Patent application title:

PROTEASE-RESISTANT LIPIDATED GLP-1 ANALOGS

Publication number:

US20200079833A1

Publication date:
Application number:

16/521,662

Filed date:

2019-07-25

Abstract:

The present invention provides protease-resistant peptides, methods of making such peptides, as well as compositions comprising protease-resistant peptides and method of treatment utilizing such peptides. A combination of lipidation of certain amino acid residues and substituition of alpha-methyl functionalized amino acids for natural amino acids has been determined to produce protease-resistant peptides.

Inventors:

Interested in similar patents?

Get notified when new applications in this technology area are published.

Classification:

C07K14/605 »  CPC main

Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans; Hormones Glucagons

A61K38/26 »  CPC further

Medicinal preparations containing peptides; Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans; Hormones Glucagons

A61K47/60 »  CPC further

Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an organic macromolecular compound, e.g. an oligomeric, polymeric or dendrimeric molecule obtained otherwise than by reactions only involving carbon-to-carbon unsaturated bonds, e.g. polyureas or polyurethanes the organic macromolecular compound being a polyoxyalkylene oligomer, polymer or dendrimer, e.g. PEG, PPG, PEO or polyglycerol

A61K45/06 »  CPC further

Medicinal preparations containing active ingredients not provided for in groups  -  Mixtures of active ingredients without chemical characterisation, e.g. antiphlogistics and cardiaca

A61K38/28 »  CPC further

Medicinal preparations containing peptides; Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans; Hormones Insulins

Description

CROSS-REFERENCE TO RELATED APPLICATIONS

This application is a continuation application of U.S. application Ser. No. 15/579,774, filed Dec. 5, 2017, said U.S. application Ser. No. 15/579,774 is a U.S. National Stage application of International Application No. PCT/EP2016/063206 filed Jun. 9, 2016, said International Application Number PCT/EP2016/063206 claims priority under 35 U.S.C. § 119 to U.S. Provisional Application Ser. No. 62/173,631, filed Jun. 10, 2015, and U.S. Provisional Application Ser. No. 62/343,390, filed May 31, 2016 each of which are incorporated herein by reference in their entirety.

REFERENCE TO SEQUENCE LISTING SUBMITTED ELECTRONICALLY

The content of the electronically submitted sequence listing in ASCII text file (Name: ORPEP-101WO1_SL.txt; Size: 828,674 bytes; and Date of Creation: Jul. 22, 2019) filed with the application is incorporated herein by reference in its entirety.

BACKGROUND

The present disclosure provides protease-resistant peptides, methods of making such peptides, as well as compositions comprising protease-resistant peptides and methods of treatment utilizing such peptides. Lipid modification of amino acids at certain positions in the peptide sequence is described herein.

The development of long-acting peptide therapeutics is hampered by factors such as short plasma half-life and poor oral bioavailability, largely a result of the natural susceptibility of peptides to enzymatic degradation. The majority of proteolytic functions are necessary, including regulating essential biomolecular processes such as turning off peptide signaling events at cell surfaces, or the gastric breakdown of proteins and peptides during digestion. Thus, the activity of the responsible proteases cannot simply be inhibited without, in many cases, causing other metabolic disturbances.

In order to overcome degradation, increasing the enzymatic resistance of a peptide of interest is therefore desirable. Generally, two methods are utilized to increase enzymatic resistance: sequence specific modifications, e.g., those affecting the primary structure of the peptide itself; and globally effective modifications, e.g., those which alter certain overall physicochemical characteristics of the peptide. Introduced strategically, such modifications can reduce the effects of natural physiological processes which would otherwise eliminate or inactivate a peptide whose action is desired, e.g. enzymatic degradation and/or clearance by renal ultrafiltration.

Sequence specific modifications include incorporation of proteolysis-resistant unusual amino acids, or more involved modifications including cyclization between naturally occurring side-chain functions, e.g. disulfide formation (Cys-Cys), or lactamization (Lys-Glu or Lys-Asp). Additional modifications include cyclization between unnatural amino acid surrogates within the peptide backbone e.g. olefin metathesis stapling.

Global modifications include processes such as peptide lipidation e.g. palmitoylation and/or PEGylation. Palmitoylation has the effect of creating a circulating reservoir of peptide which reversibly associates with naturally abundant albumin in blood serum. Peptide associated with albumin effectively escapes renal ultrafiltration since the size of the associated complex is above the glomerular filtration cutoff. As the peptide dissociates from the surface of the albumin it is again free to interact with endogenous receptors. PEGylation has the effect of physically shielding the peptide from proteolysis and imparts significant hydrophilicity which upon hydration greatly increases the hydrodynamic radius of the therapeutic molecule to overcome renal clearance.

While these technologies can be broadly applicable to therapeutic peptides in general, and to an extent are able to extend circulatory half-life, a need still exists for methods of increasing stability of peptides and proteins to enzymatic degradation, particularly in light of the desire to produce peptides suitable for oral administration.

SUMMARY

The present disclosure provides for an isolated polypeptide comprising the amino acid sequence: H X2E G S X6 T S D V X11 X12 X13 L E G E A A X20 E X22 I X24 X25 V V X28 G G (SEQ ID NO: 2) wherein X2 is A or Aib, X6 is F or an alpha-methyl functionalized amino acid, X11 is S or an alpha-methyl functionalized amino acid, X12 is S or a lipid modified K, X13 is Y or an alpha-methyl functionalized amino acid, X20 is a lipid modified K, K, or an alpha-methyl functionalized amino acid, X22 is F or an alpha-methyl functionalized amino acid, X24 is A or a lipid modified K; X25 is W or an alpha-methyl functionalized amino acid, and X28 is K, E, or an alpha-methyl functionalized amino acid, wherein the polypeptide is lipidated on only one of X12, X20, or X24.

In certain embodiments, a peptide comprising the amino acid sequence of SEQ ID NO: 2 comprises a C-terminal amide. In certain embodiments, a peptide comprising the amino acid sequence of SEQ ID NO: 2 comprises a C-terminal acid.

In certain embodiments of a peptide comprising the amino acid sequence of SEQ ID NO: 2, X2 is Aib. In certain embodiments of a peptide comprising the amino acid sequence of SEQ ID NO: 2, the lipid modified K is selected from the group consisting of: K(ε-(PEG)2-(PEG)2-γE-Stearate), K(ε-γE-Palmitoyl), K(ε-(PEG)2-(PEG)2-(PEG)2-Stearoyl), K(ε-γE-Lauroyl), K(ε-γE-γE-Lauroyl), K(ε-γE-γE-γE-Lauroyl), K(ε-Ahx-Lauroyl), K(ε-Ahx-Ahx-Lauroyl), K(ε-Ahx-Ahx-Ahx-Lauroyl), K(ε-(PEG)2-Lauroyl), K(ε-(PEG)2-(PEG)2-Lauroyl), K(ε-(PEG)2-(PEG)2-(PEG)2-Lauroyl), K(ε-γE-12-(4-carboxyphenoxy)dodecanoyl), K(ε-γE-γE-12-(4-carboxyphenoxy)dodecanoyl), K(ε-γE-γE-γE-12-(4-carboxyphenoxy)dodecanoyl), K(ε-Ahx-12-(4-carboxyphenoxy)dodecanoyl), K(ε-Ahx-Ahx-12-(4-carboxyphenoxy)dodecanoyl), K(ε-Ahx-Ahx-Ahx-12-(4-carboxyphenoxy)dodecanoyl), K(ε-(PEG)2-12-(4-carboxyphenoxy)dodecanoyl), K(ε-(PEG)2-(PEG)2-12-(4-carboxyphenoxy)dodecanoyl), K(ε-(PEG)2-(PEG)2-(PEG)2-12-(4-carboxyphenoxy)dodecanoyl), K(ε-γE-Stearoyl), K(ε-γE-γE-Stearoyl), K(ε-γE-γE-γE-Stearoyl), K(ε-Ahx-Stearoyl), K(ε-Ahx-Ahx-Stearoyl), K(ε-Ahx-Ahx-Ahx-Stearoyl), K(ε-(PEG)2-Stearoyl), K(ε-(PEG)2-(PEG)2-Stearoyl), K(ε-(PEG)2-(PEG)2-(PEG)2-Stearoyl), K(ε-γE-Stearate), K(ε-γE-γE-Stearate), K(ε-γE-γE-γE-Stearate), K(ε-Ahx-Stearate), K(ε-Ahx-Ahx-Stearate), K(ε-Ahx-Ahx-Ahx-Stearate), K(ε-(PEG)2-Stearate), K(ε-(PEG)2-(PEG)2-Stearate), K(ε-(PEG)2-(PEG)2-(PEG)2-Stearate), and any combination thereof. In certain embodiments, the lipid modified K is K(ε-(PEG)2-(PEG)2-γE-Stearate).

In certain embodiments of a peptide comprising the amino acid sequence of SEQ ID NO: 2, X6 is α-MeF, X11 is α-MeS, X13 is α-MeF, X22 is α-MeF, X25 is α-MeF, X28 is α-MeK, or any combination thereof. In certain embodiments, X2 is Aib, X6 is α-MeF, X11 is α-MeS, X13 is α-MeF, X20 is K(ε-(PEG)2-(PEG)2-γE-Stearate), X22 is α-MeF, X25 is α-MeF, and X28 is α-MeK (SEQ ID NO: 3). In certain embodiments, the peptide comprises the amino acid sequence of SEQ ID NO: 48, SEQ ID NO: 60, or SEQ ID NO: 68.

In certain embodiments of a peptide comprising the amino acid sequence of SEQ ID NO: 2, the polypeptide is substantially resistant to proteolytic degradation. In certain embodiments, the polypeptide is substantially resistant to DPP-IV, neprilysin, α-chymotrypsin, plasmin, thrombin, kallikrein, trypsin, elastase and/or pepsin degradation. In certain embodiments, the polypeptide at least maintains substantially the same receptor potency as a corresponding non-lipidated polypeptide. In certain embodiments, the polypeptide at least maintains substantially the same receptor selectivity as a corresponding non-lipidated polypeptide. In certain embodiments, the polypeptide exhibits increased receptor potency over a corresponding non-lipidated polypeptide.

The present disclosure also provides for an isolated polypeptide comprising the amino acid sequence: H X2 E G X5 X6 T S D X10 X11 X12 X13 X14 E G X17 A A X20 E X22 I X24 X25 X26 V X28 G X30 (SEQ ID NO: 4); wherein X2 is A or Aib, X5 is T or S, X6 is F or an alpha-methyl functionalized amino acid, X10 is V or a lipid modified K, X11 is S or an alpha-methyl functionalized amino acid, X12 is S or a lipid modified K, X13 is Y, F, or a lipid modified K, X14 is L or a lipid modified K, X17 is Q or E, X20 is K, E, or an alpha-methyl functionalized amino acid, X22 is F, norleucine, tyrosine methyl ester, or an alpha-methyl functionalized amino acid, X24 is A or a lipid modified K, X25 is W, F, or a lipid modified K, X26 is L, V, or a lipid modified K, X28 is K or E, and X30 is R or G, wherein the polypeptide comprises two lipid modified K residues, and wherein one of X10, X12, X13, or X14 is a lipid modified K residue and one of X24, X25, or X26 is a lipid modified K residue. In certain embodiments: X6 is F, α-MeF, α-MeS, or α-MeK; X11 is S α-MeF, α-MeS, or α-MeK; and X20 is K, E, α-MeF, α-MeS, or α-MeK.

In certain embodiments, a peptide comprising the amino acid sequence of SEQ ID NO: 4 comprises a C-terminal amide. In certain embodiments, a peptide comprising the amino acid sequence of SEQ ID NO: 4 comprises a C-terminal acid.

In certain embodiments of a peptide comprising the amino acid sequence of SEQ ID NO: 4, X2 is Aib. In certain embodiments, the two lipid modified K residues are the same or are different, and are selected from the group consisting of: K(ε-(PEG)2-(PEG)2-γE-Lauroyl), K(ε-(PEG)2-(PEG)2-γE-Palmitate), K(ε-(PEG)2-(PEG)2-γE-Myristoyl), K(ε-(PEG)2-(PEG)2-γE-Palmitoyl), K(ε-(PEG)2-(PEG)2-γE-Stearoyl), K(ε-(PEG)2-(PEG)2-γE-Stearate), and any combination thereof. In certain embodiments, the two lipid modified K residues are both K(ε-(PEG)2-(PEG)2-γE-Lauroyl), both K(ε-(PEG)2-(PEG)2-γE-Palmitate), both K(ε-(PEG)2-(PEG)2-γE-Myristoyl), both K(ε-(PEG)2-(PEG)2-γE-Palmitoyl), both K(ε-(PEG)2-(PEG)2-γE-Stearoyl), or both K(ε-(PEG)2-(PEG)2-γE-Stearate).

In certain embodiments of a peptide comprising the amino acid sequence of SEQ ID NO: 4, X10 is a lipid modified K and one of X24, X25, or X26 is a lipid modified K. In certain embodiments, X12 is a lipid modified K and one of X24, X25, or X26 is a lipid modified K. In certain embodiments, X13 is a lipid modified K and one of X24, X25, or X26 is a lipid modified K. In certain embodiments, X14 is a lipid modified K and one of X24, X25, or X26 is a lipid modified K. In certain embodiments, X24 is a lipid modified K and one of X10, X12, X13, or X14 is a lipid modified K. In certain embodiments, X25 is a lipid modified K and one of X10, X12, X13, or X14 is a lipid modified K. In certain embodiments, X26 is a lipid modified K and one of X10, X12, X13, or X14 is a lipid modified K.

In certain embodiments of a peptide comprising the amino acid sequence of SEQ ID NO: 4: X6 is α-MeF, X11 is α-MeS, X20 is α-MeK, X6 is α-MeF and X11 is α-MeS, X6 is α-MeF and X20 is α-MeK, X11 is α-MeS, and X20 is α-MeK or X6 is α-MeF, X11 is α-MeS, and X20 is α-MeK. In certain embodiments, X13 is a lipid modified K and one of X24, X25, or X26 is a lipid modified K. In certain embodiments, X14 is a lipid modified K and one of X24, X25, or X26 is a lipid modified K. In certain embodiments, X5 is S. In certain embodiments, X17 is E, X28 is E, and X30 is G. In certain embodiments, the polypeptide comprises the amino acid sequence of SEQ ID NO: 252; SEQ ID NO: 263; SEQ ID NO: 269; SEQ ID NO: 405; SEQ ID NO: 408; SEQ ID NO: 409; or SEQ ID NO: 410.

The present disclosure also provides for an isolated polypeptide comprising the amino acid sequence: H (Aib) E G S (α-MeF) T S D X10 X11 X12 X13 X14 E X16 X17 X18 A (α-MeK) X21 F I X24 X25 X26 V E G G (SEQ ID NO: 487), wherein X10 is V or a lipid modified K; X11 is S or an alpha-methyl functionalized amino acid; X12 is S or a lipid modified K; X13 is Y or a lipid modified K; X14 is L or a lipid modified K; X16 is G or a lipid modified K; X17 is E or a lipid modified K; X18 is A or a lipid modified K; X21 is E or a lipid modified K; X24 is A or a lipid modified K; X25 is F or a lipid modified K; X26 is V or a lipid modified K; and wherein the polypeptide comprises three lipid modified K residues, and wherein one of X10, X12, X13, or X14 is a lipid modified K residue and one of X16, X17, X18, or X21 is a lipid modified K residue and one of X24, X25, or X26 is a lipid modified K residue.

In certain embodiments, a peptide comprising the amino acid sequence of SEQ ID NO: 487 comprises a C-terminal amide. In certain embodiments, a peptide comprising the amino acid sequence of SEQ ID NO: 487 comprises a C-terminal acid.

In certain embodiments, the lipid modified K residues can be attached to a variety of lipids or lipid moieties such as any of those described herein. In certain embodiments, examples include those selected from the group consisting of: K(ε-(PEG)2-(PEG)2-γE-Lauroyl); K(ε-(PEG)2-(PEG)2-γE-Palmitate); K(ε-(PEG)2-(PEG)2-γE-Myristoyl); K(ε-(PEG)2-(PEG)2-γE-Palmitoyl); K(ε-(PEG)2-(PEG)2-γE-Stearoyl); K(ε-(PEG)2-(PEG)2-γE-Stearate); and any combination thereof. In other embodiments, the lipid modification of the K residues can be the same or different. In certain embodiments, they are the same. Thus, in certain embodiments, at least three lipid modified K residues can all be K(ε-(PEG)2-(PEG)2-γE-Lauroyl); all be K(ε-(PEG)2-(PEG)2-γE-Palmitate); all be K(ε-(PEG)2-(PEG)2-γE-Myristoyl); all be K(ε-(PEG)2-(PEG)2-γE-Palmitoyl); all be K(ε-(PEG)2-(PEG)2-γE-Stearoyl); or all be K(ε-(PEG)2-(PEG)2-γE-Stearate). In certain embodiments of a peptide comprising the amino acid sequence of SEQ ID NO: 487: all modified residues can be K(ε-(PEG)2-(PEG)2-γE-Lauroyl); all can be K(ε-(PEG)2-(PEG)2-γE-Palmitate); all can be K(ε-(PEG)2-(PEG)2-γE-Myristoyl); all can be K(ε-(PEG)2-(PEG)2-γE-Palmitoyl); all can be K(ε-(PEG)2-(PEG)2-γE-Stearoyl); or all can be K(ε-(PEG)2-(PEG)2-γE-Stearate).

In certain embodiments of a peptide comprising the amino acid sequence of SEQ ID NO: 4 or 487, the polypeptide is substantially resistant to proteolytic degradation. In certain embodiments, the synthetic peptide is substantially resistant to DPP-IV, neprilysin, α-chymotrypsin, plasmin, thrombin, kallikrein, trypsin, elastase and/or pepsin degradation. In certain embodiments, the polypeptide, which comprises two lipid modified K residues, at least maintains substantially the same receptor potency as a corresponding non-lipidated peptide. In certain embodiments, the polypeptide, which comprises two lipid modified K residues, at least maintains substantially the same receptor selectivity as a corresponding non-lipidated peptide. In certain embodiments, the polypeptide, which comprises two lipid modified K residues, exhibits increased receptor potency over a corresponding non-lipidated polypeptide.

Provided herein are lipidated peptidse that can bind to a human GLP-1 receptor with an EC50 in the cAMP assay less than 5000 pM, less than 2500 pM, less than 1000 pM, less than 900 pM, less than 800 pM, less than 700 pM, less than 600 pM, less than 500 pM, less than 400 pM, less than 300 pM, less than 200 pM, less than 100 pM, less than 50 pM, less than 25 pM, less than 20 pM, less than 15 pM, less than 10 pM, less than 5 pM, less than 4 pM, less than 3 pM, or less than 2 pM.

The disclosure also provides for isolated polynucleotides encoding any of the lipidted polypeptide described herein. Certain embodiments provide for vectors comprising such polynucleotides. Certain embodiments provide for host cells comprising such nucleotides or vectors.

Certain embodiments provide for methods of making a lipidated polypeptide described herein. In certain embodiments, the method comprises culturing a host cell under conditions allowing expression of the peptide, and recovering the peptide.

Certain embodiments provide for pharmaceutical compositions comprising a lipidated polypeptide described in detail elsewhere herein. In certain embodiments, a kit comprises such composition.

Certain embodiments provide for methods of treating or preventing a disease or condition caused or characterized by hypoglycemia or impaired insulin release. Such methods comprise administering to a subject in need of treatment an effective amount of a lipidated polypeptide described in detail elsewhere herein or as pharmaceutical composition comprising such polypeptide. In certain embodiments, the disease or condition is diabetes. In certain embodiments, the disease or condition is type-2 diabetes. In certain embodiments, the administration further improves glycemic control, provides body weight control, improves β-cell function and mass, reduces the rate of gastric acid secretion and gastric emptying, or any combination thereof. In certain embodiments, the polypeptide or the pharmaceutical composition is administered orally or by injection. In certain embodiments, the polypeptide or the pharmaceutical composition is administered orally. In certain embodiments, the injection is administered subcutaneously or intravenously. In certain embodiments, the peptide or the pharmaceutical composition is administered once per day. In certain embodiments, methods of treating or preventing a disease or condition further comprise administering one or more additional therapies. In certain embodiments, the additional therapy comprises blood sugar monitoring, diet modifications, exercise, insulin, a thiazolidinedione, a sulfonylurea, an incretin, metformin, a glyburide, a dipeptidyl peptidase 4 inhibitor, a bile acid sequestrant, or any combination thereof. In certain embodiments, the subject treated is a human.

BRIEF DESCRIPTIONS OF THE DRAWINGS

FIG. 1 shows representative lipid, lipid moieties, and linkers for forming lipidated polypeptides disclosed herein.

FIG. 2 shows the percent peptide remaining of 100 μg of peptide hydrolysed by 100 μg/mL Neprilysin at pH 8.3.

FIG. 3 shows the percent peptide remaining of 100 μg of peptide hydrolysed by 200 μg/mL Pepsin, 100 mM HCl at pH 2.

FIG. 4 shows the percent peptide remaining of 100 μg of peptide hydrolysed by 150 μg/mL Trypsin at pH 8.1.

FIG. 5 shows the percent peptide remaining of 100 μg of peptide hydrolysed by 100 μg/mL Chymotrypsin at pH 8.

FIG. 6 shows the percent peptide remaining of 1000 μg of peptide hydrolysed by 100 μg/mL fresh SIF/Pancreatin® at pH 6.8.

FIG. 7 shows the mean values from a triplicate run of the percent peptide remaining of 1000 μg of peptide hydrolysed by 100 μg/mL fresh SIF/Pancreatin® (with Enterokinase) at pH 6.8.

FIG. 8 shows the chemical structure, chemical formula and molecular weight for SEQ ID NO:3 and SEQ ID NO:17.

FIG. 9 shows the FIG. 9 shows the chemical structure, chemical formula and molecular weight for SEQ ID NO:48 and SEQ ID NO:60.

FIG. 10 shows the chemical structure, chemical formula and molecular weight for SEQ ID NO:68 and SEQ ID NO:252.

FIG. 11 shows the chemical structure, chemical formula and molecular weight for SEQ ID NO:263 and SEQ ID NO:269.

FIG. 12 shows the chemical structure, chemical formula and molecular weight for SEQ ID NO:405 and SEQ ID NO:406.

FIG. 13 shows the chemical structure, chemical formula and molecular weight for SEQ ID NO:407 and SEQ ID NO:408.

FIG. 14 shows the chemical structure, chemical formula and molecular weight for SEQ ID NO:409 and SEQ ID NO:410.

FIG. 15 shows the chemical structure, chemical formula and molecular weight for SEQ ID NO:488 and SEQ ID NO:489.

FIG. 16 shows the chemical structure, chemical formula and molecular weight for SEQ ID NO:490 (Liraglutide) and SEQ ID NO:491 (Semaglutide)

DETAILED DESCRIPTION

It should be appreciated that the particular implementations shown and described herein are examples and are not intended to otherwise limit the scope of the application in any way.

The published patents, patent applications, websites, company names, and scientific literature referred to herein are hereby incorporated by reference in their entirety to the same extent as if each was specifically and individually indicated to be incorporated by reference. Any conflict between any reference cited herein and the specific teachings of this specification shall be resolved in favor of the latter. Likewise, any conflict between an art-understood definition of a word or phrase and a definition of the word or phrase as specifically taught in this specification shall be resolved in favor of the latter.

As used in this specification, the singular forms “a,” “an” and “the” specifically also encompass the plural forms of the terms to which they refer, unless the content clearly dictates otherwise. The term “about” is used herein to mean approximately, in the region of, roughly, or around. When the term “about” is used in conjunction with a numerical range, it modifies that range by extending the boundaries above and below the numerical values set forth. In general, the term “about” is used herein to modify a numerical value above and below the stated value by a variance of 20%.

Furthermore, “and/or” where used herein is to be taken as specific disclosure of each of the two specified features or components with or without the other. Thus, the term “and/or” as used in a phrase such as “A and/or B” herein is intended to include “A and B,” “A or B,” “A” (alone), and “B” (alone). Likewise, the term “and/or” as used in a phrase such as “A, B, and/or C” is intended to encompass each of the following aspects: A, B, and C; A, B, or C; A or C; A or B; B or C; A and C; A and B; B and C; A (alone); B (alone); and C (alone).

It is understood that wherever aspects are described herein with the language “comprising,” otherwise analogous aspects described in terms of “consisting of” and/or “consisting essentially of” are also provided.

Technical and scientific terms used herein have the meaning commonly understood by one of ordinary skill in the art to which the present application pertains, unless otherwise defined. Reference is made herein to various methodologies and materials known to those of skill in the art. Standard reference works setting forth the general principles of peptide synthesis include W. C. Chan and P. D. White, “Fmoc Solid Phase Peptide Synthesis: A Practical Approach”, Oxford University Press, Oxford (2004).

Units, prefixes, and symbols are denoted in their Système International de Unites (SI) accepted form. Numeric ranges are inclusive of the numbers defining the range. Unless otherwise indicated, amino acid sequences are written left to right in amino to carboxy orientation. The headings provided herein are not limitations of the various aspects of the disclosure, which can be had by reference to the specification as a whole. Accordingly, the terms defined immediately below are more fully defined by reference to the specification in its entirety.

The terms “polypeptide,” “peptide,” “protein,” and “protein fragment” are used interchangeably herein to refer to a polymer of amino acid residues. The terms apply to amino acid polymers in which one or more amino acid residue is an artificial chemical mimetic of a corresponding naturally occurring amino acid, as well as to naturally occurring amino acid polymers and non-naturally occurring amino acid polymers.

The term “amino acid” refers to naturally occurring and synthetic amino acids, as well as amino acid analogs and amino acid mimetics that function similarly to the naturally occurring amino acids. Naturally occurring amino acids are those encoded by the genetic code, as well as those amino acids that are later modified, e.g., hydroxyproline, gamma-carboxyglutamate, and O-phosphoserine. Amino acid analogs refer to compounds that have the same basic chemical structure as a naturally occurring amino acid, e.g., an alpha carbon that is bound to a hydrogen, a carboxyl group, an amino group, and an R group, e.g., homoserine, norleucine, methionine sulfoxide, methionine methyl sulfonium. Such analogs can have modified R groups (e.g., norleucine) or modified peptide backbones, but retain the same basic chemical structure as a naturally occurring amino acid. Amino acid mimetics refer to chemical compounds that have a structure that is different from the general chemical structure of an amino acid, but that function similarly to a naturally occurring amino acid. The terms “amino acid” and “amino acid residue” are used interchangeably throughout.

The terms “fragment,” “analog,” “derivative,” or “variant” when referring to a lipidated peptide as provided herein includes any peptide that retains at least some activity of a corresponding native peptide, e.g., GLP-1. As used herein, the term “lipidated GLP-1 peptide analog” refers to, e.g., a synthetic peptide comprising one or more lipidated amino acids, e.g., to render the peptide protease resistant, while still maintaining at least some of the GLP-1 activities of a native GLP-1 peptide. Chemical modifications intended to improve metabolic stability of peptides can involve additional chemical manipulation following synthesis of the main peptide chain. Examples of manipulation include lactamization, disulfide bridge closure, lipidation and/or PEGylation.

The terms “lipid modified amino acid” and “lipidated amino acid” are used interchangeably herein, and refer to an amino acid, typically a lysine or cysteine, which has a lipid moiety attached. The terms “lipidated polypeptide,” “lipoprotein,” and the like refer to a peptide or polypeptide that includes one or more lipid modified amino acids. FIG. 1 illustrates various representative examples of lipids, lipid moieties, and linkers.

The terms “composition” or “pharmaceutical composition” refer to compositions containing a peptide or polypeptide provided herein, along with e.g., pharmaceutically acceptable carriers, excipients, or diluents for administration to a subject in need of treatment.

The term “pharmaceutically acceptable” refers to compositions that are, within the scope of sound medical judgment, suitable for contact with the tissues of human beings and animals without excessive toxicity or other complications commensurate with a reasonable benefit/risk ratio.

An “effective amount” is that amount of a peptide or polypeptide provided herein, the administration of which to a subject, either in a single dose or as part of a series, is effective for treatment.

The term “subject” is meant any subject, particularly a mammalian subject, in need of treatment with a peptide or polypeptide provided herein. Mammalian subjects include, but are not limited to, humans, dogs, cats, guinea pigs, rabbits, rats, mice, horses, cattle, bears, cows, apes, monkeys, orangutans, and chimpanzees, and so on. In one aspect, the subject is a human subject.

Provided herein are compositions and methods that address the natural enzymatic liabilities of peptides. By lipidating selected amino acid residues, peptides are provided that demonstrate increased resistance to enzymatic degradation, while still maintaining substantially the same or exhibiting increased receptor potency and selectivity as a wild-type peptide.

Peptides Demonstrating Protease Resistance

This disclosure provides lipidated peptides with improved protease resistance and increased potency. Improvements in protease resistance and potency can be associated with the position of the lipidation on the peptide. Lipidation can include carboxyl- or amino-terminal lipidation, or main-chain lipidation. In certain embodiments, the modification is of a main-chain amino acid residue. In certain embodiments, improvements in protease resistance and increased potency are associated with the selective and strategic position of the lipidation of one or more main-chain amino acid residues. Methods of preparing peptides with lipid modified amino acids are known in the art.

In certain embodiments, a lipidated peptide comprising at least one lipidated amino acid residue is provided. In certain embodiments, the lipidated peptide comprises at least two lipidated amino acid residues. In certain embodiments, the lipidated peptide contains only one lipidated amino acid residue. As used herein, a peptide with one lipid or lipid moiety attached is referred to as a mono-lipidated peptide. In other embodiments, the lipidated peptide contains two lipidated amino acid residues. As used herein, a peptide with two lipids or lipid moieties attached is referred to as a bis-lipidated peptide.

In certain embodiments, the lipidated peptide is a synthetic peptide. See International Patent Application No. PCT/EP2014/077240, published as WO2015/086686A2, which is incorporated by reference herein in its entirety. In certain embodiments, the lipidated synthetic peptide comprises at least one substitution of an alpha-methyl functionalized amino acid for a native amino acid residue. In other embodiments, a lipidated synthetic peptide comprises at least two, three, four, five, six, or more substitutions of alpha-methyl functionalized amino acids for native amino acid residues.

As described herein, “synthetic peptide” refers to a polymer of amino acid residues that has been generated by chemically coupling a carboxyl group or C-terminus of one amino acid to an amino group or N-terminus of another. Chemical peptide synthesis typically starts at the C-terminus of the peptide and ends at the N-terminus. Various methods for generating synthetic peptides are well known in the art.

As described herein “alpha-methyl functionalized amino acids” refer to amino acids in which the first (alpha) carbon atom of the amino acid includes a methyl group (CH3) substituent bound to the alpha carbon. Alpha-methyl functionalized amino acids include any of the naturally occurring twenty amino acids that include such a functionalization.

As described throughout, alpha-methyl functionalized amino acids can replace any native amino acid in a peptide. The term “native” amino acid refers to one of the standard 20 amino acids that exist in biologically generated proteins.

Substitution refers to the replacement of a native amino acid with, e.g., an alpha-functionalized amino acid. During chemical synthesis of a synthetic peptide, the native amino acid can be readily replaced by an alpha functionalized amino acid.

The synthetic peptides described herein can be of any length, e.g., any number of amino acids in length, e.g., about 5 amino acids to about 200 amino acids in length, about 10 amino acids to about 150 amino acids in length, about 20 amino acids to about 100 amino acids in length, about 30 amino acids to about 75 amino acids in length, or about 20 amino acids, about 30 amino acids, about 40 amino acids, about 50 amino acids, about 60 amino acids, about 70 amino acids, about 80 amino acids, about 90 amino acids, or about 100 amino acids in length.

Certain lipidated synthetic peptides described herein contain one or more alpha-functionalized amino acids substituted for native amino acids, while at least maintaining substantially the same or exhibiting increased receptor potency as a corresponding synthetic peptide that does not comprise the substitutions. Improvements in protease resistance and potency can be associated with the selective and strategic position of the lipidation and alpha-functionalized amino acids substituted amino acids on the peptide. In certain embodiments, synthetic peptides that at least maintain substantially the same or exhibit increased receptor potency and selectivity contain two or more alpha-functionalized amino acids substituted for native amino acids. In some embodiments, synthetic peptides that at least maintain substantially the same or exhibiting increased receptor potency and selectivity contain three four, five, six or more alpha-functionalized amino acids substituted for the native amino acids.

The term receptor “potency” refers to the inverse of the half maximum (50%) effective concentration (EC50) of the peptide. The EC50 refers to the concentration of peptide that induces a biological response halfway between the baseline response and maximum response, after a specified exposure time, for a selected target of the peptide. Thus, peptides exhibiting a small value for EC50 have a corresponding high receptor potency, while peptides exhibiting a large value for EC50 have a corresponding low receptor potency—the more peptide required to induce a response related to a receptor, the less potent the peptide is for that receptor.

Methods for determining the receptor potency and EC50 are known in the art and suitably involve determining stimulation of one or more cellular receptor responses. For example, suitable cell lines expressing GLP-1 receptor (GLP-1R), glucagon receptor (GCGR) or glucose-dependent insulinotropic peptide (gastric inhibitory polypeptide) receptor (GIPR) are generated by standard methods. Peptide activation of these various receptors results in downstream production of a cAMP second messenger which can be measured in a functional activity assay. From these measurements, EC50 values are readily determined.

As described throughout, lipidated peptides comprising one or more, e.g., one or two, attached lipids or lipid moieties and and substituition of alpha-methyl functionalized amino acids for the native amino acids can maintain “substantially the same” or exhibit increased receptor potency as compared to a corresponding peptide that does not comprise the lipids or lipid moieties or the non-natural amino acids. As used herein, “substantially the same” when referring to receptor potency, means that the lipidated peptide can exhibit, e.g., at least about 75% of the receptor potency, when the lipidated peptide is compared to the receptor potency of a corresponding peptide that is unlipidated or unlipidated and having different and/or fewer amino acid modifications, or other suitable comparator sequence (e.g., a control). In further embodiments, a lipidated peptide as provided herein can exhibit, e.g., about 80% of the receptor potency, about 85% of the receptor potency, about 90% of the receptor potency, about 91% of the receptor potency, about 92% of the receptor potency, about 93% of the receptor potency, about 94% of the receptor potency, about 95% of the receptor potency, about 96% of the receptor potency, about 97% of the receptor potency, about 98% of the receptor potency, about 99% of the receptor potency, about 99.1% of the receptor potency, about 99.2% of the receptor potency, about 99.3% of the receptor potency, about 99.4% of the receptor potency, about 99.5% of the receptor potency, about 99.6% of the receptor potency, about 99.7% of the receptor potency, about 99.8% of the receptor potency, about 99.9% of the receptor potency, or about 100% of the receptor potency, when the lipidated peptide is compared to the receptor potency of a corresponding peptide that is unlipidated or unlipidated and having different and/or fewer amino acid modification, or other suitable comparator sequence (e.g., a control). As used herein, “increased” when referring to receptor potency, means that the lipidated peptide exhibits greater receptor potency greater than the receptor potency of a corresponding peptide that is unlipidated or unlipidated and having different and/or fewer amino acid modifications, or other suitable comparator sequence (e.g., a control). In certain embodiments, increased receptor potency refers to, for example, 1% greater receptor potency, 2% percent greater receptor potency, 3% percent greater receptor potency, 4% percent greater receptor potency, 5% percent greater receptor potency, 6% percent greater receptor potency, 7% percent greater receptor potency, 8% percent greater receptor potency, 9% percent greater receptor potency, 10% percent greater receptor potency. In certain embodiments, increased receptor potency refers to for example, 1% to 10% greater receptor potency, 1% to 20% percent greater receptor potency, 1% to 30% percent greater receptor potency, 1% to 40% percent greater receptor potency, 1% to 50% percent greater receptor potency, 5% to 10% greater receptor potency, 5% to 20% percent greater receptor potency, 5% to 30% percent greater receptor potency, 5% to 40% percent greater receptor potency, 5% to 50% percent greater receptor potency, 10 to 50% percent greater receptor potency, 20 to 50% percent greater receptor potency, 30 to 50% percent greater receptor potency, 40% to 50% percent greater receptor potency, or 50% to 100% percent greater receptor potency.

As described throughout, a lipidated peptide as provided herein comprising one or more, e.g., one or two, attached lipids or lipid moieties and substituition of alpha-methyl functionalized amino acids for native amino acids can also at least maintain “substantially the same selectivity” as a corresponding peptide that does not comprise the lipid or lipid moiety or non-natural amino acids, or other suitable comparator sequence (e.g., a control), as described herein. As used herein, “selectivity,” refers to the ability of a peptide to bind its target (e.g., the agonist to which it is designed to bind) while not binding to other non-target proteins. A lipidated peptide as provided herein can exhibit “substantially the same selectivity” and thus exhibit, e.g., at least about 75% of the selectivity when the lipidated peptides are compared to the selectivity of peptides that do not comprise the lipid or lipid moiety, or other suitable comparator sequence (e.g., a control), as described herein. For example, a lipidated peptide as provided herein can exhibit about 80% of the selectivity, about 85% of the selectivity, about 90% of the selectivity, about 91% of the selectivity, about 92% of the selectivity, about 93% of the selectivity, about 94% of the selectivity, about 95% of the selectivity, about 96% of the selectivity, about 97% of the selectivity, about 98% the selectivity, about 99% of the selectivity, about 99.1% of the selectivity, about 99.2% of the selectivity, about 99.3% of the selectivity, about 99.4% of the selectivity, about 99.5% of the selectivity, about 99.6% of the selectivity, about 99.7% of the selectivity, about 99.8% of the selectivity, about 99.9% of the selectivity, or about 100% of the selectivity, when the lipidated peptide is compared to the selectivity of a corresponding peptide that does not comprise the lipid or lipid moiety, or other suitable comparator sequence (e.g., a control), as described herein. In certain embodiments, the selective and strategic incorporation of lipidation and/or alpha-methyl amino acids in GLP-1 analogues both increases GLP-1 receptor potency and accordingly, increases selectivity for this receptor.

In certain embodiments, a lipidated peptide as provided herein can also comprise one or more alpha-methyl functionalized amino acids corresponding to the substituted native amino acids in a corresponding wild-type protein. For example, the amino acid in the original, wild-type peptide sequence can be substituted with an alpha-methyl functionalized amino acid that has the same side chain, e.g., Phe, Trp, Tyr, Ser, Arg, Ala, Val, Leu, His, or Lys, can be substituted with α-MePhe, α-MeTrp, α-MeTyr, α-MeSer, α-MeArg, α-MeAla (Aib), α-MeVal, α-MeLeu, α-MeHis, or α-MeLys, respectively.

In certain embodiments, an alpha-methyl functionalized amino acid in a lipidated peptide as provided herein can correspond to the same class as the substituted native amino acids. For example, aliphatic alpha-methyl functionalized amino acids can be substituted for aliphatic native amino acids; hydroxyl alpha-methyl functionalized amino acids can be substituted for hydroxyl native amino acids; sulfur-containing alpha-methyl functionalized amino acids can be substituted for sulfur-containing native amino acids; cyclic alpha-methyl functionalized amino acids can be substituted for cyclic native amino acids; aromatic alpha-methyl functionalized amino acids can be substituted for aromatic native amino acids; basic alpha-methyl functionalized amino acids can be substituted for basic native amino acids; and/or acidic alpha-methyl functionalized amino acids can be substituted for acidic native amino acids.

In additional embodiments, an alpha-methyl functionalized amino acid in a lipidated peptide as provided herein does not correspond to the substituted native amino acids.

Commercial sources of alpha-methyl functionalized amino acids include, for example, Bachem AG, Switzerland.

In certain embodiments, at least one alpha-methyl functionalized amino acid in a lipidated synthetic peptide described herein is alpha-methyl phenylalanine.

In certain embodiments, at least one alpha-methyl functionalized amino acid in a synthetic lipidated peptide described herein is selected from alpha-methyl functionalized Histidine, alpha-methyl functionalized Alanine, alpha-methyl functionalized Isoleucine, alpha-methyl functionalized Arginine, alpha-methyl functionalized Leucine, alpha-methyl functionalized Asparagine, alpha-methyl functionalized Lysine, alpha-methyl functionalized Aspartic acid, alpha-methyl functionalized Methionine, alpha-methyl functionalized Cysteine, alpha-methyl functionalized Phenylalanine, alpha-methyl functionalized Glutamic acid, alpha-methyl functionalized Threonine, alpha-methyl functionalized Glutamine, alpha-methyl functionalized Tryptophan, alpha-methyl functionalized Glycine, alpha-methyl functionalized Valine, alpha-methyl functionalized Ornithine, alpha-methyl functionalized Proline, alpha-methyl functionalized Selenocysteine, alpha-methyl functionalized Serine and alpha-methyl functionalized Tyrosine.

In certain embodiments, the lipidated peptides described herein can be substantially resistant to proteolytic degradation.

As used herein, “proteolytic degradation” means the breakdown of peptides into smaller peptides or even amino acids, generally caused by the hydrolysis of a peptide bond by enzymes.

Lipidated peptides that are “substantially resistant” to proteolytic degradation can, for example, remain at least about 50% intact following exposure to an enzyme in conditions that the enzyme is generally active (e.g., suitable pH, temperature, other environmental conditions) for a defined period of time. Lipidated peptides provided herein can be substantially resistant to proteolytic degradation for a period of at least 4 hours, at least 8 hours, at least 12 hours, at least 24 hours, at least 36 hours, at least 48 hours, at least 72 hours, at least 96 hours, at least 120 hours, at least 144 hours, at least 168 hours, at least 192 hours, at least 216 hours, at least 240 hours, or about 36 hours to about 240 hours, about 48 hours to 240 hours, about 72 hours to about 240 hours, about 96 hours to about 240 hours, about 120 hours to about 240 hours, about 144 hours to about 240 hours, about 168 hours to about 240 hours, about 192 hours to about 240 hours, or about 216 hours to about 240 hours. In certain embodiments, at least about 60% of the lipidated peptide remains intact following exposure to an enzyme in conditions that the enzyme is generally active for a defined period of time, for example, at least about 70%, at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 99%, at least about 99.1%, at least about 99.2%, at least about 99.3%, at least about 99.4%, at least about 99.5%, at least about 99.6%, at least about 99.7%, at least about 99.8%, at least about 99.9%, or at least about 100% of the lipidated peptide remains intact following exposure to an enzyme in conditions that the enzyme is generally active for a defined period of time.

Lipidated peptides provided herein can be substantially resistant to proteolytic degradation by one or more enzymes found in a mammalian body, e.g., the human body. For example, the lipidated peptides can be substantially resistant to proteolytic degradation by one or more of dipeptidyl peptidase-IV (DPP-IV), neprilysin, α-chymotrypsin, plasmin, thrombin, kallikrein, trypsin, elastase and pepsin. In certain embodiments, the lipidated peptides can be resistant to proteolytic degradation by to two or more, three or more, four or more, five or more, six or more, seven or more, or suitably all of the recited enzymes. The lipidated peptides described herein can also be substantially resistant to proteolytic degradation by other enzymes known in the art. In certain embodiments, the lipidated peptides described herein can be substantially resistant to proteolytic degradation by digestive (gastric) enzymes and/or enzymes in the blood/serum.

In certain embodiments, the lipidated peptides described herein can be substantially resistant to proteolytic degradation by DPP-IV and neprilysin. In certain embodiments, the lipidated peptides described herein can be substantially resistant to proteolytic degradation by pepsin, trypsin, α-chymotrypsin, and elastase. In certain embodiments, the lipidated peptides described herein can be substantially resistant to proteolytic degradation by plasmin, thrombin, and kallikrein. In certain embodiments, the lipidated peptides described herein can be substantially resistant to proteolytic degradation by pepsin, trypsin and α-chymotrypsin. In certain embodiments, the lipidated peptides described herein can be substantially resistant to proteolytic degradation by pepsin and trypsin, etc.

As described herein, including in various embodiments provided throughout, lipidation of amino acid residues and/or substitution of alpha-functionalized amino acids for native amino acids can occur at native amino acid residues that are sites susceptible to proteolytic cleavage. That is, the amino acid residues that are substituted are determined to be sites where proteolytic enzymes are active in cleaving peptide bonds in the native peptides. Methods for determining sites of proteolytic cleavage are well known in the art and described herein.

Any class of peptide can be prepared according to the methods provided herein to yield lipidated peptides having the recited characteristics.

In exemplary embodiments, the lipidated peptides can be incretin class peptides. Exemplary synthetic incretin class peptides that can be prepared as described herein include, but are not limited to, glucagon-like peptide 1 (GLP-1), a glucose-dependent insulinotropic peptide (GIP), an exenatide peptide, plus glucagon, secretins, tenomodulin, oxyntomodulin, insulin, or vasoactive intestinal peptide (VIP).

Additional classes of peptides can be prepared as described herein.

In certain embodiments, the lipidated peptide described herein is derived from the sequence of GLP-1 and referred to herein as a lipidated GLP-1 peptide analog.

Sequences for the native (wild type) peptides of the various peptides and classes of peptides described herein that can be prepared to yield synthetic peptides having the recited characteristics are well known in the art.

The native amino acid sequence for GLP-1 (7-36) is known in the art as set forth below:

(SEQ ID NO: 1)
HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR.

In certain embodiments, lipidated GLP-1 peptide analogs are provided comprising at least one lipid modified amino acid residue, such as those shown in Table 1. In certain embodiments, the lipidated GLP-1 peptide analog contains only one lipid modified amino acid residue. Mono-lipidated GLP-1 peptide analogs disclosed herein can be substantially resistant to proteolytic degradation. For example, in certain embodiments the mono-lipidated peptide is substantially resistant to DPP-IV, neprilysin, α-chymotrypsin, plasmin, thrombin, kallikrein, trypsin, elastase, and/or pepsin degradation. Mono-lipidated GLP-1 peptide analogs disclosed herein can maintain substantially the same or exhibit increased receptor potency and selectivity as a corresponding non-lipidated GLP-1 peptide or GLP-1 peptide analog.

In certain embodiments, a mono-lipidated peptide is lipidated on only one K (lysine) or only one C (cysteine) residue. Thus, certain embodiments provide for an isolated polypeptide comprising the amino acid sequence:

(SEQ ID NO: 2)
H X2 E G S X6 T S D V X11 X12 X13 L E G E A A X20
E X22 I X24 X25 V V X28 G G;

    • wherein X2 is A or Aib;
    • X6 is F or an alpha-methyl functionalized amino acid;
    • X11 is S or an alpha-methyl functionalized amino acid;
    • X12 is S, a lipid modified K, or a lipid modified C;
    • X13 is Y or an alpha-methyl functionalized amino acid;
    • X20 is a lipid modified K, a lipid modified C, K, or an alpha-methyl functionalized amino acid;
    • X22 is F or an alpha-methyl functionalized amino acid;
    • X24 is A, a lipid modified K, or a lipid modified C;
    • X25 is W or an alpha-methyl functionalized amino acid; and
    • X28 is K, E, or an alpha-methyl functionalized amino acid,
      wherein the polypeptide is lipidated on only one of X12, X20, or X24.

In certain embodiments, a mono-lipidated peptide comprises one or more aminoisobutyric acid (Aib) substitutions. In certain embodiments of a peptide comprising the amino acid sequence of SEQ ID NO: 2: X2 is Aib.

The lipidated K or lipidated C can be attached to a variety of lipids or lipid moieties such as any of those described herein. Examples include those selected from the group consisting of: K(ε-(PEG)2-(PEG)2-γE-Stearate); K(ε-γE-Palmitoyl); K(ε-(PEG)2-(PEG)2-γE-Stearate); K(γE-Palmitoyl); K(ε-(PEG)2-(PEG)2-(PEG)2-Stearoyl); K(ε-γE-Lauroyl); K(ε-γE-γE-Lauroyl); K(ε-γE-γE-γE-Lauroyl); K(ε-Ahx-Lauroyl); K(ε-Ahx-Ahx-Lauroyl); K(ε-Ahx-Ahx-Ahx-Lauroyl); K(ε-(PEG)2-Lauroyl); K(ε-(PEG)2-(PEG)2-Lauroyl); K(ε-(PEG)2-(PEG)2-(PEG)2-Lauroyl); K(ε-γE-12-(4-carboxyphenoxy)dodecanoyl); K(ε-γE-γE-12-(4-carboxyphenoxy)dodecanoyl); K(ε-γE-γE-γE-12-(4-carboxyphenoxy)dodecanoyl); K(ε-Ahx-12-(4-carboxyphenoxy)dodecanoyl); K(ε-Ahx-Ahx-12-(4-carboxyphenoxy)dodecanoyl); K(ε-Ahx-Ahx-Ahx-12-(4-carboxyphenoxy)dodecanoyl); K(ε-(PEG)2-12-(4-carboxyphenoxy)dodecanoyl); K(ε-(PEG)2-(PEG)2-12-(4-carboxyphenoxy)dodecanoyl); K(ε-(PEG)2-(PEG)2-(PEG)2-12-(4-carboxyphenoxy)dodecanoyl); K(ε-γE-Stearoyl); K(ε-γE-γE-Stearoyl); K(ε-γE-γE-γE-Stearoyl); K(ε-Ahx-Stearoyl); K(ε-Ahx-Ahx-Stearoyl); K(ε-Ahx-Ahx-Ahx-Stearoyl); K(ε-(PEG)2-Stearoyl); K(ε-(PEG)2-(PEG)2-Stearoyl); K(ε-(PEG)2-(PEG)2-(PEG)2-Stearoyl); K(ε-γE-Stearate); K(ε-γE-γE-Stearate); K(ε-γE-γE-γE-Stearate); K(ε-Ahx-Stearate); K(ε-Ahx-Ahx-Stearate); K(ε-Ahx-Ahx-Ahx-Stearate); K(ε-(PEG)2-Stearate); K(ε-(PEG)2-(PEG)2-Stearate); K(ε-(PEG)2-(PEG)2-(PEG)2-Stearate), and any combination thereof. For example, in certain embodiments of a peptide comprising the amino acid sequence of SEQ ID NO: 2: X20 is K(ε-(PEG)2-(PEG)2-γE-Stearate).

In certain embodiments, the alpha-methyl functionalized amino acid is α-MeF, α-MeS, or α-MeK. In certain embodiments of a peptide comprising the amino acid sequence of SEQ ID NO: 2: X6 is α-MeF; X11 is α-MeS; X13 is α-MeF; X22 is α-MeF; X25 is α-MeF; and/or X28 is α-MeK. In certain embodiments of a peptide comprising the amino acid sequence of SEQ ID NO: 2: X6 is α-MeF; X11 is α-MeS; X13 is α-MeF; X22 is α-MeF; X25 is α-MeF; and X28 is α-MeK. In certain embodiments of a peptide comprising the amino acid sequence of SEQ ID NO: 2: X2 is Aib; X6 is α-MeF; X11 is α-MeS; X13 is α-MeF; X20 is K(ε-(PEG)2-(PEG)2-γE-Stearate); X22 is α-MeF; X25 is α-MeF; and X28 is α-MeK (SEQ ID NO: 3; Table 1).

In certain embodiments, the peptide comprises the amino acid sequence of SEQ ID NO: 48 (Table 1), SEQ ID NO: 60 (Table 1), or SEQ ID NO: 68 (Table 1).

In certain embodiments, a peptide comprising the amino acid sequence of SEQ ID NO: 2, 3, 48, 60, or 68 is substantially resistant to proteolytic degradation. For example, in certain embodiments the peptide is substantially resistant to DPP-IV, neprilysin, α-chymotrypsin, plasmin, thrombin, kallikrein, trypsin, elastase, and/or pepsin degradation. In certain embodiments, a peptide comprising the amino acid sequence of SEQ ID NO: 2, 3, 48, 60, or 68 at least maintains substantially the same receptor potency or exhibits increased receptor potency as compared to a corresponding non-lipidated peptide. In certain embodiments, a peptide comprising the amino acid sequence of SEQ ID NO: 2, 3, 48, 60, or 68 at least maintains substantially the same receptor or exhibits increased receptor potency and selectivity as compared to a corresponding non-lipidated peptide.

TABLE 1
Substituted and Mono-lipidated Peptide Sequences
SEQ
ID
ID NO Peptide
GLP-1 1 HAEGT5 FTSDV10 SSYLE15 GQAAK20 EFIAW25 LVKGR30-amide
(7-36)
mono- 2 H X2 E G S X6 T S D V X11 X12 X13 L E G E A A X20 E X22 I X24 X25 V V X28 G G
3 H-(Aib)2-EG-(S)5-(α-MeF)6-TSDV10-(α-MeS)11-S-(α-MeF)13-LE15 G-(E)17-AAK(ϵ-PEG)2-(PEG)2-γE-
Stearate)20 E-(α-MeF)22-IA-(α-MeF)25-(V)26-V-(α-MeK)28-G-(G)30
5 H-(Aib)2-EGT5 FTSDV10 SSYLE15 GQAAK20 EFIAW25 LVKGR30-K(ϵ-γE-Palmitoyl)
6 H-(Aib)2-EGT5 FTSDV10 SSYLE15 GQAAK20 EFIAW25 LVKGR30-K(ϵ-(PEG)2-(PEG)2-γE-Stearate)
7 H-(Aib)2-EG-(S)5-(α-MeF)6-TS-(E)9-V10 SS-(α-MeF)13-LE15 G-(E)17-AA-(α-MeK)20 E-(α-MeF)22-IA-
(α-MeF)25-(V)26-V-(α-MeK)28-G-(G)30
8 H-(Aib)2-EG-(S)5-(α-MeF)6-(S)7-SDV10 SS-(α-MeF)13-LE15 G-(E)17-AA-(α-MeK)20 E-(α-MeF)22-IA-(α-
MeF)25-(V)26-V-(α-MeK)28-G-(G)30
9 H-(Aib)2-EG-(S)5-(α-MeF)6-(S)7-S-(E)9-V10 SS-(α-MeF)13-LE15 G-(E)17-AA-(α-MeK)20 E-(α-MeF)22-
IA-(α-MeF)25-(V)26-V-(α-MeK)28-G-(G)30
10 H-(Aib)2-EG-(S)5-(α-MeF)6-TSDV10 SS-(α-MeF)13-(V)14-E15 G-(E)17-AA-(α-MeK)20 E-(α-MeF)22-IA-
(α-MeF)25-(V)26-V-(α-MeK)28-G-(G)30
11 H-(Aib)2-EG-(S)5-(α-MeF)6-TSDV10 SS-(α-MeF)13-LE15 G-(E)17-AA-(α-MeK)20 E-(α-MeF)22-(V)23-A-
(α-MeF)25-(V)26-V-(α-MeK)28-G-(G)30
12 H-(Aib)2-EG-(S)5-(α-MeF)6-(S)7-S-(E)9-V10 SS-(α-MeF)13-(V)14-E15 G-(E)17-AA-(α-MeK)20 E-(α-
MeF)22-(V)23-A-(α-MeF)25-(V)26-V-(α-MeK)28-G-(G)30
13 H-(Aib)2-QG-(S)5-(α-MePhe)6-TSD-K10 (γE-Palmitoyl)-SE-(α-MePhe)13-LD15 SERAR20 D-(α-
MePhe)22-VA-(α-MePhe)25-LEAGG30
14 H-(Aib)2-QG-(S)5-(α-MePhe)6-TSD-(α-MePhe)10-SK-(α-MePhe)13-LD15 SRRAQ20 D-(α-MePhe)22-VQ-
(α-MePhe)25-LMNT29
15 Y-(Aib)2-EG-(S)5-(α-MePhe)6-ISD-(α-MePhe)10-SIAMD15 KIHQQ20 D-(α-MePhe)22-VN-(α-MePhe)25-
LLAQK30
16 H-(Aib)2-EG-(S)5-(α-MeF)6-T-(α-MeS)8-DV10-SS-(α-MeF)13-LE15 G-(E)17-AA-(α-MeK)20 E-(α-MeF)22-
IA-(α-MeF)25-(V)26-V-(α-MeK)28-G-(G)30
17 H-(Aib)2-EG-(S)5-(α-MeF)6-TSDV10-(α-MeS)11-S-(α-MeF)13-LE15 G-(E)17-AA-(α-MeK)20 E-(α-MeF)22-
IA-(α-MeF)25-(V)26-V-(α-MeK)28-G-(G)30
18 H-(Aib)2-EG-(S)5-(α-MeF)6-T-(α-MeS)8-DV10-(α-MeS)11-S-(α-MeF)13-LE15 G-(E)17-AA-(α-MeK)20 E-
(α-MeF)22-IA-(α-MeF)25-(V)26-V-(α-MeK)28-G-(G)30
19 H-(Aib)2-EGT5 FT-(α-MeSer)8-DV10 SSYLE15 GQAAK20 EFIAW25 LVKGR30
20 H-(Aib)2-EGT5 FT-(Aib)8-DV10 SSYLE15 GQAAK20 EFIAW25 LVKGR30
21 H-(Aib)2-EGT5 FTSDV10 (α-MeSer)11-SYLE15 GQAAK20 EFIAW25 LVKGR30
22 H-(Aib)2-EGT5 FTSDV10 (Aib)11-SYLE15 GQAAK20 EFIAW25 LVKGR30
23 H-(Aib)2-EGT5 FT-(α-MeSer)8-DV10-(α-MeSer)11-SYLE15 GQAAK20 EFIAW25 LVKGR30
24 H-(Aib)2-EGT5 FT-(Aib)8-DV10-(Aib)11-SYLE15 GQAAK20 EFIAW25 LVKGR30
25 H-(Aib)2-EG-(S)5-(α-MeF)6-T-(G)8-DV10-(α-MeSer)11-S-(α-MeF)13-LE15 G-(E)17-AA-(α-MeK)20 E-(α-
MeF)22-IA-(α-MeF)25-(V)26-V-(α-MeK)28-G-(G)30
26 H-(Aib)2-EG-(S)5-(α-MeF)6-T-(A)8-DV10-(α-MeSer)11-S-(α-MeF)13-LE15 G-(E)17-AA-(α-MeK)20 E-(α-
MeF)22-IA-(α-MeF)25-(V)26-V-(α-MeK)28-G-(G)30
27 H-(Aib)2-EG-(S)5-(α-MeF)6-T-(D)8-DV10-(α-MeSer)11-S-(α-MeF)13-LE15 G-(E)17-AA-(α-MeK)20 E-(α-
MeF)22-IA-(α-MeF)25-(V)26-V-(α-MeK)28-G-(G)30
28 H-(Aib)2-EG-(S)5-(α-MeF)6-T-(E)8-DV10-(α-MeSer)11-S-(α-MeF)13-LE15 G-(E)17-AA-(α-MeK)20 E-(α-
MeF)22-IA-(α-MeF)25-(V)26-V-(α-MeK)28-G-(G)30
29 H-(Aib)2-EG-(S)5-(α-MeF)6-T-(T)8-DV10-(α-MeSer)11-S-(α-MeF)13-LE15 G-(E)17-AA-(α-MeK)20 E-(α-
MeF)22-IA-(α-MeF)25-(V)26-V-(α-MeK)28-G-(G)30
30 H-(Aib)2-EG-(S)5-(α-MeF)6-T-(V)8-DV10-(α-MeSer)11-S-(α-MeF)13-LE15 G-(E)17-AA-(α-MeK)20 E-(α-
MeF)22-IA-(α-MeF)25-(V)26-V-(α-MeK)28-G-(G)30
31 H-(Aib)2-EG-(S)5-(α-MeF)6-TSDV10-(α-MeS)11-S-(α-MeF)13-LE15 G-(E)17-AA-(α-MeK)20 E-(α-MeF)22-
IA-(α-MeF)25-(V)26-V-(α-MeK)28-G-(G)30-K(ϵ-PEG)2-(PEG)2-ϵ-γE-Stearate)
32 H-(Aib)2-EG-(S)5-(α-MeF)6-TSDV10-(α-MeS)11-S-(α-MeF)13-LE15 G-(E)17-AA-(α-MeK)20 E-(α-MeF)22-
IA-(α-MeF)25-(V)26-V-(α-MeK)28-G-(G)30-K(ϵ-γE-Palmitoyl)
33 H-(Aib)2-EG-(S)5-(α-MeF)6-TSDV10-(α-MeS)11-S-(α-MeF)13-LE15 G-(E)17-AAK(ϵ-PEG)2-(PEG)2-ϵ-γE-
Stearate)20 E-(α-MeF)22-IA-(α-MeF)25-(V)26-V-(α-MeK)28-G-(G)30
34 H-(Aib)2-EG-(S)5-(α-MeF)6-TSDV10-(α-MeS)11-S-(α-MeF)13-LE15 G-(E)17-AAK(ϵ-γE-Palmitoyl)20 E-
(α-MeF)22-IA-(α-MeF)25-(V)26-V-(α-MeK)28-G-(G)30
35 H-(Aib)2-EG-(S)5-(α-MeF)6-T-(D)8-DV10-(α-MeSer)11-S-(α-MeF)13-LE15 G-(E)17-AA-(α-MeK)20 E-(α-
MeF)22-IA-(α-MeF)25-(V)26-V-(α-MeK)28-G-(G)30-K(ϵ-γE-Palmitoyl)
36 H-(Aib)2-EG-(S)5-(α-MeF)6-T-(D)8-DV10-(α-MeSer)11-S-(α-MeF)13-LE15 G-(E)17-AAK(ϵ-PEG)2-(PEG)2-
ϵ-γE-Stearate)20 E-(α-MeF)22-IA-(α-MeF)25-(V)26-V-(α-MeK)28-G-(G)30
37 H-(Aib)2-EG-(S)5-(α-MeF)6-T-(D)8-DV10-(α-MeSer)11-S-(α-MeF)13-LE15 G-(E)17-AAK(ϵ-γE-
Palmitoyl)20 E-(α-MeF)22-IA-(α-MeF)25-(V)26-V-(α-MeK)28-G-(G)30
38 H-(Aib)2-EG-(S)5-(α-MeF)6-TSDV10 SS-(α-MeF)13-LE15 G-(E)17-AAK20 E-(α-MeF)22-IA-(α-MeF)25
(V)26-VKG-(G)30-K(ϵ-PEG)2-(PEG)2-ϵ-γE-Stearate)
39 H-(Aib)2-EG-(S)5-(α-MeF)6-TSDV10 SS-(α-MeF)13-LE15 G-(E)17-AAK20 E-(α-MeF)22-IA-(α-MeF)25
(V)26-VKG-(G)30-K(ϵ-γE-Palmitoyl)
40 H-(Aib)2-EG-(S)5-(α-MeF)6-TSDV10 SS-(α-MeF)13-LE15 G-(E)17-AAK(ϵ-PEG)2-(PEG)2-ϵ-γE-Stearate)20
E-(α-MeF)22-IA-(α-MeF)25(V)26-VKG-(G)30
41 H-(Aib)2-EG-(S)5-(α-MeF)6-TSDV10 SS-(α-MeF)13-LE15 G-(E)17-AAK(ϵ-γE-Palmitoyl)20 E-(α-MeF)22-
IA-(α-MeF)25(V)26-VKG-(G)30
42 H-(Aib)2-EG-(S)5-(α-MeF)6-TSDV10-(α-MeS)11-S-(α-MeF)13-LE15 G-(E)17-AA-(E)20 E-(α-MeF)22-IA-
(α-MeF)25-(V)26-V-(α-MeK)28-G-(G)30
43 H-(Aib)2-EG-(S)5-(α-MeF)6-TSDV10-(α-MeS)11-S-(α-MeF)13-LE15 G-(E)17-AA-(α-MeK)20 E-(α-MeF)22-
IA-(α-MeF)25-(V)26-V-(E)28-G-(G)30
44 H-(Aib)2-EG-(S)5-(α-MeF)6-TSDV10-(α-MeS)11-S-(α-MeF)13-LE15 G-(E)17-AA-(E)20 E-(α-MeF)22-IA-
(α-MeF)25-(V)26-V-(E)28-G-(G)30
45 H-(Aib)2-EG-(S)5-FTSDV10-(α-MeS)11-S-(α-MeF)13-LE15 G-(E)17-AAK(ϵ-PEG)2-(PEG)2-γE-Stearate)20
E-(α-MeF)22-IA-(α-MeF)25-(V)26-V-(α-MeK)28-G-(G)30
46 H-(Aib)2-EG-(S)5-(α-MeF)6-TSDV10-SS-(α-MeF)13-LE15 G-(E)17-AAK(ϵ-PEG)2-(PEG)2-γE-Stearate)20
E-(α-MeF)22-IA-(α-MeF)25-(V)26-V-(α-MeK)28-G-(G)30
47 H-(Aib)2-EG-(S)5-(α-MeF)6-TSDV10-(α-MeS)11-SYLE15 G-(E)17-AAK(ϵ-PEG)2-(PEG)2-γE-Stearate)20 E-
(α-MeF)22-IA-(α-MeF)25-(V)26-V-(α-MeK)28-G-(G)30
48 H-(Aib)2-EG-(S)5-(α-MeF)6-TSDV10-(α-MeS)11-S-(α-MeF)13-LE15 G-(E)17-AAK(ϵ-PEG)2-(PEG)2-γE-
Stearate)20 EFIA-(α-MeF)25-(V)26-V-(α-MeK)28-G-(G)30
49 H-(Aib)2-EG-(S)5-(α-MeF)6-TSDV10-(α-MeS)11-S-(α-MeF)13-LE15 G-(E)17-AAK(ϵ-PEG)2-(PEG)2-γE-
Stearate)20 E-(α-MeF)22-IAW-(V)26-V-(α-MeK)28-G-(G)30
50 H-(Aib)2-EG-(S)5-(α-MeF)6-TSDV10-(α-MeS)11-S-(α-MeF)13-LE15 G-(E)17-AAK(ϵ-PEG)2-(PEG)2-γE-
Stearate)20 E-(α-MeF)22-IA-(α-MeF)25-(V)26-VKG-(G)30
51 H-(Aib)2-EG-(S)5-FTSDV10-(α-MeS)11-S-(α-MeF)13-LE15 G-(E)17-AAK(ϵ-PEG)2-(PEG)2-(PEG)2-
Stearoyl)20 E-(α-MeF)22-IA-(α-MeF)25-(V)26-V-(α-MeK)28-G-(G)30
52 H-(Aib)2-EG-(S)5-(α-MeF)6-TSDV10-SS-(α-MeF)13-LE15 G-(E)17-AAK(ϵ-PEG)2-(PEG)2-(PEG)2-
Stearoyl)20 E-(α-MeF)22-IA-(α-MeF)25-(V)26-V-(α-MeK)28-G-(G)30
53 H-(Aib)2-EG-(S)5-(α-MeF)6-TSDV10-(α-MeS)11-SYLE15 G-(E)17-AAK(ϵ-PEG)2-(PEG)2-(PEG)2-
Stearoyl)20 E-(α-MeF)22-IA-(α-MeF)25-(V)26-V-(α-MeK)28-G-(G)30
54 H-(Aib)2-EG-(S)5-(α-MeF)6-TSDV10-(α-MeS)11-S-(α-MeF)13-LE15 G-(E)17-AAK(ϵ-PEG)2-(PEG)2-(PEG)2-
Stearoyl)20 EFIA-(α-MeF)25-(V)26-V-(α-MeK)28-G-(G)30
55 H-(Aib)2-EG-(S)5-(α-MeF)6-TSDV10-(α-MeS)11-S-(α-MeF)13-LE15 G-(E)17-AAK(ϵ-PEG)2-(PEG)2-(PEG)2-
Stearoyl)20 E-(α-MeF)22-IAW-(V)26-V-(α-MeK)28-G-(G)30
56 H-(Aib)2-EG-(S)5-(α-MeF)6-TSDV10-(α-MeS)11-S-(α-MeF)13-LE15 G-(E)17-AAK(ϵ-PEG)2-(PEG)2-(PEG)2-
Stearoyl)20 E-(α-MeF)22-IA-(α-MeF)25-(V)26-VKG-(G)30
57 H-(Aib)2-EG-(S)5-(α-MeF)6-TSDV10-S-K(-ϵ-(PEG)2-(PEG)2-γE-Stearate)12-YLE15 G-(E)17-AA-K20-E-
(α-MeF)22-IA-(α-MeF)25-(V)26-V-(E)28-G-(G)30
58 H-(Aib)2-EG-(S)5-(α-MeF)6-TSDV10-S-K(-ϵ-(PEG)2-(PEG)2-γE-Stearate)12-YLE15 G-(E)17-AA-(E)20-E-
(α-MeF)22-IA-(α-MeF)25-(V)26-V-(E)28-G-(G)30
59 H-(Aib)2-EG-(S)5-(α-MeF)6-TSDV10-S-K(-ϵ-(PEG)2-(PEG)2-γE-Stearate)12-YLE15 G-(E)17-AA-(Aib)20
E-(α-MeF)22-IA-(α-MeF)25-(V)26-V-(E)28-G-(G)30
60 H-(Aib)2-EG-(S)5-(α-MeF)6-TSDV10-S-K(-ϵ-(PEG)2-(PEG)2-γE-Stearate)12-YLE15 G-(E)17-AA-(α-
MeK)20 E-(α-MeF)22-IA-(α-MeF)25-(V)26-V-(E)28-G-(G)30
61 H-(Aib)2-EG-(S)5-(α-MeF)6-TSDV10-S-K(-ϵ-(PEG)2-(PEG)2-(PEG)2-Stearoyl)12-YLE15 G-(E)17-AA-K20-
E-(α-MeF)22-IA-(α-MeF)25-(V)26-V-(E)28-G-(G)30
62 H-(Aib)2-EG-(S)5-(α-MeF)6-TSDV10-S-K(-ϵ-(PEG)2-(PEG)2-(PEG)2-Stearoyl)12-YLE15 G-(E)17-AA-
(E)20-E-(α-MeF)22-IA-(α-MeF)25-(V)26-V-(E)28-G-(G)30
63 H-(Aib)2-EG-(S)5-(α-MeF)6-TSDV10-S-K(-ϵ-(PEG)2-(PEG)2-(PEG)2-Stearoyl)12-YLE15 G-(E)17-AA-
(Aib)20 E-(α-MeF)22-IA-(α-MeF)25-(V)26-V-(E)28-G-(G)30
64 H-(Aib)2-EG-(S)5-(α-MeF)6-TSDV10-S-K(-ϵ-(PEG)2-(PEG)2-(PEG)2-Stearoyl)12-YLE15 G-(E)17-AA-(α-
MeK)20 E-(α-MeF)22-IA-(α-MeF)25-(V)26-V-(E)28-G-(G)30
65 H-(Aib)2-EG-(S)5-(α-MeF)6-TSDV10-(α-MeS)11-S-(α-MeF)13-LE15 G-(E)17-AA-K20-EFI-K(-ϵ-(PEG)2-
(PEG)2-γE-Stearate)24-W25-(V)26-V-(E)28-G-(G)30
66 H-(Aib)2-EG-(S)5-(α-MeF)6-TSDV10-(α-MeS)11-S-(α-MeF)13-LE15 G-(E)17-AA-(E)20 EFI-K(-ϵ-(PEG)2-
(PEG)2-γE-Stearate)24-W25-(V)26-V-(E)28-G-(G)30
67 H-(Aib)2-EG-(S)5-(α-MeF)6-TSDV10-(α-MeS)11-S-(α-MeF)13-LE15 G-(E)17-AA-(Aib)20 EFI-K(-ϵ-
(PEG)2-(PEG)2-γE-Stearate)24-W25-(V)26-V-(E)28-G-(G)30
68 H-(Aib)2-EG-(S)5-(α-MeF)6-TSDV10-(α-MeS)11-S-(α-MeF)13-LE15 G-(E)17-AA-(α-MeK)20 EFI-K(-ϵ-
(PEG)2-(PEG)2-γE-Stearate)24-W25-(V)26-V-(E)28-G-(G)30
69 H-(Aib)2-EG-(S)5-(α-MeF)6-TSDV10-(α-MeS)11-S-(α-MeF)13-LE15 G-(E)17-AA-(A)20 EFI-K(-ϵ-(PEG)2-
(PEG)2-γE-Stearate)24-W25-(V)26-V-(E)28-G-(G)30
70 H-(Aib)2-EG-(S)5-(α-MeF)6-TSDV10-(α-MeS)11-S-(α-MeF)13-LE15 G-(E)17-AA-(α-MeK)20 E-(α-MeF)22-
IA-(α-MeF)25-(V)26-V-(α-MeK)28-G-K(ϵ-γE-Palmitoyl)30
71 H-(Aib)2-EG-(S)5-(α-MeF)6-TSDV10-(α-MeS)11-S-(α-MeF)13-LE15 G-(E)17-AA-(α-MeK)20 E-(α-MeF)22-
IA-(α-MeF)25-(V)26-V-(α-MeK)28-K(ϵ-γE-Palmitoyl)29-(G)30
72 H-(Aib)2-EG-(S)5-(α-MeF)6-TSDV10-(α-MeS)11-S-(α-MeF)13-LE15 G-(E)17-AA-(α-MeK)20 E-(α-MeF)22-
IA-(α-MeF)25-(V)26-V-K(ϵ-γE-Palmitoyl)28-G-(G)30
73 H-(Aib)2-EG-(S)5-(α-MeF)6-TSDV10-(α-MeS)11-S-(α-MeF)13-LE15 G-(E)17-AA-(α-MeK)20 E-(α-MeF)22-
IA-(α-MeF)25-(V)26-K(ϵ-γE-Palmitoyl)27-(α-MeK)28-G-(G)30
74 H-(Aib)2-EG-(S)5-(α-MeF)6-TSDV10-(α-MeS)11-S-(α-MeF)13-LE15 G-(E)17-AA-(α-MeK)20 E-(α-MeF)22-
IA-(α-MeF)25-K(ϵ-γE-Palmitoyl)26-V-(α-MeK)28-G-(G)30
75 H-(Aib)2-EG-(S)5-(α-MeF)6-TSDV10-(α-MeS)11-S-(α-MeF)13-LE15 G-(E)17-AA-(α-MeK)20 E-(α-MeF)22-
IA-K(ϵ-γE-Palmitoyl)25-(V)26-V-(α-MeK)28G-(G)30
76 H-(Aib)2-EG-(S)5-(α-MeF)6-TSDV10-(α-MeS)11-S-(α-MeF)13-LE15 G-(E)17-AA-(α-MeK)20 E-(α-MeF)22-
IK(ϵ-γE-Palmitoyl)24-(α-MeF)25-(V)26-V-(α-MeK)28G-(G)30
77 H-(Aib)2-EG-(S)5-(α-MeF)6-TSDV10-(α-MeS)11-S-(α-MeF)13-LE15 G-(E)17-AA-(α-MeK)20 E-(α-MeF)22-
K(ϵ-γE-Palmitoyl)23-A-(α-MeF)25-(V)26-V-(α-MeK)28G-(G)30
78 H-(Aib)2-EG-(S)5-(α-MeF)6-TSDV10-(α-MeS)11-S-(α-MeF)13-LE15 G-(E)17-AA-(α-MeK)20 E-K(ϵ-γE-
Palmitoyl)22-IA-(α-MeF)25-(V)26-V-(α-MeK)28G-(G)30
79 H-(Aib)2-EG-(S)5-(α-MeF)6-TSDV10-(α-MeS)11-S-(α-MeF)13-LE15 G-(E)17-AA-(α-MeK)20 K(ϵ-γE-
Palmitoyl)21-(α-MeF)22-IA-(α-MeF)25-(V)26-V-(α-MeK)28G-(G)30
80 H-(Aib)2-EG-(S)5-(α-MeF)6-TSDV10-(α-MeS)11-S-(α-MeF)13-LE15 G-(E)17-AA-K(ϵ-γE-Palmitoyl)20-E-
(α-MeF)22-IA-(α-MeF)25-(V)26-V-(α-MeK)28G-(G)30
81 H-(Aib)2-EG-(S)5-(α-MeF)6-TSDV10-(α-MeS)11-S-(α-MeF)13-LE15 G-(E)17-AK(ϵ-γE-Palmitoyl)19-(α-
MeK)20 E-(α-MeF)22-IA-(α-MeF)25-(V)26-V-(α-MeK)28G-(G)30
82 H-(Aib)2-EG-(S)5-(α-MeF)6-TSDV10-(α-MeS)11-S-(α-MeF)13-LE15 G-(E)17-K(ϵ-γE-Palmitoyl)18-A-(α-
MeK)20 E-(α-MeF)22-IA-(α-MeF)25-(V)26-V-(α-MeK)28G-(G)30
83 H-(Aib)2-EG-(S)5-(α-MeF)6-TSDV10-(α-MeS)11-S-(α-MeF)13-LE15 G-K(ϵ-γE-Palmitoyl)17-AA-(α-MeK)20
E-(α-MeF)22-IA-(α-MeF)25-(V)28-V-(α-MeK)28G-(G)30
84 H-(Aib)2-EG-(S)5-(α-MeF)6-TSDV10-(α-MeS)11-S-(α-MeF)13-LE15 K(ϵ-γE-Palmitoyl)16-(E)17-AA-(α-
MeK)20 E-(α-MeF)22-IA-(α-MeF)25-(V)28-V-(α-MeK)28-G-(G)30
85 H-(Aib)2-EG-(S)5-(α-MeF)6-TSDV10-(α-MeS)11-S-(α-MeF)13-L-K(ϵ-γE-Palmitoyl)15-G-(E)17-AA-(α-
MeK)20 E-(α-MeF)22-IA-(α-MeF)25-(V)28-V-(α-MeK)28-G-(G)30
86 H-(Aib)2-EG-(S)5-(α-MeF)6-TSDV10-(α-MeS)11-S-(α-MeF)13-K(ϵ-γE-Palmitoyl)14-EG-(E)17-AA-(α-
MeK)20 E-(α-MeF)22-IA-(α-MeF)25-(V)28-V-(α-MeK)28-G-(G)30
87 H-(Aib)2-EG-(S)5-(α-MeF)6-TSDV10-(α-MeS)11-S-K(ϵ-γE-Palmitoyl)13-LE15 G-(E)17-AA-(α-MeK)20 E-
(α-MeF)22-IA-(α-MeF)25-(V)28-V-(α-MeK)28-G-(G)30
88 H-(Aib)2-EG-(S)5-(α-MeF)6-TSDV10-(α-MeS)11-K(ϵ-γE-Palmitoyl)12-(α-MeF)13-LE15 G-(E)17-AA-(α-
MeK)20 E-(α-MeF)22-IA-(α-MeF)25-(V)28-V-(α-MeK)28-G-(G)30
89 H-(Aib)2-EG-(S)5-(α-MeF)6-TSDV10-K(ϵ-γE-Palmitoyl)11-S-(α-MeF)13-LE15 G-(E)17-AA-(α-MeK)20 E-
(α-MeF)22-IA-(α-MeF)25-(V)28-V-(α-MeK)28-G-(G)30
90 H-(Aib)2-EG-(S)5-(α-MeF)6-TSD-K(ϵ-γE-Palmitoyl)10-(α-MeS)11-S-(α-MeF)13-LE15 G-(E)17-AA-(α-
MeK)20 E-(α-MeF)22-IA-(α-MeF)25-(V)28-V-(α-MeK)28-G-(G)30
91 H-(Aib)2-EG-(S)5-(α-MeF)6-TS-K(ϵ-γE-Palmitoyl)9-V-(α-MeS)11-S-(α-MeF)13-LE15 G-(E)17-AA-(α-
MeK)20 E-(α-MeF)22-IA-(α-MeF)25-(V)28-V-(α-MeK)28-G-(G)30
92 H-(Aib)2-EG-(S)5-(α-MeF)6-T-K(ϵ-γE-Palmitoyl)8-DV-(α-MeS)11-S-(α-MeF)13-LE15 G-(E)17-AA-(α-
MeK)20 E-(α-MeF)22-IA-(α-MeF)25-(V)28-V-(α-MeK)28-G-(G)30
93 H-(Aib)2-EG-(S)5-(α-MeF)6-K(ϵ-γE-Palmitoyl)7-TSDV-(α-MeS)11-S-(α-MeF)13-LE15 G-(E)17-AA-(α-
MeK)20 E-(α-MeF)22-IA-(α-MeF)25-(V)28-V-(α-MeK)28-G-(G)30
94 H-(Aib)2-EG-(S)5-K(ϵ-γE-Palmitoyl)6-TSDV-(α-MeS)11-S-(α-MeF)13-LE15 G-(E)17-AA-(α-MeK)20 E-
(α-MeF)22-IA-(α-MeF)25-(V)28-V-(α-MeK)28-G-(G)30
95 H-(Aib)2-EG-K(ϵ-γE-Palmitoyl)5-(α-MeF)6-TSDV-(α-MeS)11-S-(α-MeF)13-LE15 G-(E)17-AA-(α-MeK)20
E-(α-MeF)22-IA-(α-MeF)25-(V)28-V-(α-MeK)28-G-(G)30
96 H-(Aib)2-E-K(ϵ-γE-Palmitoyl)4-(S)5-(α-MeF)6-TSDV-(α-MeS)11-S-(α-MeF)13-LE15 G-(E)17-AA-(α-
MeK)20 E-(α-MeF)22-IA-(α-MeF)25-(V)26-V-(α-MeK)28-G-(G)30
97 H-(Aib)2-K(ϵ-γE-Palmitoyl)3-G-(S)5-(α-MeF)6-TSDV-(α-MeS)11-S-(α-MeF)13-LE15 G-(E)17-AA-(α-
MeK)20 E-(α-MeF)22-IA-(α-MeF)25-(V)26-V-(α-MeK)28-G-(G)30
98 H-K(ϵ-γE-Palmitoyl)2-EG-(S)5-(α-MeF)6-TSDV-(α-MeS)11-S-(α-MeF)13-LE15 G-(E)17-AA-(α-MeK)20 E-
(α-MeF)22-IA-(α-MeF)25-(V)26-V-(α-MeK)28-G-(G)30
99 H-(Aib)2-EG-(S)5-(α-MeF)6-TSDV10-(α-MeS)11-S-(α-MeF)13-LE15 G-(E)17-AA-(α-MeK)20 E-(α-MeF)22-
IA-(α-MeF)25-(V)26-V-(α-MeK)28-G-K(ϵ-(PEG)2-(PEG)2-γE-Stearate)30
100 H-(Aib)2-EG-(S)5-(α-MeF)6-TSDV10-(α-MeS)11-S-(α-MeF)13-LE15 G-(E)17-AA-(α-MeK)20 E-(α-MeF)22-
IA-(α-MeF)25-(V)26-V-(α-MeK)28-K(ϵ-(PEG)2-(PEG)2-γE-Stearate)29-(G)30
101 H-(Aib)2-EG-(S)5-(α-MeF)6-TSDV10-(α-MeS)11-S-(α-MeF)13-LE15 G-(E)17-AA-(α-MeK)20 E-(α-MeF)22-
IA-(α-MeF)25-(V)26-V-K(ϵ-(PEG)2-(PEG)2-γE-Stearate)28-G-(G)30
102 H-(Aib)2-EG-(S)5-(α-MeF)6-TSDV10-(α-MeS)11-S-(α-MeF)13-LE15 G-(E)17-AA-(α-MeK)20 E-(α-MeF)22-
IA-(α-MeF)25-(V)26-K(ϵ-(PEG)2-(PEG)2-γE-Stearate)27-(α-MeK)28-G-(G)30
103 H-(Aib)2-EG-(S)5-(α-MeF)6-TSDV10-(α-MeS)11-S-(α-MeF)13-LE15 G-(E)17-AA-(α-MeK)20 E-(α-MeF)22-
IA-(α-MeF)25-K(ϵ-(PEG)2-(PEG)2-γE-Stearate)26-V-(α-MeK)28-G-(G)30
104 H-(Aib)2-EG-(S)5-(α-MeF)6-TSDV10-(α-MeS)11-S-(α-MeF)13-LE15 G-(E)17-AA-(α-MeK)20 E-(α-MeF)22-
IA-K(ϵ-(PEG)2-(PEG)2-γE-Stearate)25-(V)26-V-(α-MeK)28G-(G)30
105 H-(Aib)2-EG-(S)5-(α-MeF)6-TSDV10-(α-MeS)11-S-(α-MeF)13-LE15 G-(E)17-AA-(α-MeK)20 E-(α-MeF)22-
IK(ϵ-(PEG)2-(PEG)2-γE-Stearate)24-(α-MeF)25-(V)26-V-(α-MeK)28G-(G)30
106 H-(Aib)2-EG-(S)5-(α-MeF)6-TSDV10-(α-MeS)11-S-(α-MeF)13-LE15 G-(E)17-AA-(α-MeK)20 E-(α-MeF)22-
K(ϵ-(PEG)2-(PEG)2-γE-Stearate)23-A-(α-MeF)25-(V)26-V-(α-MeK)28G-(G)30
107 H-(Aib)2-EG-(S)5-(α-MeF)6-TSDV10-(α-MeS)11-S-(α-MeF)13-LE15 G-(E)17-AA-(α-MeK)20 E-K(ϵ-(PEG)2-
(PEG)2-γE-Stearate)22-IA-(α-MeF)25-(V)26-V-(α-MeK)28G-(G)30
108 H-(Aib)2-EG-(S)5-(α-MeF)6-TSDV10-(α-MeS)11-S-(α-MeF)13-LE15 G-(E)17-AA-(α-MeK)20 K(ϵ-(PEG)2-
(PEG)2-γE-Stearate)21-(α-MeF)22-IA-(α-MeF)25-(V)26-V-(α-MeK)28G-(G)30
109 H-(Aib)2-EG-(S)5-(α-MeF)6-TSDV10-(α-MeS)11-S-(α-MeF)13-LE15 G-(E)17-AA-K(ϵ-(PEG)2-(PEG)2-γE-
Palmitate)20-E-(α-MeF)22-IA-(α-MeF)25-(V)26-V-(α-MeK)28G-(G)30
110 H-(Aib)2-EG-(S)5-(α-MeF)6-TSDV10-(α-MeS)11-S-(α-MeF)13-LE15 G-(E)17-AK(ϵ-(PEG)2-(PEG)2-γE-
Stearate)19-(α-MeK)20 E-(α-MeF)22-IA-(α-MeF)25-(V)26-V-(α-MeK)28G-(G)30
111 H-(Aib)2-EG-(S)5-(α-MeF)6-TSDV10-(α-MeS)11-S-(α-MeF)13-LE15 G-(E)17-K(ϵ-(PEG)2-(PEG)2-γE-
Stearate)18-A-(α-MeK)20 E-(α-MeF)22-IA-(α-MeF)25-(V)26-V-(α-MeK)28G-(G)30
112 H-(Aib)2-EG-(S)5-(α-MeF)6-TSDV10-(α-MeS)11-S-(α-MeF)13-LE15 G-K(ϵ-(PEG)2-(PEG)2-γE-
Stearate)17-AA-(α-MeK)20 E-(α-MeF)22-IA-(α-MeF)25-(V)26-V-(α-MeK)28G-(G)30
113 H-(Aib)2-EG-(S)5-(α-MeF)6-TSDV10-(α-MeS)11-S-(α-MeF)13-LE15 K(ϵ-(PEG)2-(PEG)2-γE-Stearate)
(E)17-AA-(α-MeK)20 E-(α-MeF)22-IA-(α-MeF)25-(V)26-V-(α-MeK)28-G-(G)30
114 H-(Aib)2-EG-(S)5-(α-MeF)6-TSDV10-(α-MeS)11-S-(α-MeF)13-L-K(ϵ-(PEG)2-(PEG)2-γE-Stearate)15-G-
(E)17-AA-(α-MeK)20 E-(α-MeF)22-IA-(α-MeF)25-(V)26-V-(α-MeK)28-G-(G)30
115 H-(Aib)2-EG-(S)5-(α-MeF)6-TSDV10-(α-MeS)11-S-(α-MeF)13-K(ϵ-(PEG)2-(PEG)2-γE-Stearate)14-EG-
(E)17-AA-(α-MeK)20 E-(α-MeF)22-IA-(α-MeF)25-(V)26-V-(α-MeK)28-G-(G)30
116 H-(Aib)2-EG-(S)5-(α-MeF)6-TSDV10-(α-MeS)11-S-K(ϵ-(PEG)2-(PEG)2-γE-Stearate)13-LE15 G-(E)17-AA-
(α-MeK)20 E-(α-MeF)22-IA-(α-MeF)25-(V)26-V-(α-MeK)28-G-(G)30
117 H-(Aib)2-EG-(S)5-(α-MeF)6-TSDV10-(α-MeS)11-K(ϵ-(PEG)2-(PEG)2-γE-Stearate)12-(α-MeF)13-LE15 G-
(E)17-AA-(α-MeK)20 E-(α-MeF)22-IA-(α-MeF)25-(V)26-V-(α-MeK)28-G-(G)30
118 H-(Aib)2-EG-(S)5-(α-MeF)6-TSDV10-K(ϵ-(PEG)2-(PEG)2-γE-Stearate)11-S-(α-MeF)13-LE15 G-(E)17-AA-
(α-MeK)20 E-(α-MeF)22-IA-(α-MeF)25-(V)26-V-(α-MeK)28-G-(G)30
119 H-(Aib)2-EG-(S)5-(α-MeF)6-TSD-K(ϵ-(PEG)2-(PEG)2-γE-Stearate)10-(α-MeS)11-S-(α-MeF)13-LE15 G-
(E)17-AA-(α-MeK)20 E-(α-MeF)22-IA-(α-MeF)25-(V)26-V-(α-MeK)28-G-(G)30
120 H-(Aib)2-EG-(S)5-(α-MeF)6-TS-K(ϵ-(PEG)2-(PEG)2-γE-Stearate)9-V-(α-MeS)11-S-(α-MeF)13-LE15 G-
(E)17-AA-(α-MeK)20 E-(α-MeF)22-IA-(α-MeF)25-(V)26-V-(α-MeK)28-G-(G)30
121 H-(Aib)2-EG-(S)5-(α-MeF)6-T-K(ϵ-(PEG)2-(PEG)2-γE-Stearate)8-DV-(α-MeS)11-S-(α-MeF)13-LE15 G-
(E)17-AA-(α-MeK)20 E-(α-MeF)22-IA-(α-MeF)25-(V)26-V-(α-MeK)28-G-(G)30
122 H-(Aib)2-EG-(S)5-(α-MeF)6-K(ϵ-(PEG)2-(PEG)2-γE-Stearate)7-TSDV-(α-MeS)11-S-(α-MeF)13-LE15 G-
(E)17-AA-(α-MeK)20 E-(α-MeF)22-IA-(α-MeF)25-(V)26-V-(α-MeK)28-G-(G)30
123 H-(Aib)2-EG-(S)5-K(ϵ-(PEG)2-(PEG)2-γE-Stearate)6-TSDV-(α-MeS)11-S-(α-MeF)13-LE15 G-(E)17-AA-
(α-MeK)20 E-(α-MeF)22-IA-(α-MeF)25-(V)26-V-(α-MeK)28-G-(G)30
124 H-(Aib)-EG-K(ϵ-(PEG)2-(PEG)2-γE-Stearate)5-(α-MeF)6-TSDV-(α-MeS)11-S-(α-MeF)13-LE15 G-(E)17-
AA-(α-MeK)20 E-(α-MeF)22-IA-(α-MeF)25-(V)26-V-(α-MeK)28-G-(G)30
125 H-(Aib)2-E-K(ϵ-(PEG)2-(PEG)2-γE-Stearate)4-(S)5-(α-MeF)6-TSDV-(α-MeS)11-S-(α-MeF)13-LE15 G-
(E)17-AA-(α-MeK)20 E-(α-MeF)22-IA-(α-MeF)25-(V)26-V-(α-MeK)28-G-(G)30
126 H-(Aib)2-K(ϵ-(PEG)2-(PEG)2-γE-Stearate)3-G-(S)5-(α-MeF)6-TSDV-(α-MeS)11-S-(α-MeF)13-LE15 G-
(E)17-AA-(α-MeK)20 E-(α-MeF)22-IA-(α-MeF)25-(V)26-V-(α-MeK)28-G-(G)30
127 H-K(ϵ-(PEG)2-(PEG)2-γE-Stearate)2-EG-(S)5-(α-MeF)6-TSDV-(α-MeS)11-S-(α-MeF)13-LE15 G-(E)17-
AA-(α-MeK)20 E-(α-MeF)22-IA-(α-MeF)25-(V)26-V-(α-MeK)28-G-(G)30
128 H-(Aib)2-EG-(S)5-(α-MeF)6-TSDV10-(α-MeS)11-S-(α-MeF)13-LE15 G-(E)17-AAK(ϵ-γE-Lauroyl)20 E-(α-
MeF)22-IA-(α-MeF)25-(V)26-V-(α-MeK)28-G-(G)30
129 H-(Aib)2-EG-(S)5-(α-MeF)6-TSDV10-(α-MeS)11-S-(α-MeF)13-LE15 G-(E)17-AAK(ϵ-γE-γE-Lauroyl)20 E-
(α-MeF)22-IA-(α-MeF)25-(V)26-V-(α-MeK)28-G-(G)30
130 H-(Aib)2-EG-(S)5-(α-MeF)6-TSDV10-(α-MeS)11-S-(α-MeF)13-LE15 G-(E)17-AAK(ϵ-γE-γE-γE-Lauroyl)20
E-(α-MeF)22-IA-(α-MeF)25-(V)26-V-(α-MeK)28-G-(G)30
131 H-(Aib)2-EG-(S)5-(α-MeF)6-TSDV10-(α-MeS)11-S-(α-MeF)13-LE15 G-(E)17-AAK(ϵ-Ahx-Lauroyl)20 E-(α-
MeF)22-IA-(α-MeF)25-(V)26-V-(α-MeK)28-G-(G)30
132 H-(Aib)2-EG-(S)5-(α-MeF)6-TSDV10-(α-MeS)11-S-(α-MeF)13-LE15 G-(E)17-AAK(ϵ-Ahx-Ahx-Lauroyl)20
E-(α-MeF)22-IA-(α-MeF)25-(V)26-V-(α-MeK)28-G-(G)30
133 H-(Aib)2-EG-(S)5-(α-MeF)6-TSDV10-(α-MeS)11-S-(α-MeF)13-LE15 G-(E)17-AAK(ϵ-Ahx-Ahx-Ahx-
Lauroyl)20 E-(α-MeF)22-IA-(α-MeF)25-(V)26-V-(α-MeK)28-G-(G)30
134 H-(Aib)2-EG-(S)5-(α-MeF)6-TSDV10-(α-MeS)11-S-(α-MeF)13-LE15 G-(E)17-AAK(ϵ-(PEG)2-Lauroyl)20 E-
(α-MeF)22-IA-(α-MeF)25-(V)26-V-(α-MeK)28-G-(G)30
135 H-(Aib)2-EG-(S)5-(α-MeF)6-TSDV10-(α-MeS)11-S-(α-MeF)13-LE15 G-(E)17-AAK(ϵ-(PEG)2-(PEG)2-
Lauroyl)20 E-(α-MeF)22-IA-(α-MeF)25-(V)26-V-(α-MeK)28-G-(G)30
136 H-(Aib)2-EG-(S)5-(α-MeF)6-TSDV10-(α-MeS)11-S-(α-MeF)13-LE15 G-(E)17-AAK(ϵ-(PEG)2-(PEG)2-
(PEG)2-Lauroyl)20 E-(α-MeF)22-IA-(α-MeF)25-(V)26-V-(α-MeK)28-G-(G)30
137 H-(Aib)2-EG-(S)5-(α-MeF)6-TSDV10-(α-MeS)11-S-(α-MeF)13-LE15 G-(E)17-AAK(ϵ-γE-12-(4-
carboxyphenoxy)dodecanoyl)20 E-(α-MeF)22-IA-(α-MeF)25-(V)26-V-(α-MeK)28-G-(G)30
138 H-(Aib)2-EG-(S)5-(α-MeF)6-TSDV10-(α-MeS)11-S-(α-MeF)13-LE15 G-(E)17-AAK(ϵ-γE-γE-12-(4-
carboxyphenoxy)dodecanoyl)20 E-(α-MeF)22-IA-(α-MeF)25-(V)26-V-(α-MeK)28-G-(G)30
139 H-(Aib)2-EG-(S)5-(α-MeF)6-TSDV10-(α-MeS)11-S-(α-MeF)13-LE15 G-(E)17-AAK(ϵ-γE-γE-γE-12-(4-
carboxyphenoxy)dodecanoyl)20 E-(α-MeF)22-IA-(α-MeF)25-(V)26-V-(α-MeK)28-G-(G)30
140 H-(Aib)2-EG-(S)5-(α-MeF)6-TSDV10-(α-MeS)11-S-(α-MeF)13-LE15 G-(E)17-AAK(ϵ-Ahx-12-(4-
carboxyphenoxy)dodecanoyl)20 E-(α-MeF)22-IA-(α-MeF)25-(V)26-V-(α-MeK)28-G-(G)30
141 H-(Aib)2-EG-(S)5-(α-MeF)6-TSDV10-(α-MeS)11-S-(α-MeF)13-LE15 G-(E)17-AAK(ϵ-Ahx-Ahx-12-(4-
carboxyphenoxy)dodecanoyl)20 E-(α-MeF)22-IA-(α-MeF)25-(V)26-V-(α-MeK)28-G-(G)30
142 H-(Aib)2-EG-(S)5-(α-MeF)6-TSDV10-(α-MeS)11-S-(α-MeF)13-LE15 G-(E)17-AAK(ϵ-Ahx-Ahx-Ahx-12-(4-
carboxyphenoxy)dodecanoyl)20 E-(α-MeF)22-IA-(α-MeF)25-(V)26-V-(α-MeK)28-G-(G)30
143 H-(Aib)2-EG-(S)5-(α-MeF)6-TSDV10-(α-MeS)11-S-(α-MeF)13-LE15 G-(E)17-AAK(ϵ-(PEG)2-12-(4-
carboxyphenoxy)dodecanoyl)20 E-(α-MeF)22-IA-(α-MeF)25-(V)26-V-(α-MeK)28-G-(G)30
144 H-(Aib)2-EG-(S)5-(α-MeF)6-TSDV10-(α-MeS)11-S-(α-MeF)13-LE15 G-(E)17-AAK(ϵ-(PEG)2-(PEG)2-12-(4-
carboxyphenoxy)dodecanoyl)20 E-(α-MeF)22-IA-(α-MeF)25-(V)26-V-(α-MeK)28-G-(G)30
145 H-(Aib)2-EG-(S)5-(α-MeF)6-TSDV10-(α-MeS)11-S-(α-MeF)13-LE15 G-(E)17-AAK(ϵ-(PEG)2-(PEG)2-
(PEG)2-12-(4-carboxyphenoxy)dodecanoyl)20 E-(α-MeF)22-IA-(α-MeF)25-(V)26-V-(α-MeK)28-G-(G)30
146 H-(Aib)2-EG-(S)5-(α-MeF)6-TSDV10-(α-MeS)11-S-(α-MeF)13-LE15 G-(E)17-AAK(ϵ-γE-Stearoyl)20 E-(α-
MeF)22-IA-(α-MeF)25-(V)26-V-(α-MeK)28-G-(G)30
147 H-(Aib)2-EG-(S)5-(α-MeF)6-TSDV10-(α-MeS)11-S-(α-MeF)13-LE15 G-(E)17-AAK(ϵ-γE-γE-Stearoyl)20 E-
(α-MeF)22-IA-(α-MeF)25-(V)26-V-(α-MeK)28-G-(G)30
148 H-(Aib)2-EG-(S)5-(α-MeF)6-TSDV10-(α-MeS)11-S-(α-MeF)13-LE15 G-(E)17-AAK(ϵ-γE-γE-γE-Stearoyl)20
E-(α-MeF)22-IA-(α-MeF)25-(V)26-V-(α-MeK)28-G-(G)30
149 H-(Aib)2-EG-(S)5-(α-MeF)6-TSDV10-(α-MeS)11-S-(α-MeF)13-LE15 G-(E)17-AAK(ϵ-Ahx-Stearoyl)20 E-
(α-MeF)22-IA-(α-MeF)25-(V)26-V-(α-MeK)28-G-(G)30
150 H-(Aib)2-EG-(S)5-(α-MeF)6-TSDV10-(α-MeS)11-S-(α-MeF)13-LE15 G-(E)17-AAK(ϵ-Ahx-Ahx-Stearoyl)20
E-(α-MeF)22-IA-(α-MeF)25-(V)26-V-(α-MeK)28-G-(G)30
151 H-(Aib)2-EG-(S)5-(α-MeF)6-TSDV10-(α-MeS)11-S-(α-MeF)13-LE15 G-(E)17-AAK(ϵ-Ahx-Ahx-Ahx-
Stearoyl)20 E-(α-MeF)22-IA-(α-MeF)25-(V)26-V-(α-MeK)28-G-(G)30
152 H-(Aib)2-EG-(S)5-(α-MeF)6-TSDV10-(α-MeS)11-S-(α-MeF)13-LE15 G-(E)17-AAK(ϵ-(PEG)2-Stearoyl)20
E-(α-MeF)22-IA-(α-MeF)25-(V)26-V-(α-MeK)28-G-(G)30
153 H-(Aib)2-EG-(S)5-(α-MeF)6-TSDV10-(α-MeS)11-S-(α-MeF)13-LE15 G-(E)17-AAK(ϵ-(PEG)2-(PEG)2-
Stearoyl)20 E-(α-MeF)22-IA-(α-MeF)25-(V)26-V-(α-MeK)28-G-(G)30
154 H-(Aib)2-EG-(S)5-(α-MeF)6-TSDV10-(α-MeS)11-S-(α-MeF)13-LE15 G-(E)17-AAK(ϵ-(PEG)2-(PEG)2-
(PEG)2-Stearoyl)20 E-(α-MeF)22-IA-(α-MeF)25-(V)26-V-(α-MeK)28-G-(G)30
155 H-(Aib)2-EG-(S)5-(α-MeF)6-TSDV10-(α-MeS)11-S-(α-MeF)13-LE15 G-(E)17-AAK(ϵ-γE-Stearate)20 E-(α-
MeF)22-IA-(α-MeF)25-(V)26-V-(α-MeK)28-G-(G)30
156 H-(Aib)2-EG-(S)5-(α-MeF)6-TSDV10-(α-MeS)11-S-(α-MeF)13-LE15 G-(E)17-AAK(ϵ-γE-γE-Stearate)20 E-
(α-MeF)22-IA-(α-MeF)25-(V)26-V-(α-MeK)28-G-(G)30
157 H-(Aib)2-EG-(S)5-(α-MeF)6-TSDV10-(α-MeS)11-S-(α-MeF)13-LE15 G-(E)17-AAK(ϵ-γE-γE-γE-Stearate)20
E-(α-MeF)22-IA-(α-MeF)25-(V)26-V-(α-MeK)28-G-(G)30
158 H-(Aib)2-EG-(S)5-(α-MeF)6-TSDV10-(α-MeS)11-S-(α-MeF)13-LE15 G-(E)17-AAK(ϵ-Ahx-Stearate)20 E-
(α-MeF)22-IA-(α-MeF)25-(V)26-V-(α-MeK)28-G-(G)30
159 H-(Aib)2-EG-(S)5-(α-MeF)6-TSDV10-(α-MeS)11-S-(α-MeF)13-LE15 G-(E)17-AAK(ϵ-Ahx-Ahx-Stearate)20
E-(α-MeF)22-IA-(α-MeF)25-(V)26-V-(α-MeK)28-G-(G)30
160 H-(Aib)2-EG-(S)5-(α-MeF)6-TSDV10-(α-MeS)11-S-(α-MeF)13-LE15 G-(E)17-AAK(ϵ-Ahx-Ahx-Ahx-
Stearate)20 E-(α-MeF)22-IA-(α-MeF)25-(V)26-V-(α-MeK)28-G-(G)30
161 H-(Aib)2-EG-(S)5-(α-MeF)6-TSDV10-(α-MeS)11-S-(α-MeF)13-LE15 G-(E)17-AAK(ϵ-(PEG)2-Stearate)20
E-(α-MeF)22-IA-(α-MeF)25-(V)26-V-(α-MeK)28-G-(G)30
162 H-(Aib)2-EG-(S)5-(α-MeF)6-TSDV10-(α-MeS)11-S-(α-MeF)13-LE15 G-(E)17-AAK(ϵ-(PEG)2-(PEG)2-
Stearate)20 E-(α-MeF)22-IA-(α-MeF)25-(V)26-V-(α-MeK)28-G-(G)30
163 H-(Aib)2-EG-(S)5-(α-MeF)6-TSDV10-(α-MeS)11-S-(α-MeF)13-LE15 G-(E)17-AAK(ϵ-(PEG)2-(PEG)2-
(PEG)2-Stearate)20 E-(α-MeF)22-IA-(α-MeF)25-(V)26-V-(α-MeK)28-G-(G)30
164 H-(Aib)2-EG-(S)5-(α-MeF)6-TSDV10-(α-MeS)11-S-(α-MeF)13-LE15 G-(E)17-AA-(α-MeK)20 E-(α-MeF)22-
IA-(α-MeF)25-(V)26-VK(ϵ-γE-Lauroyl)28-G-(G)30
165 H-(Aib)2-EG-(S)5-(α-MeF)6-TSDV10-(α-MeS)11-S-(α-MeF)13-LE15 G-(E)17-AA-(α-MeK)20 E-(α-MeF)22-
IA-(α-MeF)25-(V)26-VK(ϵ-γE-γE-Lauroyl)28-G-(G)30
166 H-(Aib)2-EG-(S)5-(α-MeF)6-TSDV10-(α-MeS)11-S-(α-MeF)13-LE15 G-(E)17-AA-(α-MeK)20 E-(α-MeF)22-
IA-(α-MeF)25-(V)26-VK(ϵ-γE-γE-γE-Lauroyl)28-G-(G)30
167 H-(Aib)2-EG-(S)5-(α-MeF)6-TSDV10-(α-MeS)11-S-(α-MeF)13-LE15 G-(E)17-AA-(α-MeK)20 E-(α-MeF)22-
IA-(α-MeF)25-(V)26-VK(ϵ-Ahx-Lauroyl)28-G-(G)30
168 H-(Aib)2-EG-(S)5-(α-MeF)6-TSDV10-(α-MeS)11-S-(α-MeF)13-LE15 G-(E)17-AA-(α-MeK)20 E-(α-MeF)22-
IA-(α-MeF)25-(V)26-VK(ϵ-Ahx-Ahx-Lauroyl)28-G-(G)30
169 H-(Aib)2-EG-(S)5-(α-MeF)6-TSDV10-(α-MeS)11-S-(α-MeF)13-LE15 G-(E)17-AA-(α-MeK)20 E-(α-MeF)22-
IA-(α-MeF)25-(V)26-VK(ϵ-Ahx-Ahx-Ahx-Lauroyl)28-G-(G)30
170 H-(Aib)2-EG-(S)5-(α-MeF)6-TSDV10-(α-MeS)11-S-(α-MeF)13-LE15 G-(E)17-AA-(α-MeK)20 E-(α-MeF)22-
IA-(α-MeF)25-(V)26-VK(ϵ-(PEG)2-Lauroyl)28-G-(G)30
171 H-(Aib)2-EG-(S)5-(α-MeF)6-TSDV10-(α-MeS)11-S-(α-MeF)13-LE15 G-(E)17-AA-(α-MeK)20 E-(α-MeF)22-
IA-(α-MeF)25-(V)26-VK(ϵ-(PEG)2-(PEG)2-Lauroyl)28-G-(G)30
172 H-(Aib)2-EG-(S)5-(α-MeF)6-TSDV10-(α-MeS)11-S-(α-MeF)13-LE15 G-(E)17-AA-(α-MeK)20 E-(α-MeF)22-
IA-(α-MeF)25-(V)26-VK(ϵ-(PEG)2-(PEG)2-(PEG)2-Lauroyl)28-G-(G)30
173 H-(Aib)2-EG-(S)5-(α-MeF)6-TSDV10-(α-MeS)11-S-(α-MeF)13-LE15 G-(E)17-AA-(α-MeK)20 E-(α-MeF)22-
IA-(α-MeF)25-(V)26-VK(ϵ-γE-Dodecylbenzoate)28-G-(G)30
174 H-(Aib)2-EG-(S)5-(α-MeF)6-TSDV10-(α-MeS)11-S-(α-MeF)13-LE15 G-(E)17-AA-(α-MeK)20 E-(α-MeF)22-
IA-(α-MeF)25-(V)26-VK(ϵ-γE-γE-Dodecylbenzoate)28-G-(G)30
175 H-(Aib)2-EG-(S)5-(α-MeF)6-TSDV10-(α-MeS)11-S-(α-MeF)13-LE15 G-(E)17-AA-(α-MeK)20 E-(α-MeF)22-
IA-(α-MeF)25-(V)26-VK(ϵ-γE-γE-γE-Dodecylbenzoate)28-G-(G)30
176 H-(Aib)2-EG-(S)5-(α-MeF)6-TSDV10-(α-MeS)11-S-(α-MeF)13-LE15 G-(E)17-AA-(α-MeK)20 E-(α-MeF)22-
IA-(α-MeF)25-(V)26-VK(ϵ-Ahx-Dodecylbenzoate)28-G-(G)30
177 H-(Aib)2-EG-(S)5-(α-MeF)6-TSDV10-(α-MeS)11-S-(α-MeF)13-LE15 G-(E)17-AA-(α-MeK)20 E-(α-MeF)22-
IA-(α-MeF)25-(V)26-VK(ϵ-Ahx-Ahx-Dodecylbenzoate)28-G-(G)30
178 H-(Aib)2-EG-(S)5-(α-MeF)6-TSDV10-(α-MeS)11-S-(α-MeF)13-LE15 G-(E)17-AA-(α-MeK)20 E-(α-MeF)22-
IA-(α-MeF)25-(V)26-VK(ϵ-Ahx-Ahx-Ahx-Dodecylbenzoate)28-G-(G)30
179 H-(Aib)2-EG-(S)5-(α-MeF)6-TSDV10-(α-MeS)11-S-(α-MeF)13-LE15 G-(E)17-AA-(α-MeK)20 E-(α-MeF)22-
IA-(α-MeF)25-(V)26-VK(ϵ-(PEG)2-Dodecylbenzoate)28-G-(G)30
180 H-(Aib)2-EG-(S)5-(α-MeF)6-TSDV10-(α-MeS)11-S-(α-MeF)13-LE15 G-(E)17-AA-(α-MeK)20 E-(α-MeF)22-
IA-(α-MeF)25-(V)26-VK(ϵ-(PEG)2-(PEG)2-Dodecylbenzoate)28-G-(G)30
181 H-(Aib)2-EG-(S)5-(α-MeF)6-TSDV10-(α-MeS)11-S-(α-MeF)13-LE15 G-(E)17-AA-(α-MeK)20 E-(α-MeF)22-
IA-(α-MeF)25-(V)26-VK(ϵ-(PEG)2-(PEG)2-(PEG)2-Dodecylbenzoate)28-G-(G)30
182 H-(Aib)2-EG-(S)5-(α-MeF)6-TSDV10-(α-MeS)11-S-(α-MeF)13-LE15 G-(E)17-AA-(α-MeK)20 E-(α-MeF)22-
IA-(α-MeF)25-(V)26-VK(ϵ-γE-Stearoyl)28-G-(G)30
183 H-(Aib)2-EG-(S)5-(α-MeF)6-TSDV10-(α-MeS)11-S-(α-MeF)13-LE15 G-(E)17-AA-(α-MeK)20 E-(α-MeF)22-
IA-(α-MeF)25-(V)26-VK(ϵ-γE-γE-Stearoyl)28-G-(G)30
184 H-(Aib)2-EG-(S)5-(α-MeF)6-TSDV10-(α-MeS)11-S-(α-MeF)13-LE15 G-(E)17-AA-(α-MeK)20 E-(α-MeF)22-
IA-(α-MeF)25-(V)26-VK(ϵ-γE-γE-γE-Stearoyl)28-G-(G)30
185 H-(Aib)2-EG-(S)5-(α-MeF)6-TSDV10-(α-MeS)11-S-(α-MeF)13-LE15 G-(E)17-AA-(α-MeK)20 E-(α-MeF)22-
IA-(α-MeF)25-(V)26-VK(ϵ-Ahx-Stearoyl)28-G-(G)30
186 H-(Aib)2-EG-(S)5-(α-MeF)6-TSDV10-(α-MeS)11-S-(α-MeF)13-LE15 G-(E)17-AA-(α-MeK)20 E-(α-MeF)22-
IA-(α-MeF)25-(V)26-VK(ϵ-Ahx-Ahx-Stearoyl)28-G-(G)30
187 H-(Aib)2-EG-(S)5-(α-MeF)6-TSDV10-(α-MeS)11-S-(α-MeF)13-LE15 G-(E)17-AA-(α-MeK)20 E-(α-MeF)22-
IA-(α-MeF)25-(V)26-VK(ϵ-Ahx-Ahx-Ahx-Stearoyl)28-G-(G)30
188 H-(Aib)2-EG-(S)5-(α-MeF)6-TSDV10-(α-MeS)11-S-(α-MeF)13-LE15 G-(E)17-AA-(α-MeK)20 E-(α-MeF)22-
IA-(α-MeF)25-(V)26-VK(ϵ-(PEG)2-Stearoyl)28-G-(G)30
189 H-(Aib)2-EG-(S)5-(α-MeF)6-TSDV10-(α-MeS)11-S-(α-MeF)13-LE15 G-(E)17-AA-(α-MeK)20 E-(α-MeF)22-
IA-(α-MeF)25-(V)26-VK(ϵ-(PEG)2-(PEG)2-Stearoyl)28-G-(G)30
190 H-(Aib)2-EG-(S)5-(α-MeF)6-TSDV10-(α-MeS)11-S-(α-MeF)13-LE15 G-(E)17-AA-(α-MeK)20 E-(α-MeF)22-
IA-(α-MeF)25-(V)26-VK(ϵ-(PEG)2-(PEG)2-(PEG)2-Stearoyl)28-G-(G)30
191 H-(Aib)2-EG-(S)5-(α-MeF)6-TSDV10-(α-MeS)11-S-(α-MeF)13-LE15 G-(E)17-AA-(α-MeK)20 E-(α-MeF)22-
IA-(α-MeF)25-(V)26-VK(ϵ-γE-Stearate)28-G-(G)30
192 H-(Aib)2-EG-(S)5-(α-MeF)6-TSDV10-(α-MeS)11-S-(α-MeF)13-LE15 G-(E)17-AA-(α-MeK)20 E-(α-MeF)22-
IA-(α-MeF)25-(V)26-VK(ϵ-γE-γE-Stearate)28-G-(G)30
193 H-(Aib)2-EG-(S)5-(α-MeF)6-TSDV10-(α-MeS)11-S-(α-MeF)13-LE15 G-(E)17-AA-(α-MeK)20 E-(α-MeF)22-
IA-(α-MeF)25-(V)26-VK(ϵ-γE-γE-γE-Stearate)28-G-(G)30
194 H-(Aib)2-EG-(S)5-(α-MeF)6-TSDV10-(α-MeS)11-S-(α-MeF)13-LE15 G-(E)17-AA-(α-MeK)20 E-(α-MeF)22-
IA-(α-MeF)25-(V)26-VK(ϵ-Ahx-Stearate)28-G-(G)30
195 H-(Aib)2-EG-(S)5-(α-MeF)6-TSDV10-(α-MeS)11-S-(α-MeF)13-LE15 G-(E)17-AA-(α-MeK)20 E-(α-MeF)22-
IA-(α-MeF)25-(V)26-VK(ϵ-Ahx-Ahx-Stearate)28-G-(G)30
196 H-(Aib)2-EG-(S)5-(α-MeF)6-TSDV10-(α-MeS)11-S-(α-MeF)13-LE15 G-(E)17-AA-(α-MeK)20 E-(α-MeF)22-
IA-(α-MeF)25-(V)26-VK(ϵ-Ahx-Ahx-Ahx-Stearate)28-G-(G)30
197 H-(Aib)2-EG-(S)5-(α-MeF)6-TSDV10-(α-MeS)11-S-(α-MeF)13-LE15 G-(E)17-AA-(α-MeK)20 E-(α-MeF)22-
IA-(α-MeF)25-(V)26-VK(ϵ-(PEG)2-Stearate)28-G-(G)30
198 H-(Aib)2-EG-(S)5-(α-MeF)6-TSDV10-(α-MeS)11-S-(α-MeF)13-LE15 G-(E)17-AA-(α-MeK)20 E-(α-MeF)22-
IA-(α-MeF)25-(V)26-VK(ϵ-(PEG)2-(PEG)2-Stearate)28-G-(G)30
199 H-(Aib)2-EG-(S)5-(α-MeF)6-TSDV10-(α-MeS)11-S-(α-MeF)13-LE15 G-(E)17-AA-(α-MeK)20 E-(α-MeF)22-
IA-(α-MeF)25-(V)26-VK(ϵ-(PEG)2-(PEG)2-(PEG)2-Stearate)28-G-(G)30
200 H-(Aib)2-EG-(S)5-(α-MeF)6-TSDV10-(α-MeS)11-S-(α-MeF)13-LE15 G-(E)17-AA-(α-MeK)20 E-(α-MeF)22-
IA-(α-MeF)25-(V)26-V-(α-MeK)28-G-(G)30-K(ϵ-γE-Lauroyl)31
201 H-(Aib)2-EG-(S)5-(α-MeF)6-TSDV10-(α-MeS)11-S-(α-MeF)13-LE15 G-(E)17-AA-(α-MeK)20 E-(α-MeF)22-
IA-(α-MeF)25-(V)26-V-(α-MeK)28-G-(G)30-K(ϵ-γE-γE-Lauroyl)31
202 H-(Aib)2-EG-(S)5-(α-MeF)6-TSDV10-(α-MeS)11-S-(α-MeF)13-LE15 G-(E)17-AA-(α-MeK)20 E-(α-MeF)22-
IA-(α-MeF)25-(V)26-V-(α-MeK)28-G-(G)30-K(ϵ-γE-γE--E-Lauroyl)31
203 H-(Aib)2-EG-(S)5-(α-MeF)6-TSDV10-(α-MeS)11-S-(α-MeF)13-LE15 G-(E)17-AA-(α-MeK)20 E-(α-MeF)22-
IA-(α-MeF)25-(V)26-V-(α-MeK)28-G-(G)30-K(ϵ-Ahx-Lauroyl)31
204 H-(Aib)2-EG-(S)5-(α-MeF)6-TSDV10-(α-MeS)11-S-(α-MeF)13-LE15 G-(E)17-AA-(α-MeK)20 E-(α-MeF)22-
IA-(α-MeF)25-(V)26-V-(α-MeK)28-G-(G)30-K(ϵ-Ahx-Ahx-Lauroyl)31
205 H-(Aib)2-EG-(S)5-(α-MeF)6-TSDV10-(α-MeS)11-S-(α-MeF)13-LE15 G-(E)17-AA-(α-MeK)20 E-(α-MeF)22-
IA-(α-MeF)25-(V)26-V-(α-MeK)28-G-(G)30-K(ϵ-Ahx-Ahx-Ahx-Lauroyl)31
206 H-(Aib)2-EG-(S)5-(α-MeF)6-TSDV10-(α-MeS)11-S-(α-MeF)13-LE15 G-(E)17-AA-(α-MeK)20 E-(α-MeF)22-
IA-(α-MeF)25-(V)26-V-(α-MeK)28-G-(G)30-K(ϵ-(PEG)2-Lauroyl)31
207 H-(Aib)2-EG-(S)5-(α-MeF)6-TSDV10-(α-MeS)11-S-(α-MeF)13-LE15 G-(E)17-AA-(α-MeK)20 E-(α-MeF)22-
IA-(α-MeF)25-(V)26-V-(α-MeK)28-G-(G)30-K(ϵ-(PEG)2-(PEG)2-Lauroyl)31
208 H-(Aib)2-EG-(S)5-(α-MeF)6-TSDV10-(α-MeS)11-S-(α-MeF)13-LE15 G-(E)17-AA-(α-MeK)20 E-(α-MeF)22-
IA-(α-MeF)25-(V)26-V-(α-MeK)28-G-(G)30-K(ϵ-(PEG)2-(PEG)2-(PEG)2-Lauroyl)31
209 H-(Aib)2-EG-(S)5-(α-MeF)6-TSDV10-(α-MeS)11-S-(α-MeF)13-LE15 G-(E)17-AA-(α-MeK)20 E-(α-MeF)22-
IA-(α-MeF)25-(V)26-V-(α-MeK)28-G-(G)30-K(ϵ-γE-12-(4-carboxyphenoxy)dodecanoyl)31
210 H-(Aib)2-EG-(S)5-(α-MeF)6-TSDV10-(α-MeS)11-S-(α-MeF)13-LE15 G-(E)17-AA-(α-MeK)20 E-(α-MeF)22-
IA-(α-MeF)25-(V)26-V-(α-MeK)28-G-(G)30-K(ϵ-γE-γE-12-(4-carboxyphenoxy)dodecanoyl)31
211 H-(Aib)2-EG-(S)5-(α-MeF)6-TSDV10-(α-MeS)11-S-(α-MeF)13-LE15 G-(E)17-AA-(α-MeK)20 E-(α-MeF)22-
IA-(α-MeF)25-(V)26-V-(α-MeK)28-G-(G)30-K(ϵ-γE-γE-γE-12-(4-carboxyphenoxy)dodecanoyl)31
212 H-(Aib)2-EG-(S)5-(α-MeF)6-TSDV10-(α-MeS)11-S-(α-MeF)13-LE15 G-(E)17-AA-(α-MeK)20 E-(α-MeF)22-
IA-(α-MeF)25-(V)26-V-(α-MeK)28-G-(G)30-K(ϵ-Ahx-12-(4-carboxyphenoxy)dodecanoyl)31
213 H-(Aib)2-EG-(S)5-(α-MeF)6-TSDV10-(α-MeS)11-S-(α-MeF)13-LE15 G-(E)17-AA-(α-MeK)20 E-(α-MeF)22-
IA-(α-MeF)25-(V)26-V-(α-MeK)28-G-(G)30-K(ϵ-Ahx-Ahx-12-(4-carboxyphenoxy)dodecanoyl)31
214 H-(Aib)2-EG-(S)5-(α-MeF)6-TSDV10-(α-MeS)11-S-(α-MeF)13-LE15 G-(E)17-AA-(α-MeK)20 E-(α-MeF)22-
IA-(α-MeF)25-(V)26-V-(α-MeK)28-G-(G)30-K(ϵ-Ahx-Ahx-Ahx-12-(4-carboxyphenoxy)dodecanoyl)31
215 H-(Aib)2-EG-(S)5-(α-MeF)6-TSDV10-(α-MeS)11-S-(α-MeF)13-LE15 G-(E)17-AA-(α-MeK)20 E-(α-MeF)22-
IA-(α-MeF)25-(V)26-V-(α-MeK)28-G-(G)30-K(ϵ-(PEG)2-12-(4-carboxyphenoxy)dodecanoyl)3-
216 H-(Aib)2-EG-(S)5-(α-MeF)6-TSDV10-(α-MeS)11-S-(α-MeF)13-LE15 G-(E)17-AA-(α-MeK)20 E-(α-MeF)22-
IA-(α-MeF)25-(V)26-V-(α-MeK)28-G-(G)30-K(ϵ-(PEG)2-(PEG)2-12-(4-carboxyphenoxy)dodecanoyl)31
217 H-(Aib)2-EG-(S)5-(α-MeF)6-TSDV10-(α-MeS)11-S-(α-MeF)13-LE15 G-(E)17-AA-(α-MeK)20 E-(α-MeF)22-
IA-(α-MeF)25-(V)26-V-(α-MeK)28-G-(G)30-K(ϵ-(PEG)2-(PEG)2-(PEG)2-12-(4-carboxyphenoxy)
dodecanoyl)31
218 H-(Aib)2-EG-(S)5-(α-MeF)6-TSDV10-(α-MeS)11-S-(α-MeF)13-LE15 G-(E)17-AA-(α-MeK)20 E-(α-MeF)22-
IA-(α-MeF)25-(V)26-V-(α-MeK)28-G-(G)30-K(ϵ-γE-Stearoyl)31
219 H-(Aib)2-EG-(S)5-(α-MeF)6-TSDV10-(α-MeS)11-S-(α-MeF)13-LE15 G-(E)17-AA-(α-MeK)20 E-(α-MeF)22-
IA-(α-MeF)25-(V)26-V-(α-MeK)28-G-(G)30-K(ϵ-γE-γE-Stearoyl)31
220 H-(Aib)2-EG-(S)5-(α-MeF)6-TSDV10-(α-MeS)11-S-(α-MeF)13-LE15 G-(E)17-AA-(α-MeK)20 E-(α-MeF)22-
IA-(α-MeF)25-(V)26-V-(α-MeK)28-G-(G)30-K(ϵ-γE-γE-γE-Stearoyl)31
221 H-(Aib)2-EG-(S)5-(α-MeF)6-TSDV10-(α-MeS)11-S-(α-MeF)13-LE15 G-(E)17-AA-(α-MeK)20 E-(α-MeF)22-
IA-(α-MeF)25-(V)26-V-(α-MeK)28-G-(G)30-K(ϵ-Ahx-Stearoyl)31
222 H-(Aib)2-EG-(S)5-(α-MeF)6-TSDV10-(α-MeS)11-S-(α-MeF)13-LE15 G-(E)17-AA-(α-MeK)20 E-(α-MeF)22-
IA-(α-MeF)25-(V)26-V-(α-MeK)28-G-(G)30-K(ϵ-Ahx-Ahx-Stearoyl)31
223 H-(Aib)2-EG-(S)5-(α-MeF)6-TSDV10-(α-MeS)11-S-(α-MeF)13-LE15 G-(E)17-AA-(α-MeK)20 E-(α-MeF)22-
IA-(α-MeF)25-(V)26-V-(α-MeK)28-G-(G)30-K(ϵ-Ahx-Ahx-Ahx-Stearoyl)31
224 H-(Aib)2-EG-(S)5-(α-MeF)6-TSDV10-(α-MeS)11-S-(α-MeF)13-LE15 G-(E)17-AA-(α-MeK)20 E-(α-MeF)22-
IA-(α-MeF)25-(V)26-V-(α-MeK)28-G-(G)30-K(ϵ-(PEG)2-Stearoyl)31
225 H-(Aib)2-EG-(S)5-(α-MeF)6-TSDV10-(α-MeS)11-S-(α-MeF)13-LE15 G-(E)17-AA-(α-MeK)20 E-(α-MeF)22-
IA-(α-MeF)25-(V)26-V-(α-MeK)28-G-(G)30-K(ϵ-(PEG)2-(PEG)2-Stearoyl)31
226 H-(Aib)2-EG-(S)5-(α-MeF)6-TSDV10-(α-MeS)11-S-(α-MeF)13-LE15 G-(E)17-AA-(α-MeK)20 E-(α-MeF)22-
IA-(α-MeF)25-(V)26-V-(α-MeK)28-G-(G)30-K(ϵ-(PEG)2-(PEG)2-(PEG)2-Stearoyl)31
227 H-(Aib)2-EG-(S)5-(α-MeF)6-TSDV10-(α-MeS)11-S-(α-MeF)13-LE15 G-(E)17-AA-(α-MeK)20 E-(α-MeF)22-
IA-(α-MeF)25-(V)26-V-(α-MeK)28-G-(G)30-K(ϵ-γE-Stearate)31
228 H-(Aib)2-EG-(S)5-(α-MeF)6-TSDV10-(α-MeS)11-S-(α-MeF)13-LE15 G-(E)17-AA-(α-MeK)20 E-(α-MeF)22-
IA-(α-MeF)25-(V)26-V-(α-MeK)28-G-(G)30-K(ϵ-γE-γE-Stearate)31
229 H-(Aib)2-EG-(S)5-(α-MeF)6-TSDV10-(α-MeS)11-S-(α-MeF)13-LE15 G-(E)17-AA-(α-MeK)20 E-(α-MeF)22-
IA-(α-MeF)25-(V)26-V-(α-MeK)28-G-(G)30-K(ϵ-γE-γE-γE-Stearate)31
230 H-(Aib)2-EG-(S)5-(α-MeF)6-TSDV10-(α-MeS)11-S-(α-MeF)13-LE15 G-(E)17-AA-(α-MeK)20 E-(α-MeF)22-
IA-(α-MeF)25-(V)26-V-(α-MeK)28-G-(G)30-K(ϵ-Ahx-Stearate)31
231 H-(Aib)2-EG-(S)5-(α-MeF)6-TSDV10-(α-MeS)11-S-(α-MeF)13-LE15 G-(E)17-AA-(α-MeK)20 E-(α-MeF)22-
IA-(α-MeF)25-(V)26-V-(α-MeK)28-G-(G)30-K(ϵ-Ahx-Ahx-Stearate)31
232 H-(Aib)2-EG-(S)5-(α-MeF)6-TSDV10-(α-MeS)11-S-(α-MeF)13-LE15 G-(E)17-AA-(α-MeK)20 E-(α-MeF)22-
IA-(α-MeF)25-(V)26-V-(α-MeK)28-G-(G)30-K(ϵ-Ahx-Ahx-Ahx-Stearate)31
233 H-(Aib)2-EG-(S)5-(α-MeF)6-TSDV10-(α-MeS)11-S-(α-MeF)13-LE15 G-(E)17-AA-(α-MeK)20 E-(α-MeF)22-
IA-(α-MeF)25-(V)26-V-(α-MeK)28-G-(G)30-K(ϵ-(PEG)2-Stearate)31
234 H-(Aib)2-EG-(S)5-(α-MeF)6-TSDV10-(α-MeS)11-S-(α-MeF)13-LE15 G-(E)17-AA-(α-MeK)20 E-(α-MeF)22-
IA-(α-MeF)25-(V)26-V-(α-MeK)28-G-(G)30-K(ϵ-(PEG)2-(PEG)2-Stearate)31
235 H-(Aib)2-EG-(S)5-(α-MeF)6-TSDV10-(α-MeS)11-S-(α-MeF)13-LE15 G-(E)17-AA-(α-MeK)20 E-(α-MeF)22-
IA-(α-MeF)25-(V)26-V-(α-MeK)28-G-(G)30-K(ϵ-(PEG)2-(PEG)2-(PEG)2-Stearate)31

In certain embodiments, lipidated GLP-1 peptide analogs are provided comprising at least two lipid modified amino acid residues, such as those shown in Table 2. In certain embodiments, lipidated GLP-1 peptide analogs contain two lipidated amino acid residues. Bis-lipidated GLP-1 peptide analogs disclosed herein can be substantially resistant to proteolytic degradation. For example, in certain embodiments the bis-lipidated peptide is substantially resistant to DPP-IV, neprilysin, α-chymotrypsin, plasmin, thrombin, kallikrein, trypsin, elastase, and/or pepsin degradation. Bis-lipidated GLP-1 peptide analogs disclosed herein can maintain substantially the same or exhibit increased receptor potency and selectivity as a corresponding non-lipidated GLP-1 peptide or GLP-1 peptide analog.

A bis-lipidated peptide is lipid modified at two amino acid residues. In certain embodiments, this can be at two K (lysine) residues, at two C (cysteine) residues, or at one K and one C residue in the same peptide. In certain embodiments, two K residues are lipid modified. Thus, certain embodiments provide for an isolated polypeptide comprising the amino acid sequence:

(SEQ ID NO: 4)
H X2 E G X5 X6 T S D X10 X11 X12 X13 X14 E G X17 A
A X20 E X22 I X24 X25 X26 V X28 G X30;

    • wherein X2 is A or Aib;
    • X5 is T or S;
    • X6 is F or an alpha-methyl functionalized amino acid;
    • X10 is V or a lipid modified K;
    • X11 is S or an alpha-methyl functionalized amino acid;
    • X12 is S or a lipid modified K;
    • X13 is Y, F, or a lipid modified K;
    • X14 is L or a lipid modified K;
    • X17 is Q or E;
    • X20 is K, E, or an alpha-methyl functionalized amino acid;
    • X22 is F, norleucine, tyrosine methyl ester, or an alpha-methyl functionalized amino acid;
    • X24 is A or a lipid modified K;
    • X25 is W, F, or a lipid modified K;
    • X26 is L, V, or a lipid modified K;
    • X28 is K or E; and
    • X30 is R or G,
      wherein the polypeptide comprises two lipid modified K residues, and wherein one of X10, X12, X13, or X14 is a lipid modified K residue and one of X24, X25, or X26 is a lipid modified K residue.

In certain embodiments, a bis-lipidated peptide comprises one or more aminoisobutyric acid (Aib) substitutions. In certain embodiments of a peptide comprising the amino acid sequence of SEQ ID NO: 4: X2 is Aib. In certain embodiments, an alpha-methyl functionalized amino acid is one of α-MeF, α-MeS, or α-MeK.

The lipid modified K residues can be attached to a variety of lipids or lipid moieties such as any of those described herein. Example include those selected from the group consisting of: K(ε-(PEG)2-(PEG)2-γE-Lauroyl); K(ε-(PEG)2-(PEG)2-γE-Palmitate); K(ε-(PEG)2-(PEG)2-γE-Myristoyl); K(ε-(PEG)2-(PEG)2-γE-Palmitoyl); K(ε-(PEG)2-(PEG)2-γE-Stearoyl); K(ε-(PEG)2-(PEG)2-γE-Stearate); and any combination thereof. The lipid modification of the K residues can be the same or different. In certain embodiments, they are the same. Thus, in certain embodiments, at least two lipid modified K residues can both be K(ε-(PEG)2-(PEG)2-γE-Lauroyl); both be K(ε-(PEG)2-(PEG)2-γE-Palmitate); both be K(ε-(PEG)2-(PEG)2-γE-Myristoyl); both be K(ε-(PEG)2-(PEG)2-γE-Palmitoyl); both be K(ε-(PEG)2-(PEG)2-γE-Stearoyl); or both be K(ε-(PEG)2-(PEG)2-γE-Stearate). In certain embodiments of a peptide comprising the amino acid sequence of SEQ ID NO: 4: both modified residues can be K(ε-(PEG)2-(PEG)2-γE-Lauroyl); both can be K(ε-(PEG)2-(PEG)2-γE-Palmitate); both can be K(ε-(PEG)2-(PEG)2-γE-Myristoyl); both can be K(ε-(PEG)2-(PEG)2-γE-Palmitoyl); both can be K(ε-(PEG)2-(PEG)2-γE-Stearoyl); or both can be K(ε-(PEG)2-(PEG)2-γE-Stearate).

In certain embodiments, amino acid lipid modification of a peptide comprising the amino acid sequence of SEQ ID NO: 4 occurs in two distinct regions: one amino acid at position X10, X12, X13, or X14 is a lipid modified K residue and another amino acid at position X24, X25, or X26 is a lipid modified K residue. Thus, in certain embodiments:

    • X10 is a lipid modified K and one of X24, X25, or X26 is a lipid modified K;
    • X12 is a lipid modified K and one of X24, X25, or X26 is a lipid modified K;
    • X13 is a lipid modified K and one of X24, X25, or X26 is a lipid modified K;
    • X14 is a lipid modified K and one of X24, X25, or X26 is a lipid modified K;
    • X24 is a lipid modified K and one of X10, X12, X13, or X14 is a lipid modified K;
    • X25 is a lipid modified K and one of X10, X12, X13, or X14 is a lipid modified K; or
    • X26 is a lipid modified K and one of X10, X12, X13, or X14 is a lipid modified K.

The number, position, and identity of an alpha-methyl functionalized amino acid in a bis-lipidated polypeptide comprising the amino acid sequence of SEQ ID NO: 4 can vary. In certain embodiments, position X6 is α-MeF; X11 is α-MeS; X20 is α-MeK; and/or X22 is α-MeF. In certain embodiments, X6 is α-MeF. In certain embodiments, X6 is α-MeF and X11 is α-MeS. In certain embodiments, X6 is α-MeF and X20 is α-MeK. In certain embodiments, X6 is α-MeF, X11 is α-MeS, X20 is α-MeK, and X22 is α-MeF.

In certain embodiments, the number, position, and identity of an alpha-methyl functionalized amino acid in a bis-lipidated polypeptide comprising the amino acid sequence of SEQ ID NO: 4 can vary along with the position of the lipid modified amino acid residues. In certain embodiments where X13 is a lipid modified K and one of X24, X25, or X26 is a lipid modified K, X6 is α-MeF and X11 is α-MeS. In certain embodiments where X14 is a lipid modified K and one of X24, X25, or X26 is a lipid modified K, X6 is α-MeF and X11 is α-MeS.

In certain embodiments of a peptide comprising the GLP-1-derived amino acid sequence of SEQ ID NO: 4, one or more wild-type GLP-1 sequence amino acids can be substituted with another naturally occurring amino acid. For example, in certain embodiments, the wild-type T residue at position X5 is substituted with S. In certain embodiments, the wild-type Q, K, and R residues at positions X17, X28, and X30, respectively, can be substituted with E, E, and G, respectively.

In certain embodiments of a peptide comprising the amino acid sequence of SEQ ID NO: 4; the peptide comprises the amino acid sequence of SEQ ID NO: 252 (Table 2); SEQ ID NO: 263 (Table 2); SEQ ID NO: 269 (Table 2); SEQ ID NO: 405 (Table 2); SEQ ID NO: 408 (Table 2); SEQ ID NO: 409 (Table 2); or SEQ ID NO: 410 (Table 2).

In certain embodiments, a peptide comprising the amino acid sequence of SEQ ID NO: 4, 252, 263, 269, 405, 408, 409, or 410 is substantially resistant to proteolytic degradation. For example, in certain embodiments the peptide is substantially resistant to DPP-IV, neprilysin, α-chymotrypsin, plasmin, thrombin, kallikrein, trypsin, elastase, and/or pepsin degradation. In certain embodiments, a peptide comprising the amino acid sequence of SEQ ID NO: 4, 252, 263, 269, 405, 408, 409, or 410 at least maintains substantially the same receptor potency as compared to a corresponding non-lipidated peptide. In certain embodiments, a peptide comprising the amino acid sequence of SEQ ID NO: 4, 252, 263, 269, 405, 408, 409, or 410 at least maintains substantially the same receptor potency and selectivity as a compared to corresponding non-lipidated peptide.

TABLE 2
Bis-lipidated Peptide Sequences
SEQ
ID ID NO
GLP-1 1 HAEGT5 FTSDV10 SSYLE15 GQAAK20 EFIAW25 LVKGR30-amide
(7-36)
bis- 4 H X2 E G X5 X6 T S D X10 X11 X12 X13 X14 E G X17 A A X20 E F I X24 X25 X26 V X28 G
X30
236 H-(Aib)2-EGT5 FTSDV10 S-K(ϵ-(PEG)2-(PEG)2-γE-Lauroyl)12-YLE15 G-(E)17-AA-(E)20-EFI-K(ϵ-
(PEG)2-(PEG)2-γE-Lauroyl)24-W25 (V)26-V-(E)28-G-(G)30
237 H-(Aib)2-EGT5 FTSDV10 S-K(ϵ-(PEG)2-(PEG)2-γE-Lauroyl)12-(F)13-LE15 G-(E)17-AA-(E)20 EFI-
K(ϵ-(PEG)2-(PEG)2-γE-Lauroyl)24-W25 (V)26-V-(E)28-G-(G)30
238 H-(Aib)2-EGT5 FTSDV10 S-K(ϵ-(PEG)2-(PEG)2-γE-Lauroyl)12-YLE15 G-(E)17-AA-(E)20 EFI-K(ϵ-
(PEG)2-(PEG)2-γE-Lauroyl)24-(F)25-(V)26-V-(E)28-G-(G)30
239 H-(Aib)2-EGT5 FTSDV10 S-K(ϵ-(PEG)2-(PEG)2-γE-Lauroyl)12-(F)13-LE15 G-(E)17-AA-(E)20-EFI-
K(ϵ-(PEG)2-(PEG)2-γE-Lauroyl)24-(E)25-(V)26-V-(E)28-G-(G)30
240 H-(Aib)2-EG-(S)5-(α-MeF)6-TSDV10-S-K(ϵ-(PEG)2-(PEG)2-γE-Lauroyl)12-YLE15 G-(E)17-AA-(E)20
EFI-K(ϵ-(PEG)2-(PEG)2-γE-Lauroyl)24-W25-(V)26-V-(E)28-G-(G)30
241 H-(Aib)2-EG-(S)5-(α-MeF)6-TSDV10-S-K(ϵ-(PEG)2-(PEG)2-γE-Lauroyl)12-(F)13-LE15 G-(E)17-AA-
(E)20 EFI-K(ϵ-(PEG)2-(PEG)2-γE-Lauroyl)24-(F)25-(V)26-V-(E)28-G-(G)30
242 H-(Aib)2-EGT5 FTSDV10 S-K(ϵ-(PEG)2-(PEG)2-γE-Palmitate)12-YLE15 G-(E)17-AA-(E)20-EFI-K(ϵ-
(PEG)2-(PEG)2-γE-Palmitate)24-W25(V)26-V-(E)28-G-(G)30
243 H-(Aib)2-EGT5 FTSDV10 S-K(ϵ-(PEG)2-(PEG)2-γE-Palmitate)12-(F)13-LE15 G-(E)17-AA-(E)20 EFI-
K(ϵ-(PEG)2-(PEG)2-γE-Palmitate)24-W25(V)26-V-(E)28-G-(G)30
244 H-(Aib)2-EGT5 FTSDV10 S-K(ϵ-(PEG)2-(PEG)2-γE-Palmitate)12-YLE15 G-(E)17-AA-(E)20 EFI-K(ϵ-
(PEG)2-(PEG)2-γE-Palmitate)24-(F)25-(V)26-V-(E)28-G-(G)30
245 H-(Aib)2-EGT5 FTSDV10 S-K(ϵ-(PEG)2-(PEG)2-γE-Palmitate)12-(F)13-LE15 G-(E)17-AA-(E)20-EFI-
K(ϵ-(PEG)2-(PEG)2-γE-Palmitate)24-(F)25-(V)26-V-(E)28-G-(G)30
246 H-(Aib)2-EG-(S)5-(α-MeF)6-TSDV10-S-K(ϵ-(PEG)2-(PEG)2-γE-Palmitate)12-YLE15 G-(E)17-AA-(E)20
EFI-K(ϵ-(PEG)2-(PEG)2-γE-Palmitate)24-W25-(V)26-V-(E)28-G-(G)30
247 H-(Aib)2-EG-(S)5-(α-MeF)6-TSDV10-S-K(ϵ-(PEG)2-(PEG)2-γE-Palmitate)12-(E)13-LE15 G-(E)17-AA-
(E)20 EFI-K(ϵ-(PEG)2-(PEG)2-γE-Palmitate)24-(E)25-(V)26-V-(E)28-G-(G)30
248 H-(Aib)2-EG-(S)5-(α-MeF)6-TSDV10-S-K(ϵ-(PEG)2-(PEG)2-γE-Lauroyl)12-(F)13-LE15 G-(E)17-AA-
(α-MeK)20 EFI-K(ϵ-(PEG)2-(PEG)2-γE-Lauroyl)24-(F)25-(V)26-V-(E)28-G-(G)30
249 H-(Aib)2-EG-(S)5-(α-MeF)6-TSDV10-S-K(ϵ-(PEG)2-(PEG)2-γE-Lauroyl)12-YLE15 G-(E)17-AA-(α-
MeK)20 EFI-K(ϵ-(PEG)2-(PEG)2-γE-Lauroyl)24-W25-(V)26-V-(E)28-G-(G)30
250 H-(Aib)2-EG-(S)5-(α-MeF)6-TSDV10-S-K(ϵ-(PEG)2-(PEG)2-γE-Palmitate)12-(E)13-LE15 G-(E)17-AA-
(α-MeK)20 EFI-K(ϵ-(PEG)2-(PEG)2-γE-Palmitate)24-(E)25-(V)26-V-(E)28-G-(G)30
251 H-(Aib)2-EG-(S)5-(α-MeF)6-TSDV10-S-K(ϵ-(PEG)2-(PEG)2-γE-Palmitate)12-YLE15 G-(E)17-AA-(α-
MeK)20 EFI-K(ϵ-(PEG)2-(PEG)2-γE-Palmitate)24-W25-(V)26-V-(E)28-G-(G)30
252 H-(Aib)2-EG-(S)5-(α-MeF)6-TSDV10-S-K(ϵ-(PEG)2-(PEG)2-γE-Lauroyl)12-YLE15 G-(E)17-AA-(α-
MeK)20 EFIA-K(ϵ-(PEG)2-(PEG)2-γE-Lauroyl)25-(V)26-V-(E)28-G-(G)30
253 H-(Aib)2-EG-(S)5-(α-MeF)6-TSDV10-S-K(ϵ-(PEG)2-(PEG)2-γE-Lauroyl)12-YLE15 G-(E)17-AA-(α-
MeK)20 EFIAW25-K(ϵ-(PEG)2-(PEG)2-γE-Lauroyl)26-V-(E)28-G-(G)30
254 H-(Aib)2-EG-(S)5-(α-MeF)6-TSDV10-S-K(ϵ-(PEG)2-(PEG)2-γE-Palmitate)12-YLE15 G-(E)17-AA-(α-
MeK)20 EFIA-K(ϵ-(PEG)2-(PEG)2-γE-Palmitate)25-(V)26-V-(E)28-G-(G)30
255 H-(Aib)2-EG-(S)5-(α-MeF)6-TSDV10-S-K(ϵ-(PEG)2-(PEG)2-γE-Palmitate)12-YLE15 G-(E)17-AA-(α-
MeK)20 EFIAW25-K(ϵ-(PEG)2-(PEG)2-γE-Palmitate)26-V-(E)28-G-(G)30
256 H-(Aib)2-EG-(S)5-(α-MeF)6-TSD-K(ϵ-(PEG)2-(PEG)2-γE-Lauroyl)10-SSYLE15 G-(E)17-AA-(α-MeK)20
EFI-K(ϵ-(PEG)2-(PEG)2-γE-Lauroyl)24-W25-(V)26-V-(E)28-G-(G)30
257 H-(Aib)2-EG-(S)5-(α-MeF)6-TSD-K(ϵ-(PEG)2-(PEG)2-γE-Lauroyl)10-SSYLE15 G-(E)17-AA-(α-MeK)20
EFIA-K(ϵ-(PEG)2-(PEG)2-γE-Lauroyl)25-(V)26-V-(E)28-G-(G)30
258 H-(Aib)2-EG-(S)5-(α-MeF)6-TSD-K(ϵ-(PEG)2-(PEG)2-γE-Lauroyl)10-SSYLE15 G-(E)17-AA-(α-MeK)20
EFIAW25-K(ϵ-(PEG)2-(PEG)2-γE-Lauroyl)26-V-(E)28-G-(G)30
259 H-(Aib)2-EG-(S)5-(α-MeF)6-TSD-K(ϵ-(PEG)2-(PEG)2-γE-Palmitate)10-SSYLE15 G-(E)17-AA-(α-
MeK)20 EFI-K(ϵ-(PEG)2-(PEG)2-γE-Palmitate)24-W25-(V)26-V-(E)28-G-(G)30
260 H-(Aib)2-EG-(S)5-(α-MeF)6-TSD-K(ϵ-(PEG)2-(PEG)2-γE-Palmitate)10-SSYLE15 G-(E)17-AA-(α-
MeK)20 EFIA-K(ϵ-(PEG)2-(PEG)2-γE-Palmitate)25-(V)26-V-(E)28-G-(G)30
261 H-(Aib)2-EG-(S)5-(α-MeF)6-TSD-K(ϵ-(PEG)2-(PEG)2-γE-Palmitate)10-SSYLE15 G-(E)17-AA-(α-
MeK)20 EFIAW25-K(ϵ-(PEG)2-(PEG)2-γE-Palmitate)26-V-(E)28-G-(G)30
262 H-(Aib)2-EG-(S)5-(α-MeF)6-TSDV10-(α-MeS)11-S-K(ϵ-(PEG)2-(PEG)2-γE-Lauroyl)13-LE15 G-(E)17-
AA-(α-MeK)20 EFI-K(ϵ-(PEG)2-(PEG)2-γE-Lauroyl)24-W25-(V)26-V-(E)28-G-(G)30
263 H-(Aib)2-EG-(S)5-(α-MeF)6-TSDV10-(α-MeS)11-S-K(ϵ-(PEG)2-(PEG)2-γE-Lauroyl)13-LE15 G-(E)17-
AA-(α-MeK)20 EFIA-K(ϵ-(PEG)2-(PEG)2-γE-Lauroyl)25-(V)26-V-(E)28-G-(G)30
264 H-(Aib)2-EG-(S)5-(α-MeF)6-TSDV10-(α-MeS)11-S-K(ϵ-(PEG)2-(PEG)2-γE-Lauroyl)13-LE15 G-(E)17-
AA-(α-MeK)20 EFIAW25-K(-ϵ-(PEG)2-(PEG)2-γE-Lauroyl)26-V-(E)28-G-(G)30
265 H-(Aib)2-EG-(S)5-(α-MeF)6-TSDV10-(α-MeS)11-S-K(ϵ-(PEG)2-(PEG)2-γE-Palmitate)13-LE15 G-
(E)17-AA-(α-MeK)20 EFI-K(ϵ-(PEG)2-(PEG)2-γE-Palmitate)24-W25-(V)26-V-(E)28-G-(G)30
266 H-(Aib)2-EG-(S)5-(α-MeF)6-TSDV10-(α-MeS)11-S-K(ϵ-(PEG)2-(PEG)2-γE-Palmitate)13-LE15 G-
(E)17-AA-(α-MeK)20 EFIA-K(ϵ-(PEG)2-(PEG)2-γE-Palmitate)25-(V)26-V-(E)28-G-(G)30
267 H-(Aib)2-EG-(S)5-(α-MeF)6-TSDV10-(α-MeS)11-S-K(ϵ-(PEG)2-(PEG)2-γE-Palmitate)13-LE15 G-
(E)17-AA-(α-MeK)20 EFIAW25-K(ϵ-(PEG)2-(PEG)2-γE-Palmitate)26-V-(E)28-G-(G)30
268 H-(Aib)2-EG-(S)5-(α-MeF)6-TSDV10-(α-MeS)11-SY-K(ϵ-(PEG)2-(PEG)2-γE-Lauroyl)14-E15 G-(E)17-
AA-(α-MeK)20 EFI-K(-ϵ-(PEG)2-(PEG)2-γE-Lauroyl)24-W25-(V)26-V-(E)28-G-(G)30
269 H-(Aib)2-EG-(S)5-(α-MeF)6-TSDV10-(α-MeS)11-SY-K(ϵ-(PEG)2-(PEG)2-γE-Lauroyl)14-E15 G-(E)17-
AA-(α-MeK)20 EFIA-K(-ϵ-(PEG)2-(PEG)2-γE-Lauroyl)25-(V)26-V-(E)28-G-(G)30
270 H-(Aib)2-EG-(S)5-(α-MeF)6-TSDV10-(α-MeS)11-SY-K(ϵ-(PEG)2-(PEG)2-γE-Lauroyl)14-E15 G-(E)17-
AA-(α-MeK)20 EFIAW25-K(-ϵ-(PEG)2-(PEG)2-γE-Lauroyl)26-V-(E)28-G-(G)30
271 H-(Aib)2-EG-(S)5-(α-MeF)6-TSDV10-(α-MeS)11-SY-K(ϵ-(PEG)2-(PEG)2-γE-Palmitate)14-E15 G-
(E)17-AA-(α-MeK)20 EFI-K(ϵ-(PEG)2-(PEG)2-γE-Palmitate)24-W25-(V)26-V-(E)28-G-(G)30
272 H-(Aib)2-EG-(S)5-(α-MeF)6-TSDV10-(α-MeS)11-SY-K(ϵ-(PEG)2-(PEG)2-γE-Palmitate)14-E15 G-
(E)17-AA-(α-MeK)20 EFIA-K(ϵ-(PEG)2-(PEG)2-γE-Palmitate)25-(V)26-V-(E)28-G-(G)30
273 H-(Aib)2-EG-(S)5-(α-MeF)6-TSDV10-(α-MeS)11-SY-K(ϵ-(PEG)2-(PEG)2-γE-Palmitate)14-E15 G-
(E)17-AA-(α-MeK)20 EFIAW25-K(ϵ-(PEG)2-(PEG)2-γE-Palmitate)26-V-(E)28-G-(G)30
274 H-(Aib)2-EG-(S)5-(α-MeF)6-TSDV10-S-K(ϵ-(PEG)2-(PEG)2-γE-Lauroyl)12-YLE15 G-(E)17-AA-(E)20
EFIA-K(ϵ-(PEG)2-(PEG)2-γE-Lauroyl)25-(V)26-V-(E)28-G-(G)30
275 H-(Aib)2-EG-(S)5-(α-MeF)6-TSDV10-S-K(ϵ-(PEG)2-(PEG)2-γE-Lauroyl)12-YLE15 G-(E)17-AA-(E)20
EFIAW25-K(ϵ-(PEG)2-(PEG)2-γE-Lauroyl)26-V-(E)28-G-(G)30
276 H-(Aib)2-EG-(S)5-(α-MeF)6-TSDV10-S-K(ϵ-(PEG)2-(PEG)2-γE-Palmitate)12-YLE15 G-(E)17-AA-(E)20
EFIA-K(ϵ-(PEG)2-(PEG)2-γE-Palmitate)25-(V)26-V-(E)28-G-(G)30
277 H-(Aib)2-EG-(S)5-(α-MeF)6-TSDV10-S-K(ϵ-(PEG)2-(PEG)2-γE-Palmitate)12-YLE15 G-(E)17-AA-(E)20
EFIAW25-K(ϵ-(PEG)2-(PEG)2-γE-Palmitate)26-V-(E)28-G-(G)30
278 H-(Aib)2-EG-(S)5-(α-MeF)6-TSD-K(ϵ-(PEG)2-(PEG)2-γE-Lauroyl)10-SSYLE15 G-(E)17-AA-(E)20
EFI-K(ϵ-(PEG)2-(PEG)2-γE-Lauroyl)24-W25-(V)26-V-(E)28-G-(G)30
279 H-(Aib)2-EG-(S)5-(α-MeF)6-TSD-K(ϵ-(PEG)2-(PEG)2-γE-Lauroyl)10-SSYLE15 G-(E)17-AA-(E)20
EFIA-K(ϵ-(PEG)2-(PEG)2-γE-Lauroyl)25-(V)26-V-(E)28-G-(G)30
280 H-(Aib)2-EG-(S)5-(α-MeF)6-TSD-K(ϵ-(PEG)2-(PEG)2-γE-Lauroyl)10-SSYLE15 G-(E)17-AA-(E)20
EFIAW25-K(ϵ-(PEG)2-(PEG)2-γE-Lauroyl)26-V-(E)28-G-(G)30
281 H-(Aib)2-EG-(S)5-(α-MeF)6-TSD-K(ϵ-(PEG)2-(PEG)2-γE-Palmitate)10-SSYLE15 G-(E)17-AA-(E)20
EFI-K(ϵ-(PEG)2-(PEG)2-γE-Palmitate)24-W25-(V)26-V-(E)28-G-(G)30
282 H-(Aib)2-EG-(S)5-(α-MeF)6-TSD-K(ϵ-(PEG)2-(PEG)2-γE-Palmitate)10-SSYLE15 G-(E)17-AA-(E)20
EFIA-K(ϵ-(PEG)2-(PEG)2-γE-Palmitate)25-(V)26-V-(E)28-G-(G)30
283 H-(Aib)2-EG-(S)5-(α-MeF)6-TSD-K(ϵ-(PEG)2-(PEG)2-γE-Palmitate)10-SSYLE15 G-(E)17-AA-(E)20
EFIAW25-K(ϵ-(PEG)2-(PEG)2-γE-Palmitate)26-V-(E)28-G-(G)30
284 H-(Aib)2-EG-(S)5-(α-MeF)6-TSDV10-(α-MeS)11-S-K(ϵ-(PEG)2-(PEG)2-γE-Lauroyl)13-LE15 G-(E)17-
AA-(E)20 EFI-K(ϵ-(PEG)2-(PEG)2-γE-Lauroyl)24-W25-(V)26-V-(E)28-G-(G)30
285 H-(Aib)2-EG-(S)5-(α-MeF)6-TSDV10-(α-MeS)11-S-K(ϵ-(PEG)2-(PEG)2-γE-Lauroyl)13-LE15 G-(E)17-
AA-(E)20 EFIA-K(ϵ-(PEG)2-(PEG)2-γE-Lauroyl)25-(V)26-V-(E)28-G-(G)30
286 H-(Aib)2-EG-(S)5-(α-MeF)6-TSDV10-(α-MeS)11-S-K(ϵ-(PEG)2-(PEG)2-γE-Lauroyl)13-LE15 G-(E)17-
AA-(E)20 EFIAW25-K(-ϵ-(PEG)2-(PEG)2-γE-Lauroyl)26-V-(E)28-G-(G)30
287 H-(Aib)2-EG-(S)5-(α-MeF)6-TSDV10-(α-MeS)11-S-K(ϵ-(PEG)2-(PEG)2-γE-Palmitate)13-LE15 G-
(E)17-AA-(E)20 EFI-K(ϵ-(PEG)2-(PEG)2-γE-Palmitate)24-W25-(V)26-V-(E)28-G-(G)30
288 H-(Aib)2-EG-(S)5-(α-MeF)6-TSDV10-(α-MeS)11-S-K(ϵ-(PEG)2-(PEG)2-γE-Palmitate)13-LE15 G-
(E)17-AA-(E)20 EFIA-K(ϵ-(PEG)2-(PEG)2-γE-Palmitate)25-(V)26-V-(E)28-G-(G)30
289 H-(Aib)2-EG-(S)5-(α-MeF)6-TSDV10-(α-MeS)11-S-K(ϵ-(PEG)2-(PEG)2-γE-Palmitate)13-LE15 G-
(E)17-AA-(E)20 EFIAW25-K(ϵ-(PEG)2-(PEG)2-γE-Palmitate)26-V-(E)28-G-(G)30
290 H-(Aib)2-EG-(S)5-(α-MeF)6-TSDV10-(α-MeS)11-SY-K(ϵ-(PEG)2-(PEG)2-γE-Lauroyl)14-E15 G-(E)17-
AA-(E)20 EFI-K(-ϵ-(PEG)2-(PEG)2-γE-Lauroyl)24-W25-(V)26-V-(E)28-G-(G)30
291 H-(Aib)2-EG-(S)5-(α-MeF)6-TSDV10-(α-MeS)11-SY-K(ϵ-(PEG)2-(PEG)2-γE-Lauroyl)14-E15 G-(E)17-
AA-(E)20 EFIA-K(-ϵ-(PEG)2-(PEG)2-γE-Lauroyl)25-(V)26-V-(E)28-G-(G)30
292 H-(Aib)2-EG-(S)5-(α-MeF)6-TSDV10-(α-MeS)11-SY-K(ϵ-(PEG)2-(PEG)2-γE-Lauroyl)14-E15 G-(E)17-
AA-(E)20 EFIAW25-K(-ϵ-(PEG)2-(PEG)2-γE-Lauroyl)26-V-(E)28-G-(G)30
293 H-(Aib)2-EG-(S)5-(α-MeF)6-TSDV10-(α-MeS)11-SY-K(ϵ-(PEG)2-(PEG)2-γE-Palmitate)14-E15 G-
(E)17-AA-(E)20 EFI-K(ϵ-(PEG)2-(PEG)2-γE-Palmitate)24-W25-(V)26-V-(E)28-G-(G)30
294 H-(Aib)2-EG-(S)5-(α-MeF)6-TSDV10-(α-MeS)11-SY-K(ϵ-(PEG)2-(PEG)2-γE-Palmitate)14-E15 G-
(E)17-AA-(E)20 EFIA-K(ϵ-(PEG)2-(PEG)2-γE-Palmitate)25-(V)26-V-(E)28-G-(G)30
295 H-(Aib)2-EG-(S)5-(α-MeF)6-TSDV10-(α-MeS)11-SY-K(ϵ-(PEG)2-(PEG)2-γE-Palmitate)14-E15 G-
(E)17-AA-(E)20 EFIAW25-K(ϵ-(PEG)2-(PEG)2-γE-Palmitate)26-V-(E)28-G-(G)30
296 H-(Aib)2-EG-(S)5-(α-MeF)6-TSDV10-S-K(ϵ-(PEG)2-(PEG)2-γE-Myristoyl)12-YLE15 G-(E)17-AA-(E)20
EFI-K(ϵ-(PEG)2-(PEG)2-γE-Myristoyl)24-W25-(V)26-V-(E)28-G-(G)30
297 H-(Aib)2-EG-(S)5-(α-MeF)6-TSDV10-S-K(ϵ-(PEG)2-(PEG)2-γE-Palmitoyl)12-YLE15 G-(E)17-AA-(E)20
EFI-K(ϵ-(PEG)2-(PEG)2-γE-Palmitoyl)24-W25-(V)26-V-(E)28-G-(G)30
298 H-(Aib)2-EG-(S)5-(α-MeF)6-TSDV10-S-K(ϵ-(PEG)2-(PEG)2-γE-Stearoyl)12-YLE15 G-(E)17-AA-(E)20
EFI-K(ϵ-(PEG)2-(PEG)2-γE-Stearoyl)24-W25-(V)26-V-(E)28-G-(G)30
299 H-(Aib)2-EG-(S)5-(α-MeF)6-TSDV10-S-K(ϵ-(PEG)2-(PEG)2-γE-Stearate)12-YLE15 G-(E)17-AA-(E)20
EFI-K(ϵ-(PEG)2-(PEG)2-γE-Stearate)24-W25-(V)26-V-(E)28-G-(G)30
300 H-(Aib)2-EG-(S)5-(α-MeF)6-TSDV10-S-K(ϵ-(PEG)2-(PEG)2-γE-Myristoyl)12-(F)13-LE15 G-(E)17-AA-
(E)20 EFI-K(ϵ-(PEG)2-(PEG)2-γE-Myristoyl)24-(F)25-(V)26-V-(E)28-G-(G)30
301 H-(Aib)2-EG-(S)5-(α-MeF)6-TSDV10-S-K(ϵ-(PEG)2-(PEG)2-γE-Palmitoyl)12-(F)13-LE15 G-(E)17-AA-
(E)20 EFI-K(ϵ-(PEG)2-(PEG)2-γE-Palmitoyl)24-(F)25-(V)26-V-(E)28-G-(G)30
302 H-(Aib)2-EG-(S)5-(α-MeF)6-TSDV10-S-K(ϵ-(PEG)2-(PEG)2-γE-Stearoyl)12-(F)13-LE15 G-(E)17-AA-
(E)20 EFI-K(ϵ-(PEG)2-(PEG)2-γE-Stearoyl)24-(F)25-(V)26-V-(E)28-G-(G)30
303 H-(Aib)2-EG-(S)5-(α-MeF)6-TSDV10-S-K(ϵ-(PEG)2-(PEG)2-γE-Stearate)12-(F)13-LE15 G-(E)17-AA-
(E)20 EFI-K(ϵ-(PEG)2-(PEG)2-γE-Stearate)24-(F)25-(V)26-V-(E)28-G-(G)30
304 H-(Aib)2-EG-(S)5-(α-MeF)6-TSDV10-S-K(ϵ-(PEG)2-(PEG)2-γE-Myristoyl)12-YLE15 G-(E)17-AA-(α-
MeK)20 EFI-K(ϵ-(PEG)2-(PEG)2-γE-Myristoyl)24-W25-(V)26-V-(E)28-G-(G)30
305 H-(Aib)2-EG-(S)5-(α-MeF)6-TSDV10-S-K(ϵ-(PEG)2-(PEG)2-γE-Palmitoyl)12-YLE15 G-(E)17-AA-(α-
MeK)20 EFI-K(ϵ-(PEG)2-(PEG)2-γE-Palmitoyl)24-W25-(V)26-V-(E)28-G-(G)30
306 H-(Aib)2-EG-(S)5-(α-MeF)6-TSDV10-S-K(ϵ-(PEG)2-(PEG)2-γE-Stearoyl)12-YLE15 G-(E)17-AA-(α-
MeK)20 EFI-K(ϵ-(PEG)2-(PEG)2-γE-Stearoyl)24-W25-(V)26-V-(E)28-G-(G)30
307 H-(Aib)2-EG-(S)5-(α-MeF)6-TSDV10-S-K(ϵ-(PEG)2-(PEG)2-γE-Stearate)12-YLE15 G-(E)17-AA-(α-
MeK)20 EFI-K(ϵ-(PEG)2-(PEG)2-γE-Stearate)24-W25-(V)26-V-(E)28-G-(G)30
308 H-(Aib)2-EG-(S)5-(α-MeF)6-TSDV10-S-K(ϵ-(PEG)2-(PEG)2-γE-Myristoyl)12-(F)13-LE15 G-(E)17-AA-
(α-MeK)20 EFI-K(ϵ-(PEG)2-(PEG)2-γE-Myristoyl)24-(F)25-(V)26-V-(E)28-G-(G)30
309 H-(Aib)2-EG-(S)5-(α-MeF)6-TSDV10-S-K(ϵ-(PEG)2-(PEG)2-γE-Palmitoyl)12-(F)13-LE15 G-(E)17-AA-
(α-MeK)20 EFI-K(ϵ-(PEG)2-(PEG)2-γE-Palmitoyl)24-(F)25-(V)26-V-(E)28-G-(G)30
310 H-(Aib)2-EG-(S)5-(α-MeF)6-TSDV10-S-K(ϵ-(PEG)2-(PEG)2-γE-Stearoyl)12-(F)13-LE15 G-(E)17-AA-
(α-MeK)20 EFI-K(ϵ-(PEG)2-(PEG)2-γE-Stearoyl)24-(F)25-(V)26-V-(E)28-G-(G)30
311 H-(Aib)2-EG-(S)5-(α-MeF)6-TSDV10-S-K(ϵ-(PEG)2-(PEG)2-γE-Stearate)12-(F)13-LE15 G-(E)17-AA-
(α-MeK)20 EFI-K(ϵ-(PEG)2-(PEG)2-γE-Stearate)24-(E)25-(V)26-V-(E)28-G-(G)30
312 H-(Aib)2-EG-(S)5-(α-MeF)6-TSDV10-S-K(ϵ-(PEG)2-(PEG)2-γE-Lauroyl)12-(F)13-LE15 G-(E)17-AA-
(Aib)20 EFI-K(ϵ-(PEG)2-(PEG)2-γE-Lauroyl)24-(F)25-(V)26-V-(E)28-G-(G)30
313 H-(Aib)2-EG-(S)5-(α-MeF)6-TSDV10-S-K(ϵ-(PEG)2-(PEG)2-γE-Lauroyl)12-YLE15 G-(E)17-AA-(Aib)20
EFI-K(ϵ-(PEG)2-(PEG)2-γE-Lauroyl)24-W25-(V)26-V-(E)28-G-(G)30
314 H-(Aib)2-EG-(S)5-(α-MeF)6-TSDV10-S-K(ϵ-(PEG)2-(PEG)2-γE-Palmitate)12-(E)13-LE15 G-(E)17-AA-
(Aib)20 EFI-K(ϵ-(PEG)2-(PEG)2-γE-Palmitate)24-(E)25-(V)26-V-(E)28-G-(G)30
315 H-(Aib)2-EG-(S)5-(α-MeF)6-TSDV10-S-K(ϵ-(PEG)2-(PEG)2-γE-Palmitate)12-YLE15 G-(E)17-AA-
(Aib)20 EFI-K(ϵ-(PEG)2-(PEG)2-γE-Palmitate)24-W25-(V)26-V-(E)28-G-(G)30
316 H-(Aib)2-EG-(S)5-(α-MeF)6-TSDV10-S-K(ϵ-(PEG)2-(PEG)2-γE-Lauroyl)12-YLE15 G-(E)17-AA-(Aib)20
EFIA-K(ϵ-(PEG)2-(PEG)2-γE-Lauroyl)25-(V)26-V-(E)28-G-(G)30
317 H-(Aib)2-EG-(S)5-(α-MeF)6-TSDV10-S-K(ϵ-(PEG)2-(PEG)2-γE-Lauroyl)12-YLE15 G-(E)17-AA-(Aib)20
EFIAW25-K(ϵ-(PEG)2-(PEG)2-γE-Lauroyl)26-V-(E)28-G-(G)30
318 H-(Aib)2-EG-(S)5-(α-MeF)6-TSDV10-S-K(ϵ-(PEG)2-(PEG)2-γE-Palmitate)12-YLE15 G-(E)17-AA-
(Aib)20 EFIA-K(ϵ-(PEG)2-(PEG)2-γE-Palmitate)25-(V)26-V-(E)28-G-(G)30
319 H-(Aib)2-EG-(S)5-(α-MeF)6-TSDV10-S-K(ϵ-(PEG)2-(PEG)2-γE-Palmitate)12-YLE15 G-(E)17-AA-
(Aib)20 EFIAW25-K(ϵ-(PEG)2-(PEG)2-γE-Palmitate)26-V-(E)28-G-(G)30
320 H-(Aib)2-EG-(S)5-(α-MeF)6-TSD-K(ϵ-(PEG)2-(PEG)2-γE-Lauroyl)10-SSYLE15 G-(E)17-AA-(Aib)20
EFI-K(ϵ-(PEG)2-(PEG)2-γE-Lauroyl)24-W25-(V)26-V-(E)28-G-(G)30
321 H-(Aib)2-EG-(S)5-(α-MeF)6-TSD-K(ϵ-(PEG)2-(PEG)2-γE-Lauroyl)10-SSYLE15 G-(E)17-AA-(Aib)20
EFIA-K(ϵ-(PEG)2-(PEG)2-γE-Lauroyl)25-(V)26-V-(E)28-G-(G)30
322 H-(Aib)2-EG-(S)5-(α-MeF)6-TSD-K(ϵ-(PEG)2-(PEG)2-γE-Lauroyl)10-SSYLE15 G-(E)17-AA-(Aib)20
EFIAW25-K(ϵ-(PEG)2-(PEG)2-γE-Lauroyl)26-V-(E)28-G-(G)30
323 H-(Aib)2-EG-(S)5-(α-MeF)6-TSD-K(ϵ-(PEG)2-(PEG)2-γE-Palmitate)10-SSYLE15 G-(E)17-AA-(Aib)20
EFI-K(ϵ-(PEG)2-(PEG)2-γE-Palmitate)24-W25-(V)26-V-(E)28-G-(G)30
324 H-(Aib)2-EG-(S)5-(α-MeF)6-TSD-K(ϵ-(PEG)2-(PEG)2-γE-Palmitate)10-SSYLE15 G-(E)17-AA-(Aib)20
EFIA-K(ϵ-(PEG)2-(PEG)2-γE-Palmitate)25-(V)26-V-(E)28-G-(G)30
325 H-(Aib)2-EG-(S)5-(α-MeF)6-TSD-K(ϵ-(PEG)2-(PEG)2-γE-Palmitate)10-SSYLE15 G-(E)17-AA-(Aib)20
EFIAW25-K(ϵ-(PEG)2-(PEG)2-γE-Palmitate)26-V-(E)28-G-(G)30
326 H-(Aib)2-EG-(S)5-(α-MeF)6-TSDV10-(α-MeS)11-S-K(ϵ-(PEG)2-(PEG)2-γE-Lauroyl)13-LE15 G-(E)17-
AA-(Aib)20 EFI-K(ϵ-(PEG)2-(PEG)2-γE-Lauroyl)24-W25-(V)26-V-(E)28-G-(G)30
327 H-(Aib)2-EG-(S)5-(α-MeF)6-TSDV10-(α-MeS)11-S-K(ϵ-(PEG)2-(PEG)2-γE-Lauroyl)13-LE15 G-(E)17-
AA-(Aib)20 EFIA-K(ϵ-(PEG)2-(PEG)2-γE-Lauroyl)25-(V)26-V-(E)28-G-(G)30
328 H-(Aib)2-EG-(S)5-(α-MeF)6-TSDV10-(α-MeS)11-S-K(ϵ-(PEG)2-(PEG)2-γE-Lauroyl)13-LE15 G-(E)17-
AA-(Aib)20 EFIAW25-K(-ϵ-(PEG)2-(PEG)2-γE-Lauroyl)26-V-(E)28-G-(G)30
329 H-(Aib)2-EG-(S)5-(α-MeF)6-TSDV10-(α-MeS)11-S-K(ϵ-(PEG)2-(PEG)2-γE-Palmitate)13-LE15 G-
(E)17-AA-(Aib)20 EFI-K(ϵ-(PEG)2-(PEG)2-γE-Palmitate)24-W25-(V)26-V-(E)28-G-(G)30
330 H-(Aib)2-EG-(S)5-(α-MeF)6-TSDV10-(α-MeS)11-S-K(ϵ-(PEG)2-(PEG)2-γE-Palmitate)13-LE15 G-
(E)17-AA-(Aib)20 EFIA-K(ϵ-(PEG)2-(PEG)2-γE-Palmitate)25-(V)26-V-(E)28-G-(G)30
331 H-(Aib)2-EG-(S)5-(α-MeF)6-TSDV10-(α-MeS)11-S-K(ϵ-(PEG)2-(PEG)2-γE-Palmitate)13-LE15 G-
(E)17-AA-(Aib)20 EFIAW25-K(ϵ-(PEG)2-(PEG)2-γE-Palmitate)26-V-(E)28-G-(G)30
332 H-(Aib)2-EG-(S)5-(α-MeF)6-TSDV10-(α-MeS)11-SY-K(ϵ-(PEG)2-(PEG)2-γE-Lauroyl)14-E15 G-(E)17-
AA-(Aib)20 EFI-K(-ϵ-(PEG)2-(PEG)2-γE-Lauroyl)24-W25-(V)26-V-(E)28-G-(G)30
333 H-(Aib)2-EG-(S)5-(α-MeF)6-TSDV10-(α-MeS)11-SY-K(ϵ-(PEG)2-(PEG)2-γE-Lauroyl)14-E15 G-(E)17-
AA-(Aib)20 EFIA-K(-ϵ-(PEG)2-(PEG)2-γE-Lauroyl)25-(V)26-V-(E)28-G-(G)30
334 H-(Aib)2-EG-(S)5-(α-MeF)6-TSDV10-(α-MeS)11-SY-K(ϵ-(PEG)2-(PEG)2-γE-Lauroyl)14-E15 G-(E)17-
AA-(Aib)20 EFIAW25-K(-ϵ-(PEG)2-(PEG)2-γE-Lauroyl)26-V-(E)28-G-(G)30
335 H-(Aib)2-EG-(S)5-(α-MeF)6-TSDV10-(α-MeS)11-SY-K(ϵ-(PEG)2-(PEG)2-γE-Palmitate)14-E15 G-
(E)17-AA-(Aib)20 EFI-K(ϵ-(PEG)2-(PEG)2-γE-Palmitate)24-W25-(V)26-V-(E)28-G-(G)30
336 H-(Aib)2-EG-(S)5-(α-MeF)6-TSDV10-(α-MeS)11-SY-K(ϵ-(PEG)2-(PEG)2-γE-Palmitate)14-E15 G-
(E)17-AA-(Aib)20 EFIA-K(ϵ-(PEG)2-(PEG)2-γE-Palmitate)25-(V)26-V-(E)28-G-(G)30
337 H-(Aib)2-EG-(S)5-(α-MeF)6-TSDV10-(α-MeS)11-SY-K(ϵ-(PEG)2-(PEG)2-γE-Palmitate)14-E15 G-
(E)17-AA-(Aib)20 EFIAW25-K(ϵ-(PEG)2-(PEG)2-γE-Palmitate)26-V-(E)28-G-(G)30
338 H-(Aib)2-EG-(S)5-(α-MeF)6-TSDV10-S-K(ϵ-(PEG)2-(PEG)2-γE-Myristoyl)12-YLE15 G-(E)17-AA-
(Aib)20 EFI-K(ϵ-(PEG)2-(PEG)2-γE-Myristoyl)24-W25-(V)26-V-(E)28-G-(G)30
339 H-(Aib)2-EG-(S)5-(α-MeF)6-TSDV10-S-K(ϵ-(PEG)2-(PEG)2-γE-Palmitoyl)12-YLE15 G-(E)17-AA-
(Aib)20 EFI-K(ϵ-(PEG)2-(PEG)2-γE-Palmitoyl)24-W25-(V)26-V-(E)28-G-(G)30
340 H-(Aib)2-EG-(S)5-(α-MeF)6-TSDV10-S-K(ϵ-(PEG)2-(PEG)2-γE-Stearoyl)12-YLE15 G-(E)17-AA-
(Aib)20 EFI-K(ϵ-(PEG)2-(PEG)2-γE-Stearoyl)24-W25-(V)26-V-(E)28-G-(G)30
341 H-(Aib)2-EG-(S)5-(α-MeF)6-TSDV10-S-K(ϵ-(PEG)2-(PEG)2-γE-Stearate)12-YLE15 G-(E)17-AA-
(Aib)20 EFI-K(ϵ-(PEG)2-(PEG)2-γE-Stearate)24-W25-(V)26-V-(E)28-G-(G)30
342 H-(Aib)2-EG-(S)5-(α-MeF)6-TSDV10-S-K(ϵ-(PEG)2-(PEG)2-γE-Myristoyl)12-(F)13-LE15 G-(E)17-AA-
(Aib)20 EFI-K(ϵ-(PEG)2-(PEG)2-γE-Myristoyl)24-(F)25-(V)26-V-(E)28-G-(G)30
343 H-(Aib)2-EG-(S)5-(α-MeF)6-TSDV10-S-K(ϵ-(PEG)2-(PEG)2-γE-Palmitoyl)12-(F)13-LE15 G-(E)17-AA-
(Aib)20 EFI-K(ϵ-(PEG)2-(PEG)2-γE-Palmitoyl)24-(F)25-(V)26-V-(E)28-G-(G)30
344 H-(Aib)2-EG-(S)5-(α-MeF)6-TSDV10-S-K(ϵ-(PEG)2-(PEG)2-γE-Stearoyl)12-(F)13-LE15 G-(E)17-AA-
(Aib)20 EFI-K(ϵ-(PEG)2-(PEG)2-γE-Stearoyl)24-(F)25-(V)26-V-(E)28-G-(G)30
345 H-(Aib)2-EG-(S)5-(α-MeF)6-TSDV10-S-K(ϵ-(PEG)2-(PEG)2-γE-Stearate)12-(F)13-LE15 G-(E)17-AA-
(Aib)20 EFI-K(ϵ-(PEG)2-(PEG)2-γE-Stearate)24-(F)25-(V)26-V-(E)28-G-(G)30
346 H-(Aib)2-EG-(S)5-(α-MeF)6-TSDV10-S-K(ϵ-(PEG)2-(PEG)2-γE-Myristoyl)12-YLE15 G-(E)17-AA-(E)20
EFIA-K(ϵ-(PEG)2-(PEG)2-γE-Myristoyl)25-(V)26-V-(E)28-G-(G)30
347 H-(Aib)2-EG-(S)5-(α-MeF)6-TSDV10-S-K(ϵ-(PEG)2-(PEG)2-γE-Palmitoyl)12-YLE15 G-(E)17-AA-(E)20
EFIA-K(ϵ-(PEG)2-(PEG)2-γE-Palmitoyl)25-(V)26-V-(E)28-G-(G)30
348 H-(Aib)2-EG-(S)5-(α-MeF)6-TSDV10-S-K(ϵ-(PEG)2-(PEG)2-γE-Stearoyl)12-YLE15 G-(E)17-AA-(E)20
EFIA-K(ϵ-(PEG)2-(PEG)2-γE-Stearoyl)25-(V)26-V-(E)28-G-(G)30
349 H-(Aib)2-EG-(S)5-(α-MeF)6-TSDV10-S-K(ϵ-(PEG)2-(PEG)2-γE-Stearate)12-YLE15 G-(E)17-AA-(E)20
EFIA-K(ϵ-(PEG)2-(PEG)2-γE-Stearate)25-(V)26-V-(E)28-G-(G)30
350 H-(Aib)2-EG-(S)5-(α-MeF)6-TSDV10-S-K(ϵ-(PEG)2-(PEG)2-γE-Myristoyl)12-(F)13-LE15 G-(E)17-AA-
(E)20 EFIA-K(ϵ-(PEG)2-(PEG)2-γE-Myristoyl)25-(V)26-V-(E)28-G-(G)30
351 H-(Aib)2-EG-(S)5-(α-MeF)6-TSDV10-S-K(ϵ-(PEG)2-(PEG)2-γE-Palmitoyl)12-(F)13-LE15 G-(E)17-AA-
(E)20 EFIA-K(ϵ-(PEG)2-(PEG)2-γE-Palmitoyl)25-(V)26-V-(E)28-G-(G)30
352 H-(Aib)2-EG-(S)5-(α-MeF)6-TSDV10-S-K(ϵ-(PEG)2-(PEG)2-γE-Stearoyl)12-(F)13-LE15 G-(E)17-AA-
(E)20 EFIA-K(ϵ-(PEG)2-(PEG)2-γE-Stearoyl)25-(V)26-V-(E)28-G-(G)30
353 H-(Aib)2-EG-(S)5-(α-MeF)6-TSDV10-S-K(ϵ-(PEG)2-(PEG)2-γE-Stearate)12-(F)13-LE15 G-(E)17-AA-
(E)20 EFIA-K(ϵ-(PEG)2-(PEG)2-γE-Stearate)25-(V)26-V-(E)28-G-(G)30
354 H-(Aib)2-EG-(S)5-(α-MeF)6-TSDV10-S-K(ϵ-(PEG)2-(PEG)2-γE-Myristoyl)12-YLE15 G-(E)17-AA-(α-
MeK)20 EFIA-K(ϵ-(PEG)2-(PEG)2-γE-Myristoyl)25-(V)26-V-(E)28-G-(G)30
355 H-(Aib)2-EG-(S)5-(α-MeF)6-TSDV10-S-K(ϵ-(PEG)2-(PEG)2-γE-Palmitoyl)12-YLE15 G-(E)17-AA-(α-
MeK)20 EFIA-K(ϵ-(PEG)2-(PEG)2-γE-Palmitoyl)25-(V)26-V-(E)28-G-(G)30
356 H-(Aib)2-EG-(S)5-(α-MeF)6-TSDV10-S-K(ϵ-(PEG)2-(PEG)2-γE-Stearoyl)12-YLE15 G-(E)17-AA-(α-
MeK)20 EFIA-K(ϵ-(PEG)2-(PEG)2-γE-Stearoyl)25-(V)26-V-(E)28-G-(G)30
357 H-(Aib)2-EG-(S)5-(α-MeF)6-TSDV10-S-K(ϵ-(PEG)2-(PEG)2-γE-Stearate)12-YLE15 G-(E)17-AA-(α-
MeK)20 EFIA-K(ϵ-(PEG)2-(PEG)2-γE-Stearate)25-(V)26-V-(E)28-G-(G)30
358 H-(Aib)2-EG-(S)5-(α-MeF)8-TSDV10-S-K(ϵ-(PEG)2-(PEG)2-γE-Myristoyl)12-(F)13-LE15 G-(E)17-AA-
(α-MeK)20 EFIA-K(ϵ-(PEG)2-(PEG)2-γE-Myristoyl)25-(V)26-V-(E)28-G-(G)30
359 H-(Aib)2-EG-(S)5-(α-MeF)6-TSDV10-S-K(ϵ-(PEG)2-(PEG)2-γE-Palmitoyl)12-(F)13-LE15 G-(E)17-AA-
(α-MeK)20 EFIA-K(ϵ-(PEG)2-(PEG)2-γE-Palmitoyl)25-(V)26-V-(E)28-G-(G)30
360 H-(Aib)2-EG-(S)5-(α-MeF)6-TSDV10-S-K(ϵ-(PEG)2-(PEG)2-γE-Stearoyl)12-(F)13-LE15 G-(E)17-AA-
(α-MeK)20 EFIA-K(ϵ-(PEG)2-(PEG)2-γE-Stearoyl)25-(V)26-V-(E)28-G-(G)30
361 H-(Aib)2-EG-(S)5-(α-MeF)6-TSDV10-S-K(ϵ-(PEG)2-(PEG)2-γE-Stearate)12-(F)13-LE15 G-(E)17-AA-
(α-MeK)20 EFIA-K(ϵ-(PEG)2-(PEG)2-γE-Stearate)25-(V)26-V-(E)28-G-(G)30
362 H-(Aib)2-EG-(S)5-(α-MeF)6-TSDV10-S-K(ϵ-(PEG)2-(PEG)2-γE-Myristoyl)12-YLE15 G-(E)17-AA-
(Aib)20 EFIA-K(ϵ-(PEG)2-(PEG)2-γE-Myristoyl)25-(V)26-V-(E)28-G-(G)30
363 H-(Aib)2-EG-(S)5-(α-MeF)6-TSDV10-S-K(ϵ-(PEG)2-(PEG)2-γE-Palmitoyl)12-YLE15 G-(E)17-AA-
(Aib)20 EFIA-K(ϵ-(PEG)2-(PEG)2-γE-Palmitoyl)25-(V)26-V-(E)28-G-(G)30
364 H-(Aib)2-EG-(S)5-(α-MeF)6-TSDV10-S-K(ϵ-(PEG)2-(PEG)2-γE-Stearoyl)12-YLE15 G-(E)17-AA-
(Aib)20 EFIA-K(ϵ-(PEG)2-(PEG)2-γE-Stearoyl)25-(V)26-V-(E)28-G-(G)30
365 H-(Aib)2-EG-(S)5-(α-MeF)6-TSDV10-S-K(ϵ-(PEG)2-(PEG)2-γE-Stearate)12-YLE15 G-(E)17-AA-
(Aib)20 EFIA-K(ϵ-(PEG)2-(PEG)2-γE-Stearate)25-(V)26-V-(E)28-G-(G)30
366 H-(Aib)2-EG-(S)5-(α-MeF)6-TSDV10-S-K(ϵ-(PEG)2-(PEG)2-γE-Myristoyl)12-(F)13-LE15 G-(E)17-AA-
(Aib)20 EFIA-K(ϵ-(PEG)2-(PEG)2-γE-Myristoyl)25-(V)26-V-(E)28-G-(G)30
367 H-(Aib)2-EG-(S)5-(α-MeF)6-TSDV10-S-K(ϵ-(PEG)2-(PEG)2-γE-Palmitoyl)12-(F)13-LE15 G-(E)17-AA-
(Aib)20 EFIA-K(ϵ-(PEG)2-(PEG)2-γE-Palmitoyl)25-(V)26-V-(E)28-G-(G)30
368 H-(Aib)2-EG-(S)5-(α-MeF)6-TSDV10-S-K(ϵ-(PEG)2-(PEG)2-γE-Stearoyl)12-(F)13-LE15 G-(E)17-AA-
(Aib)20 EFIA-K(ϵ-(PEG)2-(PEG)2-γE-Stearoyl)25-(V)26-V-(E)28-G-(G)30
369 H-(Aib)2-EG-(S)5-(α-MeF)6-TSDV10-S-K(ϵ-(PEG)2-(PEG)2-γE-Stearate)12-(F)13-LE15 G-(E)17-AA-
(Aib)20 EFIA-K(ϵ-(PEG)2-(PEG)2-γE-Stearate)25-(V)26-V-(E)28-G-(G)30
370 H-(Aib)2-EG-(S)5-(α-MeF)6-TSDV10-(α-MeS)11-S-K(ϵ-(PEG)2-(PEG)2-γE-Myristoyl)13-LE15 G-
(E)17-AA-(α-MeK)20 EFIA-K(ϵ-(PEG)2-(PEG)2-γE-Myristoyl)25-(V)26-V-(E)28-G-(G)30
371 H-(Aib)2-EG-(S)5-(α-MeF)6-TSDV10-(α-MeS)11-S-K(ϵ-(PEG)2-(PEG)2-γE-Palmitoyl)13-LE15 G-
(E)17-AA-(α-MeK)20 EFIA-K(ϵ-(PEG)2-(PEG)2-γE-Palmitoyl)25-(V)26-V-(E)28-G-(G)30
372 H-(Aib)2-EG-(S)5-(α-MeF)6-TSDV10-(α-MeS)11-S-K(ϵ-(PEG)2-(PEG)2-γE-Stearoyl)13-LE15 G-(E)17-
AA-(α-MeK)20 EFIA-K(ϵ-(PEG)2-(PEG)2-γE-Stearoyl)25-(V)26-V-(E)28-G-(G)30
373 H-(Aib)2-EG-(S)5-(α-MeF)6-TSDV10-(α-MeS)11-S-K(ϵ-(PEG)2-(PEG)2-γE-Laurate)13-LE15 G-(E)17-
AA-(α-MeK)20 EFIA-K(ϵ-(PEG)2-(PEG)2-γE-Laurate)25-(V)26-V-(E)28-G-(G)30
374 H-(Aib)2-EG-(S)5-(α-MeF)6-TSDV10-(α-MeS)11-S-K(ϵ-(PEG)2-(PEG)2-γE-Stearate)13-LE15 G-(E)17-
AA-(α-MeK)20 EFIA-K(ϵ-(PEG)2-(PEG)2-γE-Stearate)25-(V)26-V-(E)28-G-(G)30
375 H-(Aib)2-EG-(S)5-(α-MeF)6-TSDV10-(α-MeS)11-S-K(ϵ-(PEG)2-(PEG)2-γE-Myristoyl)13-LE15 G-
(E)17-AA-(E)20 EFIA-K(ϵ-(PEG)2-(PEG)2-γE-Myristoyl)25-(V)26-V-(E)28-G-(G)30
376 H-(Aib)2-EG-(S)5-(α-MeF)6-TSDV10-(α-MeS)11-S-K(ϵ-(PEG)2-(PEG)2-γE-Palmitoyl)13-LE15 G-
(E)17-AA-(E)20 EFIA-K(ϵ-(PEG)2-(PEG)2-γE-Palmitoyl)25-(V)26-V-(E)28-G-(G)30
377 H-(Aib)2-EG-(S)5-(α-MeF)6-TSDV10-(α-MeS)11-S-K(ϵ-(PEG)2-(PEG)2-γE-Stearoyl)13-LE15 G-(E)17-
AA-(E)20 EFIA-K(ϵ-(PEG)2-(PEG)2-γE-Stearoyl)25-(V)26-V-(E)28-G-(G)30
378 H-(Aib)2-EG-(S)5-(α-MeF)6-TSDV10-(α-MeS)11-S-K(ϵ-(PEG)2-(PEG)2-γE-Laurate)13-LE15 G-(E)17-
AA-(E)20 EFIA-K(ϵ-(PEG)2-(PEG)2-γE-Laurate)25-(V)26-V-(E)28-G-(G)30
379 H-(Aib)2-EG-(S)5-(α-MeF)6-TSDV10-(α-MeS)11-S-K(ϵ-(PEG)2-(PEG)2-γE-Stearate)13-LE15 G-(E)17-
AA-(E)20 EFIA-K(ϵ-(PEG)2-(PEG)2-γE-Stearate)25-(V)26-V-(E)28-G-(G)30
380 H-(Aib)2-EG-(S)5-(α-MeF)6-TSDV10-(α-MeS)11-S-K(ϵ-(PEG)2-(PEG)2-γE-Myristoyl)13-LE15 G-
(E)17-AA-(Aib)20 EFIA-K(ϵ-(PEG)2-(PEG)2-γE-Myristoyl)25-(V)26-V-(E)28-G-(G)30
381 H-(Aib)2-EG-(S)5-(α-MeF)6-TSDV10-(α-MeS)11-S-K(ϵ-(PEG)2-(PEG)2-γE-Palmitoyl)13-LE15 G-
(E)17-AA-(Aib)20 EFIA-K(ϵ-(PEG)2-(PEG)2-γE-Palmitoyl)25-(V)26-V-(E)28-G-(G)30
382 H-(Aib)2-EG-(S)5-(α-MeF)6-TSDV10-(α-MeS)11-S-K(ϵ-(PEG)2-(PEG)2-γE-Stearoyl)13-LE15 G-(E)17-
AA-(Aib)20 EFIA-K(ϵ-(PEG)2-(PEG)2-γE-Stearoyl)25-(V)26-V-(E)28-G-(G)30
383 H-(Aib)2-EG-(S)5-(α-MeF)6-TSDV10-(α-MeS)11-S-K(ϵ-(PEG)2-(PEG)2-γE-Laurate)13-LE15 G-(E)17-
AA-(Aib)20 EFIA-K(ϵ-(PEG)2-(PEG)2-γE-Laurate)25-(V)26-V-(E)28-G-(G)30
384 H-(Aib)2-EG-(S)5-(α-MeF)6-TSDV10-(α-MeS)11-S-K(ϵ-(PEG)2-(PEG)2-γE-Stearate)13-LE15 G-(E)17-
AA-(Aib)20 EFIA-K(ϵ-(PEG)2-(PEG)2-γE-Stearate)25-(V)26-V-(E)28-G-(G)30
385 H-(Aib)2-EG-(S)5-(α-MeF)6-TSDV10-(α-MeS)11-S-K(ϵ-γE-Lauroyl)13-LE15 G-(E)17-AA-(α-MeK)20
EFIA-K(ϵ-γE-Lauroyl)25-(V)26-V-(E)28-G-(G)30
386 H-(Aib)2-EG-(S)5-(α-MeF)6-TSDV10-(α-MeS)11-S-K(ϵ-γE-Myristoyl)13-LE15 G-(E)17-AA-(α-MeK)20
EFIA-K(ϵ-γE-Myristoyl)25-(V)26-V-(E)28-G-(G)30
387 H-(Aib)2-EG-(S)5-(α-MeF)6-TSDV10-(α-MeS)11-S-K(ϵ-γE-Palmitoyl)13-LE15 G-(E)17-AA-(α-MeK)20
EFIA-K(ϵ-γE-Palmitoyl)25-(V)26-V-(E)28-G-(G)30
388 H-(Aib)2-EG-(S)5-(α-MeF)6-TSDV10-(α-MeS)11-S-K(ϵ-γE-Stearoyl)13-LE15 G-(E)17-AA-(α-MeK)20
EFIA-K(ϵ-γE-Stearoyl)25-(V)26-V-(E)28-G-(G)30
389 H-(Aib)2-EG-(S)5-(α-MeF)6-TSDV10-(α-MeS)11-S-K(ϵ-(PEG)2-γE-Lauroyl)13-LE15 G-(E)17-AA-(α-
MeK)20 EFIA-K(ϵ-(PEG)2-γE-Lauroyl)25-(V)26-V-(E)28-G-(G)30
390 H-(Aib)2-EG-(S)5-(α-MeF)6-TSDV10-(α-MeS)11-S-K(ϵ-(PEG)2-γE-Myristoyl)13-LE15 G-(E)17-AA-
(α-MeK)20 EFIA-K(ϵ-(PEG)2-γE-Myristoyl)25-(V)26-V-(E)28-G-(G)30
391 H-(Aib)2-EG-(S)5-(α-MeF)6-TSDV10-(α-MeS)11-S-K(ϵ-(PEG)2-γE-Palmitoyl)13-LE15 G-(E)17-AA-
(α-MeK)20 EFIA-K(ϵ-(PEG)2-γE-Palmitoyl)25-(V)26-V-(E)28-G-(G)30
392 H-(Aib)2-EG-(S)5-(α-MeF)6-TSDV10-(α-MeS)11-S-K(ϵ-(PEG)2-γE-Stearoyl)13-LE15 G-(E)17-AA-(α-
MeK)20 EFIA-K(ϵ-(PEG)2-γE-Stearoyl)25-(V)26-V-(E)28-G-(G)30
393 H-(Aib)2-EG-(S)5-(α-MeF)6-TSDV10-SS-K(ϵ-γE-Lauroyl)13-LE15 G-(E)17-AA-(α-MeK)20 EFIA-K(ϵ-
γE-Lauroyl)25-(V)26-V-(E)28-G-(G)30
394 H-(Aib)2-EG-(S)5-(α-MeF)6-TSDV10-SS-K(ϵ-γE-Myristoyl)13-LE15 G-(E)17-AA-(α-MeK)20 EFIA-
K(ϵ-γE-Myristoyl)25-(V)26-V-(E)28-G-(G)30
395 H-(Aib)2-EG-(S)5-(α-MeF)6-TSDV10-SS-K(ϵ-γE-Palmitoyl)13-LE15 G-(E)17-AA-(α-MeK)20 EFIA-
K(ϵ-γE-Palmitoyl)25-(V)26-V-(E)28-G-(G)30
396 H-(Aib)2-EG-(S)5-(α-MeF)6-TSDV10-SS-K(ϵ-γE-Stearoyl)13-LE15 G-(E)17-AA-(α-MeK)20 EFIA-K(ϵ-
γE-Stearoyl)25-(V)26-V-(E)28-G-(G)30
397 H-(Aib)2-EG-(S)5-(α-MeF)6-TSDV10-SS-K(ϵ-(PEG)2-γE-Lauroyl)13-LE15 G-(E)17-AA-(α-MeK)20
EFIA-K(ϵ-(PEG)2-γE-Lauroyl)25-(V)26-V-(E)28-G-(G)30
398 H-(Aib)2-EG-(S)5-(α-MeF)6-TSDV10-SS-K(ϵ-(PEG)2-γE-Myristoyl)13-LE15 G-(E)17-AA-(α-MeK)20
EFIA-K(ϵ-(PEG)2-γE-Myristoyl)25-(V)26-V-(E)28-G-(G)30
399 H-(Aib)2-EG-(S)5-(α-MeF)6-TSDV10-SS-K(ϵ-(PEG)2-γE-Palmitoyl)13-LE15 G-(E)17-AA-(α-MeK)20
EFIA-K(ϵ-(PEG)2-γE-Palmitoyl)25-(V)26-V-(E)28-G-(G)30
400 H-(Aib)2-EG-(S)5-(α-MeF)6-TSDV10-SS-K(ϵ-(PEG)2-γE-Stearoyl)13-LE15 G-(E)17-AA-(α-MeK)20
EFIA-K(ϵ-(PEG)2-γE-Stearoyl)25-(V)26-V-(E)28-G-(G)30
401 H-(Aib)2-EG-(S)5-(α-MeF)6-TSDV10-SS-K(ϵ-(PEG)2-(PEG)2-γE-Lauroyl)13-LE15 G-(E)17-AA-(α-
MeK)20 EFIA-K(ϵ-(PEG)2-(PEG)2-γE-Lauroyl)25-(V)26-V-(E)28-G-(G)30
402 H-(Aib)2-EG-(S)5-(α-MeF)6-TSDV10-SS-K(ϵ-(PEG)2-(PEG)2-γE-Myristoyl)13-LE15 G-(E)17-AA-(α-
MeK)20 EFIA-K(ϵ-(PEG)2-(PEG)2-γE-Myristoyl)25-(V)26-V-(E)28-G-(G)30
403 H-(Aib)2-EG-(S)5-(α-MeF)6-TSDV10-SS-K(ϵ-(PEG)2-(PEG)2-γE-Palmitoyl)13-LE15 G-(E)17-AA-(α-
MeK)20 EFIA-K(ϵ-(PEG)2-(PEG)2-γE-Palmitoyl)25-(V)26-V-(E)28-G-(G)30
404 H-(Aib)2-EG-(S)5-(α-MeF)6-TSDV10-SS-K(ϵ-(PEG)2-(PEG)2-γE-Stearoyl)13-LE15 G-(E)17-AA-(α-
MeK)20 EFIA-K(ϵ-(PEG)2-(PEG)2-γE-Stearoyl)25-(V)26-V-(E)28-G-(G)30
405 H-(Aib)2-EG-(S)5-(α-MeF)6-TSDV10-(α-MeS)11-S-K(ϵ-(PEG)2-(PEG)2-γE-Lauroyl)13-LE15 G-(E)17-
AA-(α-MeK)20 E-(α-MeF)22 IA-K(ϵ-(PEG)2-(PEG)2-γE-Lauroyl)25-(V)26-V-(E)28-G-(G)30
406 H-(Aib)2-EG-(S)5-(α-MeF)6-TSDV10-(α-MeS)11-S-K(ϵ-(PEG)2-(PEG)2-γE-Lauroyl)13-LE15 G-(E)17-
AA-(α-MeK)20 E-(Tyr (0Me)22 IA-K(ϵ-(PEG)2-(PEG)2-γE-Lauroyl)25-(V)26-V-(E)28-G-(G)30
407 H-(Aib)2-EG-(S)5-(α-MeF)6-TSDV10-(α-MeS)11-S-K(ϵ-(PEG)2-(PEG)2-γE-Lauroyl)13-LE15 G-(E)17-
AA-(α-MeK)20 E-(Nle)22 IA-K(ϵ-(PEG)2-(PEG)2-γE-Lauroyl)25-(V)26-V-(E)28-G-(G)30
408 H-(Aib)2-EG-(S)5-(α-MeF)6-TSDV10-(α-MeS)11-S-K(ϵ-(PEG)2-(PEG)2-γE-Myristoyl)13-LE15 G-
(E)17-AA-(α-MeK)20 E-(α-MeF)22 IA-K(ϵ-(PEG)2-(PEG)2-γE-Myristoyl)25-(V)26-V-(E)28-G-(G)30
409 H-(Aib)2-EG-(S)5-(α-MeF)6-TSDV10-(α-MeS)11-S-K(ϵ-(PEG)2-(PEG)2-γE-Palmitoyl)13-LE15 G-
(E)17-AA-(α-MeK)20 E-(α-MeF)22 IA-K(ϵ-(PEG)2-(PEG)2-γE-Palmitoyl)25-(V)26-V-(E)28-G-(G)30
410 H-(Aib)2-EG-(S)5-(α-MeF)6-TSDV10-(α-MeS)11-S-K(ϵ-(PEG)2-(PEG)2-γE-Stearoyl)13-LE15 G-(E)17-
AA-(α-MeK)20 E-(α-MeF)22 IA-K(ϵ-(PEG)2-(PEG)2-γE-Stearoyl)25-(V)26-V-(E)28-G-(G)30
411 H-(Aib)2-EG-(S)5-(α-MeF)6-TSDV10-(α-MeS)11-S-K(ϵ-(PEG)2-(PEG)2-γE-Laurate)13-LE15 G-(E)17-
AA-(α-MeK)20 E-(α-MeF)22 IA-K(ϵ-(PEG)2-(PEG)2-γE-Laurate)25-(V)26-V-(E)28-G-(G)30
412 H-(Aib)2-EG-(S)5-(α-MeF)6-TSDV10-(α-MeS)11-S-K(ϵ-(PEG)2-(PEG)2-γE-Myristate)13-LE15 G-
(E)17-AA-(α-MeK)20 E-(α-MeF)22 IA-K(ϵ-(PEG)2-(PEG)2-γE-Myristate)25-(V)26-V-(E)28-G-(G)30
413 H-(Aib)2-EG-(S)5-(α-MeF)6-TSDV10-(α-MeS)11-S-K(ϵ-(PEG)2-(PEG)2-γE-Palmitate)13-LE15 G-
(E)17-AA-(α-MeK)20 E-(α-MeF)22 IA-K(ϵ-(PEG)2-(PEG)2-γE-Palmitate)25-(V)26-V-(E)28-G-(G)30
414 H-(Aib)2-EG-(S)5-(α-MeF)6-TSDV10-(α-MeS)11-S-K(ϵ-(PEG)2-(PEG)2-γE-Stearate)13-LE15 G-(E)17-
AA-(α-MeK)20 E-(α-MeF)22 IA-K(ϵ-(PEG)2-(PEG)2-γE-Stearate)25-(V)26-V-(E)28-G-(G)30
415 H-(Aib)2-EG-(S)5-(α-MeF)6-TSDV10-(α-MeS)11-S-K(ϵ-(PEG)2-γE-Lauroyl)13-LE15 G-(E)17-AA-(α-
MeK)20 E-(α-MeF)22 IA-K(ϵ-(PEG)2-γE-Lauroyl)25-(V)26-V-(E)28-G-(G)30
416 H-(Aib)2-EG-(S)5-(α-MeF)6-TSDV10-(α-MeS)11-S-K(ϵ-(PEG)2-γE-Myristoyl)13-LE15 G-(E)17-AA-
(α-MeK)20 E-(α-MeF)22 IA-K(ϵ-(PEG)2-γE-Myristoyl)25-(V)26-V-(E)28-G-(G)30
417 H-(Aib)2-EG-(S)5-(α-MeF)6-TSDV10-(α-MeS)11-S-K(ϵ-(PEG)2-γE-Palmitoyl)13-LE15 G-(E)17-AA-
(α-MeK)20 E-(α-MeF)22 IA-K(ϵ-(PEG)2-γE-Palmitoyl)25-(V)26-V-(E)28-G-(G)30
418 H-(Aib)2-EG-(S)5-(α-MeF)6-TSDV10-(α-MeS)11-S-K(ϵ-(PEG)2-γE-Stearoyl)13-LE15 G-(E)17-AA-(α-
MeK)20 E-(α-MeF)22 IA-K(ϵ-(PEG)2-γE-Stearoyl)25-(V)26-V-(E)28-G-(G)30
419 H-(Aib)2-EG-(S)5-(α-MeF)6-TSDV10-(α-MeS)11-S-K(ϵ-(PEG)2-γE-Laurate)13-LE15 G-(E)17-AA-(α-
MeK)20 E-(α-MeF)22 IA-K(ϵ-(PEG)2-γE-Laurate)25-(V)26-V-(E)28-G-(G)30
420 H-(Aib)2-EG-(S)5-(α-MeF)6-TSDV10-(α-MeS)11-S-K(ϵ-(PEG)2-γE-Myristate)13-LE15 G-(E)17-AA-
(α-MeK)20 E-(α-MeF)22 IA-K(ϵ-(PEG)2-γE-Myristate)25-(V)26-V-(E)28-G-(G)30
421 H-(Aib)2-EG-(S)5-(α-MeF)6-TSDV10-(α-MeS)11-S-K(ϵ-(PEG)2-γE-Palmitate)13-LE15 G-(E)17-AA-
(α-MeK)20 E-(α-MeF)22 IA-K(ϵ-(PEG)2-γE-Palmitate)25-(V)26-V-(E)28-G-(G)30
422 H-(Aib)2-EG-(S)5-(α-MeF)6-TSDV10-(α-MeS)11-S-K(ϵ-(PEG)2-γE-Stearate)13-LE15 G-(E)17-AA-(α-
MeK)20 E-(α-MeF)22 IA-K(ϵ-(PEG)2-γE-Stearate)25-(V)26-V-(E)28-G-(G)30
423 H-(Aib)2-EG-(S)5-(α-MeF)6-TSDV10-(α-MeS)11-S-K(ϵ-γE-Lauroyl)13-LE15 G-(E)17-AA-(α-MeK)20 E-
(α-MeF)22 IA-K(ϵ-γE-Lauroyl)25-(V)26-V-(E)28-G-(G)30
424 H-(Aib)2-EG-(S)5-(α-MeF)6-TSDV10-(α-MeS)11-S-K(ϵ-γE-Myristoyl)13-LE15 G-(E)17-AA-(α-MeK)20
E-(α-MeF)22 IA-K(ϵ-γE-Myristoyl)25-(V)26-V-(E)28-G-(G)30
425 H-(Aib)2-EG-(S)5-(α-MeF)6-TSDV10-(α-MeS)11-S-K(ϵ-γE-Palmitoyl)13-LE15 G-(E)17-AA-(α-MeK)20
E-(α-MeF)22 IA-K(ϵ-γE-Palmitoyl)25-(V)26-V-(E)28-G-(G)30
426 H-(Aib)2-EG-(S)5-(α-MeF)6-TSDV10-(α-MeS)11-S-K(ϵ-γE-Stearoyl)13-LE15 G-(E)17-AA-(α-MeK)20
E-(α-MeF)22 IA-K(ϵ-γE-Stearoyl)25-(V)26-V-(E)28-G-(G)30
427 H-(Aib)2-EG-(S)5-(α-MeF)6-TSDV10-(α-MeS)11-S-K(ϵ-γE-Laurate)13-LE15 G-(E)17-AA-(α-MeK)20 E-
(α-MeF)22 IA-K(ϵ-γE-Laurate)25-(V)26-V-(E)28-G-(G)30
428 H-(Aib)2-EG-(S)5-(α-MeF)6-TSDV10-(α-MeS)11-S-K(ϵ-γE-Myristate)13-LE15 G-(E)17-AA-(α-MeK)20
E-(α-MeF)22 IA-K(ϵ-γE-Myristate)25-(V)26-V-(E)28-G-(G)30
429 H-(Aib)2-EG-(S)5-(α-MeF)6-TSDV10-(α-MeS)11-S-K(ϵ-γE-Palmitate)13-LE15 G-(E)17-AA-(α-MeK)20
E-(α-MeF)22 IA-K(ϵ-γE-Palmitate)25-(V)26-V-(E)28-G-(G)30
430 H-(Aib)2-EG-(S)5-(α-MeF)6-TSDV10-(α-MeS)11-S-K(ϵ-γE-Stearate)13-LE15 G-(E)17-AA-(α-MeK)20
E-(α-MeF)22 IA-K(ϵ-γE-Stearate)25-(V)26-V-(E)28-G-(G)30
431 H-(Aib)2-EG-(S)5-(α-MeF)6-TSDV10-(α-MeS)11-S-K(ϵ-Lauroyl)13-LE15 G-(E)17-AA-(α-MeK)20 E-(α-
MeF)22 IA-K(ϵ-Lauroyl)25-(V)26-V-(E)28-G-(G)30
432 H-(Aib)2-EG-(S)5-(α-MeF)6-TSDV10-(α-MeS)11-S-K(ϵ-Myristoyl)13-LE15 G-(E)17-AA-(α-MeK)20 E-
(α-MeF)22 IA-K(ϵ-Myristoyl)25-(V)26-V-(E)28-G-(G)30
433 H-(Aib)2-EG-(S)5-(α-MeF)6-TSDV10-(α-MeS)11-S-K(ϵ-Palmitoyl)13-LE15 G-(E)17-AA-(α-MeK)20 E-
(α-MeF)22 IA-K(ϵ-Palmitoyl)25-(V)26-V-(E)28-G-(G)30
434 H-(Aib)2-EG-(S)5-(α-MeF)6-TSDV10-(α-MeS)11-S-K(ϵ-Stearoyl)13-LE15 G-(E)17-AA-(α-MeK)20 E-
(α-MeF)22 IA-K(ϵ-Stearoyl)25-(V)26-V-(E)28-G-(G)30
435 H-(Aib)2-EG-(S)5-(α-MeF)6-TSDV10-(α-MeS)11-S-K(ϵ-Laurate)13-LE15 G-(E)17-AA-(α-MeK)20 E-(α-
MeF)22 IA-K(ϵ-Laurate)25-(V)26-V-(E)28-G-(G)30
436 H-(Aib)2-EG-(S)5-(α-MeF)6-TSDV10-(α-MeS)11-S-K(ϵ-Myristate)13-LE15 G-(E)17-AA-(α-MeK)20 E-
(α-MeF)22 IA-K(ϵ-Myristate)25-(V)26-V-(E)28-G-(G)30
437 H-(Aib)2-EG-(S)5-(α-MeF)6-TSDV10-(α-MeS)11-S-K(ϵ-Palmitate)13-LE15 G-(E)17-AA-(α-MeK)20 E-
(α-MeF)22 IA-K(ϵ-Palmitate)25-(V)26-V-(E)28-G-(G)30
438 H-(Aib)2-EG-(S)5-(α-MeF)6-TSDV10-(α-MeS)11-S-K(ϵ-Stearate)13-LE15 G-(E)17-AA-(α-MeK)20 E-
(α-MeF)22 IA-K(ϵ-Stearate)25-(V)26-V-(E)28-G-(G)30

In certain embodiments, lipidated GLP-1 peptide analogs are provided comprising at least three lipid modified amino acid residues, such as those shown in Table 3. In certain embodiments, lipidated GLP-1 peptide analogs contain three lipidated amino acid residues. Tris-lipidated GLP-1 peptide analogs disclosed herein can be substantially resistant to proteolytic degradation. For example, in certain embodiments the tris-lipidated peptide is substantially resistant to DPP-IV, neprilysin, α-chymotrypsin, plasmin, thrombin, kallikrein, trypsin, elastase, and/or pepsin degradation. Tris-lipidated GLP-1 peptide analogs disclosed herein can maintain substantially the same or exhibit increased receptor potency and selectivity as a corresponding non-lipidated GLP-1 peptide or GLP-1 peptide analog.

A tris-lipidated peptide is lipid modified at three amino acid residues. In certain embodiments, this can be at three K (lysine) residues, at three C (cysteine) residues, or at one K, one C residue, and a third K or C residue in the same peptide. In certain embodiments, three K residues are lipid modified. Thus, certain embodiments provide for an isolated polypeptide comprising the amino acid sequence:

(SEQ ID NO: 487)
H (Aib) E G S (α-MeF) T S D X10 X11 X12 X13 X14 E
X16 X17 X18 A (α-MeK) X21 F I X24 X25 X26 V E G G;

    • wherein X10 is V or a lipid modified K;
    • X11 is S or an alpha-methyl functionalized amino acid;
    • X12 is S or a lipid modified K;
    • X13 is Y or a lipid modified K;
    • X14 is L or a lipid modified K;
    • X16 is G or a lipid modified K;
    • X17 is E or a lipid modified K;
    • X18 is A or a lipid modified K;
    • X21 is E or a lipid modified K;
    • X24 is A or a lipid modified K;
    • X25 is F or a lipid modified K;
    • X26 is V or a lipid modified K; and
      wherein the polypeptide comprises three lipid modified K residues, and wherein one of X10, X12, X13, or X14 is a lipid modified K residue and one of X16, X17, X18, or X21 is a lipid modified K residue and one of X24, X25, or X26 is a lipid modified K residue.

The lipid modified K residues can be attached to a variety of lipids or lipid moieties such as any of those described herein. Example include those selected from the group consisting of: K(ε-(PEG)2-(PEG)2-γE-Lauroyl); K(ε-(PEG)2-(PEG)2-γE-Palmitate); K(ε-(PEG)2-(PEG)2-γE-Myristoyl); K(ε-(PEG)2-(PEG)2-γE-Palmitoyl); K(ε-(PEG)2-(PEG)2-γE-Stearoyl); K(ε-(PEG)2-(PEG)2-γE-Stearate); and any combination thereof. The lipid modification of the K residues can be the same or different. In certain embodiments, they are the same. Thus, in certain embodiments, at least three lipid modified K residues can all be K(ε-(PEG)2-(PEG)2-γE-Lauroyl); all be K(ε-(PEG)2-(PEG)2-γE-Palmitate); all be K(ε-(PEG)2-(PEG)2-γE-Myristoyl); all be K(ε-(PEG)2-(PEG)2-γE-Palmitoyl); all be K(ε-(PEG)2-(PEG)2-γE-Stearoyl); or all be K(ε-(PEG)2-(PEG)2-γE-Stearate). In certain embodiments of a peptide comprising the amino acid sequence of SEQ ID NO: 487: all modified residues can be K(ε-(PEG)2-(PEG)2-γE-Lauroyl); all can be K(ε-(PEG)2-(PEG)2-γE-Palmitate); all can be K(ε-(PEG)2-(PEG)2-γE-Myristoyl); all can be K(ε-(PEG)2-(PEG)2-γE-Palmitoyl); all can be K(ε-(PEG)2-(PEG)2-γE-Stearoyl); or all can be K(ε-(PEG)2-(PEG)2-γE-Stearate).

TABLE 3
Tris-lipidated Peptide Sequences
Seq
ID ID No
GLP-1   1 HAEGT5 FTSDV10 SSYLE15 GQAAK20 EFIAW25 LVKGR30-amide
(7-36)
Tris- 487 H (Aib) E G S (α-MeF) T S D X10 X11 X12 X13 X14 E X16 X17 X18 A(α-MeK) X21 F I X24
X25 X26 V E G G
439 H-(Aib)2-EG-(S)5-(α-MeF)6-TSD-K(ε-(PEG)2-(PEG)2-γE-Lauroyl)10-SSYLE15-K(ε-(PEG)2-(PEG)2-
γE-Lauroyl)16-(E)17-AA-(α-MeK)20 EFI-K(ε-(PEG)2-(PEG)2-γE-Lauroyl)24-(F)25-(V)26-V-(E)28-G-
(G)30
440 H-(Aib)2-EG-(S)5-(α-MeF)6-TSD-K(ε-(PEG)2-(PEG)2-γE-Lauroyl)10-SSYLE15-G-K(ε-(PEG)2-
(PEG)2-γE-Lauroyl)17-AA-(α-MeK)20 EFI-K(ε-(PEG)2-(PEG)2-γE-Lauroyl)24-(F)25-(V)26-V-(E)28-
G-(G)30
441 H-(Aib)2-EG-(S)5-(α-MeF)6-TSD-K(ε-(PEG)2-(PEG)2-γE-Lauroyl)10-SSYLE15-G-(E)17-K(ε-(PEG)2-
(PEG)2-γE-Lauroyl)18-A-(α-MeK)20 EFI-K(ε-(PEG)2-(PEG)2-γE-Lauroyl)24-(F)25-(V)26-V-(E)28-G-
(G)30
442 H-(Aib)2-EG-(S)5-(α-MeF)6-TSD-K(ε-(PEG)2-(PEG)2-γE-Lauroyl)10-SSYLE15-G-(E)17-AA-(α-MeK)20
K(ε-(PEG)2-(PEG)2-γE-Lauroyl)21-FI-K(ε-(PEG)2-(PEG)2-γE-Lauroyl)24-(F)25-(V)26-V-(E)28-G-
(G)30
443 H-(Aib)2-EG-(S)5-(α-MeF)6-TSDV10-S-K(ε-(PEG)2-(PEG)2-γE-Lauroyl)12-YLE15-K(ε-(PEG)2-
(PEG)2-γE-Lauroyl)16-(E)17-AA-(α-MeK)20 EFI-K(ε-(PEG)2-(PEG)2-γE-Lauroyl)24-(F)25-(V)26-V-
(E)28-G-(G)30
444 H-(Aib)2-EG-(S)5-(α-MeF)6-TSDV10-S-K(ε-(PEG)2-(PEG)2-γE-Lauroyl)12-YLE15-G-K(ε-(PEG)2-
(PEG)2-γE-Lauroyl)17-AA-(α-MeK)20 EFI-K(ε-(PEG)2-(PEG)2-γE-Lauroyl)24-(F)25-(V)26-V-(E)28-
G-(G)30
445 H-(Aib)2-EG-(S)5-(α-MeF)6-TSDV10-S-K(ε-(PEG)2-(PEG)2-γE-Lauroyl)12-YLE15-G-(E)17-K(ε-
(PEG)2-(PEG)2-γE-Lauroyl)18-A-(α-MeK)20 EFI-K(ε-(PEG)2-(PEG)2-γE-Lauroyl)24-(F)25-(V)26-V-
(E)28-G-(G)30
446 H-(Aib)2-EG-(S)5-(α-MeF)6-TSDV10-S-K(ε-(PEG)2-(PEG)2-γE-Lauroyl)12-YLE15-G-(E)17-AA-(α-
MeK)20 K(ε-(PEG)2-(PEG)2-γE-Lauroyl)21-FI-K(ε-(PEG)2-(PEG)2-γE-Lauroyl)24-(F)25-(V)26-V-
(E)28-G-(G)30
447 H-(Aib)2-EG-(S)5-(α-MeF)6-TSDV10-(α-MeS)11-S-K(ε-(PEG)2-(PEG)2-γE-Lauroyl)13-LE15-K(ε-
(PEG)2-(PEG)2-γE-Lauroyl)16-(E)17-AA-(α-MeK)20 EFI-K(ε-(PEG)2-(PEG)2-γE-Lauroyl)24-(F)25-
(V)26-V-(E)28-G-(G)30
448 H-(Aib)2-EG-(S)5-(α-MeF)6-TSDV10-(α-MeS)11-S-K(ε-(PEG)2-(PEG)2-γE-Lauroyl)13-LE15-G-K(ε-
(PEG)2-(PEG)2-γE-Lauroyl)17-AA-(α-MeK)20 EFI-K(ε-(PEG)2-(PEG)2-γE-Lauroyl)24-(F)25-(V)26-
V-(E)28-G-(G)30
449 H-(Aib)2-EG-(S)5-(α-MeF)6-TSDV10-(α-MeS)11-S-K(ε-(PEG)2-(PEG)2-γE-Lauroyl)13-LE15-G-(E)17-
K(ε-(PEG)2-(PEG)2-γE-Lauroyl)18-A-(α-MeK)20 EFI-K(ε-(PEG)2-(PEG)2-γE-Lauroyl)24-(F)25-
(V)26-V-(E)28-G-(G)30
450 H-(Aib)2-EG-(S)5-(α-MeF)6-TSDV10-(α-MeS)11-S-K(ε-(PEG)2-(PEG)2-γE-Lauroyl)13-LE15-G-(E)17-
AA-(α-MeK)20 K(ε-(PEG)2-(PEG)2-γE-Lauroyl)21-FI-K(ε-(PEG)2-(PEG)2-γE-Lauroyl)24-(F)25-
(V)26-V-(E)28-G-(G)30
451 H-(Aib)2-EG-(S)5-(α-MeF)6-TSDV10-(α-MeS)11-SY-K(ε-(PEG)2-(PEG)2-γE-Lauroyl)14-E15-K(ε-
(PEG)2-(PEG)2-γE-Lauroyl)16-(E)17-AA-(α-MeK)20 EFI-K(ε-(PEG)2-(PEG)2-γE-Lauroyl)24-(F)25-
(V)26-V-(E)28-G-(G)30
452 H-(Aib)2-EG-(S)5-(α-MeF)6-TSDV10-(α-MeS)11-SY-K(ε-(PEG)2-(PEG)2-γE-Lauroyl)14-E15-G-K(ε-
(PEG)2-(PEG)2-γE-Lauroyl)17-AA-(α-MeK)20 EFI-K(ε-(PEG)2-(PEG)2-γE-Lauroyl)24-(F)25-(V)26-
V-(E)28-G-(G)30
453 H-(Aib)2-EG-(S)5-(α-MeF)6-TSDV10-(α-MeS)11-SY-K(ε-(PEG)2-(PEG)2-γE-Lauroyl)14-E15-G-(E)17-
K(ε-(PEG)2-(PEG)2-γE-Lauroyl)18-A-(α-MeK)20 EFI-K(ε-(PEG)2-(PEG)2-γE-Lauroyl)24-(F)25-
(V)26-V-(E)28-G-(G)30
454 H-(Aib)2-EG-(S)5-(α-MeF)6-TSDV10-(α-MeS)11-SY-K(ε-(PEG)2-(PEG)2-γE-Lauroyl)14-E15-G-(E)17-
AA-(α-MeK)20 K(ε-(PEG)2-(PEG)2-γE-Lauroyl)21-FI-K(ε-(PEG)2-(PEG)2-γE-Lauroyl)24-(F)25-
(V)26-V-(E)28-G-(G)30
455 H-(Aib)2-EG-(S)5-(α-MeF)6-TSD-K(ε-(PEG)2-(PEG)2-γE-Lauroyl)10-SSYLE15-K(ε-(PEG)2-(PEG)2-
γE-Lauroyl)16-(E)17-AA-(α-MeK)20 EFIA-K(ε-(PEG)2-(PEG)2-γE-Lauroyl)25-(V)26-V-(E)28-G-(G)30
456 H-(Aib)2-EG-(S)5-(α-MeF)6-TSD-K(ε-(PEG)2-(PEG)2-γE-Lauroyl)10-SSYLE15-G-K(ε-(PEG)2-
(PEG)2-γE-Lauroyl)17-AA-(α-MeK)20 EFIA-K(ε-(PEG)2-(PEG)2-γE-Lauroyl)25-(V)26-V-(E)28-G-
(G)30
457 H-(Aib)2-EG-(S)5-(α-MeF)6-TSD-K(ε-(PEG)2-(PEG)2-γE-Lauroyl)10-SSYLE15-G-(E)17-K(ε-(PEG)2-
(PEG)2-γE-Lauroyl)18-A-(α-MeK)20 EFIA-K(ε-(PEG)2-(PEG)2-γE-Lauroyl)25-(V)26-V-(E)28-G-(G)30
458 H-(Aib)2-EG-(S)5-(α-MeF)6-TSD-K(ε-(PEG)2-(PEG)2-γE-Lauroyl)10-SSYLE15-G-(E)17-AA-(α-MeK)20
K(ε-(PEG)2-(PEG)2-γE-Lauroyl)21-FIA-K(ε-(PEG)2-(PEG)2-γE-Lauroyl)25-(V)26-V-(E)28-G-(G)30
459 H-(Aib)2-EG-(S)5-(α-MeF)6-TSDV10-S-K(ε-(PEG)2-(PEG)2-γE-Lauroyl)12-YLE15-K(ε-(PEG)2-
(PEG)2-γE-Lauroyl)16-(E)17-AA-(α-MeK)20 EFIA-K(ε-(PEG)2-(PEG)2-γE-Lauroyl)25-(V)26-V-(E)28-
G-(G)30
460 H-(Aib)2-EG-(S)5-(α-MeF)6-TSDV10-S-K(ε-(PEG)2-(PEG)2-γE-Lauroyl)12-YLE15-G-K(ε-(PEG)2-
(PEG)2-γE-Lauroyl)17-AA-(α-MeK)20 EFIA-K(ε-(PEG)2-(PEG)2-γE-Lauroyl)25-(V)26-V-(E)28-G-
(G)30
461 H-(Aib)2-EG-(S)5-(α-MeF)6-TSDV10-S-K(ε-(PEG)2-(PEG)2-γE-Lauroyl)12-YLE15-G-(E)17-K(ε-
(PEG)2-(PEG)2-γE-Lauroyl)18-A-(α-MeK)20 EFIA-K(ε-(PEG)2-(PEG)2-γE-Lauroyl)25-(V)26-V-
(E)28-G-(G)30
462 H-(Aib)2-EG-(S)5-(α-MeF)6-TSDV10-S-K(ε-(PEG)2-(PEG)2-γE-Lauroyl)12-YLE15-G-(E)17-AA-(α-
MeK)20 K(ε-(PEG)2-(PEG)2-γE-Lauroyl)21-FIA-K(ε-(PEG)2-(PEG)2-γE-Lauroyl)25-(V)26-V-(E)28-
G-(G)30
463 H-(Aib)2-EG-(S)5-(α-MeF)6-TSDV10-(α-MeS)11-S-K(ε-(PEG)2-(PEG)2-γE-Lauroyl)13-LE15-K(ε-
(PEG)2-(PEG)2-γE-Lauroyl)16-(E)17-AA-(α-MeK)20 EFIA-K(ε-(PEG)2-(PEG)2-γE-Lauroyl)25-(V)26-
V-(E)28-G-(G)30
464 H-(Aib)2-EG-(S)5-(α-MeF)6-TSDV10-(α-MeS)11-S-K(ε-(PEG)2-(PEG)2-γE-Lauroyl)13-LE15-G-K(ε-
(PEG)2-(PEG)2-γE-Lauroyl)17-AA-(α-MeK)20 EFIA-K(ε-(PEG)2-(PEG)2-γE-Lauroyl)25-(V)26-V-
(E)28-G-(G)30
465 H-(Aib)2-EG-(S)5-(α-MeF)6-TSDV10-(α-MeS)11-S-K(ε-(PEG)2-(PEG)2-γE-Lauroyl)13-LE15-G-(E)17-
K(ε-(PEG)2-(PEG)2-γE-Lauroyl)18-A-(α-MeK)20 EFIA-K(ε-(PEG)2-(PEG)2-γE-Lauroyl)25-(V)26-V-
(E)28-G-(G)30
466 H-(Aib)2-EG-(S)5-(α-MeF)6-TSDV10-(α-MeS)11-S-K(ε-(PEG)2-(PEG)2-γE-Lauroyl)13-LE15-G-(E)17-
AA-(α-MeK)20 K(ε-(PEG)2-(PEG)2-γE-Lauroyl)21-FIA-K(ε-(PEG)2-(PEG)2-γE-Lauroyl)25-(V)26-V-
(E)28-G-(G)30
467 H-(Aib)2-EG-(S)5-(α-MeF)6-TSDV10-(α-MeS)11-SY-K(ε-(PEG)2-(PEG)2-γE-Lauroyl)14-E15-K(ε-
(PEG)2-(PEG)2-γE-Lauroyl)16-(E)17-AA-(α-MeK)20 EFIA-K(ε-(PEG)2-(PEG)2-γE-Lauroyl)25-(V)26-
V-(E)28-G-(G)30
468 H-(Aib)2-EG-(S)5-(α-MeF)6-TSDV10-(α-MeS)11-SY-K(ε-(PEG)2-(PEG)2-γE-Lauroyl)14-E15-G-K(ε-
(PEG)2-(PEG)2-γE-Lauroyl)17-AA-(α-MeK)20 EFIA-K(ε-(PEG)2-(PEG)2-γE-Lauroyl)25-(V)26-V-
(E)28-G-(G)30
469 H-(Aib)2-EG-(S)5-(α-MeF)6-TSDV10-(α-MeS)11-SY-K(ε-(PEG)2-(PEG)2-γE-Lauroyl)14-E15-G-(E)17-
K(ε-(PEG)2-(PEG)2-γE-Lauroyl)18-A-(α-MeK)20 EFIA-K(ε-(PEG)2-(PEG)2-γE-Lauroyl)25-(V)26-V-
(E)28-G-(G)30
470 H-(Aib)2-EG-(S)5-(α-MeF)6-TSDV10-(α-MeS)11-SY-K(ε-(PEG)2-(PEG)2-γE-Lauroyl)14-E15-G-(E)17-
AA-(α-MeK)20 K(ε-(PEG)2-(PEG)2-γE-Lauroyl)21-FIA-K(ε-(PEG)2-(PEG)2-γE-Lauroyl)25-(V)26-V-
(E)28-G-(G)30
471 H-(Aib)2-EG-(S)5-(α-MeF)6-TSD-K(ε-(PEG)2-(PEG)2-γE-Lauroyl)10-SSYLE15-K(ε-(PEG)2-(PEG)2-
γE-Lauroyl)16-(E)17-AA-(α-MeK)20 EFIA-(F)25-K(ε-(PEG)2-(PEG)2-γE-Lauroyl)26-V-(E)28-G-(G)30
472 H-(Aib)2-EG-(S)5-(α-MeF)6-TSD-K(ε-(PEG)2-(PEG)2-γE-Lauroyl)10-SSYLE15-G-K(ε-(PEG)2-
(PEG)2-γE-Lauroyl)17-AA-(α-MeK)20 EFIA-(F)25-K(ε-(PEG)2-(PEG)2-γE-Lauroyl)26-V-(E)28-G-
(G)30
473 H-(Aib)2-EG-(S)5-(α-MeF)6-TSD-K(ε-(PEG)2-(PEG)2-γE-Lauroyl)10-SSYLE15-G-(E)17-K(ε-(PEG)2-
(PEG)2-γE-Lauroyl)18-A-(α-MeK)20 EFIA-(F)25-K(ε-(PEG)2-(PEG)2-γE-Lauroyl)26-V-(E)28-G-(G)30
474 H-(Aib)2-EG-(S)5-(α-MeF)6-TSD-K(ε-(PEG)2-(PEG)2-γE-Lauroyl)10-SSYLE15-G-(E)17-AA-(α-MeK)20
K(ε-(PEG)2-(PEG)2-γE-Lauroyl)21-FIA-(F)25-K(ε-(PEG)2-(PEG)2-γE-Lauroyl)26-V-(E)28-G-(G)30
475 H-(Aib)2-EG-(S)5-(α-MeF)6-TSDV10-S-K(ε-(PEG)2-(PEG)2-γE-Lauroyl)12-YLE15-K(ε-(PEG)2-
(PEG)2-γE-Lauroyl)16-(E)17-AA-(α-MeK)20 EFIA-(F)25-K(ε-(PEG)2-(PEG)2-γE-Lauroyl)26-V-(E)28-
G-(G)30
476 H-(Aib)2-EG-(S)5-(α-MeF)6-TSDV10-S-K(ε-(PEG)2-(PEG)2-γE-Lauroyl)12-YLE15-G-K(ε-(PEG)2-
(PEG)2-γE-Lauroyl)17-AA-(α-MeK)20 EFIA-(F)25-K(ε-(PEG)2-(PEG)2-γE-Lauroyl)26-V-(E)28-G-
(G)30
477 H-(Aib)2-EG-(S)5-(α-MeF)6-TSDV10-S-K(ε-(PEG)2-(PEG)2-γE-Lauroyl)12-YLE15-G-(E)17-K(ε-
(PEG)2-(PEG)2-γE-Lauroyl)18-A-(α-MeK)20 EFIA-(F)25-K(ε-(PEG)2-(PEG)2-γE-Lauroyl)26-V-
(E)28-G-(G)30
478 H-(Aib)2-EG-(S)5-(α-MeF)6-TSDV10-S-K(ε-(PEG)2-(PEG)2-γE-Lauroyl)12-YLE15-G-(E)17-AA-(α-
MeK)20 K(ε-(PEG)2-(PEG)2-γE-Lauroyl)21-FIA-(F)25-K(ε-(PEG)2-(PEG)2-γE-Lauroyl)26-V-(E)28-
G-(G)30
479 H-(Aib)2-EG-(S)5-(α-MeF)6-TSDV10-(α-MeS)11-S-K(ε-(PEG)2-(PEG)2-γE-Lauroyl)13-LE15-K(ε-
(PEG)2-(PEG)2-γE-Lauroyl)16-(E)17-AA-(α-MeK)20 EFIA-(F)25-K(ε-(PEG)2-(PEG)2-γE-Lauroyl)26-
V-(E)28-G-(G)30
480 H-(Aib)2-EG-(S)5-(α-MeF)6-TSDV10-(α-MeS)11-S-K(ε-(PEG)2-(PEG)2-γE-Lauroyl)13-LE15-G-K(ε-
(PEG)2-(PEG)2-γE-Lauroyl)17-AA-(α-MeK)20 EFIA-(F)25-K(ε-(PEG)2-(PEG)2-γE-Lauroyl)26-V-
(E)28-G-(G)30
481 H-(Aib)2-EG-(S)5-(α-MeF)6-TSDV10-(α-MeS)11-S-K(ε-(PEG)2-(PEG)2-γE-Lauroyl)13-LE15-G-(E)17-
K(ε-(PEG)2-(PEG)2-γE-Lauroyl)18-A-(α-MeK)20 EFIA-(F)25-K(ε-(PEG)2-(PEG)2-γE-Lauroyl)26-V-
(E)28-G-(G)30
482 H-(Aib)2-EG-(S)5-(α-MeF)6-TSDV10-(α-MeS)11-S-K(ε-(PEG)2-(PEG)2-γE-Lauroyl)13-LE15-G-(E)17-
AA-(α-MeK)20 K(ε-(PEG)2-(PEG)2-γE-Lauroyl)21-FIA-(F)25-K(ε-(PEG)2-(PEG)2-γE-Lauroyl)26-V-
(E)28-G-(G)30
483 H-(Aib)2-EG-(S)5-(α-MeF)6-TSDV10-(α-MeS)11-SY-K(ε-(PEG)2-(PEG)2-γE-Lauroyl)14-E15-K(ε-
(PEG)2-(PEG)2-γE-Lauroyl)16-(E)17-AA-(α-MeK)20 EFIA-(F)25-K(ε-(PEG)2-(PEG)2-γE-Lauroyl)26-
V-(E)28-G-(G)30
484 H-(Aib)2-EG-(S)5-(α-MeF)6-TSDV10-(α-MeS)11-SY-K(ε-(PEG)2-(PEG)2-γE-Lauroyl)14-E15-G-K(ε-
(PEG)2-(PEG)2-γE-Lauroyl)17-AA-(α-MeK)20 EFIA-(F)25-K(ε-(PEG)2-(PEG)2-γE-Lauroyl)26-V-
(E)28-G-(G)30
485 H-(Aib)2-EG-(S)5-(α-MeF)6-TSDV10-(α-MeS)11-SY-K(ε-(PEG)2-(PEG)2-γE-Lauroyl)14-E15-G-(E)17-
K(ε-(PEG)2-(PEG)2-γE-Lauroyl)18-A-(α-MeK)20 EFIA-(F)25-K(ε-(PEG)2-(PEG)2-γE-Lauroyl)26-V-
(E)28-G-(G)30
486 H-(Aib)2-EG-(S)5-(α-MeF)6-TSDV10-(α-MeS)11-SY-K(ε-(PEG)2-(PEG)2-γE-Lauroyl)14-E15-G-(E)17-
AA-(α-MeK)20 K(ε-(PEG)2-(PEG)2-γE-Lauroyl)21-FIA-(F)25-K(ε-(PEG)2-(PEG)2-γE-Lauroyl)26-V-
(E)28-G-(G)30
487 H-(Aib)-EGS-(α-MeF)-TSD-X10-X11-X12-X13-X14-E-X16-X17-X18-A-(α-MeK)-X21-FI-X24-X25-
X26-VEGG

The C-terminus of a peptide is generally either a free carboxylic acid or an amide. Thus, in certain aspects, any one of the peptides in Tables 1, 2, and 3 can either have a C-terminal acid or a C-terminal amide. In certain aspects, any one of the peptides in Tables 1, 2, and 3 comprises a C-terminal acid. In certain aspects, any one of the peptides in Tables 1, 2, and 3 comprises a C-terminal amide.

Linkers used in various polypeptides provided herein can facilitate formation of a structure. In some aspects, a polypeptide linker can comprise 1-50 amino acids, 1-25 amino acids, 25-50 amino acids, or 30-50 amino acids. Generally longer linkers correlate with higher activity (more flexible), but also decreased stability as the peptide becomes more exposed. Linkers can comprise, e.g., (Gly-Ser)n, residues, where n is an integer of at least one, and up to, e.g., 4, 5, 6, 10, 20, 50, 100, or more, optionally with some Glu or Lys residues dispersed throughout to increase solubility. Alternatively, certain linkers do not comprise any Serine residues, e.g., where the linker is subject to O-linked glycosylation. In some aspects, linkers can contain cysteine residues, for example, if dimerization of linkers is used to bring two or more agonist polypeptides into a dimeric configuration. In some aspects, an agonist polypeptide can comprise at least one, two, three, four, or more linkers. The length and amino acid sequence of a linker can be readily selected and optimized.

Methods of Preparing Lipidated Peptides

While various methods of attaching lipids and lipid moieties to peptides are known, provided herein is at least one representative method of preparing lipidated peptides.

In certain embodiments, lipidated peptides can be prepared as C-terminal carboxamides, such as on NovaSyn® TGR resin. In certain embodiments, amino acids (both natural and unnatural) can be coupled at ambient temperature, such as by using HCTU/DIPEA in NMP, capping residual functionality with a solution of acetic anhydride and pyridine. In such methods, the N-Fmoc group can be deblocked using piperidine in DMF (20% v/v) at ambient temperature and the C-terminal residue incorporated as the N-Boc-protected form, e.g. Boc-His(Trt)-OH or Boc-Tyr(tBu)-OH or equivalent. At the position(s) of lipidation Fmoc-Lys(Mmt)-OH can be incorporated into the peptide backbone during automated assembly and upon completion the Mmt protecting group(s) can be removed manually and selectively by treatment of the synthesis resin with 1% TFA, 2% TIPS, DCM (10×1 minute, 20.0 mL/g). The acidified resin can be quenched, such as with 5% DIPEA/NMP, and the exposed lysine amino-function(s) acylated, PEGylated or lipidated as required prior to peptide cleavage.

Crude peptides can be cleaved from the resin support by treatment with a suitable cleavage cocktail. In certain embodiments the cocktail consists of TFA (95% v/v), TIPS (2.5% v/v), and water (2.5% v/v) with agitation (3×1 hour at ambient temperature). Cleavage aliquots can be combined, concentrated by rotary evaporation and precipitated by addition of cold diethyl ether, isolating the solids by centrifugation. The crude peptides can be dried under a flow of dry nitrogen, reconstituted in a suitable aqueous buffer and filtered prior to chromatographic purification.

Crude mono-lipidated peptides can be dissolved in a solution of acetic acid/acetonitrile/water (1:5:50 v/v) and filtered. The crude filtrates can be chromatographed, such as over an Agilent Polaris C8-A stationary phase (21.2×250 mm, 5 micron) eluting with a linear solvent gradient of 10-70%, 15-80% or 20-90% MeCN (0.1% TFA v/v) in water (0.1% TFA v/v) over 30 minutes using a Varian SD-1 PrepStar binary pump system, monitoring by UV absorption at 210 nm. The peptide-containing fractions can then be pooled, frozen (dry-ice/acetone) and lyophilized.

Crude bis-lipidated peptides can be dissolved, such as in 0.1M ammonium bicarbonate solution (1:5 acetonitrile/water v/v, pH 8.0) and filtered. The crude filtrates can be chromatographed, such as over a Waters X-Bridge C18 stationary phase (19.0×250 mm, 5 micron) eluting with a linear solvent gradient of 20-90% B against A over 30 minutes using a Varian SD-1 PrepStar binary pump system, monitoring by UV absorption at 210 nm. (A=0.1M ammonium bicarbonate in water, B=0.1M ammonium bicarbonate in 1:2 water/acetonitrile). The peptide-containing fractions can then pooled, frozen (dry-ice/acetone) and lyophilized.

The peptide sequence can be a GLP-1 analog sequence such as those disclosed in Tables 1 and 2. The lipid or lipid moiety can be any such as disclosed herein, including but not limited to: K(ε-(PEG)2-(PEG)2-γE-Stearate); K(ε-γE-Palmitoyl); K(ε-(PEG)2-(PEG)2-γE-Stearate); K(γE-Palmitoyl); K(ε-(PEG)2-(PEG)2-(PEG)2-Stearoyl); K(ε-γE-Lauroyl); K(ε-γE-γE-Lauroyl); K(ε-γE-γE-γE-Lauroyl); K(ε-Ahx-Lauroyl); K(ε-Ahx-Ahx-Lauroyl); K(ε-Ahx-Ahx-Ahx-Lauroyl); K(ε-(PEG)2-Lauroyl); K(ε-(PEG)2-(PEG)2-Lauroyl); K(ε-(PEG)2-(PEG)2-(PEG)2-Lauroyl); K(ε-γE-12-(4-carboxyphenoxy)dodecanoyl); K(ε-γE-γE-12-(4-carboxyphenoxy)dodecanoyl); K(ε-γE-γE-γE-12-(4-carboxyphenoxy)dodecanoyl); K(ε-Ahx-12-(4-carboxyphenoxy)dodecanoyl); K(ε-Ahx-Ahx-12-(4-carboxyphenoxy)dodecanoyl); K(ε-Ahx-Ahx-Ahx-12-(4-carboxyphenoxy)dodecanoyl); K(ε-(PEG)2-12-(4-carboxyphenoxy)dodecanoyl); K(ε-(PEG)2-(PEG)2-12-(4-carboxyphenoxy)dodecanoyl); K(ε-(PEG)2-(PEG)2-(PEG)2-12-(4-carboxyphenoxy)dodecanoyl); K(ε-γE-Stearoyl); K(ε-γE-γE-Stearoyl); K(ε-γE-γE-γE-Stearoyl); K(ε-Ahx-Stearoyl); K(ε-Ahx-Ahx-Stearoyl); K(ε-Ahx-Ahx-Ahx-Stearoyl); K(ε-(PEG)2-Stearoyl); K(ε-(PEG)2-(PEG)2-Stearoyl); K(ε-(PEG)2-(PEG)2-(PEG)2-Stearoyl); K(ε-γE-Stearate); K(ε-γE-γE-Stearate); K(ε-γE-γE-γE-Stearate); K(ε-Ahx-Stearate); K(ε-Ahx-Ahx-Stearate); K(ε-Ahx-Ahx-Ahx-Stearate); K(ε-(PEG)2-Stearate); K(ε-(PEG)2-(PEG)2-Stearate); K(ε-(PEG)2-(PEG)2-(PEG)2-Stearate), and any combination thereof.

Methods of Preparing Synthetic Peptides

Also provided are methods of preparing synthetic peptides.

In some embodiments, the methods suitably comprise identifying at least one native amino acid residue in the peptide for substitution. In other embodiments, the methods suitably comprise identifying at least two native amino acid residues in the peptide for substitution. Alpha-methyl functionalized amino acids can then substituted for the identified native amino acid residues.

As described throughout, the synthetic peptides prepared by the methods provided herein suitably maintain substantially the same or exhibit increased receptor potency and in some cases selectivity as a corresponding synthetic peptide that does not comprise the substitutions. In addition, the synthetic peptides prepared according to the methods described herein can also be substantially resistant to proteolytic degradation.

Suitably in the methods provided herein the substituted alpha-methyl functionalized amino acids correspond to the substituted native amino acid residues, and in additional embodiments, the substituted alpha-methyl functionalized amino acids correspond to the same class as the substituted native amino acid residues.

In further embodiments, the substituted alpha-methyl functionalized amino acids can be alpha-methyl phenylalanine. In exemplary embodiments, alpha-methyl phenylalanine is substituted for corresponding native amino acids, though in further embodiments of the methods, the alpha-methyl phenylalanine do not have to correspond to the same native amino acids for which the substitution is occurring.

In certain embodiments, the synthetic peptides prepared according to the methods described herein can be substantially resistant to one or more of DPP-IV, neprilysin, a-chymotrypsin, plasmin, thrombin, kallikrein, trypsin, elastase and pepsin degradation.

In embodiments, synthetic peptides can be prepared as C-terminal carboxamides on NOVASYN® TGR resin. Amino acids (both natural and unnatural) can be coupled at ambient temperature using HCTU/DIPEA in NMP, capping residual functionality with a solution of acetic anhydride and pyridine. Fmoc is suitably deblocked in using piperidine in DMF at ambient temperature.

As described herein, identifying at least one native amino acid residue in the peptide for substitution suitably comprises identifying amino acids at sites susceptible to enzymatic cleavage. Exemplary methods of identifying amino acids at sites susceptible to enzymatic cleavage are well known in the art. In certain embodiments, methods of identifying amino acids at sites susceptible to enzymatic cleavage suitably comprise exposing a natural peptide (e.g., a wild-type peptide) to a single enzyme under conditions in which the enzyme is active (e.g., suitable pH, buffer conditions, temperature, etc.) for a pre-determined amount of time and measuring the enzymatic degradation products of the peptide. Exemplary methods for measuring the enzymatic degradation products include, for example, reverse-phase liquid chromatography-mass spectrometry.

Peptide solutions can be added to solutions of a protease. The peptide and enzyme can be co-incubated, suitably at about 37° C. Aliquots of the incubated peptide-enzyme mixture can be withdrawn periodically, quenched to arrest proteolytic activity, and analyzed by liquid chromatography-mass spectrometry (LC/MS). Analytes can be detected by both UV absorption (e.g., at 210 nm) and by ionization using a mass detector (ESI+ mode). Peptidic species (fragments) deriving from enzymatic cleavage of peptides can be analyzed post-process, and their molecular masses can be used to identify the precise cleavage position (highlighting the scissile bond in each case).

In certain embodiments, the methods described herein can be used to prepare any class of peptide having the recited characteristics.

In certain embodiments, the methods can be used to prepare incretin class peptides. Synthetic incretin class peptides that can be prepared as described herein include, but are not limited to, glucagon-like peptide 1 (GLP-1), a glucose-dependent insulinotropic peptide (GIP), an exenatide peptide, plus glucagon, secretins, tenomodulin and oxyntomodulin.

Additional classes of peptides can be prepared as described herein.

In embodiments, the methods can be used to prepare synthetic GLP-1 peptides. In further embodiments, the methods can be used to prepare synthetic insulin.

In further embodiments, methods of preparing a proteolytically stable peptide are provided. Suitably, such methods comprise exposing a peptide to one or more proteases, identifying at least two native amino acid residues which are sites susceptible to proteolytic cleavage, and substituting alpha-methyl functionalized amino acids for the identified amino acid residues.

As described throughout, suitably such methods provide a synthetic peptide that maintains substantially the same or exhibits increased receptor potency and in some cases selectivity as a corresponding synthetic peptide that does not comprise the substitution(s). In further embodiments, the methods also provide a synthetic peptide that is substantially resistant to proteolytic degradation.

Suitably in the methods provided herein, the substituted alpha-methyl functionalized amino acids correspond to the substituted native amino acid residues, and in additional embodiments, the substituted alpha-methyl functionalized amino acids correspond to the same class as the substituted native amino acid residues.

In still further embodiments, the substituted alpha-methyl functionalized amino acids can be selected from alpha-methyl functionalized Histidine, alpha-methyl functionalized Alanine, alpha-methyl functionalized Isoleucine, alpha-methyl functionalized Arginine, alpha-methyl functionalized Leucine, alpha-methyl functionalized Asparagine, alpha-methyl functionalized Lysine, alpha-methyl functionalized Aspartic acid, alpha-methyl functionalized Methionine, alpha-methyl functionalized Cysteine, alpha-methyl functionalized Phenylalanine, alpha-methyl functionalized Glutamic acid, alpha-methyl functionalized Threonine, alpha-methyl functionalized Glutamine, alpha-methyl functionalized Tryptophan, alpha-methyl functionalized Glycine, alpha-methyl functionalized Valine, alpha-methyl functionalized Ornithine, alpha-methyl functionalized Proline, alpha-methyl functionalized Selenocysteine, alpha-methyl functionalized Serine and alpha-methyl functionalized Tyrosine.

In further embodiments, the substituted alpha-methyl functionalized amino acids can be alpha-methyl phenylalanine and/or alpha-methyl lysine. In exemplary embodiments, alpha-methyl phenylalanine and/or alpha-methyl lysine can be substituted for corresponding native amino acids, though in further embodiments of the methods, the alpha-methyl phenylalanine and/or alpha-methyl lysine do not have to correspond to the same native amino acids for which the substitution is occurring.

In certain embodiments, the synthetic peptides prepared according to the methods described herein can be substantially resistant to one or more of DPP-IV, neprilysin, a-chymotrypsin, plasmin, thrombin, kallikrein, trypsin, elastase and pepsin degradation.

Formulations Comprising Lipidated Peptides

Also provided are formulations (or pharmaceutical compositions) comprising a lipidated peptide described herein. Suitably such formulations comprise a lipidated peptide as described herein and a carrier. Such formulations can be readily administered in the various methods described throughout. In some embodiments, the formulation comprises a pharmaceutically acceptable carrier.

The term “pharmaceutically acceptable carrier” means one or more non-toxic materials that do not interfere with the effectiveness of the biological activity of the lipidated peptides. The term “carrier” denotes an organic or inorganic ingredient, natural or synthetic, with which the lipidated peptide is combined to facilitate the application.

Formulations as described herein can be formulated for a particular dosage. Dosage regimens can be adjusted to provide the optimum response. It can be useful to formulate parenteral compositions in dosage unit forms for ease of administration and uniformity of dosage. Dosage unit forms as used herein refers to physically discrete units suited as unitary dosages for the subjects to be treated; each unit contains a predetermined quantity of a lipidated peptide calculated to produce a therapeutic effect in association with the required pharmaceutical carrier. The specification for the dosage unit forms are dictated by, and directly dependent on, (a) the unique characteristics of the lipidated peptide and the particular therapeutic effect to be achieved, and (b) the limitations inherent in the art of compounding such a lipidated peptide.

Formulations described herein can be formulated for particular routes of administration, such as oral, nasal, pulmonary, topical (including buccal and sublingual), rectal, vaginal and/or parenteral administration. The formulations can conveniently be presented in unit dosage form and can be prepared by any methods known in the art of pharmacy. The amount of lipidated peptide that can be combined with a carrier material to produce a single dosage form will vary depending upon the subject being treated, and the particular mode of administration. The amount of lipidated peptide that can be combined with a carrier material to produce a single dosage form will generally be that amount of the composition which produces a therapeutic effect.

Methods of Treatment Utilizing Lipidated Peptides

Also provided herein are methods of treating a patient comprising administering a lipidated peptide, e.g., the formulations, described herein to a subject in need thereof.

Suitably subjects that can be administered the lipidated peptides in the various methods described herein are mammals, such as for example, humans, dogs, cats, primates, cattle, sheep, horses, pigs, etc.

Methods by which the lipidated peptides can be administered to the subject in any of the various methods described herein include, but are not limited to, intravenous (IV), intratumoral (IT), intralesional (IL), aerosol, percutaneous, oral, endoscopic, topical, intramuscular (IM), intradermal (ID), intraocular (IO), intraperitoneal (IP), transdermal (TD), intranasal (IN), intracerebral (IC), intraorgan (e.g. intrahepatic), slow release implant, or subcutaneous administration, or via administration using an osmotic or mechanical pump.

Suitably, the lipidated peptides can be administered as soon as possible after a suitable diagnosis, e.g., within hours or days.

As described herein, suitably the various methods can be carried out on mammalian subjects that are humans, including adults of any age and children.

In certain embodiments, the methods of treatment comprise treating a subject (also referred to herein as a patient) diagnosed with diabetes comprising administering a therapeutically effective amount of a suitable lipidated peptide as described herein, suitably a lipidated GLP-1 peptide as described herein.

As used herein, the term “therapeutically effective amount” refers to the amount of a lipidated peptide, or formulation, that is sufficient to reduce the severity of a disease or disorder (or one or more symptoms thereof), ameliorate one or more symptoms of such a disease or disorder, prevent the advancement of such a disease or disorder, cause regression of such a disease or disorder, or enhance or improve the therapeutic effect(s) of another therapy. In some embodiments, the therapeutically effective amount cannot be specified in advance and can be determined by a caregiver, for example, by a physician or other healthcare provider, using various means, for example, dose titration.

In embodiments, methods are provided of treating a patient diagnosed with diabetes comprising administering a therapeutically effective amount of lipidated insulin to a patient.

As described herein, in certain embodiments the methods of administration of the lipidated peptides or formulations described herein can be delivered orally. As described herein, lipidated peptides can be substantially resistant to proteolytic degradation, e.g., degradation by enzymes in the stomach following oral administration.

It will be readily apparent to one of ordinary skill in the relevant arts that other suitable modifications and adaptations to the methods and applications described herein can be made without departing from the scope of any of the embodiments. The following examples are included herewith for purposes of illustration only and are not intended to be limiting.

EXAMPLES

Example 1: Chemical Synthesis and Testing of Proteolytic-Resistant Lipidated Peptides

1. Introduction

The following provides exemplary methods for preparing proteolytic-resistant peptides as described herein.

2. Abbreviations

Boc, tert-butyloxycarbonyl; DCM, dichloromethane; DIPEA, N,N-diisopropylethylamine; DMF, N,N-dimethylformamide; DMSO, dimethylsulfoxide; EK, enterokinase; ESI, electrospray ionisation; Fmoc, 9-fluorenylmethyloxycarbonyl; GIP, gastric inhibitory polypeptide; GLP-1, glucagon-like peptide-1; HCTU, O-(1H-6-chlorobenzotriazole-1-yl)-1,1,3,3-tetramethyluronium hexafluorophosphate; RP-HPLC, reversed-phase high-performance liquid chromatography; EC50, half maximal (50%) effective concentration; LC/MS, liquid chromatography-coupled mass spectrometry; MeCN, acetonitrile; Mmt, 4-methoxytrityl; NMP, N-methylpyrrolidinone; Pbf, 2,2,4,6,7-pentamethyldihydrobenzofuran-5-sulfonyl; PBS, phosphate buffered saline; tBu, tertiary-butyl; TFA, trifluoroacetic acid; TIS, triisopropylsilane; Tris, Tris(hydroxymethyl) aminomethane; Trt, triphenylmethyl; UV, ultraviolet.

3. Experimental

3.1. Peptide Synthesis

3.1.1. Materials

N-α-Fmoc-L-amino acids were obtained from Bachem AG (Switzerland). Unnatural amino acids were obtained from Iris Biotech AG (Germany), prepared by Pharmaron (China), or Peptech corporation (USA). NovaSyn® TGR (TentaGel Rink) and NovaSyn® TGA (TentaGel Wang) synthesis resins were obtained from Novabiochem, Merck Biosciences (Germany). Peptides were prepared by automated synthesis (PTI Prelude) using the Fmoc/tBu protocol. Asparagine (Asn) and glutamine (Gln) were incorporated as their sidechain trityl (Trt) derivatives. Tryptophan (Trp) and lysine (Lys) were incorporated as their sidechain Boc derivatives. Serine (Ser), threonine (Thr) and tyrosine (Tyr) were incorporated as sidechain tBu ethers, and aspartate (Asp) and glutamate (Glu) as their sidechain OtBu esters. Arginine (Arg) was incorporated as the sidechain Pbf derivative. Synthesis reagents were obtained from Sigma-Aldrich, Dorset, United Kingdom. Solvents were obtained from Merck, Darmstadt, Germany at the highest grade available and used without further purification.

3.1.2. Chemical Synthesis of Lipidated Peptides Containing α-Methyl Amino Acids

Unless otherwise stated, peptides were prepared as C-terminal carboxamides on NovaSyn® TGR resin (initial substitution 0.24 mmole/g) Amino acids (both natural and unnatural) were coupled at ambient temperature using HCTU/DIPEA in NMP, capping residual functionality with a solution of acetic anhydride and pyridine. The N-Fmoc group was deblocked using piperidine in DMF (20% v/v) at ambient temperature. The C-terminal residue was incorporated as the N-Boc-protected form, e.g. Boc-His(Trt)-OH or Boc-Tyr(tBu)-OH or equivalent. At the position(s) of lipidation Fmoc-L-Lys(Mmt)-OH was incorporated into the peptide backbone during automated assembly and upon completion the Mmt protecting group(s) were removed manually by treatment of the synthesis resin with 1% TFA, 2% TIPS, DCM (10×1 minute, 20.0 mL/g). The acidified resin was quenched with 5% DIPEA/NMP and the exposed lysine amino-function(s) acylated, PEGylated or lipidated as required prior to peptide cleavage.

3.1.3. Cleavage of Lipidated Peptides

Crude peptides were cleaved from the resin support by treatment with a cocktail consisting of TFA (95% v/v), TIPS (2.5% v/v), water (2.5% v/v) with agitation (3×1 hour at ambient temperature). Cleavage aliquots were combined, concentrated by rotary evaporation and precipitated by addition of cold diethyl ether, isolating the solids by centrifugation. Crude peptides were dried under a flow of dry nitrogen, reconstituted in a suitable buffer and filtered prior to chromatographic purification.

3.1.4. Purification of Crude Mono-Lipidated Peptides

Crude mono-lipidated peptides were dissolved in a solution of acetic acid/acetonitrile/water (1:5:50 v/v) and filtered. The crude filtrates were chromatographed over an Agilent Polaris C8-A stationary phase (21.2×250 mm, 5 micron) eluting with a linear solvent gradient of 10-70%, 15-80% or 20-90% MeCN (0.1% TFA v/v) in water (0.1% TFA v/v) over 30 minutes using a Varian SD-1 PrepStar binary pump system, monitoring by UV absorption at 210 nm. The peptide-containing fractions were pooled, frozen (dry-ice/acetone) and lyophilized

3.1.5. Purification of Crude Bis-Lipidated Peptides

Crude bis-lipidated peptides were dissolved in 0.1M ammonium bicarbonate solution (1:5 acetonitrile/water v/v, pH 8.0) and filtered. The crude filtrates were chromatographed over a Waters X-Bridge C18 stationary phase (19.0×250 mm, 5 micron) eluting with a linear solvent gradient of 20-90% B against A over 30 minutes using a Varian SD-1 PrepStar binary pump system, monitoring by UV absorption at 210 nm. (A=0.1M ammonium bicarbonate in water, B=0.1M ammonium bicarbonate in 1:2 water/acetonitrile). The peptide-containing fractions were pooled, frozen (dry-ice/acetone) and lyophilized.

3.1.6. Peptide Analysis and Characterization

Purified peptides were characterized by single quadrupole LC/MS using a Waters Mass Lynx 3100 platform. Analytes were chromatographed by elution over a Waters X-Bridge C18 stationary phase (4.6×100 mm, 3 micron) using a generic linear binary gradient of 10-90% MeCN (0.1% TFA v/v) in water (0.1% TFA v/v) over 10 minutes at 1.5 mL min−1 at ambient temperature. Analytes were detected by both UV absorption at 210 nm and ionization using a Waters 3100 mass detector (ESI+ mode), verifying molecular mass against calculated theoretical values. Analytical RP-HPLC spectra were recorded using an Agilent 1260 Infinity binary gradient system. Analytes were chromatographed by elution over an Agilent Polaris C8-A stationary phase (4.6×100 mm, 3 micron) at 1.5 mL min−1 using a linear binary gradient of 10-90% MeCN (0.1% TFA v/v) in water (0.1% TFA v/v) over 15 minutes at 40° C.

3.2. Evaluating Proteolytic-Resistance of Peptides Containing α-Methyl Residues

Table 3 details several commercially available circulatory and digestive proteases which are likely to contribute to the inactivation of endogenous peptide hormones e.g., GLP-1 through hydrolysis at numerous sites in the unmodified ligands. Several of these proteases were incubated with both native peptides and their modified counterparts containing α-methyl amino acids at known liable sites as described here.

TABLE 3
Commercially available purified proteases
Protease Distribution Family Cleavage Specificity Notes
Neprilysin Brush border Zinc Amino side: Y, F, W R&D Systems: 1182-
metalloprotease ZNC-010
DPP-IV Brush border Serine Protease N-terminal dipeptides Sigma: D3446
Pepsin Stomach Aspartate Amino side: Y, F, W, L Sigma: P7012
protease
Trypsin Duodenum Serine Protease Carboxyl side: R, K Sigma: T1426
α-Chymotrypsin Duodenum Serine Protease Carboxyl side: Y, F, W, R&D Systems: 6907-SE-
L, M 010
Pancreatic Duodenum Serine Protease Carboxyl side: G, A, S, Sigma: E1250, E7885
elastase V, I, L

3.3. Preparation of Peptide and Protease Stock Solutions

Neprilysin:

10.0 μg (˜10 units) recombinant Neprilysin (R&D Systems: 1182-ZNC-010) was reconstituted to 100 μL (100 μg/mL, ˜100 units/mL) in assay buffer (50 mM Tris, 50 mM NaCl, 50 mM NaHCO3, adjusted to pH 8.3) to give the enzyme stock solution. For evaluation of non-lipidated peptides, 10 μL (1 μg, ˜1 unit) of neprilysin stock solution was incubated with 100 μL of peptide solution (1.0 mg/mL, ˜100 μg of peptide, ˜33 μmoles). Ratio enzyme (units):peptide (moles) ˜1:33. For evaluation of lipidated peptides, 100 μL (10 μg, ˜10 units) of neprilysin stock solution was incubated with 100 μL of peptide solution (1.0 mg/mL, ˜100 μg of peptide, ˜25 μmoles). Ratio enzyme (units):peptide (μmoles) ˜1:2.5.

Pepsin:

Lyophilized porcine pancreatic pepsin (Sigma: P7012) was reconstituted to afford a solution of 200 μg/mL (˜500 units/mL) in assay buffer (0.1 M HCl, pH 2.0) to give the enzyme stock solution. For evaluation of non-lipidated peptides, 10 μL (2 μg, ˜5 units) of enzyme solution was incubated with 100 μL of peptide solution (1.0 mg/mL, ˜100 μg of peptide, ˜33 μmoles). Ratio enzyme (units):peptide (moles) ˜1:6. For evaluation of lipidated peptides, 100 μL (20 μg, ˜50 units) of enzyme solution was incubated with 100 μL of peptide solution (1.0 mg/mL, ˜100 μg of peptide, ˜25 μmoles). Ratio enzyme (units):peptide (moles) ˜2:1.

Trypsin:

Lyophilized porcine pancreatic trypsin (Sigma: T1426) was reconstituted to afford a solution of 100 μg/mL (˜300 units/mL) in assay buffer (50 mM Tris, 10 mM CaCl2), 150 mM NaCl, 1 mM HCl, adjusted to pH 7.8) to give the enzyme stock solution. For evaluation of non-lipidated peptides, 10 μL (1 μg, ˜3 units) of enzyme solution was incubated with 100 μL of peptide solution (1.0 mg/mL, ˜100 μg of peptide, ˜33 μmoles). Ratio enzyme (units):peptide (μmoles) ˜1:11. For evaluation of lipidated peptides, 100 μL (10 μg, ˜30 units) of enzyme solution was incubated with 100 μL of peptide solution (1.0 mg/mL, ˜100 μg of peptide, ˜25 μmoles). Ratio enzyme (units):peptide (μ moles) ˜1.2:1.

α-Chymotrypsin:

10.0 μg (˜10 units) recombinant α-chymotrypsin (R&D Systems: 6907-SE-010) was reconstituted to 100 μL (100 μg/mL, ˜100 units/mL) in assay buffer (50 mM Tris, 10 mM CaCl2), 150 mM NaCl, 1 mM HCl, adjusted to pH 7.8) to give the enzyme stock solution. For evaluation of non-lipidated peptides, 10 μL (1 μg, ˜1 unit) of α-chymotrypsin stock solution was incubated with 100 μL of peptide solution (1.0 mg/mL, ˜100 μg of peptide, ˜33 μmoles). Ratio enzyme (units):peptide (μmoles) ˜1:33. For evaluation of lipidated peptides, 100 μL (10 μg, ˜10 units) of α-chymotrypsin stock solution was incubated with 100 μL of peptide solution (1.0 mg/mL, ˜100 μg of peptide, ˜25 μmoles). Ratio enzyme (units):peptide (μmoles) ˜1:2.5.

Elastase:

1.0 mg (˜5 units) lyophilized porcine pancreatic elastase (Sigma: E7885) was reconstituted to 100 μL (10 mg/mL, ˜50 units/mL) in assay buffer (50 mM Tris, 50 mM NaCl, 50 mM NaHCO3) and adjusted to pH 8.1 using NaOH (0.1 M) to give the enzyme stock solution. For evaluation of non-lipidated peptides, 20 μL (200 μg, ˜1 unit) of elastase stock solution was incubated with 100 μL of the peptide solution (1.0 mg/mL, ˜100 μg of peptide, ˜33 μmoles). Ratio enzyme (units):peptide (moles) ˜1:33. For evaluation of lipidated peptides, 100 μL (1000 μg, ˜5 units) of elastase stock solution was incubated with 100 μL of the peptide solution (1.0 mg/mL, ˜100 μg of peptide, ˜25 μmoles). Ratio enzyme (units):peptide (moles) ˜1:5.

3.4 Peptide Proteolysis Procedures

3.4.1 Evaluating Proteolytic-Resistance of Non-Lipidated Peptides to Neprilysin

10.0 μg (˜10 units) recombinant Neprilysin (R&D Systems: 1182-ZNC-010) was reconstituted to 100 μL (100 μg/mL, ˜100 units/mL) in assay buffer (50 mM Tris, 50 mM NaCl, 50 mM NaHCO3, adjusted to pH 8.3) to give the enzyme stock solution. Peptide stock solutions were prepared to a concentration of 330 μM (˜1.0 mg/mL) in assay buffer, pure water or 1×PBS (Dulbecco). 10 μL (1 μg, ˜1 unit) of neprilysin stock solution was added to 100 μL of peptide stock solution (1.0 mg/mL, ˜100 μg of peptide, ˜33 μmoles) and the mixture was co-incubated in a temperature-regulated water bath at 37° C. for the duration of the experiment (ratio enzyme [units]:peptide [μmoles] ˜1:33). 15 μL aliquots (˜15 μg initial peptide) of the peptide-enzyme mixture were periodically withdrawn (t=0, 30 mins, 1 hr, 2 hr, 4 hr, 8 hr, 24 hr) and quenched immediately by addition to an equal volume (15 μL) of 5% TFA (v/v) in 1:1 water/acetonitrile to arrest proteolytic activity. 20 μL aliquots (˜10 μg initial peptide) were analyzed by LC/MS and/or analytical RP-HPLC as follows: LC/MS method: Agilent Polaris C8-A column (4.6×100 mm, 3 micron) eluted with a linear binary gradient of 10-90% MeCN (0.1% TFA v/v) in water (0.1% TFA v/v) over 30 mins at 1.5 mL min-1 at ambient temperature with detection by both UV absorption at 210 nm and ionization using a Waters 3100 mass detector (ESI+ mode). Peptide fragments deriving from enzymatic hydrolysis were identified by molecular weight, allowing location of the site of cleavage. Analytical RP-HPLC method: Agilent Polaris C8-A column (4.6×100 mm, 3 micron) eluted with a linear binary gradient of 10-90% MeCN (0.1% TFA v/v) in water (0.1% TFA v/v) over either 10 or 15 mins at 1.5 mL min−1 at 40° C. with detection by UV absorption at 210 nm. Manual integration (AUC) allowed estimation of remaining intact peptide over the time course of the experiment.

3.4.2 Evaluating Proteolytic-Resistance of Mono- or Bis-Lipidated Peptides to Neprilysin

10.0 μg (˜10 units) recombinant Neprilysin (R&D Systems: 1182-ZNC-010) was reconstituted to 100 μL (100 μg/mL, ˜100 units/mL) in assay buffer (50 mM Tris, 50 mM NaCl, 50 mM NaHCO3, adjusted to pH 8.3) to give the enzyme stock solution. Peptide stock solutions were prepared to a concentration of 250 μM (˜1.0 mg/mL) in assay buffer, pure water or 1×PBS (Dulbecco). 100 μL (10 μg, ˜10 units) of neprilysin stock solution was added to 100 μL of peptide stock solution (1.0 mg/mL, ˜100 ng of peptide, ˜25 μmoles) and the mixture was co-incubated in a temperature regulated bath at 37° C. for the duration of the experiment (ratio enzyme [units]:peptide [moles] ˜1:2.5). 25 μL aliquots (˜12.5 ng initial peptide) of the peptide-enzyme mixture were periodically withdrawn (t=0, 30 mins, 1 hr, 2 hr, 4 hr, 8 hr, 24 hr) and quenched immediately by addition to an equal volume (25 μL) of 5% TFA (v/v) in 1:1 water/acetonitrile to arrest proteolytic activity. 25 μL aliquots (˜6 ng initial peptide) were analyzed by LC/MS and/or analytical RP-HPLC as follows: LC/MS method: Agilent Polaris C8-A column (4.6×100 mm, 3 micron) eluted with a linear binary gradient of 10-90% MeCN (0.1% TFA v/v) in water (0.1% TFA v/v) over 30 mins at 1.5 mL min−1 at ambient temperature with detection by both UV absorption at 210 nm and ionization using a Waters 3100 mass detector (ESI+ mode). Peptide fragments deriving from enzymatic hydrolysis were identified by molecular weight, allowing location of the site of cleavage. Analytical RP-HPLC method: Agilent Polaris C8-A column (4.6×100 mm, 3 micron) eluted with a linear binary gradient of 10-90% MeCN (0.1% TFA v/v) in water (0.1% TFA v/v) over either 10 or 15 mins at 1.5 mL min−1 at 40° C. with detection by UV absorption at 210 nm. Manual integration (AUC) allowed estimation of remaining intact peptide over the time course of the experiment. Table 4 shows the results of this experiment.

TABLE 4
Percentage remaining peptide (AUC at specified time-point by RP-HPLC) upon incubation with neprilysin.
Peptide Seq ID Class t = 0 t = 30 min t = 1 hr t = 2 hr t = 4 hr t = 8 hr t = 24 hr
488 Un-lipidated 100% 63.4% 38.0% 13.1%  2.4%  1.4%   0%
17 Un-lipidated 100%
489 Mono-lipidated 100%
3 Mono-lipidated 100%  100% 99.8%  100% 98.6% 96.5% 96.9%
48 Mono-lipidated 100% 96.8% 96.5% 93.0% 93.9% 89.5% 90.0%
60 Mono-lipidated 100%
68 Mono-lipidated 100% 97.4% 95.4% 96.4% 95.4% 93.9% 94.9%
252 Bis-lipidated 100% 98.1% 98.2% 96.0% 95.2% 89.4% 88.1%
263 Bis-lipidated 100% 98.3% 99.5% 97.7% 92.3% 91.2% 91.9%
269 Bis-lipidated 100% 95.7% 92.8% 93.8% 95.3% 89.7% 89.3%
Liraglutide 490 Mono-lipidated 100% 95.6% 91.7% 89.6% 85.5% 77.9% 63.7%
Semaglutide 491 Mono-lipidated 100% 93.8% 92.2% 84.9% 78.1% 61.3% 29.8%

3.4.3 Evaluating Proteolytic-Resistance of Non-Lipidated Peptides to Porcine Pancreatic Pepsin

Lyophilized porcine pancreatic pepsin (Sigma: P7012) was reconstituted to 200 μg/mL (˜500 units/mL) in assay buffer (1.0 M HCl, pH 2.0) to give the enzyme stock solution. Peptides stock solutions were prepared to a concentration of 330 μM (˜1.0 mg/mL) in assay buffer, pure water or 1×PBS (Dulbecco). 10 μL (2 μg, ˜5 units) of pepsin stock solution was added to 100 μL of peptide solution (1.0 mg/mL, ˜100 μg of peptide, ˜33 μmoles) and the mixture was co-incubated in a temperature-regulated water bath at 37° C. for the duration of the experiment (ratio enzyme [units]:peptide [moles] ˜1:6). 15 μL aliquots (˜15 ng initial peptide) of the peptide-enzyme mixture were periodically withdrawn (t=0, 30 mins, 1 hr, 2 hr, 4 hr, 8 hr, 24 hr) and quenched immediately by addition to an equal volume (15 μL) of 0.1M ammonium bicarbonate solution in water/acetonitrile (1:4, pH 8) to arrest proteolytic activity. 20 μL aliquots (˜10 μg initial peptide) were analyzed by LC/MS and/or analytical RP-HPLC as follows: LC/MS method: Agilent Polaris C8-A column (4.6×100 mm, 3 micron) eluted with a linear binary gradient of 10-90% MeCN (0.1% TFA v/v) in water (0.1% TFA v/v) over 30 mins at 1.5 mL min−1 at ambient temperature with detection by both UV absorption at 210 nm and ionization using a Waters 3100 mass detector (ESI+ mode). Peptide fragments deriving from enzymatic hydrolysis were identified by molecular weight, allowing location of the site of cleavage. Analytical RP-HPLC method: Agilent Polaris C8-A column (4.6×100 mm, 3 micron) eluted with a linear binary gradient of 10-90% MeCN (0.1% TFA v/v) in water (0.1% TFA v/v) over either 10 or 15 mins at 1.5 mL min−1 at 40° C. with detection by UV absorption at 210 nm. Manual integration (AUC) allowed estimation of remaining intact peptide over the time course of the experiment. Table 5 shows the results of this experiment.

3.4.4 Evaluating Proteolytic-Resistance of Mono- or Bis-Lipidated Peptides to Porcine Pancreatic Pepsin

Lyophilized porcine pancreatic pepsin (Sigma: P7012) was reconstituted to 200 ng/mL (˜500 units/mL) in assay buffer (1.0 M HCl, pH 2.0) to give the enzyme stock solution. Peptide stock solutions were prepared to a concentration of 250 μM (˜1.0 mg/mL) in assay buffer, pure water or 1×PBS (Dulbecco). 50 μL (10 μg, ˜25 units) of pepsin stock solution was added to 100 μL of peptide solution (1.0 mg/mL, ˜100 μg of peptide, ˜25 μmoles) and the mixture was co-incubated in a temperature-regulated water bath at 37° C. for the duration of the experiment (ratio enzyme [units]:peptide [moles] ˜1:1. 25 μL aliquots (˜17 μg initial peptide) of the peptide-enzyme mixture were periodically withdrawn (t=0, 30 mins, 1 hr, 2 hr, 4 hr, 8 hr, 24 hr) and quenched immediately by addition to an equal volume (25 μL) of 0.1M ammonium bicarbonate solution in water/acetonitrile (1:4, pH 8) to arrest proteolytic activity. 25 μL aliquots (˜8 μg initial peptide) were analysed by LC/MS and/or analytical RP-HPLC as follows: LC/MS method: Agilent Polaris C8-A column (4.6×100 mm, 3 micron) eluted with a linear binary gradient of 10-90% MeCN (0.1% TFA v/v) in water (0.1% TFA v/v) over 30 mins at 1.5 mL min−1 at ambient temperature with detection by both UV absorption at 210 nm and ionization using a Waters 3100 mass detector (ESI+ mode). Peptide fragments deriving from enzymatic hydrolysis were identified by molecular weight, allowing location of the site of cleavage. Analytical RP-HPLC method: Agilent Polaris C8-A column (4.6×100 mm, 3 micron) eluted with a linear binary gradient of 10-90% MeCN (0.1% TFA v/v) in water (0.1% TFA v/v) over either 10 or 15 mins at 1.5 mL min−1 at 40° C. with detection by UV absorption at 210 nm. Manual integration (AUC) allowed estimation of remaining intact peptide over the time course of the experiment. Table 5 shows the results of this experiment.

TABLE 5
Percentage remaining intact peptide (AUC at specified time-point by RP-HPLC) upon incubation with pepsin.
Peptide Seq ID Class t = 0 t = 30 min t = 1 hr t = 2 hr t = 4 hr t = 8 hr t = 24 hr
488 Un-lipidated 100%
17 Un-lipidated 100%
489 Mono-lipidated 100%
3 Mono-lipidated 100% 99.4% 99.3% 99.1% 98.9% 97.4% 91.3%
48 Mono-lipidated 100% 89.1% 80.8% 71.4% 60.6% 45.9%  9.4%
60 Mono-lipidated 100% 99.9% 98.5% 95.5% 92.1% 89.8% 87.0%
68 Mono-lipidated 100% 96.5% 94.7% 92.2% 88.2% 86.0% 85.3%
252 Bis-lipidated 100% 90.6% 83.2% 69.7% 57.7% 38.8%  0.7%
263 Bis-lipidated 100% 57.7% 36.0% 14.3%  5.1%  1.1%  0.0%
269 Bis-lipidated 100% 74.9% 55.8% 38.6% 22.4% 13.4%  0.0%
Liraglutide 490 Mono-lipidated 100% 12.0%  0.0%  0.0%  0.0%  0.0%  0.0%
Semaglutide 491 Mono-lipidated 100% 10.4%  0.0%  0.0%  0.0%  0.0%  0.0%

3.4.5 Evaluating Proteolytic-Resistance of Non-Lipidated Peptides to Porcine Pancreatic Trypsin

Lyophilized porcine pancreatic trypsin (Sigma: T7409) was reconstituted to 200 μg/mL (˜300 units/mL) in assay buffer (50 mM Tris, 10 mM CaCl2), 150 mM NaCl, 1 mM HCl, adjusted to pH 7.8) to give the enzyme stock solution. Peptide stock solutions were prepared to a concentration of 330 μM (˜1.0 mg/mL) in assay buffer, pure water or 1×PBS (Dulbecco). 10 μL (2 μg, ˜3 units) of trypsin stock solution was added to 100 μL of peptide stock solution (1.0 mg/mL, ˜100 μg of peptide, ˜33 μmoles) and the mixture was co-incubated in a temperature-regulated water bath at 37° C. for the duration of the experiment (ratio enzyme [units]:peptide [μ moles] ˜1:11). 15 μL aliquots (˜15 μg initial peptide) of the peptide-enzyme mixture were periodically withdrawn (t=0, 30 mins, 1 hr, 2 hr, 4 hr, 8 hr, 24 hr) and quenched immediately by addition to an equal volume (15 μL) of 5% TFA (v/v) in 1:1 water/acetonitrile to arrest proteolytic activity. 20 μL aliquots (˜10 ng initial peptide) were analysed by LC/MS and/or analytical RP-HPLC as follows: LC/MS method: Agilent Polaris C8-A column (4.6×100 mm, 3 micron) eluted with a linear binary gradient of 10-90% MeCN (0.1% TFA v/v) in water (0.1% TFA v/v) over 30 mins at 1.5 mL min−1 at ambient temperature with detection by both UV absorption at 210 nm and ionization using a Waters 3100 mass detector (ESI+ mode). Peptide fragments deriving from enzymatic hydrolysis were identified by molecular weight, allowing location of the site of cleavage. Analytical RP-HPLC method: Agilent Polaris C8-A column (4.6×100 mm, 3 micron) eluted with a linear binary gradient of 10-90% MeCN (0.1% TFA v/v) in water (0.1% TFA v/v) over either 10 or 15 mins at 1.5 mL min−1 at 40° C. with detection by UV absorption at 210 nm. Manual integration (AUC) allowed estimation of remaining intact peptide over the time course of the experiment. Table 6 shows the results of this experiment.

3.4.6 Evaluating Proteolytic-Resistance of Mono- or Bis-Lipidated Peptides to Porcine Pancreatic Trypsin

Lyophilized porcine pancreatic trypsin (Sigma: T7409) was reconstituted to 200 μg/mL (˜300 units/mL) in assay buffer (50 mM Tris, 10 mM CaCl2), 150 mM NaCl, 1 mM HCl, adjusted to pH 7.8) to give the enzyme stock solution. Peptide stock solutions were prepared to a concentration of 250 μM (˜1.0 mg/mL) in assay buffer, pure water or 1×PBS (Dulbecco). 50 μL (10 μg, ˜15 units) of trypsin stock solution was added to 100 μL of peptide stock solution (1.0 mg/mL, ˜100 μg of peptide, ˜25 μmoles) and the mixture was co-incubated in a temperature regulated bath at 37° C. for the duration of the experiment (ratio enzyme [units]:peptide [moles] ˜1:1.7). 25 μL aliquots (˜17 μg initial peptide) of the peptide-enzyme mixture were periodically withdrawn (t=0, 30 mins, 1 hr, 2 hr, 4 hr, 8 hr, 24 hr) and quenched immediately by addition to an equal volume (25 μL) of 5% TFA (v/v) in 1:1 water/acetonitrile to arrest proteolytic activity. 25 μL aliquots (˜8 ng initial peptide) were analysed by LC/MS and/or analytical RP-HPLC as follows: LC/MS method: Agilent Polaris C8-A column (4.6×100 mm, 3 micron) eluted with a linear binary gradient of 10-90% MeCN (0.1% TFA v/v) in water (0.1% TFA v/v) over 30 mins at 1.5 mL min−1 at ambient temperature with detection by both UV absorption at 210 nm and ionization using a Waters 3100 mass detector (ESI+ mode). Peptide fragments deriving from enzymatic hydrolysis were identified by molecular weight, allowing location of the site of cleavage. Analytical RP-HPLC method: Agilent Polaris C8-A column (4.6×100 mm, 3 micron) eluted with a linear binary gradient of 10-90% MeCN (0.1% TFA v/v) in water (0.1% TFA v/v) over either 10 or 15 mins at 1.5 mL min−1 at 40° C. with detection by UV absorption at 210 nm. Manual integration (AUC) allowed estimation of remaining intact peptide over the time course of the experiment. Table 6 shows the results of this experiment.

TABLE 6
Percentage remaining intact peptide (AUC at specified time-point by RP-HPLC) upon incubation with trypsin.
Peptide Seq ID Class t = 0 t = 30 min t = 1 hr t = 2 hr t = 4 hr t = 8 hr t = 24 hr
488 Un-lipidated   100%
17 Un-lipidated   100%
489 Mono-lipidated   100%
3 Mono-lipidated 100.0% 90.2% 86.7% 82.5% 79.3% 76.2% 74.8%
48 Mono-lipidated 100.0% 93.0% 89.2% 83.5% 75.6% 68.9% 56.5%
60 Mono-lipidated 100.0% 90.0% 87.1% 82.4% 78.6% 73.5% 65.1%
68 Mono-lipidated 100.0% 92.3% 86.2% 76.8% 48.6% 39.8% 27.4%
252 Bis-lipidated 100.0% 97.2% 92.5% 86.0% 80.1% 78.1% 70.2%
263 Bis-lipidated 100.0% 98.9% 97.2% 94.8% 89.8% 85.0% 78.6%
269 Bis-lipidated   100% 96.8% 95.2% 89.9% 85.2% 82.9% 74.7%
Liraglutide 490 Mono-lipidated 100.0%  9.6%  4.8%  1.8%  0.0%  0.0%  0.0%
Semaglutide 491 Mono-lipidated 100.0%  0.0%  0.0%  0.0%  0.0%  0.0%  0.0%

3.4.7 Evaluating Proteolytic-Resistance of Non-Lipidated Peptides to α-Chymotrypsin

10.0 μg (˜10 units) recombinant a-Chymotrypsin (R&D Systems: 6907-SE-010) is reconstituted to 100 μL (100 μg/mL, ˜100 units/mL) in assay buffer (50 mM Tris, 10 mM CaCl2), 150 mM NaCl, 1 mM HCl, adjusted to pH 7.8) to give the enzyme stock solution. Peptide stock solutions are prepared to a concentration of 330 μM (˜1.0 mg/mL) in assay buffer, pure water or 1×PBS (Dulbecco). 10 μL (1 μg, ˜1 unit) of α-chymotrypsin stock solution is added to 100 μL of peptide stock solution (1.0 mg/mL, ˜100 ng of peptide, ˜33 μmoles) and the mixture is co-incubated in a temperature-regulated water bath at 37° C. for the duration of the experiment (ratio enzyme [units]:peptide [moles] ˜1:33). 15 μL aliquots (˜15 ng initial peptide) of the peptide-enzyme mixture are periodically withdrawn (t=0, 30 mins, 1 hr, 2 hr, 4 hr, 8 hr, 24 hr) and quenched immediately by addition to an equal volume (15 μL) of 5% TFA (v/v) in 1:1 water/acetonitrile to arrest proteolytic activity. 20 μL aliquots (˜10 ng initial peptide) are analysed by LC/MS and/or analytical RP-HPLC as follows: LC/MS method: Agilent Polaris C8-A column (4.6×100 mm, 3 micron) elutes with a linear binary gradient of 10-90% MeCN (0.1% TFA v/v) in water (0.1% TFA v/v) over 30 mins at 1.5 mL min−1 at ambient temperature with detection by both UV absorption at 210 nm and ionization using a Waters 3100 mass detector (ESI+ mode). Peptide fragments deriving from enzymatic hydrolysis are identified by molecular weight, allowing location of the site of cleavage. Analytical RP-HPLC method: Agilent Polaris C8-A column (4.6×100 mm, 3 micron) elutes with a linear binary gradient of 10-90% MeCN (0.1% TFA v/v) in water (0.1% TFA v/v) over either 10 or 15 mins at 1.5 mL min−1 at 40° C. with detection by UV absorption at 210 nm. Manual integration (AUC) allows estimation of remaining intact peptide over the time course of the experiment.

3.4.8 Evaluating Proteolytic-Resistance of Mono- or Bis-Lipidated Peptides to α-Chymotrypsin

10.0 ng (˜10 units) recombinant α-chymotrypsin (R&D Systems: 6907-SE-010) is reconstituted to 100 μL (100 μg/mL, ˜100 units/mL) in assay buffer (50 mM Tris, 10 mM CaCl2), 150 mM NaCl, 1 mM HCl, adjusted to pH 7.8) to give the enzyme stock solution. Peptide stock solutions are prepared to a concentration of 250 μM (˜1.0 mg/mL) in assay buffer, pure water or 1×PBS (Dulbecco). 100 μL (10 μg, ˜10 units) of α-chymotrypsin stock solution is added to 100 μL of peptide stock solution (1.0 mg/mL, ˜100 ng of peptide, ˜25 μmoles) and the mixture is co-incubated in a temperature regulated bath at 37° C. for the duration of the experiment (ratio enzyme [units]:peptide [moles] ˜1:2.5). 25 μL aliquots (˜12.5 ng initial peptide) of the peptide-enzyme mixture are periodically withdrawn (t=0, 30 mins, 1 hr, 2 hr 4 hr, 8 hr, 24 hr) and quenched immediately by addition to an equal volume (25 μL) of 5% TFA (v/v) in 1:1 water/acetonitrile to arrest proteolytic activity. 25 μL aliquots (˜6 ng initial peptide) are analysed by LC/MS and/or analytical RP-HPLC as follows: LC/MS method: Agilent Polaris C8-A column (4.6×100 mm, 3 micron) elutes with a linear binary gradient of 10-90% MeCN (0.1% TFA v/v) in water (0.1% TFA v/v) over 30 mins at 1.5 mL min−1 at ambient temperature with detection by both UV absorption at 210 nm and ionization using a Waters 3100 mass detector (ESI+ mode). Peptide fragments deriving from enzymatic hydrolysis are identified by molecular weight, allowing location of the site of cleavage. Analytical RP-HPLC method: Agilent Polaris C8-A column (4.6×100 mm, 3 micron) elutes with a linear binary gradient of 10-90% MeCN (0.1% TFA v/v) in water (0.1% TFA v/v) over either 10 or 15 mins at 1.5 mL min−1 at 40° C. with detection by UV absorption at 210 nm. Manual integration (AUC) allows estimation of remaining intact peptide over the time course of the experiment.

TABLE 7
Percentage remaining intact peptide (AUC at specified time-point by RP-HPLC) upon incubation with α-chymotrypsin.
Peptide Seq ID Class t = 0 t = 30 m t = 1 h t = 2 h t = 4 h t = 8 h t = 24 h
488 Un-lipidated 100% 93.9% 92.6% 86.7% 81.7% 70.2% 22.1%
17 Un-lipidated 100% 91.6% 87.2% 86.3% 86.6% 87.7% 82.1%
3 Mono-lipidated 100% 97.8% 96.6% 95.4% 95.2% 95.1% 94.6%
48 Mono-lipidated 100% 97.8% 94.6% 90.9% 88.8% 89.4% 86.4%
252 Bis-lipidated 100% 96.3% 96.4% 94.2% 91.4% 86.4% 77.4%
263 Bis-lipidated 100% 88.1% 93.9% 92.2% 93.5% 95.0% 92.3%
269 Bis-lipidated 100% 97.1% 95.8% 96.0% 94.2% 92.6% 89.4%
Liraglutide 490 Mono-lipidated 100% 95.7% 95.6% 91.5% 89.4% 84.4% 73.8%
Semaglutide 491 Mono-lipidated 100% 93.6% 90.8% 87.8% 84.3% 78.6% 63.6%

3.4.9 Evaluating Proteolytic-Resistance of Non-Lipidated Peptides to Porcine Pancreatic Elastase

1.0 mg (˜5 units) lyophilized porcine pancreatic elastase (Sigma: E7885) is reconstituted to 100 μL (10 mg/mL, ˜50 units/mL) in assay buffer (50 mM Tris, 50 mM NaCl, 50 mM NaHCO3) and adjusted to pH 8.1 using NaOH (1.0 M) to give the enzyme stock solution. Peptide stock solutions are prepared to a concentration of 330 μM (˜1.0 mg/mL) in assay buffer, pure water or 1×PBS (Dulbecco). 20 μL (200 μg, ˜1 unit) of elastase stock solution is added to 100 μL of peptide stock solution (1.0 mg/mL, ˜100 μg of peptide, ˜33 μmoles) and the mixture is co-incubated in a temperature-regulated water bath at 37° C. for the duration of the experiment (ratio enzyme [units]:peptide [moles] ˜1:33). 15 μL aliquots (˜15 ng initial peptide) of the peptide-enzyme mixture are periodically withdrawn (t=0, 30 mins, 1 hr, 2 hr, 4 hr, 8 hr, 24 hr) and quenched immediately by addition to an equal volume (15 μL) of 5% TFA (v/v) in 1:1 water/acetonitrile to arrest proteolytic activity. 20 μL aliquots (˜10 ng initial peptide) are analysed by LC/MS and/or analytical RP-HPLC as follows: LC/MS method: Agilent Polaris C8-A column (4.6×100 mm, 3 micron) elutes with a linear binary gradient of 10-90% MeCN (0.1% TFA v/v) in water (0.1% TFA v/v) over 30 mins at 1.5 mL min−1 at ambient temperature with detection by both UV absorption at 210 nm and ionization using a Waters 3100 mass detector (ESI+ mode). Peptide fragments deriving from enzymatic hydrolysis are identified by molecular weight, allowing location of the site of cleavage. Analytical RP-HPLC method: Agilent Polaris C8-A column (4.6×100 mm, 3 micron) elutes with a linear binary gradient of 10-90% MeCN (0.1% TFA v/v) in water (0.1% TFA v/v) over either 10 or 15 mins at 1.5 mL min−1 at 40° C. with detection by UV absorption at 210 nm. Manual integration (AUC) allows estimation of remaining intact peptide over the time course of the experiment.

3.4.10 Evaluating Proteolytic-Resistance of Mono- or Bis-Lipidated Peptides to Porcine Pancreatic Elastase

1.0 mg (˜5 units) lyophilized porcine pancreatic elastase (Sigma: E7885) are reconstituted to 100 μL (10 mg/mL, ˜50 units/mL) in assay buffer (50 mM Tris, 50 mM NaCl, 50 mM NaHCO3) and adjusted to pH 8.1 using NaOH (1.0 M) to give the enzyme stock solution. Peptide stock solutions are prepared to a concentration of 250 μM (˜1.0 mg/mL) in assay buffer, pure water or 1×PBS (Dulbecco). 100 μL (1000 μg, ˜5 units) of elastase stock solution are added to 100 μL of peptide stock solution (1.0 mg/mL, ˜100 ng of peptide, ˜25 μmoles) and the mixture is co-incubated in a temperature regulated bath at 37° C. for the duration of the experiment (ratio enzyme [units]:peptide [moles] ˜1:5). 25 μL aliquots (˜17 ng initial peptide) of the peptide-enzyme mixture are periodically withdrawn (t=0, 30 mins, 1 hr, 2 hr, 4 hr, 8 hr, 24 hr) and is quenched immediately by addition to an equal volume (25 μL) of 5% TFA (v/v) in 1:1 water/acetonitrile to arrest proteolytic activity. 25 μL aliquots (˜8 ng initial peptide) are analysed by LC/MS and/or analytical RP-HPLC as follows: LC/MS method: Agilent Polaris C8-A column (4.6×100 mm, 3 micron) elutes with a linear binary gradient of 10-90% MeCN (0.1% TFA v/v) in water (0.1% TFA v/v) over 30 mins at 1.5 mL min−1 at ambient temperature with detection by both UV absorption at 210 nm and ionization using a Waters 3100 mass detector (ESI+ mode). Peptide fragments deriving from enzymatic hydrolysis are identified by molecular weight, allowing location of the site of cleavage. Analytical RP-HPLC method: Agilent Polaris C8-A column (4.6×100 mm, 3 micron) elutes with a linear binary gradient of 10-90% MeCN (0.1% TFA v/v) in water (0.1% TFA v/v) over either 10 or 15 mins at 1.5 mL min−1 at 40° C. with detection by UV absorption at 210 nm. Manual integration (AUC) allows estimation of remaining intact peptide over the time course of the experiment.

3.4.11 Evaluating Proteolytic-Resistance of Mono- or Bis-Lipidated Peptides to Fasted-State Simulated Intestinal Fluid (FASSIF/Pancreatin®)

A fresh suspension of FASSIF/P (Fasted-State Simulated Intestinal Fluid+USP Pancreatin®) was prepared according to that described by Galia, Nicolaides, Hörter, Lobenberg, Reppas and Dressman: Pharm. Res. 15 (1998) 698-705. The resulting preparation is proteolytically equivalent to ˜375 units/mL (375 kU/L) and was used immediately without storage. Peptides for evaluation (1.0 mg, ˜250 nmoles) were initially dissolved in pre-warmed FASSIF without Pancreatin® (200 μL) to which was added pre-warmed fresh FASSIF/Pancreatin® (100 μL) to initiate potential digestion. Following momentary vortexing of the Eppendorf reaction tube the mixture was incubated at 37° C. in a thermostatic waterbath for the duration of the experiment. 25 μL aliquots of the co-incubated peptide-enzyme mixture were periodically withdrawn (t=0, 5 m, 10 m, 15 m, 30 m, 1 h, 2 h) and quenched immediately by addition to a solution of 10% TFA in 1:1 water/acetonitrile (75 μL) to arrest proteolytic activity. Quenched samples were centrifuged (7800 RPM, 3 mins) to pellet solids and 30 μL aliquots of the supernatant solution were analysed by LC/MS and/or analytical RP-HPLC as follows: LC/MS method: Agilent Polaris C8-A column (4.6×100 mm, 3 micron) eluted with a linear binary gradient of 10-90% MeCN (0.1% TFA v/v) in water (0.1% TFA v/v) over 30 mins at 1.5 mL min-1 at ambient temperature with detection by both UV absorption at 210 nm and ionization using a Waters 3100 mass detector (ESI+ mode). Peptide fragments deriving from enzymatic hydrolysis were identified by molecular weight, allowing location of the site of cleavage. Analytical RP-HPLC method: Agilent Polaris C8-A column (4.6×100 mm, 3 micron) eluted with a linear binary gradient of 10-90% MeCN (0.1% TFA v/v) in water (0.1% TFA v/v) over either 10 or 15 mins at 1.5 mL min-1 at 40° C. with detection by UV absorption at 210 nm. Manual integration (AUC) allowed estimation of remaining intact peptide over the time course of the experiment.

TABLE 8
Percentage remaining intact peptide (AUC at specified time-point by RP-HPLC)
upon incubation with fasted-state simulated intestinal fluid (FASSIF/P).
Peptide Seq ID Class t = 0 t = 5 m t = 10 m t = 15 m t = 30 m t = 1 h t = 2 h
3 Mono-lipidated 100% 99.6 98.3 97.6 95.7 92.1 82.3
252 Bis-lipidated 100% 66.3 39.4 19.9 3.1 0.0 0.0
263 Bis-lipidated 100% 93.1 85.6 76.8 57.6 35.1 7.8
405 Bis-lipidated 100% 99.5 99.0 99.4 95.7 88.7 60.4
406 Bis-lipidated 100% 93.9 85.7 75.9 56.1 33.2 7.7
407 Bis-lipidated 100% 86.2 72.9 60.3 36.3 16.2 2.1
Semaglutide 491 Mono-lipidated 100% 14.8 4.0 0.0 0.0 0.0 0.0

3.4.12 Evaluating Proteolytic-Resistance of Mono- or Bis-Lipidated Peptides to Fasted-State Simulated Intestinal Fluid (FASSIF/Pancreatin®) Following Full Zymogen Activation with Enterokinase

A fresh suspension of FASSIF/P (Fasted-State Simulated Intestinal Fluid+USP Pancreatin®) was prepared according to that described by Galia, Nicolaides, Hörter, Lobenberg, Reppas and Dressman: Pharm. Res. 15 (1998) 698-705. To the resulting preparation was added human enterokinase (100 μg/mL) to ensure the potential for full zymogen activity of the mixture which was used immediately without storage. Peptides for evaluation (1.0 mg, ˜250 nmoles) were initially dissolved in pre-warmed FASSIF without Pancreatin® (200 μL) to which was added pre-warmed fresh FASSIF/Pancreatin® (100 L) to initiate potential digestion. Following momentary vortexing of the Eppendorf reaction tube the mixture was incubated at 37° C. in a thermostatic waterbath for the duration of the experiment. 25 μL aliquots of the co-incubated peptide-enzyme mixture were periodically withdrawn (t=0, 5 m, 10 m, 15 m, 30 m, 1 h, 2 h) and quenched immediately by addition to a solution of 10% TFA in 1:1 water/acetonitrile (75 μL) to arrest proteolytic activity. Quenched samples were centrifuged (7800 RPM, 3 mins) to pellet solids and 30 μL aliquots of the supernatant solution were analysed by LC/MS and/or analytical RP-HPLC as follows: LC/MS method: Agilent Polaris C8-A column (4.6×100 mm, 3 micron) eluted with a linear binary gradient of 10-90% MeCN (0.1% TFA v/v) in water (0.1% TFA v/v) over 30 mins at 1.5 mL min-1 at ambient temperature with detection by both UV absorption at 210 nm and ionization using a Waters 3100 mass detector (ESI+ mode). Peptide fragments deriving from enzymatic hydrolysis were identified by molecular weight, allowing location of the site of cleavage. Analytical RP-HPLC method: Agilent Polaris C8-A column (4.6×100 mm, 3 micron) eluted with a linear binary gradient of 10-90% MeCN (0.1% TFA v/v) in water (0.1% TFA v/v) over either 10 or 15 mins at 1.5 mL min-1 at 40° C. with detection by UV absorption at 210 nm. Manual integration (AUC) allowed estimation of remaining intact peptide over the time course of the experiment.

TABLE 9
Percentage remaining intact peptide (AUC at specified time-point by RP-HPLC)
upon incubation with fasted-state simulated intestinal fluid (FASSIF)
activated with 100 μg/mL enterokinase to ensure full zymogen conversion.
Peptide Seq ID Class t = 0 t = 5 m t = 10 m t = 15 m t = 30 m t = 1 h t = 2 h t = 4 h
3 Mono- 100% 96.3% 96.0% 95.5% 94.1% 93.6% 94.1% 94.6%
lipidated
252 Bis- 100% 42.5% 26.8% 14.6%  2.4%  0.0%  0.0%  0.0%
lipidated
263 Bis- 100% 94.3% 86.3% 74.4% 56.2% 29.6%  8.2%  1.4%
lipidated
269 Bis- 100% 78.4% 57.9% 46.2% 21.1%  3.7%  0.0%  0.0%
lipidated
405 Bis- 100% 99.5% 98.9% 96.8% 93.2% 86.6% 75.7% 59.4%
lipidated
Semaglutide 491 Mono- 100% 10.7%  3.0%  0.0%  0.0%  0.0%  0.0%  0.0%
lipidated

4.1 cAMP Assays

The biological activities/receptor potencies of the lipidated GLP-1 anolog peptides described herein are suitably tested for biological activity, e.g., stimulation of one or more cellular receptor responses. Stable cell lines expressing human, mouse, rat, or dog GLP-1 receptor (GLP-1R), glucagon receptor (GCGR) or glucose-dependent insulinotropic peptide (gastric inhibitory polypeptide) receptor (GIPR) are generated in HEK293 cells or CHO cells by standard methods. Peptide activation of these various receptors results in downstream accumulation of cAMP second messenger which can be measured in a functional activity assay.

cAMP assays were performed using “assay buffer”: Assay Buffer: 0.1% BSA (Sigma # A3059) in HBSS (Sigma # H8264) with 25 mM HEPES, pH 7.4 and containing 0.5 mM IBMX (Sigma #17018).

Low protein binding 384-well plates (Greiner #781280) are used to perform eleven 1 in 5 serial dilutions of test samples which are made in assay buffer. Sample dilutions are made in duplicate.

A frozen cryo-vial of cells expressing the receptor of interest is thawed rapidly in a water-bath, transferred to pre-warmed assay buffer and spun at 240×g for 5 minutes. Cells are re-suspended in assay buffer at a batch-dependent optimized concentration (e.g. hGCGR cells at 2×105 cells/ml, hGLP-1R and hGIPR cells at 1×105 cells/ml).

From the dilution plate, a 5 μL replica is stamped onto a black shallow-well u-bottom 384-well plate (Corning #3676). To this, 5 μL cell suspension is added and the plates incubated at room temperature for 30 minutes.

cAMP levels are measured using a commercially available cAMP dynamic 2 HTRF kit (Cisbio, Cat #62AM4PEJ), following the two step protocol as per manufacturer's recommendations. In brief; anti-cAMP cryptate (donor fluorophore) and cAMP-d2 (acceptor fluorophore) are made up separately by diluting each 1/20 in conjugate & lysis buffer provided in the kit. 5 μL anti-cAMP cryptate is added to wells of the assay plate, and 5 μL cAMP-d2 is added to wells except non-specific binding (NSB) wells, to which conjugate and lysis buffer are added. Plates are incubated at room temperature for one hour and then read on an Envision (Perkin Elmer) using excitation wavelength of 320 nm and emission wavelengths of 620 nm & 665 nm. EC50 values of the synthetic peptides determined in cAMP assays are then determined.

In additional experiments for determining biological activity/receptor potency, CHO cells with stable recombinant expression of the human, mouse or rat GCGR or GLP-1 receptor are cultured in assay buffer as above). Cryopreserved cell stocks are prepared in 1× cell freezing medium-DMSO serum free (Sigma Aldrich) at either 1×107 or 2×107/vial and stored at −80° C. Cells are rapidly thawed at 37° C. and then diluted into assay buffer (buffer as above) containing serum albumin at 4.4, 3.2 and 3.2% for human, rat, and mouse serum albumin respectively. Peptides are serially diluted in 100% DMSO and then diluted 100 fold into assay buffer as above containing serum albumin at stated final concentration. Diluted peptides are then transferred into 384 black shallow well microtitre assay plates. Cells are added to the assay plates and incubated for 30 min at room temperature. Following incubation the assay is stopped and cAMP levels measured using the HTRF® dynamic d2 cAMP assay kit available from CisBio Bioassays, as per the manufacturer's guidelines. Plates are read on Perkin Elmer ENVISION® fluorescence plate readers. Human and rat serum albumin are purchased from Sigma Aldrich and mouse serum albumin from Equitech Bio Ltd.

Data is transformed to % Delta F as described in the manufacturer's guidelines and analyzed by 4-parameter logistic fit to determine EC50 values. EC50 values determined are dependent on both the potency of the peptides tested at the GLP-1 and glucagon receptors in the recombinant cell lines and on the affinity of the peptide for serum albumin, which determines the amount of free peptide. Association with serum albumin increases the EC50 value obtained. The fraction of free peptide at plasma concentrations of albumin and the EC50 at 0% serum albumin (SA) can be calculated based on the variation in cAMP generation with the SA concentration. To compare the balance of activities at the GLP-1R and GCGR between different peptides and across different conditions, these can be correlated, where the EC50's are related to those of comparator peptides. Tables 7-10 show the results of these experiments.

TABLE 7
cAMP activity of substituted and mono-lipidated peptides
SEQ Primary assay EC50 Primary assay EC50
ID ID GLP-1R GLP-1R Mean
NO Gluc-R n1 GIP-R Gluc-R n2 GIP-R pM GLP-1R
GLP-1 1 2.3E-08 2.2E-12 2.3E-08 2.3E-08 3.4E-12 2.3E-08 2.8
(7-36)
mono- 2
3 2.5E−08 6.4E−11 2.5E−08 2.5E−08 1.4E−10 2.5E−08 100
5 8.1E−08 7.5E−12 8.1E−08 8.1E−08 5.5E−12 8.1E−08 6.5
6 2.2E−08 4.8E−12 2.2E−08 2.2E−08 5.3E−12 2.2E−08 5.1
7 1.0E−07 3.5E−10 1.0E−07 1.0E−07 4.3E−10 1.0E−07 389
8 7.8E−09 7.1E−11 2.3E−08 1.2E−08 1.1E−10 2.3E−08 88
9 2.9E−08 1.2E−09 2.9E−08 2.9E−08 1.2E−09 2.9E−08 1195
10 1.0E−07 8.7E−11 1.0E−07 1.0E−07 9.3E−11 1.0E−07 90
11 1.0E−07 3.2E−11 1.0E−07 1.0E−07 3.2E−11 1.0E−07 32
12 1.0E−08 2.1E−09 4.5E−08 1.3E−08 2.1E−09 4.5E−08 2105
13 7.6E−09 2.2E−11 6.9E−10 4.1E−09 9.6E−12 6.3E−10 16
14 3.0E−09 3.1E−09 1.5E−08 1.1E−09 1.8E−09 1.9E−08 2445
15 1.2E−07 1.2E−07 1.6E−10 1.2E−07 1.2E−07 7.9E−11 119000
16 1.0E−07 1.1E−08 1.0E−07 1.0E−07 9.4E−09 1.0E−07 10120
17 3.1E−08 2.5E−13 3.1E−08 3.1E−08 2.4E−13 3.1E−08 0.2
18 1.0E−07 4.1E−09 1.0E−07 1.0E−07 5.8E−09 1.0E−07 4940
19 1.3E−07 3.5E−09 1.3E−07 1.3E−07 3.3E−09 1.3E−07 3410
20 2.9E−07 1.5E−08 2.9E−07 2.9E−07 1.2E−08 2.9E−07 13450
21 3.4E−07 1.0E−10 3.4E−07 3.4E−07 1.1E−10 3.4E−07 108
22 3.9E−07 1.2E−10 4.8E−07 2.4E−07 1.2E−10 4.8E−07 118
23 5.4E−07 4.0E−09 5.4E−07 5.4E−07 4.9E−09 5.4E−07 4460
24 7.4E−07 3.3E−09 7.4E−07 7.4E−07 7.9E−09 7.4E−07 5595
25 1.0E−07 5.0E−10 1.0E−07 2.2E−08 5.9E−10 1.0E−07 544
26 1.0E−07 9.9E−11 1.0E−07 3.0E−08 1.5E−10 1.0E−07 123
27 1.0E−07 4.2E−10 1.0E−07 4.0E−08 4.8E−10 1.0E−07 446
28 1.0E−07 4.6E−09 1.0E−07 1.0E−07 4.7E−09 1.0E−07 4620
29 1.0E−07 7.8E−10 1.0E−07 1.0E−07 8.2E−10 1.0E−07 801
30 1.0E−07 8.0E−08 1.0E−07 1.0E−07 9.7E−08 1.0E−07 88550
32 9.0E−08 3.6E−11 9.0E−08 9.0E−08 1.8E−11 9.0E−08 27
33 2.5E−08 6.4E−11 2.5E−08 2.5E−08 1.4E−10 2.5E−08 100
34 9.3E−08 3.9E−11 9.3E−08 9.3E−08 4.8E−11 9.3E−08 43
35 8.9E−08 4.9E−09 8.9E−08 2.7E−08 1.7E−09 2.7E−08 3260
36 8.4E−08 6.3E−08 8.4E−08 2.5E−08 2.5E−08 2.5E−08 44200
37 9.2E−08 7.3E−09 9.2E−08 2.8E−08 1.7E−09 2.8E−08 4500
38 2.5E−08 6.2E−11 2.5E−08 2.5E−08 8.2E−11 2.5E−08 72
39 2.7E−08 3.3E−11 2.7E−08 2.7E−08 3.3E−11 2.7E−08 33
40 8.5E−08 1.8E−09 8.5E−08 2.6E−08 5.7E−10 2.6E−08 1173
41 9.4E−08 2.4E−10 9.4E−08 2.8E−08 5.1E−11 2.8E−08 147
42 3.1E−08 6.9E−12 3.1E−08 3.1E−08 1.1E−11 3.1E−08 8.7
43 3.1E−08 4.5E−13 3.1E−08 3.1E−08 7.1E−13 3.1E−08 0.6
44 3.1E−08 6.5E−12 3.1E−08 3.1E−08 6.9E−12 3.1E−08 6.7
45 2.6E−08 3.8E−09 2.6E−08 2.6E−08 3.3E−09 2.6E−08 3555.0
46 2.6E−08 9.2E−10 2.6E−08 2.6E−08 2.2E−09 2.6E−08 1555.0
47 2.5E−08 3.7E−11 2.5E−08 2.5E−08 5.0E−11 2.5E−08 43.3
48 2.6E−08 3.9E−12 2.6E−08 2.6E−08 8.2E−12 2.6E−08 6.1
49 2.5E−08 9.6E−11 2.5E−08 2.5E−08 1.5E−10 2.5E−08 123.9
50 2.6E−08 1.7E−10 2.6E−08 2.6E−08 2.6E−10 2.6E−08 215.5
51 2.6E−08 1.7E−12 2.6E−08 2.6E−08 2.4E−12 2.6E−08 2.1
52 2.6E−08 1.5E−12 2.6E−08 2.6E−08 2.5E−12 2.6E−08 2.0
53 2.6E−08 8.3E−13 2.6E−08 2.6E−08 9.0E−13 2.6E−08 0.9
54 2.6E−08 7.9E−13 2.6E−08 2.6E−08 9.3E−13 2.6E−08 0.9
55 2.5E−08 1.4E−12 2.5E−08 2.5E−08 2.3E−12 2.5E−08 1.8
56 2.6E−08 2.9E−12 2.6E−08 2.6E−08 3.5E−12 2.6E−08 3.2
57 2.5E−08 1.4E−10 2.5E−08 2.5E−08 1.7E−10 2.5E−08 153
58 2.5E−08 5.2E−09 2.5E−08 2.5E−08 4.3E−09 2.5E−08 4725
59 2.56E−08  2.43E−10  2.56E−08  2.56E−08  1.79E−10  2.56E−08  211
60 2.5E−08 4.9E−11 2.5E−08 2.5E−08 5.0E−11 2.5E−08 49
61 2.5E−08 8.5E−13 2.5E−08 2.5E−08 9.1E−13 2.5E−08 0.9
62 2.5E−08 2.0E−12 2.5E−08 2.5E−08 1.8E−12 2.5E−08 1.9
63 2.57E−08  3.21E−12  2.57E−08  2.57E−08  2.55E−12  2.57E−08  2.9
64 2.5E−08 1.4E−12 2.5E−08 2.5E−08 1.2E−12 2.5E−08 1.3
65 2.51E−08  1.97E−11  2.51E−08  2.51E−08  1.40E−11  2.51E−08  16.9
66 2.51E−08  2.03E−10  2.51E−08  2.51E−08  9.79E−11  2.51E−08  150.5
67 2.54E−08  7.21E−11  2.54E−08  2.54E−08  4.80E−11  2.54E−08  60.1
68 2.50E−08  2.21E−11  2.50E−08  2.50E−08  1.55E−11  2.50E−08  18.8
69 2.55E−08  6.61E−11  2.55E−08  2.55E−08  3.99E−11  2.55E−08  53.0
70 2.7E−08 7.4E−11 2.7E−08 2.7E−08 9.2E−11 2.7E−08 83
71 2.7E−08 6.2E−12 2.7E−08 2.7E−08 8.0E−12 2.7E−08 7.1
72 2.8E−08 4.6E−11 2.8E−08 2.8E−08 5.2E−11 2.8E−08 49
73 2.8E−08 1.3E−10 2.8E−08 2.8E−08 1.6E−10 2.8E−08 146
74 2.8E−08 2.3E−12 2.8E−08 2.8E−08 2.0E−12 2.8E−08 2.1
75 2.8E−08 2.0E−12 2.8E−08 2.8E−08 1.4E−12 2.8E−08 1.7
76 2.7E−08 8.4E−12 2.7E−08 2.7E−08 6.0E−12 2.7E−08 7.2
77 2.8E−08 1.9E−09 2.8E−08 2.8E−08 1.8E−09 2.8E−08 1855
78 2.8E−08 1.8E−11 2.8E−08 2.8E−08 9.3E−12 2.8E−08 14
79 2.8E−08 3.9E−12 2.8E−08 2.8E−08 2.3E−12 2.8E−08 3.1
80 2.8E−08 3.1E−11 2.8E−08 2.8E−08 1.7E−11 2.8E−08 24
81 2.7E−08 3.7E−10 2.7E−08 2.7E−08 2.0E−10 2.7E−08 283
82 2.7E−08 3.0E−12 2.7E−08 2.7E−08 2.0E−12 2.7E−08 2.5
83 2.8E−08 3.2E−12 2.8E−08 2.8E−08 4.0E−12 2.8E−08 3.6
84 2.7E−08 7.8E−12 2.7E−08 2.7E−08 8.1E−12 2.7E−08 8.0
85 2.8E−08 6.6E−11 2.8E−08 2.8E−08 1.4E−10 2.8E−08 101
86 2.8E−08 1.3E−12 2.8E−08 2.8E−08 1.7E−12 2.8E−08 1.5
87 2.8E−08 1.6E−12 2.8E−08 2.8E−08 1.6E−12 2.8E−08 1.6
88 2.8E−08 4.3E−12 2.8E−08 2.8E−08 5.7E−12 2.8E−08 5.0
89 2.8E−08 4.5E−10 2.8E−08 2.8E−08 6.5E−10 2.8E−08 548
90 2.8E−08 6.8E−13 2.8E−08 2.8E−08 7.9E−13 2.8E−08 0.7
91 2.8E−08 2.1E−11 2.8E−08 2.8E−08 2.7E−11 2.8E−08 24
92 2.8E−08 4.5E−10 2.8E−08 2.8E−08 3.9E−10 2.8E−08 423
93 2.8E−08 2.8E−08 2.8E−08 2.8E−08 2.8E−08 2.8E−08 27600
94 2.8E−08 1.4E−10 2.8E−08 2.8E−08 3.2E−10 2.8E−08 228
95 2.8E−08 2.6E−10 2.8E−08 2.8E−08 1.9E−10 2.8E−08 224
96 2.7E−08 9.2E−10 2.7E−08 2.7E−08 5.7E−10 2.7E−08 746
97 2.8E−08 2.8E−08 2.8E−08 2.8E−08 2.8E−08 2.8E−08 27800
98 2.8E−08 2.8E−08 2.8E−08 2.8E−08 2.8E−08 2.8E−08 27500
99 2.5E−08 5.8E−11 2.5E−08 2.49E−08  4.93E−11  2.49E−08  54
100 2.5E−08 1.6E−11 2.5E−08 2.49E−08  1.46E−11  2.49E−08  15
101 2.5E−08 5.8E−11 2.5E−08 2.54E−08  5.12E−11  2.54E−08  55
102 2.5E−08 2.4E−11 2.5E−08 2.52E−08  2.06E−11  2.52E−08  22
103 2.5E−08 4.7E−12 2.5E−08 2.52E−08  4.56E−12  2.52E−08  5
104 2.6E−08 5.9E−12 2.6E−08 2.56E−08  5.11E−12  2.56E−08  5
105 2.5E−08 2.1E−11 2.5E−08 2.50E−08  1.48E−11  2.50E−08  18
106 2.5E−08 6.5E−09 2.5E−08 2.53E−08  5.79E−09  2.53E−08  6145
107 2.6E−08 8.3E−11 2.6E−08 2.56E−08  7.05E−11  2.56E−08  77
108 2.5E−08 3.8E−12 2.5E−08 2.54E−08  3.46E−12  2.54E−08  4
109 2.6E−08 3.4E−11 2.6E−08 2.56E−08  3.46E−11  2.56E−08  34
110 2.5E−08 6.0E−11 2.5E−08 2.50E−08  6.39E−11  2.50E−08  62
111 2.5E−08 1.8E−11 2.5E−08 2.50E−08  1.64E−11  2.50E−08  17
112 2.5E−08 6.1E−12 2.5E−08 2.54E−08  5.07E−12  2.54E−08  6
113 2.5E−08 1.8E−11 2.5E−08 2.49E−08  1.74E−11  2.49E−08  18
114 2.5E−08 5.5E−10 2.5E−08 2.54E−08  4.58E−10  2.54E−08  503
115 2.5E−08 6.0E−12 2.5E−08 2.53E−08  5.39E−12  2.53E−08  6
116 2.6E−08 9.3E−12 2.6E−08 2.56E−08  9.12E−12  2.56E−08  9
117 2.5E−08 2.6E−11 2.5E−08 2.51E−08  2.44E−11  2.51E−08  25
118 2.5E−08 8.1E−10 2.5E−08 2.52E−08  7.58E−10  2.52E−08  783
119 2.5E−08 1.8E−11 2.5E−08 2.52E−08  1.57E−11  2.52E−08  17
120 2.5E−08 4.1E−09 2.5E−08 2.53E−08  3.13E−09  2.53E−08  3635
121 2.5E−08 2.5E−08 2.5E−08 2.51E−08  2.51E−08  2.51E−08  25100
122 2.5E−08 2.5E−08 2.5E−08 2.52E−08  2.52E−08  2.52E−08  25200
123 2.6E−08 4.9E−09 2.6E−08 2.56E−08  4.43E−09  2.56E−08  4655
124 2.5E−08 2.5E−08 2.5E−08 2.51E−08  2.51E−08  2.51E−08  25100
125 2.5E−08 2.5E−08 2.5E−08 2.49E−08  2.49E−08  2.49E−08  24900
126 2.5E−08 2.5E−08 2.5E−08 2.54E−08  2.54E−08  2.54E−08  25400
127 2.5E−08 2.5E−08 2.5E−08 2.51E−08  2.51E−08  2.51E−08  25100
128 2.8E−08 1.5E−11 2.8E−08 2.8E−08 2.1E−11 2.8E−08 18.2
129 2.7E−08 1.2E−11 2.7E−08 2.7E−08 1.1E−11 2.7E−08 11.5
130 2.6E−08 1.6E−11 2.6E−08 2.6E−08 1.3E−11 2.6E−08 14.4
131 2.9E−08 1.4E−11 2.9E−08 2.9E−08 9.9E−12 2.9E−08 11.7
132 2.8E−08 1.1E−11 2.8E−08 2.8E−08 7.1E−12 2.8E−08 9.0
133 2.7E−08 3.4E−11 2.7E−08 2.7E−08 2.5E−11 2.7E−08 29.4
134 2.8E−08 7.0E−12 2.8E−08 2.8E−08 4.9E−12 2.8E−08 6.0
135 2.7E−08 5.4E−12 2.7E−08 2.7E−08 4.5E−12 2.7E−08 5.0
136 2.6E−08 3.5E−12 2.6E−08 2.6E−08 2.5E−12 2.6E−08 3.0
137 2.7E−08 6.6E−12 2.7E−08 2.7E−08 3.8E−12 2.7E−08 5.2
138 2.6E−08 1.9E−11 2.6E−08 2.6E−08 1.5E−11 2.6E−08 17.2
139 2.6E−08 2.9E−11 2.6E−08 2.6E−08 2.2E−11 2.6E−08 25.5
140 2.7E−08 5.9E−12 2.7E−08 2.7E−08 3.9E−12 2.7E−08 4.9
141 2.7E−08 8.7E−12 2.7E−08 2.7E−08 5.0E−12 2.7E−08 6.9
142 2.6E−08 1.2E−11 2.6E−08 2.6E−08 7.9E−12 2.6E−08 10.1
143 2.7E−08 1.2E−11 2.7E−08 2.7E−08 5.2E−12 2.7E−08 8.6
144 2.6E−08 1.6E−11 2.6E−08 2.6E−08 9.6E−12 2.6E−08 12.6
145 2.5E−08 2.7E−11 2.5E−08 2.5E−08 1.5E−11 2.5E−08 21.0
146 2.8E−08 9.6E−11 2.8E−08 2.8E−08 4.2E−11 2.8E−08 69.0
147 2.7E−08 3.2E−11 2.7E−08 2.7E−08 1.4E−11 2.7E−08 23.2
148 2.6E−08 1.6E−11 2.6E−08 2.6E−08 8.7E−12 2.6E−08 12.1
149 2.8E−08 8.1E−11 2.8E−08 2.8E−08 5.1E−11 2.8E−08 66.2
150 2.7E−08 2.8E−11 2.7E−08 2.7E−08 2.2E−11 2.7E−08 25.4
151 2.6E−08 2.2E−11 2.6E−08 2.6E−08 1.5E−11 2.6E−08 18.2
152 2.8E−08 3.9E−11 2.8E−08 2.8E−08 3.1E−11 2.8E−08 34.7
153 2.7E−08 7.9E−12 2.7E−08 2.7E−08 5.0E−12 2.7E−08 6.4
154 2.6E−08 2.8E−12 2.6E−08 2.6E−08 2.3E−12 2.6E−08 2.5
155 2.8E−08 2.9E−10 2.8E−08 2.8E−08 1.9E−10 2.8E−08 238.0
156 2.7E−08 1.1E−10 2.7E−08 2.7E−08 1.0E−10 2.7E−08 105.0
157 2.6E−08 2.4E−10 2.6E−08 2.6E−08 2.2E−10 2.6E−08 227.0
158 2.8E−08 1.4E−10 2.8E−08 2.8E−08 1.6E−10 2.8E−08 148.0
159 2.7E−08 2.8E−10 2.7E−08 2.7E−08 2.3E−10 2.7E−08 254.5
160 2.6E−08 3.9E−10 2.6E−08 2.6E−08 3.2E−10 2.6E−08 350.5
161 2.7E−08 1.6E−10 2.7E−08 2.7E−08 6.2E−11 2.7E−08 111.7
162 2.6E−08 5.3E−11 2.6E−08 2.6E−08 5.5E−11 2.6E−08 54.0
163 2.5E−08 6.3E−11 2.5E−08 2.5E−08 4.9E−11 2.5E−08 56.0
164 2.8E−08 2.2E−11 2.8E−08 2.8E−08 7.8E−12 2.8E−08 14.6
165 2.7E−08 1.4E−11 2.7E−08 2.7E−08 6.0E−12 2.7E−08 10.2
166 2.6E−08 7.2E−12 2.6E−08 2.6E−08 2.7E−12 2.6E−08 4.9
167 2.9E−08 1.3E−11 2.9E−08 2.9E−08 6.9E−12 2.9E−08 10.0
168 2.8E−08 5.1E−12 2.8E−08 2.8E−08 2.6E−12 2.8E−08 3.8
169 2.7E−08 3.4E−12 2.7E−08 2.7E−08 1.7E−12 2.7E−08 2.6
170 2.8E−08 8.0E−12 2.8E−08 2.8E−08 4.5E−12 2.8E−08 6.2
171 2.7E−08 2.5E−12 2.7E−08 2.7E−08 1.2E−12 2.7E−08 1.9
172 2.6E−08 1.5E−12 2.6E−08 2.6E−08 7.2E−13 2.6E−08 1.1
173 2.7E−08 2.1E−11 2.7E−08 2.7E−08 9.2E−12 2.7E−08 15.1
174 2.6E−08 2.2E−11 2.6E−08 2.6E−08 1.1E−11 2.6E−08 16.3
175 2.6E−08 2.3E−11 2.6E−08 2.6E−08 1.2E−11 2.6E−08 17.4
176 2.7E−08 2.3E−11 2.7E−08 2.7E−08 9.6E−12 2.7E−08 16.0
177 2.7E−08 6.4E−12 2.7E−08 2.7E−08 3.0E−12 2.7E−08 4.7
178 2.6E−08 5.0E−12 2.6E−08 2.6E−08 2.3E−12 2.6E−08 3.6
179 2.7E−08 1.1E−11 2.7E−08 2.7E−08 4.4E−12 2.7E−08 7.9
180 2.6E−08 3.2E−12 2.6E−08 2.6E−08 1.1E−12 2.6E−08 2.2
181 2.5E−08 2.1E−12 2.5E−08 2.5E−08 8.3E−13 2.5E−08 1.5
182 2.8E−08 1.3E−10 2.8E−08 2.8E−08 5.2E−11 2.8E−08 89.9
183 2.7E−08 6.4E−11 2.7E−08 2.7E−08 1.8E−11 2.7E−08 40.9
184 2.6E−08 4.7E−11 2.6E−08 2.6E−08 1.2E−11 2.6E−08 29.5
185 2.8E−08 3.8E−10 2.8E−08 2.8E−08 1.2E−10 2.8E−08 251.0
186 2.7E−08 1.3E−10 2.7E−08 2.7E−08 5.0E−11 2.7E−08 87.5
187 2.6E−08 6.4E−11 2.6E−08 2.6E−08 3.1E−11 2.6E−08 47.4
188 2.8E−08 1.7E−10 2.8E−08 2.8E−08 7.7E−11 2.8E−08 125.4
189 2.7E−08 3.0E−11 2.7E−08 2.7E−08 1.2E−11 2.7E−08 20.8
190 2.6E−08 9.7E−12 2.6E−08 2.6E−08 4.7E−12 2.6E−08 7.2
191 2.8E−08 2.5E−10 2.8E−08 2.8E−08 1.1E−10 2.8E−08 182.5
192 2.7E−08 1.7E−10 2.7E−08 2.7E−08 6.0E−11 2.7E−08 113.5
193 2.6E−08 3.3E−10 2.6E−08 2.6E−08 9.5E−11 2.6E−08 213.0
194 2.8E−08 2.4E−10 2.8E−08 2.8E−08 6.8E−11 2.8E−08 154.2
195 2.7E−08 1.7E−10 2.7E−08 2.7E−08 4.6E−11 2.7E−08 107.4
196 2.6E−08 1.9E−10 2.6E−08 2.6E−08 6.3E−11 2.6E−08 124.6
197 2.7E−08 1.2E−10 2.7E−08 2.7E−08 3.4E−11 2.7E−08 79.0
198 2.6E−08 4.1E−11 2.6E−08 2.6E−08 1.5E−11 2.6E−08 27.9
199 2.5E−08 2.9E−11 2.5E−08 2.5E−08 7.5E−12 2.5E−08 18.3

TABLE 8
cAMP activity of substituted and mono-lipidated peptides, cont.
INS1e assay EC50
GLP-1 R Mean
ID SEQ ID NO n1 n2 pM GLP-1R
GLP-1 (7-36) 1 7.00E−12 2.70E−11 17
mono- 2
3 3.59E−09 3.78E−09 3685
6 1.04E−10 1.39E−10 122
17 5.10E−12 7.87E−12 6
33 3.59E−09 3.78E−09 3685
42 2.07E−10 1.67E−10 187
43 1.60E−11 1.05E−11 13
44 4.75E−10 4.35E−10 455
45 7.61E−08 0.000000113 94550
46 5.26E−08 8.34E−08 68000
47 7.13E−09 1.22E−08 9665
48 7.29E−10 8.71E−10 800
49 9.35E−09 1.07E−08 10025
50 2.21E−08 4.26E−08 32350
51 2.47E−11 2.07E−11 23
52 2.14E−11 1.93E−11 20
53 6.25E−12 8.15E−12 7
54 2.67E−12 8.37E−12 6
55 1.25E−11 1.01E−11 11
56 3.52E−11 7.70E−11 56
60 1.43E−08 1.21E−08 13200
61 5.57E−12 1.35E−11 10
62 2.09E−10 8.37E−11 146
63 2.31E−11 3.92E−11 31
64 6.80E−12 1.21E−11 9
65 2.57E−09 3.74E−09 3155
66 4.56E−08 3.88E−08 42200
67 6.15E−09 1.81E−08 12125
68 2.69E−09 4.87E−09 3780
69 1.92E−08 2.50E−08 22100
71 6.04E−10 8.41E−10 723
72 4.26E−09 8.07E−09 6165
74 7.74E−11 1.27E−10 102
75 4.97E−11  6.3E−11 56
76 3.26E−10 5.31E−10 429
78 3.45E−10 3.46E−10 346
79 2.89E−10 5.27E−10 408
80 3.89E−09 1.33E−09 2610
82 1.51E−10 2.38E−10 195
83 1.37E−10 2.50E−10 194
84 4.55E−10 6.65E−10 560
86 4.53E−11 8.45E−11 65
87 4.36E−11 6.22E−11 53
88 2.77E−10 4.15E−10 346
90 4.34E−11 5.86E−11 51
91 1.93E−09 3.50E−09 2715
99 1.10E−08 5.88E−09 8440
100 2.33E−10 1.41E−09 822
101 1.47E−09 6.65E−09 4060
102 4.22E−09 2.89E−09 3555
103 4.28E−10 5.90E−10 509
104 3.91E−10 2.70E−10 331
105 2.20E−10 1.72E−09 970
107 5.23E−09 1.17E−08 8465
108 3.80E−11 4.58E−10 248
109 8.35E−09 4.32E−09 6335
110 3.16E−08 2.31E−08 27350
111 5.01E−10 1.11E−09 806
112 2.94E−10 4.76E−10 385
113 8.23E−10 1.26E−09 1042
115 5.93E−10 4.94E−10 544
116 1.61E−09 6.10E−10 1110
117 7.65E−10 1.67E−09 1218
119 2.71E−09 1.45E−09 2080
132 1.29E−10 1.15E−10 122
134 1.68E−10 7.76E−11 123
135 9.86E−11 5.93E−11 79
136 5.26E−11 2.15E−11 37
137 6.37E−11 3.62E−11 50
140 4.32E−11 1.67E−11 30
141 4.47E−11 3.67E−11 41
143 4.51E−11 2.27E−11 34
153 5.50E−11 6.12E−11 58
154 3.23E−11 1.71E−11 25
166 2.33E−10 6.87E−10 460
168 1.89E−10 4.62E−10 325.5
169 9.31E−11 2.69E−10 181.05
170 5.48E−10 3.76E−10 462
171 8.17E−11 1.75E−10 128.35
172 3.96E−11  2.8E−11 33.8
177 2.66E−10 7.55E−10 510.5
178  3.1E−10 2.58E−10 284
179 3.36E−10 3.45E−10 340.5
180 6.78E−11 5.06E−11 59.2
181 4.53E−11 1.14E−10 79.65
184 3.51E−10 5.01E−10 426
189 1.14E−10 1.73E−10 143.5
190 3.97E−11 4.85E−11 44.1
198 1.38E−09  8.9E−10 1135
199 7.87E−10 2.13E−09 1458.5

TABLE 9
cAMP activity of bis-lipidated agonist peptides
SEQ Primary assay EC50 Primary assay EC50
ID GLP-1R GLP-1R Mean
ID NO Gluc-R n1 GIP-R Gluc-R n2 GIP-R pM GLP-1R
GLP-1  1 2.3E-08 2.2E-12 2.3E-08 2.3E-08 3.4E-12 2.3E-08 2.8
(7-36)
bis-  4
236 2.22E−08 1.65E−11 2.22E−08 2.22E−08 2.68E−11 2.22E−08 21.7
237 2.23E−08 1.95E−11 2.23E−08 2.23E−08 2.23E−11 2.23E−08 20.9
238 2.24E−08 8.75E−12 2.24E−08 2.24E−08 1.32E−11 2.24E−08 11.0
239 2.25E−08 6.30E−12 2.25E−08 2.25E−08 8.45E−12 2.25E−08 7.4
240 2.22E−08 1.09E−11 2.22E−08 2.22E−08 1.71E−11 2.22E−08 14.0
241 2.25E−08 7.55E−12 2.25E−08 2.25E−08 1.16E−11 2.25E−08 9.6
242 2.14E−08 3.58E−09 2.14E−08 2.14E−08 4.11E−09 2.14E−08 3845.0
243 2.15E−08 2.93E−09 2.15E−08 2.15E−08 3.48E−09 2.15E−08 3205.0
244 2.16E−08 7.77E−09 2.16E−08 2.16E−08 1.69E−08 2.16E−08 12335.0
245 2.16E−08 1.23E−08 2.16E−08 2.16E−08 1.02E−08 2.16E−08 11250.0
246 2.14E−08 9.99E−10 2.14E−08 2.14E−08 1.80E−09 2.14E−08 1399.5
247 2.16E−08 1.31E−09 2.16E−08 2.16E−08 2.02E−09 2.16E−08 1665.0
248 2.24E−08 3.77E−12 2.24E−08 2.24E−08 6.20E−12 2.24E−08 5.0
249 2.21E−08 4.47E−12 2.21E−08 2.21E−08 6.49E−12 2.21E−08 5.5
250 2.16E−08 2.92E−11 2.16E−08 2.16E−08 6.10E−11 2.16E−08 45.1
251 2.13E−08 1.60E−11 2.13E−08 2.13E−08 4.62E−11 2.13E−08 31.1
252 2.27E−08 2.88E−12 2.27E−08 2.27E−08 2.17E−12 2.27E−08 2.5
253 2.23E−08 2.34E−11 2.23E−08 2.23E−08 1.77E−11 2.23E−08 20.6
254 2.19E−08 2.23E−10 2.19E−08 2.19E−08 1.86E−10 2.19E−08 204.5
255 2.15E−08 5.32E−10 2.15E−08 2.15E−08 3.93E−10 2.15E−08 462.5
256 2.22E−08 9.46E−12 2.22E−08 2.22E−08 5.57E−12 2.22E−08 7.5
257 2.28E−08 4.36E−12 2.28E−08 2.28E−08 1.24E−11 2.28E−08 8.4
258 2.23E−08 5.96E−11 2.23E−08 2.23E−08 1.25E−10 2.23E−08 92.3
259 2.14E−08 3.39E−10 2.14E−08 2.14E−08 2.87E−10 2.14E−08 313.0
260 2.19E−08 3.34E−10 2.19E−08 2.19E−08 4.43E−10 2.19E−08 388.5
261 2.30E−08 4.14E−10 2.30E−08 2.30E−08 4.22E−10 2.30E−08 418.0
262 2.25E−08 6.73E−12 2.25E−08 2.25E−08 4.14E−12 2.25E−08 5.4
263 2.15E−08 9.98E−13 2.15E−08 2.15E−08 1.45E−12 2.15E−08 1.2
264 2.26E−08 1.82E−11 2.26E−08 2.26E−08 7.37E−12 2.26E−08 12.8
265 2.16E−08 3.91E−11 2.16E−08 2.16E−08 2.80E−11 2.16E−08 33.6
266 2.22E−08 4.00E−10 2.22E−08 2.22E−08 5.57E−10 2.22E−08 478.5
267 2.17E−08 6.28E−10 2.17E−08 2.17E−08 5.10E−10 2.17E−08 569.0
268 2.22E−08 4.46E−12 2.22E−08 2.22E−08 5.05E−12 2.22E−08 4.8
269 2.28E−08 4.01E−12 2.28E−08 2.28E−08 5.24E−12 2.28E−08 4.6
270 2.23E−08 2.93E−11 2.23E−08 2.23E−08 3.65E−11 2.23E−08 32.9
271 2.14E−08 8.91E−10 2.14E−08 2.14E−08 7.50E−10 2.14E−08 820.5
272 2.19E−08 3.39E−10 2.19E−08 2.19E−08 3.31E−10 2.19E−08 335.0
273 2.15E−08 7.41E−10 2.15E−08 2.15E−08 7.83E−10 2.15E−08 762.0
405 2.15E−08 4.05E−12 2.15E−08 2.15E−08 3.66E−12 2.15E−08 3.9
406 2.15E−08 2.19E−12 2.15E−08 2.15E−08 2.31E−12 2.15E−08 2.3
407 2.15E−08 1.96E−12 2.15E−08 2.15E−08 2.01E−12 2.15E−08 2.0
408 2.15E−08 9.96E−12 2.15E−08 2.15E−08 7.89E−12 2.15E−08 8.9
409 2.15E−08 3.95E−11 2.15E−08 2.15E−08 3.26E−11 2.15E−08 36.1
410 2.15E−08 2.48E−10 2.15E−08 2.15E−08 1.26E−10 2.15E−08 187.0

TABLE 10
cAMP activity of bis-lipidated agonist peptides, cont.
INS1e assay EC50
GLP-1R Mean
ID SEQ ID NO n1 n2 pM GLP-1R
GLP-1 (7-36) 1 7.00E−12 2.70E−11 17
bis- 4
236 1.20E−08 1.27E−08 12350
237 1.43E−08 2.43E−08 19300
238 1.50E−08 1.24E−08 13700
239 1.47E−08 1.12E−08 12950
240 6.86E−09 5.17E−09 6015
241 5.84E−09 6.71E−09 6275
246 7.13E−08 7.13E−08 71300
247 7.21E−08 7.21E−08 72100
248 3.37E−10 4.68E−10 403
249 7.21E−10 4.10E−10 566
250 3.67E−08 3.94E−08 38050
251 6.47E−09 7.85E−09 7160
252 1.84E−10 1.66E−10 175
253 2.08E−09 2.14E−09 2110
256 1.25E−09 1.34E−09 1295
257 8.12E−10 3.42E−10 577
262 7.00E−10 4.03E−10 552
263 1.20E−10 1.44E−10 132
264 9.63E−10  1.1E−09 1032
265 1.22E−08 5.34E−09 8770
268 1.09E−09 1.23E−09 1160
269 2.43E−10 1.81E−10 212
270 1.41E−09 2.02E−09 1715
405 1.10E−10 1.21E−10 116
406 1.01E−10 8.72E−11 94
407 1.13E−10 9.52E−11 104
408 3.76E−10 4.48E−10 412
409 1.83E−10 2.49E−10 216
410 6.98E−10 8.62E−10 780

TABLE 11
cAMP activity of tris-lipidated agonist peptides
SEQ Primary assay EC50 Primary assay EC50 Mean
ID GLP-1R GLP-1R pM
ID NO Gluc-R n1 GIP-R Gluc-1R n2 GIP-R GLP-1R
GLP-1  1 2.3E−08 2.2E−12 2.3E−08 2.3E−08 3.4E−12 2.3E−08 2.8
(7-36)
tris- 487
439 1.95E−08 5.99E−11 1.95E−08 1.95E−08 1.34E−10 1.95E−08 97.0
440 1.97E−08 9.67E−11 1.97E−08 1.97E−08 1.64E−10 1.97E−08 130.4
441 1.95E−08 1.10E−10 1.95E−08 1.95E−08 2.41E−10 1.95E−08 175.5
442 1.97E−08 6.09E−11 1.97E−08 1.97E−08 1.03E−10 1.97E−08 82.0
443 1.94E−08 1.92E−10 1.94E−08 1.94E−08 2.54E−10 1.94E−08 223.0
444 1.97E−08 1.25E−10 1.97E−08 1.97E−08 1.62E−10 1.97E−08 143.5
445 1.95E−08 2.42E−10 1.95E−08 1.95E−08 2.77E−10 1.95E−08 259.5
446 1.97E−08 8.73E−11 1.97E−08 1.97E−08 1.27E−10 1.97E−08 107.2
447 1.97E−08 1.23E−10 1.97E−08 1.97E−08 1.76E−10 1.97E−08 149.5
448 1.99E−08 7.88E−11 1.99E−08 1.99E−08 1.06E−10 1.99E−08 92.4
449 1.97E−08 2.16E−10 1.97E−08 1.97E−08 2.76E−10 1.97E−08 246.0
450 1.99E−08 2.80E−11 1.99E−08 1.99E−08 7.00E−11 1.99E−08 49.0
451 1.97E−08 2.88E−11 1.97E−08 1.95E−08 1.58E−10 1.95E−08 93.4
452 1.95E−08 8.57E−11 1.95E−08 1.97E−08 7.61E−11 1.97E−08 80.9
453 1.95E−08 6.29E−11 1.95E−08 1.95E−08 1.65E−10 1.95E−08 114.0
454 1.97E−08 2.21E−11 1.97E−08 1.97E−08 6.52E−11 1.97E−08 43.7
455 1.98E−08 5.48E−11 1.98E−08 1.98E−08 1.20E−10 1.98E−08 87.4
456 1.00E−08 1.16E−10 2.00E−08 2.00E−08 2.24E−10 2.00E−08 170.0
457 1.98E−08 1.27E−10 1.98E−08 1.98E−08 1.56E−10 1.98E−08 141.5
458 2.00E−08 3.63E−11 2.00E−08 2.00E−08 4.64E−11 2.00E−08 41.4
459 1.97E−08 8.95E−11 1.97E−08 1.97E−08 1.11E−10 1.97E−08 100.3
460 2.00E−08 6.74E−11 2.00E−08 2.00E−08 8.88E−11 2.00E−08 78.1
461 1.98E−08 7.45E−11 1.98E−08 1.98E−08 1.45E−10 1.98E−08 109.8
462 2.00E−08 3.76E−11 2.00E−08 2.00E−08 5.64E−11 2.00E−08 47.0
463 2.00E−08 6.95E−11 2.00E−08 2.00E−08 9.44E−11 2.00E−08 82.0
464 2.02E−08 2.54E−11 2.02E−08 2.02E−08 3.51E−11 2.02E−08 30.3
465 2.00E−08 1.01E−10 2.00E−08 2.00E−08 1.33E−10 2.00E−08 117.0
466 2.02E−08 1.72E−11 2.02E−08 2.02E−08 2.75E−11 2.02E−08 22.4
467 1.98E−08 4.93E−11 1.98E−08 1.98E−08 6.15E−11 1.98E−08 55.4
468 2.00E−08 6.24E−11 2.00E−08 2.00E−08 8.45E−11 2.00E−08 73.5
469 1.98E−08 4.18E−11 1.98E−08 1.98E−08 4.90E−11 1.98E−08 45.4
470 2.00E−08 2.60E−11 2.00E−08 2.00E−08 3.65E−11 2.00E−08 31.3
471 1.96E−08 2.77E−10 1.96E−08 1.96E−08 4.70E−10 1.96E−08 373.5
472 1.99E−08 2.97E−10 1.99E−08 1.99E−08 2.77E−10 1.99E−08 287.0
473 1.96E−08 3.99E−10 1.96E−08 1.96E−08 4.70E−10 1.96E−08 434.5
474 1.99E−08 2.79E−10 1.99E−08 1.99E−08 3.00E−10 1.99E−08 289.5
475 1.95E−08 2.28E−10 1.95E−08 1.95E−08 3.47E−10 1.95E−08 287.5
476 1.98E−08 1.74E−10 1.98E−08 1.98E−08 2.57E−10 1.98E−08 215.5
477 1.96E−08 2.26E−10 1.96E−08 1.96E−08 3.02E−10 1.96E−08 264.0
478 1.98E−08 1.03E−10 1.98E−08 1.98E−08 1.34E−10 1.98E−08 118.5
479 1.98E−08 1.32E−10 1.98E−08 1.98E−08 2.39E−10 1.98E−08 185.5
480 2.00E−08 5.60E−11 2.00E−08 2.00E−08 5.89E−11 2.00E−08 57.5
481 1.98E−08 1.37E−10 1.98E−08 1.98E−08 1.49E−10 1.98E−08 143.0
482 2.00E−08 2.83E−11 2.00E−08 2.00E−08 4.42E−11 2.00E−08 36.3
483 1.96E−08 2.29E−10 1.96E−08 1.96E−08 2.58E−10 1.96E−08 243.5
484 1.99E−08 1.63E−10 1.99E−08 1.99E−08 1.68E−10 1.99E−08 165.5
485 1.96E−08 1.67E−10 1.96E−08 1.96E−08 2.24E−10 1.96E−08 195.5
486 1.99E−08 1.65E−10 1.99E−08 1.99E−08 2.59E−10 1.99E−08 212.0

TABLE 12
cAMP activity of tris-lipidated agonist peptides, cont.
INS1e assay EC50
GLP-1R Mean
ID SEQ ID NO n1 n2 pM GLP-1R
GLP-1 (7-36) 1 7.00E−12 2.70E−11 17
tris- 487
450 6.38E−09 7.24E−09 6810.00
454 4.10E−09 6.99E−09 5545.00
455 6.74E−09 3.08E−09 4910.00
458 3.07E−09 3.67E−09 3370.00
462 5.40E−09 3.73E−09 4565.00
464 4.46E−09 3.57E−09 4015.00
466 3.86E−09 2.55E−09 3205.00
467 9.92E−09 7.91E−09 8915.00
469 6.90E−09 2.89E−09 4895.00
470 3.84E−09 3.48E−09 3660.00
480 9.37E−09 3.69E−09 6530.00
482 8.57E−09 3.15E−09 5860.00

TABLE 13
Additional comparative sequences
Seq
Peptide ID
488 H-(Aib)2-EGT5 FTSDV10 SSYLE15 GQAAK20
EFIAW25 LVKGR30
489 H-(Aib)2-EG-(S)5-(α-MeF)6-TSDV10 SS-
(α-MeF)13-LE15 GQAA-(α-MeK)20 E-(α-
MeF)22-IA-(α-MeF)25-(V)26-V-(α-
MeK)28-G-(G)30-K(ε-Palmitoyl)
Liraglu- 490 HAEGTFTSDVSSYLEGQAAK(ε-γE-
tide palmitoyl)EFIAWLVRGRG-acid
Semaglu- 491 H-Aib2-EGTFTSDVSSYLEGQAAK(ε-(PEG)2-
tide (PEG)2-γE-stearate)EFIAWLVRGRG-acid

Examples of comparative sequences are found in Table 13. Additional comparative sequences can be found in International Patent Application No PCT/EP2014/077240, published as WO2015/086686A2, and such sequences are incorporated by reference herein.

All documents, patents, journal articles and other materials cited in the present application are hereby incorporated by reference.

Although the present disclosure provides numerous embodiments including reference to the accompanying drawings, it is to be understood that various changes and modifications can be apparent to those skilled in the art. Such changes and modifications are to be understood as included within the scope of the present disclosure as defined by the appended claims, unless they depart there from.

Claims

1. An isolated polypeptide comprising the amino acid sequence:

(SEQ ID NO: 2)
HX2EGS X6TSDV X11X12X13LE GEAAX20 EX22IX24X25
VVX28GG;

wherein X2 is A or Aib,

X6 is F or an alpha-methyl functionalized amino acid,

X11 is S or an alpha-methyl functionalized amino acid,

X12 is S or a lipid modified K,

X13 is Y or an alpha-methyl functionalized amino acid,

X20 is a lipid modified K, K, or an alpha-methyl functionalized amino acid,

X22 is F or an alpha-methyl functionalized amino acid,

X24 is A or a lipid modified K,

X25 is W or an alpha-methyl functionalized amino acid, and

X28 is K, E, or an alpha-methyl functionalized amino acid; and

wherein the polypeptide is lipidated on only one of X12, X20, or X24.

2. The polypeptide of claim 1, wherein the peptide comprises a C-terminal amide.

3. The polypeptide of claim 1, wherein X2 is Aib.

4. The polypeptide of any one of claim 1, wherein the lipid modified K is selected from the group consisting of: K(ε-(PEG)2-(PEG)2-γE-Stearate), K(ε-γE-Palmitoyl), K(ε-(PEG)2-(PEG)2-γE-Stearate), K(γE-Palmitoyl), K(ε-(PEG)2-(PEG)2-(PEG)2-Stearoyl), K(ε-γE-Lauroyl), K(ε-γE-γE-Lauroyl), K(ε-γE-γE-γE-Lauroyl), K(ε-Ahx-Lauroyl), K(ε-Ahx-Ahx-Lauroyl), K(ε-Ahx-Ahx-Ahx-Lauroyl), K(ε-(PEG)2-Lauroyl), K(ε-(PEG)2-(PEG)2-Lauroyl), K(ε-(PEG)2-(PEG)2-(PEG)2-Lauroyl), K(ε-γE-12-(4-carboxyphenoxy)dodecanoyl), K(ε-γE-γE-12-(4-carboxyphenoxy)dodecanoyl), K(ε-γE-γE-γE-12-(4-carboxyphenoxy)dodecanoyl), K(ε-Ahx-12-(4-carboxyphenoxy)dodecanoyl), K(ε-Ahx-Ahx-12-(4-carboxyphenoxy)dodecanoyl), K(ε-Ahx-Ahx-Ahx-12-(4-carboxyphenoxy)dodecanoyl), K(ε-(PEG)2-12-(4-carboxyphenoxy)dodecanoyl), K(ε-(PEG)2-(PEG)2-12-(4-carboxyphenoxy)dodecanoyl), K(ε-(PEG)2-(PEG)2-(PEG)2-12-(4-carboxyphenoxy)dodecanoyl), K(ε-γE-Stearoyl), K(ε-γE-γE-Stearoyl), K(ε-γE-γE-γE-Stearoyl), K(ε-Ahx-Stearoyl), K(ε-Ahx-Ahx-Stearoyl), K(ε-Ahx-Ahx-Ahx-Stearoyl), K(ε-(PEG)2-Stearoyl), K(ε-(PEG)2-(PEG)2-Stearoyl), K(ε-(PEG)2-(PEG)2-(PEG)2-Stearoyl), K(ε-γE-Stearate), K(ε-γE-γE-Stearate), K(ε-γE-γE-γE-Stearate), K(ε-Ahx-Stearate), K(ε-Ahx-Ahx-Stearate), K(ε-Ahx-Ahx-Ahx-Stearate), K(ε-(PEG)2-Stearate), K(ε-(PEG)2-(PEG)2-Stearate), K(ε-(PEG)2-(PEG)2-(PEG)2-Stearate), and any combination thereof.

5. The polypeptide of claim 4, wherein the lipid modified K is K(ε-(PEG)2-(PEG)2-γE-Stearate).

6. The polypeptide of claim 1, wherein X6 is α-MeF, X11 is α-MeS, X13 is α-MeF, X22 is α-MeF, X25 is α-MeF, X28 is α-MeK, or any combination thereof.

7. The polypeptide of claim 6, wherein X2 is Aib, X6 is α-MeF, X11 is a-MeS, X13 is α-MeF, X20 is K(ε-(PEG)2-(PEG)2-γE-Stearate), X22 is α-MeF, X25 is α-MeF, and X28 is α-MeK (SEQ ID NO: 3).

8. The polypeptide of claim 1, wherein the polypeptide is substantially resistant to proteolytic degradation.

9. The polypeptide of claim 8, wherein the polypeptide is substantially resistant to DPP-IV, neprilysin, α-chymotrypsin, plasmin, thrombin, kallikrein, trypsin, elastase and/or pepsin degradation.

10. The polypeptide of claim 1, wherein the polypeptide at least maintains substantially the same receptor potency as a corresponding non-lipidated polypeptide.

11. The polypeptide of claim 10, wherein the polypeptide at least maintains substantially the same receptor selectivity as a corresponding non-lipidated polypeptide.

12. The polypeptide of claim 11, wherein the polypeptide exhibits increased receptor potency over a corresponding non-lipidated polypeptide.

13. An isolated polypeptide comprising the amino acid sequence:

(SEQ ID NO: 4)
HX2EGX5 X6TSDX10 X11X12X13X14E GX17AAX20
EX22IX24X25 X26VX28GX30;

wherein X2 is A or Aib,

X5 is T or S,

X6 is F or an alpha-methyl functionalized amino acid,

X10 is V or a lipid modified K,

X11 is S or an alpha-methyl functionalized amino acid,

X12 is S or a lipid modified K,

X13 is Y, F, or a lipid modified K,

X14 is L or a lipid modified K,

X17 is Q or E,

X20 is K, E, or an alpha-methyl functionalized amino acid,

X22 is F, norleucine, tyrosine methyl ester, or an alpha-methyl functionalized amino acid,

X24 is A or a lipid modified K,

X25 is W, F, or a lipid modified K,

X26 is L, V, or a lipid modified K,

X28 is K or E, and

X30 is R or G;

wherein the polypeptide comprises two lipid modified K residues, and wherein one of X10, X12, X13, or X14 is a lipid modified K residue and one of X24, X25, or X26 is a lipid modified K residue.

14. The polypeptide of claim 13, wherein X6 is F, α-MeF, α-MeS, or α-MeK, X11 is S, α-MeF, α-MeS, or α-MeK, X20 is K, E, α-MeF, α-MeS, or α-MeK, and X22 is F, or α-MeF.

15. The polypeptide of claim 13, wherein the peptide comprises a C-terminal amide.

16. The polypeptide of claim 13, wherein X2 is Aib.

17. The polypeptide of claim 13, wherein the two lipid modified K residues are the same or are different, and are selected from the group consisting of: K(ε-(PEG)2-(PEG)2-γE-Lauroyl), K(ε-(PEG)2-(PEG)2-γE-Palmitate), K(ε-(PEG)2-(PEG)2-γE-Myristoyl), K(ε-(PEG)2-(PEG)2-γE-Palmitoyl), K(ε-(PEG)2-(PEG)2-γE-Stearoyl), K(ε-(PEG)2-(PEG)2-γE-Stearate), and any combination thereof.

18. The polypeptide of claim 17, wherein the two lipid modified K residues are both K(ε-(PEG)2-(PEG)2-γE-Lauroyl), both K(ε-(PEG)2-(PEG)2-γE-Palmitate), both K(ε-(PEG)2-(PEG)2-γE-Myristoyl), both K(ε-(PEG)2-(PEG)2-γE-Palmitoyl), both K(ε-(PEG)2-(PEG)2-γE-Stearoyl), or both K(ε-(PEG)2-(PEG)2-γE-Stearate).

19. The polypeptide of claim 13, wherein X10 is a lipid modified K and any one of X24, X25, or X26 is a lipid modified K.

20. The polypeptide of claim 13, wherein X12 is a lipid modified K and any one of X24, X25, or X26 is a lipid modified K.

21. The polypeptide of claim 13, wherein X13 is a lipid modified K and any one of X24, X25, or X26 is a lipid modified K.

22. The polypeptide of claim 13, wherein X14 is a lipid modified K and any one of X24, X25, or X26 is a lipid modified K.

23. The polypeptide of claim 13, wherein X24 is a lipid modified K and any one of X10, X12, X13, or X14 is a lipid modified K.

24. The polypeptide of claim 13, wherein X25 is a lipid modified K and any one of X10, X12, X13, or X14 is a lipid modified K.

25. The polypeptide of claim 13, wherein X26 is a lipid modified K and any one of X10, X12, X13, or X14 is a lipid modified K.

26. The polypeptide of claim 13, wherein:

X6 is α-MeF,

X11 is α-MeS,

X20 is α-MeK,

X6 is α-MeF and X11 is α-MeS,

X6 is α-MeF and X20 is α-MeK,

X11 is α-MeS and X20 is α-MeK, or

X6 is α-MeF, X11 is α-MeS, and X20 is α-MeK.

27. The polypeptide of claim 26, wherein X13 is a lipid modified K and one of X24, X25, or X26 is a lipid modified K.

28. The polypeptide of claim 26, wherein X14 is a lipid modified K and one of X24, X25, or X26 is a lipid modified K.

29. The polypeptide of claim 13, wherein X5 is S.

30. The polypeptide of claim 13, wherein X17 is E, X28 is E, and X30 is G.

31. The polypeptide of claim 13, wherein the polypeptide comprises the amino acid sequence of SEQ ID NO: 252, SEQ ID NO: 263, SEQ ID NO: 269, SEQ ID NO: 405, SEQ ID NO: 408, SEQ ID NO: 409, or SEQ ID NO: 410.

32. The polypeptide of claim 13, wherein the polypeptide is substantially resistant to proteolytic degradation.

33. The polypeptide of claim 32, wherein the synthetic peptide is substantially resistant to DPP-IV, neprilysin, α-chymotrypsin, plasmin, thrombin, kallikrein, trypsin, elastase and/or pepsin degradation.

34. The polypeptide of claim 33, wherein the polypeptide, which comprises two lipid modified K residues, at least maintains substantially the same receptor potency as a corresponding non-lipidated peptide.

35. The polypeptide of claim 34, wherein the polypeptide, which comprises two lipid modified K residues, at least maintains substantially the same receptor selectivity as a corresponding non-lipidated peptide.

36. The polypeptide of claim 35, wherein the polypeptide, which comprises two lipid modified K residues, exhibits increased receptor potency over a corresponding non-lipidated polypeptide.

37-63. (canceled)