGCAAGTCCAAGCGCCCCGACATGCTGGTGGACAGC
TTCGGCCTGGAGTCCACCGTGCAGGACGGCCTGGTGTTCCGCCAGTCCTTCTCCATCCGCTCCTACG
AGATCGGCACCGACCGCACCGCCAGCATCATGGCCGTGATGAACCACCTGCAGGAGGCCGCCCGCAA
CCACGCCGAGTCCCTGGGCCTGCTGGGCGACGGCTTCGGCGAGACCCTGGAGATGTCCAAGCGCGAC
CTGATCTGGGTGGTGATCAAGATGCAGATCAAGGTGAACCGCTACCCCGCCTGGGGCGACACCGTGG
AGATCAACACCCGCTTCAGCCGCCTGGGCAAGATCGGCATGGGCCGCGACTGGCTGATCTCCGACTG
CAACACCGGCGAGATCCTGGTGCGCGCCACCAGCGCCTACGCCATGATGAACCAGAAGACCCGCCGC
CTGTCCAAGCTGCCCTACGAGGTGCACCAGGAGATCGTGCCCCTGTTCGTGGACAGCCCCGTGATCG
AGGACTCCGACCTGAAGGTGCACAAGTTCAAGGTGAAGACCGGCGACAGCATCCAGAAGGGCCTGAC
CCCCGGCTGGAACGACCTGGACGTGAACCAGCACGTGTCCAACGTGAAGTACATCGGCTGGATCCTG
GAGAGCATGCCCACCGAGGTGCTGGAGACCCAGGAGCTGTGCTCCCTGGCCCTGGAGTACCGCCGCG
AGTGCGGCCGCGACTCCGTGCTGGAGAGCGTGACCGCCATGGACCCCAGCAAGGTGGGCGTGCGCTC
CCAGTACCAGCACCTGCTGCGCCTGGAGGACGGCACCGCCATCGTGAACGGCGCCACCGAGTGGCGC
CCCAAGAACGCCGGCGCCAACGGCGCCATCTCCACCGGCAAGACCAGCAACGGCAACTCCGTGTCCA
TGGACTACAAGGACCACGACGGCGACTACAAGGACCACGACATCGACTACAAGGACGACGACGACAA
GTGA
SEQ ID NO: 84-amino acid sequence for D3131 (pSZ4336); Algal
transit peptide represented with lower case, FLAG epitope tag with
underline and the portion of N-terminal specificity domain that was
mutated relative to the wild-type ChFATB2 (D3042, pSZ4243)
highlighted with bolded text
matastfsafnarcgdlrrsagsgprrparplpirgraSSLSPSFKPKSIPNGGFQVKANDSAHPKA
NGSAVSLKSGSLNTQEDTSSSPPPRTFLHQLPDWSRLLTAITTVFVKSKRPDMHDRKSKRPDMLVDS
FGLESTVQDGLVFRQSFSIRSYEIGTDRTASIMAVMNHLQEAARNHAESLGLLGDGFGETLEMSKRD
LIWVVIKMQIKVNRYPAWGDTVEINTRFSRLGKIGMGRDWLISDCNTGEILVRATSAYAMMNQKTRR
LSKLPYEVHQEIVPLFVDSPVIEDSDLKVHKFKVKTGDSIQKGLTPGWNDLDVNQHVSNVKYIGWIL
ESMPTEVLETQELCSLALEYRRECGRDSVLESVTAMDPSKVGVRSQYQHLLRLEDGTAIVNGATEWR
PKNAGANGAISTGKTSNGNSVSMDYKDHDGDYKDHDIDYKDDDDK

Claims

1. A nucleic acid molecule encoding a variant acyl-ACP thioesterase comprising a C-terminal catalytic domain, and an N-terminal hydrophobic domain and specificity domain, wherein one or more of the hydrophobic domain and/or the specificity domain are heterologous to the catalytic domain, wherein the hydrophobic domain comprises:

a) amino acid residues of an acyl-ACP-TE corresponding to an amino acid sequence selected from the group consisting of amino acid residues 61-77 of SEQ ID NO:43; amino acid residues 61-77 of SEQ ID NO:44; amino acid residues 85-101 of SEQ ID NO:45; amino acid residues 78-95 of SEQ ID NO:46; amino acid residues 50-66 of SEQ ID NO:47; amino acid residues 91-107 of SEQ ID NO:60; and amino acid residues 90-106 of SEQ ID NO:61;

b) a motif comprising the amino acid sequence (P/H)(G/D/V)(W/L)(S/N)(M/R/V)(P/L/S)(L/F)(E/A/T/S)(L/A/K)(I/V)TT(I/V)F(S/L/V/G)(A/K/V)(A/P);

c) at least 60% sequence identity to an amino acid sequence selected from the group consisting of amino acid residues 61-77 of SEQ ID NO:43; amino acid residues 61-77 of SEQ ID NO:44; amino acid residues 85-101 of SEQ ID NO:45; amino acid residues 78-95 of SEQ ID NO:46; amino acid residues 50-66 of SEQ ID NO:47; amino acid residues 91-107 of SEQ ID NO:60; and amino acid residues 90-106 of SEQ ID NO:61; and/or

d) amino acid residues 61-77 of SEQ ID NO:43; amino acid residues 61-77 of SEQ ID NO:44; amino acid residues 85-101 of SEQ ID NO:45; amino acid residues 78-95 of SEQ ID NO:46; amino acid residues 50-66 of SEQ ID NO:47; amino acid residues 91-107 of SEQ ID NO:60; or amino acid residues 90-106 of SEQ ID NO:61.

2. The nucleic acid of claim 1, wherein the nucleic acid encodes a variant acyl-acyl carrier protein (ACP) thioesterase (TE) comprising:

i) the specificity domain from a C10:0 acyl-ACP preferring TE and a catalytic domain from a C12:0 acyl-ACP preferring TE;

ii) the specificity domain from a C12:0 acyl-ACP preferring TE and a catalytic domain from a C14:0 acyl-ACP preferring TE;

iii) the specificity domain from a C14:0 acyl-ACP preferring TE and a catalytic domain from a C12:0 acyl-ACP preferring TE;

iv) the specificity domain from a C12:0 acyl-ACP preferring TE and a catalytic domain from a C10:0 acyl-ACP preferring TE; or

v) the specificity domain from a C10:0 acyl-ACP preferring TE and a catalytic domain from a C8:0 acyl-ACP preferring TE.

3-11. (canceled)

12. The nucleic acid of claim 1, wherein the nucleic acid encodes a hydrophobic domain that comprises an N-terminal Leucine residue.

13. A nucleic acid of claim 1, wherein the nucleic acid further encodes an N-terminal sequence encoding a plastid transit peptide.

14-15. (canceled)

16. The nucleic acid of claim 1, wherein the nucleic acid further encodes a linker domain positioned N-terminal to the hydrophobic domain.

17-18. (canceled)

19. A nucleic acid of claim 1, comprising codon bias for improved expression in an algal host cell.

20. An expression cassette comprising the nucleic acid of claim 1.

21. A vector comprising the nucleic acid of claim 1.

22. A variant acyl-acyl carrier protein (ACP) thioesterase (TE) encoded by the nucleic acid of claim 1.

23. A host cell comprising the nucleic acid of claim 1.

24-32. (canceled)

33. A plant, algae or microalgae comprising the nucleic acid of claim 1.

34-35. (canceled)

36. An oil product produced by the plant, algae or microalgae of claim 33, or a chemical, material, or food product produced from that oil.

37. A method of producing a plant, an algae or a microalgae that produces an oil having a desired fatty acid profile, comprising transforming the plant, algae or microalgae with a nucleic acid sequence of claim 1, and cultivating the plant, algae or microalgae so as to produce the oil.

38-41. (canceled)

42. A method of producing an oil, comprising transforming the plant, algae or microalgae with a nucleic acid molecule of claim 1, expressing the variant acyl-ACP TE to produce fatty acids, and recovering the oil produced by the plant, algae or microalgae comprising the fatty acids.

43. A method of producing an oil, comprising culturing the plant, algae or microalgae of claim 1, expressing the variant acyl-ACP TE to produce fatty acids, and recovering the oil produced by the plant, algae or microalgae comprising the fatty acids.

Resources

Images & Drawings included:

Sources:

Similar patent applications:

Recent applications in this class:

Recent applications for this Assignee: