US20200306370A1
2020-10-01
16/773,241
2020-01-27
The present invention relates to amino acid and peptide conjugates, methods for making amino acid and peptide conjugates, conjugates produced by the methods, pharmaceutical compositions comprising the conjugates, methods of eliciting immune responses in a subject and methods of vaccinating a subject, uses of the conjugates for the same, and uses of the conjugates in the manufacture of medicaments for the same.
Get notified when new applications in this technology area are published.
A61K39/0011 » CPC further
Medicinal preparations containing antigens or antibodies; Vertebrate antigens Cancer antigens
C12N2710/16134 » CPC further
dsDNA viruses; Details; Herpesviridae; Cytomegalovirus, e.g. human herpesvirus 5 Use of virus or viral component as vaccine, e.g. live-attenuated or inactivated virus, VLP, viral protein
A61K2039/6018 » CPC further
Medicinal preparations containing antigens or antibodies characteristics by the carrier linked to the antigen Lipids, e.g. in lipopeptides
A61K2039/627 » CPC further
Medicinal preparations containing antigens or antibodies characterised by the link between antigen and carrier characterised by the linker
A61K39/39 » CPC main
Medicinal preparations containing antigens or antibodies characterised by the immunostimulating additives, e.g. chemical adjuvants
A61K39/00 IPC
Medicinal preparations containing antigens or antibodies
A61K39/12 » CPC further
Medicinal preparations containing antigens or antibodies Viral antigens
The present invention relates to amino acid and peptide conjugates, methods for making amino acid and peptide conjugates, conjugates produced by the methods, pharmaceutical compositions comprising the conjugates, methods of eliciting immune responses in a subject and methods of vaccinating a subject, uses of the conjugates for the same, and uses of the conjugates in the manufacture of medicaments for the same.
Synthetic peptide vaccines generally comprise a synthetic copy of an immunogenic part of protein antigens. This approach to vaccine development has a number of advantages, including ease of synthesis, avoidance of potentially toxic biological by-products and straightforward characterisation.
A key issue in the development of peptide vaccines is the lack of immunogenicity displayed by peptides as sole vaccine components. It is usually necessary to include in the vaccine an adjuvant, designed to activate components of the innate immune system (e.g. Freund's adjuvant).
An alternative strategy in peptide vaccine design is to create self-adjuvanting vaccines in which the peptide epitope of interest is covalently linked to an appropriate adjuvant. Such self-adjuvanting vaccines may have enhanced antigen uptake, presentation and dendritic cell maturation compared to simple co-formulation of the antigen with an external adjuvant.
Several self-adjuvanting vaccines have been developed, but preparation of the vaccines can be complicated.
There is an ongoing need for new self-adjuvanting vaccines and new methods of making self-adjuvanting vaccines. It is an object of the present invention to go some way towards meeting these needs; and/or to at least provide the public with a useful choice.
Other objects of the invention may become apparent from the following description which is given by way of example only.
Any discussion of documents, acts, materials, devices, articles or the like which has been included in the present specification is solely for the purpose of providing a context for the present invention. It is not to be taken as an admission that any or all of these matters form part of the prior art base or were common general knowledge in the field relevant to the present invention as it existed before the priority date.
In one aspect, the present invention provides a method for making an amino acid or peptide conjugate, the method comprising reacting
Any of the embodiments described herein relate to any of the aspects herein.
In one embodiment, the amino acid-comprising conjuation partner is a peptide-containing conjugation partner, and the lipid-containing conjugation partner is coupled to the peptide of the peptide-containing conjugation partner.
In some embodiments, the lipid-containing conjugation partner is conjugated to the or an amino acid of the amino acid-containing conjugation partner or the peptide of the peptide-containing conjugation partner.
In certain embodiments, the lipid-containing conjugation partner is conjugated to the or an amino acid of the amino acid-containing conjugation partner.
Accordingly, in another aspect, the present invention provides a method for making a peptide conjugate, the method comprising reacting
In one embodiment, the conjugate is a lipopeptide, such that the method is for making a lipopeptide.
In one embodiment, the lipid-containing conjugation partner comprises the carbon-carbon double bond, and the peptide of the peptide-containing conjugation partner comprises the thiol.
In one embodiment, the amino acid-comprising conjugation partner comprises an epitope. In one embodiment, the peptide-containing conjugation partner comprises an epitope. In one embodiment, the amino acid-comprising conjugation partner comprises two or more epitopes. In one embodiment, the peptide-containing conjugation partner comprises two or more epitopes. In one embodiment, the peptide conjugate comprises two or more epitopes. In one embodiment, the epitope is a peptide epitope. In one embodiment, the amino acid-comprising conjugation partner consists of a peptide. In one embodiment, the amino acid-comprising conjugation partner consists of a peptide comprising a peptide epitope. In one embodiment, the peptide-containing conjugation partner consists of a peptide. In one embodiment, the peptide-containing conjugation partner consists of a peptide comprising a peptide epitope.
In some embodiments, the amino acid-comprising conjugation partner comprises an epitope bound to the or an amino acid of the conjugation partner. In some embodiments, the peptide-containing conjugation partner comprises an epitope bound to the peptide of the peptide containing conjugation partner. In some embodiments, the epitope is bound to the peptide via linker group.
In some embodiments, the amino acid-comprising conjugation partner comprises a peptide epitope bound to the or an amino acid of the conjugation partner via a linker group. In some embodiments, the peptide-containing conjugation partner comprises a peptide epitope bound to the peptide via a linker group.
In some embodiments, the amino acid-comprising conjugation partner and/or the peptide-containing conjugation partner comprises an antigenic peptide. In some embodiments, the peptide conjugate comprises an antigenic peptide.
In some embodiments, the method further comprises coupling the amino acid of the amino acid conjugate to an amino acid or a peptide to provide a peptide conjugate.
In some embodiments, coupling a peptide comprises individually coupling one or more amino acids and/or one or more peptides.
In some embodiments, the method further comprises coupling the amino acid of the amino acid conjugate or an amino acid of the peptide conjugate to an amino acid or a peptide so as to provide a peptide conjugate comprising a linker group or one or more amino acids thereof.
In some embodiments, the method further comprises coupling an amino acid of the peptide conjugate comprising a linker group or one or more amino acids thereof to an amino acid or a peptide so as to provide a peptide conjugate comprising a peptide epitope bound to the amino acid to which lipid-containing conjugation partner is conjugated via a linker group.
In some embodiments, the amino acid of the peptide conjugate to which the lipid-containing conjugate is conjugated is an N-terminal amino acid residue.
In some embodiments, the method further comprises coupling the amino acid of the amino acid conjugate or an amino acid of the peptide conjugate to an amino acid or a peptide so as to provide a peptide conjugate comprising a peptide epitope.
In some embodiments, the method further comprises coupling an epitope to the amino acid of the amino acid conjugate or an amino acid of the peptide conjugate. In some embodiments, the method further comprises coupling a peptide epitope to the amino acid of the amino acid conjugate or an amino acid of the peptide conjugate. In some embodiments, the epitope is coupled or bound via a linker group.
In some embodiments, the method further comprises coupling an epitope to the peptide of the peptide conjugate. In some embodiments, the method further comprises coupling a peptide epitope to the peptide of the peptide conjugate. In some embodiments, the epitope is bound to the peptide via a linker group.
In one embodiment, the amino acid-comprising conjugation partner consists of an amino acid. In one embodiment, the carboxyl group of the C-terminus of the amino acid is protected with a carboxyl protecting group and/or the Na-amino group of the amino acid is protected with an amino protecting group.
In some embodiments, the carboxyl group of the C-terminus of the peptide is protected with a carboxyl protecting group and/or the Na-amino group of the peptide is protected with an amino protecting group.
In one embodiment, the lipid-containing conjugation partner comprises one or more optionally substituted straight or branched aliphatic or heteroaliphatic chains each containing at least 4 chain-linked atoms. In one embodiment, the lipid-containing conjugation partner comprises one or more optionally substituted straight or branched aliphatic or heteroaliphatic chains each containing at least 6 chain-linked atoms. In one specifically contemplated embodiment, the one or more chains are aliphatic. In one specifically contemplated embodiment, the one or more chains are saturated.
In some embodiments, the one or more chains are optionally substituted. In some embodiments, the one or more chains are optionally substituted with one or more aryl groups.
In some embodiments, the one or more chains comprise at least 4, 6, 8, 10, 12, or 14 chain-linked atoms. In some embodiments, the one or more chains comprise from 4-22, 6-22, 8-22, 10-22, 12-22, or 14-22 chain-linked atoms.
In one embodiment, the one or more chains are covalently bound to a moiety comprising the carbon-carbon double bond or the thiol by a heteroatom containing functional group. Examples of heteroatom containing functional groups include but are not limited to ether, amine, sulfide, sulfoxide, sulfone, ester, amide, carbonate, carbamate, and urea groups.
In exemplary embodiments, the one or more chains are covalently bound to the moiety by ester functional groups.
In one embodiment, the lipid-containing conjugation partner comprises one or more saturated or unsaturated fatty acid esters. In some embodiments, the fatty acid is saturated. In one embodiment, one or more fatty acid ester is bound to the moiety comprising to carbon-carbon double bond or thiol. In one embodiment, the ester is an ester of the carboxyl group of the fatty acid and an alcohol of the moiety.
In one embodiment, the fatty acid is a C4-22 fatty acid. In one embodiment, the fatty acid is a C6-22 fatty acid. In another embodiment, the fatty acid is a C10-22 fatty acid. In yet another embodiment, the fatty acid is a C12-22 fatty acid. In one exemplary embodiment, the fatty acid is a C12, C14, C16, C18, or C20 fatty acid.
In some embodiments, the fatty acid is lauric acid, myristic acid, palmitic acid, stearic acid, arachic acid, palmitoleic acid, oleic acid, elaidic acid, linoleic acid, α-linolenic acid, and arachidonic acid. In one embodiment, the fatty acid is lauric acid, myristic acid, palmitic acid, or stearic acid. In a specifically contemplated embodiment, the fatty acid is palmitic acid.
In one exemplary embodiment, the lipid-containing conjugation partner comprises one or two fatty acid esters. In a specifically contemplated embodiment, the lipid-containing conjugation partner comprises one fatty acid ester.
In certain embodiments, the fatty acid ester is an ester of an alcohol comprising the carbon-carbon double bond or thiol. In one embodiment, the alcohol is a monohydric, dihydric, or trihydric C2-6 aliphatic alcohol. In another embodiment, the alcohol is a monohydric or dihydric C2-4 aliphatic alcohol. In one exemplary embodiment, the alcohol is a monohydric C2 aliphatic or monohydric or dihydric C3 aliphatic alcohol. In a specifically contemplated embodiment, the alcohol is a monohydric C2 alcohol.
In certain embodiments, the lipid-containing conjugation partner comprises the carbon-carbon double bond.
In one exemplary embodiment, the alcohol comprises the carbon-carbon double bond. In a specifically contemplated embodiment, the alcohol is vinyl alcohol.
In specifically contemplated embodiments, the peptide is a synthetic peptide.
In one embodiment, the amino acid-comprising conjugation partner and/or peptide conjugate comprises a synthetic peptide. In some embodiments, the synthetic peptide is a peptide prepared by a method comprising solid phase peptide synthesis (SPPS).
In some embodiments, the or an amino acid of the amino acid-comprising conjugation partner comprises the carbon-carbon double bond or thiol. In some embodiments, an amino acid residue of the peptide of the peptide-containing conjugation partner comprises the carbon-carbon double bond or thiol.
In some embodiments, the amino acid residue comprising the carbon-carbon double bond or thiol is a terminal amino acid residue. In some embodiments, the terminal amino acid residue is an N-terminal residue.
In some embodiments, the Na-amino group of the amino acid comprising the carbon-carbon double bond or thiol is acylated.
In certain embodiments, the method further comprises acylating the Na-amino group of the amino acid of the amino acid conjugate or the amino acid residue of the peptide conjugate to which the lipid-containing conjugation partner is conjugated. In certain embodiments, the method further comprises acylating the Na-amino group with a C2-20 fatty acid.
In certain embodiments, the or an amino acid of the amino acid-comprising conjugation partner comprises the thiol. In certain embodiments, an amino acid residue of the peptide of the peptide-containing conjugation partner comprises the thiol. In certain embodiments, the thiol is the thiol of a cysteine residue.
In certain embodiments, the cysteine residue is a terminal residue. In certain embodiments, the cysteine residue is an N-terminal residue.
In some embodiments, the amino group of the cysteine residue is acylated.
In one embodiment, the amino group is acylated with a C2-20 fatty acid.
In one exemplary embodiment, the C2-20 fatty acid is acetyl or palmitoyl. In another exemplary embodiment, the C2-20 fatty acid is acetyl.
In some embodiments, the amino acid-comprising conjugation partner and/or peptide conjugate comprises from 8 to 220, 8 to 200, 8 to 175, 8 to 150, 8 to 125, 8 to 100, 8 to 90, 8 to 80, 8 to 70, 8 to 60, 8 to 50, 8 to 40, 8 to 30, 8 to 25, 8 to 20, or 8 to 15 amino acids. In some embodiments, the peptide-containing conjugation partner comprises from 8 to 220, 8 to 200, 8 to 175, 8 to 150, 8 to 125, 8 to 100, 8 to 90, 8 to 80, 8 to 70, 8 to 60, 8 to 50, 8 to 40, 8 to 30, 8 to 25, 8 to 20, or 8 to 15 amino acids.
In one exemplary embodiment, the amino acid-comprising conjugation partner and/or peptide conjugate comprises a peptide comprising from 8 to 60 amino acids. In one exemplary embodiment, the peptide comprises from 8 to 60 amino acids.
In other embodiments, the amino acid-comprising conjugation partner and/or peptide conjugate comprises from 5 to 220, 8 to 220, 5 to 175, 8 to 175, 8 to 150, 10 to 150, 15 to 125, 20 to 100, 20 to 80, 20 to 60, 25 to 100, 25 to 80, 25 to 60, 30 to 80, 40 to 60, or 50 to 60 amino acids. In other embodiments, the peptide-containing conjugation partner comprises from 5 to 220, 8 to 220, 5 to 175, 8 to 175, 8 to 150, 10 to 150, 15 to 125, 20 to 100, 20 to 80, 20 to 60, 25 to 100, 25 to 80, 25 to 60, 30 to 80, 40 to 60, or 50 to 60 amino acids.
In other embodiments, the amino acid comprising conjugation partner and/or peptide conjugate comprises from 5 to 150, 5 to 125, 5 to 100, 5 to 75, 5 to 60, 5 to 50, 5 to 40, 5 to 30, 5 to 25, 5 to 20, 8 to 150, 8 to 125, 8 to 100, 8 to 75, 8 to 60, 8 to 50, 8 to 40, 8 to 30, 8 to 25, or 8 to 20 amino acids. In other embodiments, the peptide-containing conjugation partner comprises from 5 to 150, 5 to 125, 5 to 100, 5 to 75, 5 to 60, 5 to 50, 5 to 40, 5 to 30, 5 to 25, 5 to 20, 8 to 150, 8 to 125, 8 to 100, 8 to 75, 8 to 60, 8 to 50, 8 to 40, 8 to 30, 8 to 25, or 8 to 20 amino acids.
In one embodiment, the amino acid-comprising conjugation partner and/or peptide conjugate comprises one or more solubilising groups. In one embodiment, the peptide-containing conjugation partner comprises one or more solubilising groups.
In certain embodiments, the solubilising group is an amino acid sequence comprising two or more hydrophilic amino acid residues in the peptide chain. In certain embodiments, the solubilising group is an amino acid sequence comprising a sequence of two or more consecutive hydrophilic amino acid residues in the peptide chain. In one embodiment, the hydrophilic amino acid residues are cationic amino acid residues. In one embodiment, the cationic amino acid residues are arginine or lysine residues. In one specifically contemplated embodiment, the cationic amino acid residues are lysine residues. In one embodiment, the sequence comprises from 2 to 20, 2 to 15, 2 to 10, 3 to 7, or 3 to 5 amino acids. In one embodiment, the solubilising group is a tri-, tetra-, penta-, hexa-, or hepta-lysine sequence. In one specifically contemplated embodiment, the solubilising group is a tetralysine sequence.
In some embodiments, the peptide conjugate and/or amino-acid comprising conjugation partner comprises a serine residue adjacent to the amino acid residue to which the lipid-containing conjugation partner is conjugated. In a specifically contemplated embodiment, the peptide of the peptide-containing conjugation partner comprises a serine residue adjacent to the amino acid residue to which the lipid-containing conjugation partner is conjugated. In an exemplary embodiment, the amino acid residue to which the lipid-containing conjugation partner is conjugated is N-terminal. In a specifically contemplated embodiment, the peptide further comprises a consecutive sequence of two or more hydrophilic amino acid residues adjacent to the serine residue.
In certain embodiments, the peptide conjugate and/or amino-acid comprising conjugation partner comprises a consecutive sequence of two or more hydrophilic amino acid residues adjacent to the serine residue.
In certain embodiments, the peptide conjugate and/or amino acid-comprising conjugation partner comprises only naturally occurring amino acids. In certain embodiments, the peptide-containing conjugation partner comprises only naturally occurring amino acids. In other embodiments, 75% or more, 80% or more, 85% or more, 90% or more, 95% or more, 97% or more, or 99% or more of the amino acid residues in the peptide are naturally occurring amino acids.
In other embodiments, 75% or more, 80% or more, 85% or more, 90% or more, 95% or more, 97% or more, or 99% or more of the amino acid residues in the peptide conjugate and/or amino acid-comprising conjugation partner are naturally occurring amino acids.
In exemplary embodiments, the peptide conjugate and/or amino acid-comprising conjugation partner comprises a peptide comprising a peptide epitope. In exemplary embodiments, the peptide of the peptide-containing conjugation partner comprises one or more peptide epitopes.
In one embodiment, the peptide comprises, consists of, or consists essentially of an amino acid sequence selected from the group consisting of
| [SEQ ID NO: 4] | |
| SKKKKGARGPESRLLEFYLAMPFATPMEAELARRSLAQDAPPL, |
| [SEQ ID NO: 5] | |
| GARGPESRLLEFYLAMPFATPMEAELARRSLAQDAPPL, |
| [SEQ ID NO: 11] | |
| SKKKKVPGVLLKEFTVSGNILTIRLTAADHR, |
| [SEQ ID NO: 12] | |
| VPGVLLKEFTVSGNILTIRLTAADHR, |
| [SEQ ID NO: 17] | |
| SKKKKLQQLSLLMWITQCFLPVFLAQPPSGQRR, |
| [SEQ ID NO: 18] | |
| LQQLSLLMWITQCFLPVFLAQPPSGQRR, |
| [SEQ ID NO: 19] | |
| SLLMWITQCFLPVF, |
In one exemplary embodiment, the peptide epitope is derived from NY-ESO-1. In one specifically contemplated embodiment, the peptide comprises, consists essentially of, or consists of an amino acid sequence selected from the group consisting of 8 or more contiguous amino acid residues from any one of SEQ ID NO: 5, 6, 7, 12, 13, 18, 19, and 20.
In one embodiment, the peptide comprises, consists essentially of, or consists of an amino acid sequence selected from the group consisting of any one of SEQ ID NO: 5, 6, 7, 12, 13, 18, 19, and 20.
In one embodiment, the peptide comprises, consists essentially of, or consists of an amino acid sequence selected from the group consisting of any one of SEQ ID NO: 5, 12, and 18.
In one embodiment, the peptide comprises, consists essentially of, or consists of an amino acid sequence selected from the group consisting of any one of SEQ ID NO: 5, 12, and 18.
In one embodiment, the peptide comprises, consists essentially of, or consists of an amino acid sequence selected from the group consisting of any one of SEQ ID NO: 4, 11, and 17.
In one specifically contemplated embodiment, the reactive functional groups of the amino acids of the peptide-containing conjugation partner are unprotected.
In certain embodiments, one or more reactive functional groups of one or more amino acids of the peptide conjugate are unprotected.
In certain embodiments, one or more reactive functional groups of the amino acid of the amino acid conjugate are unprotected.
In certain embodiments, one or more reactive functional groups of one or more amino acids of the amino acid-comprising conjugation partner are unprotected.
In certain embodiments, the amino acid-comprising conjugation partner comprises a peptide, wherein the reactive functional groups of the side chains of the amino acids of the peptide are unprotected, with the exception of any thiols other than the thiol to be reacted.
In one specifically contemplated embodiment, the reactive functional groups of the amino acids of the peptide of the peptide-containing conjugation partner are unprotected. In one specifically contemplated embodiment, the reactive functional groups of the amino acids of the peptide of the peptide-containing conjugation partner are unprotected, with the exception of any thiols other than the thiol to be reacted.
In one embodiment, the method comprises making an amino acid or peptide-conjugate comprising a structure of the formula (A):
wherein
In one embodiment, the method comprises making a peptide-conjugate comprising a structure of the formula (A):
wherein
In one embodiment, the method comprises making an amino acid or peptide-conjugate comprising a structure of the formula (B):
wherein
In one embodiment, the method comprises making a peptide-conjugate comprising a structure of the formula (B):
wherein
In one embodiment, the lipid-containing conjugation partner is a compound of the formula (A1):
wherein
In another embodiment, the lipid containing conjugation partner is a compound of the formula (B1):
wherein
In one embodiment, the lipid-containing conjugation partner is a compound of the formula (II) as defined in any of the embodiments described herein.
In one embodiment, the lipid-containing conjugation partner is a compound of the formula (IIA) as defined in any of the embodiments described herein.
In one embodiment, the amino acid-comprising conjugation partner is a compound of the formula (III) as defined in any of the embodiments described herein.
In one embodiment, the peptide-containing conjugation partner is a compound of the formula (III) as defined in any of the embodiments described herein.
In one embodiment, the amino acid-comprising conjugation partner is a compound of the formula (IIIA) as defined in any of the embodiments described herein.
In one embodiment, the peptide-containing conjugation partner is a compound of the formula (IIIA) as defined in any of the embodiments described herein.
In one embodiment, the method comprises making an amino acid or peptide conjugate comprising a structure of the formula (I)
wherein
the method comprising reacting a lipid-containing conjugation partner of the formula (II)
wherein m, R1, R2, R3, R4, R5, and L1 are as defined in the compound of formula (I);
and a peptide-containing conjugation partner comprising a structure of the formula (III)
wherein n, R6, R7, R8, R9 and A1 are as defined in the compound of formula (I);
under conditions effective to conjugate the compound of formula (II) with the compound of formula (III) by hydrothiolation of the carbon-carbon double bond in the compound of formula (II) with the thiol in the compound of formula (III).
In one embodiment, the method comprises making a peptide conjugate comprising a structure of the formula (I)
wherein
the method comprising reacting a lipid-containing conjugation partner of the formula (II)
wherein m, R1, R2, R3, R4, R5, and L1 are as defined in the compound of formula (I);
and a peptide-containing conjugation partner comprising a structure of the formula (III)
wherein n, R6, R7, R8, R9 and A1 are as defined in the compound of formula (I);
under conditions effective to conjugate the compound of formula (II) with the compound of formula (III) by hydrothiolation of the carbon-carbon double bond in the compound of formula (II) with the thiol in the compound of formula (III).
In one embodiment, the method comprises making an amino acid or peptide conjugate comprising a structure of the formula (IA),
wherein
the method comprising reacting a compound of the formula (IIA)
wherein p, R11, R22, R33, R44, and L1 are as defined in the compound of formula (IA);
and a compound of the formula (IIIA)
wherein q, R55, R66, R77, R8, R9, Ra, Rb, and A1 are as defined in the compound of formula (IA);
under conditions effective to conjugate the compound of formula (IIA) with the compound of formula (IIIA) by hydrothiolation of the carbon-carbon double bond in the compound of formula (IIIA) with the thiol in the compound of formula (IIA).
In one embodiment, the method comprises making a peptide conjugate comprising a structure of the formula (IA),
wherein
the method comprising reacting a compound of the formula (IIA)
wherein p, R11, R22, R33, R44, and L1 are as defined in the compound of formula (IA);
and a compound of the formula (IIIA)
wherein q, R55, R66, R77, R8, R9, Ra, Rb, and A1 are as defined in the compound of formula (IA);
under conditions effective to conjugate the compound of formula (IIA) with the compound of formula (IIIA) by hydrothiolation of the carbon-carbon double bond in the compound of formula (IIIA) with the thiol in the compound of formula (IIA).
In one embodiment, at least one of L1 and L2 is C5-22alkyl.
In one embodiment, p is an integer from 0 to 2. In another embodiment, p is 0 or 1.
In some embodiments, R11 and R22 at each instance of p are each independently hydrogen; or R11 is L2-C(O)—OCH2. In one embodiment, R11 on the carbon adjacent to L1-C(O)—O is L2-C(O)—OCH2.
In one specifically contemplated embodiment, R11 and R22 at each instance of p are each independently hydrogen.
In one embodiment, R33 is hydrogen or L2-C(O)—OCH2.
In one embodiment, R33 and R44 are each hydrogen.
In one specifically contemplated embodiment, q is 0 or 1. In one specifically contemplated embodiment, q is 0.
In one specifically contemplated embodiment, R55, R66, and R77 are each hydrogen.
In some embodiments, Ra and Rb are at each instance of q are each hydrogen.
In one embodiment, L1 is C11-21alkyl; p is 1; R11 is hydrogen or L2-C(O)—OCH2; R22 is hydrogen; R33 is hydrogen or L2-C(O)—OCH2; R44 is hydrogen; and L2 is C11-21alkyl.
In one embodiment, R55, R66, R77, Ra, Rb and R8 are each hydrogen; and R9 is hydrogen, L3-C(O), or A2. In one embodiment, R55, R66, R77, Ra, Rb and R8 are each hydrogen; and R9 is hydrogen or L3-C(O).
In one embodiment, L1 is C11-21alkyl; p is 1; R11 is hydrogen or L2-C(O)—OCH2; R22 is hydrogen; R33 is hydrogen or L2-C(O)—OCH2; R44 is hydrogen; L2 is C11-21alkyl; R55, R66, R77, Ra, Rb and R8 are each hydrogen; and R9 is hydrogen, L3-C(O), or A2.
In one embodiment, L1 is C5-21alkyl. In another embodiment, L1 is C9-21alkyl. In yet another embodiment, L1 is C11-21alkyl. In one exemplary embodiment, L1 is C11, C13, C15, C17, or C19alkyl. In one specifically contemplated embodiment, L1 is C15alkyl.
In one embodiment, L1 comprises a linear chain of 9-21 carbon atoms. In one specifically contemplated embodiment, L1 is linear C15alkyl.
In one embodiment, m is an integer from 0 to 2. In another embodiment, m is 0 or 1.
In one specifically contemplated embodiment, m is 0.
In some embodiments, R1 and R2 at each instance of m are each independently hydrogen; or R1 is L2-C(O)—OCH2. In one embodiment, R1 on the carbon atom adjacent to L1-C(O)—O is L2-C(O)—OCH2.
In one specifically contemplated embodiment, R1 and R2 at each instance of m are each independently hydrogen.
In one embodiment, R3 is hydrogen or L2-C(O)—OCH2. In one specifically contemplated embodiment, R3 is hydrogen.
In one embodiment, L2 is C5-21alkyl. In another embodiment, L2 is C9-21alkyl. In yet another embodiment, L2 is C11-21alkyl. In one exemplary embodiment, L2 is C11, C13, C15, C17, or C19alkyl. In another exemplary embodiment, L2 is C15alkyl.
In one specifically contemplated embodiment, R4 and R5 are each hydrogen.
In one specifically contemplated embodiment, n is 1.
In one specifically contemplated embodiment, R6 and R7 are each hydrogen.
In exemplary embodiments, R8 is hydrogen.
In one embodiment, R8 and R9 are each hydrogen; or R9 is L3-C(O) or A2. In one exemplary embodiment R8 is hydrogen and R9 is L3-C(O).
In some embodiments, L3 is C1-21alkyl. In one specifically contemplated embodiment, L3 is methyl or linear C15alkyl. In exemplary embodiments, L3 is methyl.
Those skilled in the art will appreciate that the structures of formula (III) and (IIIA) may comprise a peptide of the peptide-containing conjugation partner. As described herein, the peptide may be optionally substituted, modified, or bound to various other moieties as described herein to provide the peptide containing conjugation partner.
In one embodiment A1 is a peptide comprising an epitope. In one embodiment A2 is a peptide comprising an epitope.
In some embodiments, A1 is a peptide comprising a peptide epitope. In some embodiments, A2 is a peptide comprising a peptide epitope. In one embodiment, A1 is a peptide, wherein the peptide comprises a peptide epitope.
In another embodiment, A2 is a peptide, wherein the peptide comprises a peptide epitope.
In one embodiment, A1 is a peptide substituted with an epitope. In one embodiment, A2 is a peptide substituted with an epitope.
In one embodiment, the epitope is bound to the peptide via a linker group.
In one embodiment, the epitope is a peptide epitope.
In some embodiments, A1 and/or A2 are each independently a peptide comprising from about 8 to 220, 8 to 200, 8 to 175, 8 to 150, 8 to 125, 8 to 100, 8 to 90, 8 to 80, 8 to 70, 8 to 60, 8 to 50, 8 to 40, 8 to 30, 8 to 25, 8 to 20, or 8 to 15 amino acids. In one exemplary embodiment, A1 and A2 are each independently a peptide comprising from about 8 to 60 amino acids.
In other embodiments, A1 and/or A2 are each independently a peptide comprising from about 8 to 220, 8 to 200, 8 to 175, 8 to 150, 8 to 125, 8 to 100, 8 to 90, 8 to 80, 8 to 70, 8 to 60, 8 to 50, 8 to 40, 8 to 30, 8 to 25, 8 to 20, or 8 to 15 amino acids.
In other embodiments, A1 and/or A2 are each independently a peptide comprising from about 5 to 150, 5 to 125, 5 to 100, 5 to 75, 5 to 60, 5 to 50, 5 to 40, 5 to 30, 5 to 25, 5 to 20, 8 to 150, 8 to 125, 8 to 100, 8 to 75, 8 to 60, 8 to 50, 8 to 40, 8 to 30, 8 to 25, or 8 to 20 amino acids.
In some embodiments, A1 and/or A2 are each independently a peptide, wherein the peptide comprises 8 to 60 amino acids.
In some embodiments, A1 and/or A2 are each independently a peptide comprising or substituted with a peptide epitope, wherein the peptide epitope comprises from 8 to 60 amino acids.
In one embodiment, L1 is C11-21alkyl; m is 0; R3 is hydrogen or L2-C(O)—OCH2; 12 is C11-21alkyl; and R4 and R5 are each hydrogen.
In one embodiment, n is 1; R6, R7, and R8 are each hydrogen; and R9 is hydrogen, 13-C(O), or A2. In one embodiment, n is 1; R6, R7, and R8 are each hydrogen; and R9 is hydrogen or L3-C(O). In one embodiment, L3 is methyl or linear C15alkyl.
In one embodiment, L1 is C11-21alkyl; m is 0; R3 is hydrogen or L2-C(O)—OCH2; 12 is C11-21alkyl; R4 and R5 are each hydrogen; n is 1; R6, R7, and R8 are each hydrogen; R9 is hydrogen, L3-C(O), or A2. In one embodiment, L1 is C11-21alkyl; m is 0; R3 is hydrogen or L2-C(O)—OCH2; L2 is C11-21alkyl; R4 and R5 are each hydrogen; n is 1; R6, R7, and R8 are each hydrogen; R9 is hydrogen or L3-C(O).
In one embodiment, L1 is C11-21alkyl; m is 0; R3 is hydrogen; and R4 and R5 are each hydrogen.
In one embodiment, n is 1; R6, R7, and R8 are each hydrogen; and R9 is hydrogen, 13-C(O), or A2. In one embodiment, n is 1; R6, R7, and R8 are each hydrogen; and R9 is hydrogen or L3-C(O). In one embodiment, n is 1; R6, R7, and R8 are each hydrogen; and R9 is hydrogen or L3-C(O), wherein L3 is methyl.
In one embodiment, L1 is C11-21alkyl; m is 0; R3 is hydrogen; R4 and R5 are each hydrogen; n is 1; R6, R7, and R8 are each hydrogen; R9 is hydrogen, L3-C(O), or A2. In one embodiment, L1 is C11-21alkyl; m is 0; R3 is hydrogen; R4 and R5 are each hydrogen; n is 1; R6, R7, and R8 are each hydrogen; R9 is hydrogen or L3-C(O).
In one embodiment, L1 is C11-21alkyl; m is 0; R3 is hydrogen; R4 and R5 are each hydrogen; n is 1; R6, R7, and R8 are each hydrogen; R9 is hydrogen or L3-C(O), wherein L3 is methyl.
In one embodiment, L1 is C11-21alkyl; m is 0; R3 is hydrogen; and R4 and R5 are each hydrogen.
In one embodiment, n is 1; R6, R7, and R8 are each hydrogen; and R9 is hydrogen, 13-C(O), or A2. In one embodiment, n is 1; R6, R7, and R8 are each hydrogen; and R9 is hydrogen or L3-C(O). In one embodiment, n is 1; R6, R7, and R8 are each hydrogen; and R9 is hydrogen or L3-C(O), wherein L3 is methyl.
In one embodiment, L1 is C11-21alkyl; m is 0; R3 is hydrogen; R4 and R5 are each hydrogen; n is 1; R6, R7, and R8 are each hydrogen; R9 is hydrogen, L3-C(O), or A2. In one embodiment, L1 is C11-21alkyl; m is 0; R3 is hydrogen; R4 and R5 are each hydrogen; n is 1; R6, R7, and R8 are each hydrogen; R9 is hydrogen or L3-C(O).
In one embodiment, L1 is C11-21alkyl; m is 0; R3 is hydrogen; R4 and R5 are each hydrogen; n is 1; R6, R7, and R8 are each hydrogen; R9 is hydrogen or L3-C(O), wherein L3 is methyl.
In some embodiments, A1 is a peptide comprising serine as the first N-terminal amino acid residue. In some embodiments, A1 and/or A2 is a peptide comprising a solubilising group. In some embodiments, the solubilising group comprises an amino acid sequence comprising two or more hydrophilic amino acid residues in the peptide chain. In certain embodiments, A1 is a peptide comprising a solubilising group comprising an amino acid sequence comprising two or more hydrophilic amino acid residues in the peptide chain.
In some embodiments, A1 is a peptide comprising serine as the first N-terminal amino acid residue and a solubilising group comprising an amino acid sequence comprising two or more hydrophilic amino acid residues in the peptide chain adjacent to the serine.
In some embodiments, the solubilising group comprises an amino acid sequence comprising two or more consecutive hydrophilic amino acid residues in the peptide chain.
In one embodiment, the hydrophilic amino acid residues are cationic amino acid residues.
In one embodiment, the cationic amino acid residues are arginine or lysine residues. In one specifically contemplated embodiment, the cationic amino acid residues are lysine residues. In one embodiment, the sequence comprises from 2 to 20, 2 to 15, 2 to 10, 3 to 7, or 3 to 5 amino acids. In one embodiment, the solubilising group is a tri-, tetra-, penta-, hexa-, or hepta-lysine sequence. In one specifically contemplated embodiment, the solubilising group is a tetralysine sequence.
In some embodiments, R9 is hydrogen, an amino protecting group or L3-C(O). In some embodiments, R9 is hydrogen or L3-C(O).
In some embodiments, R9 is hydrogen or an amino protecting group, and the method further comprises acylating the amino acid conjugate or peptide conjugate so as to replace the hydrogen or amino protecting group at R9 with L3-C(O). In some embodiments, acylating the amino acid conjugate or peptide conjugate so as to replace the amino protecting group at R9 with L3-C(O) comprises removing the amino protecting group at R9 to provide a hydrogen at R9.
In some embodiments, A1 and/or A2 is an amino acid or a peptide. In some embodiments, A1 and/or A2 is a peptide.
In some embodiments, A1 is OH or OP1 and/or R9 is hydrogen, an amino protecting group or L3-C(O). In some embodiments, A1 is OP1 or OH and/or R9 is hydrogen, an amino protecting group or L3-C(O). In some embodiments, A1 is a OP1 or OH and R9 is hydrogen, an amino protecting group or L3-C(O).
In some embodiments, A1 is a OP1 or OH and/or R9 is hydrogen, an amino protecting group or L3-C(O), and the method comprises coupling an amino acid or a peptide so as to replace A1 and/or R9 with the amino acid or peptide.
In some embodiments, A1 is a OP1 or OH and R9 is hydrogen, an amino protecting group or L3-C(O) and the method further comprises coupling an amino acid or a peptide so as to replace A1 and/or R9 with the amino acid or peptide.
In some embodiments, coupling a peptide comprises individually coupling one or more amino acids and/or one or more peptides.
In some embodiments, coupling the amino acid or peptide provides a peptide conjugate comprising a peptide epitope. In some embodiments, the coupling the amino acid or peptide provides a peptide conjugate comprising a linker group or one or more amino acids thereof. In some embodiments, coupling the amino acid or peptide provides a peptide conjugate comprising a peptide epitope bound to the amino acid to which lipid-containing conjugation partner is conjugated via a linker group.
In some embodiments, the amino protecting group is Boc, Fmoc, Cbz (carboxybenzyl), Nosyl (o- or p-nitrophenylsulfonyl), Bpoc (2-(4-biphenyl)isopropoxycarbonyl) and Dde (1-(4,4-dimethyl-2,6-dioxohexylidene)ethyl). In some embodiments, the amino protecting group is Boc or Fmoc.
In some embodiments, the carboxyl protecting group is tert-butyl or benzyl. In one embodiment, the compound of the formula (I) is a compound of the formula (IV):
wherein
or a pharmaceutically acceptable salt or solvate thereof.
In one embodiment, the compound of the formula (I) is a compound of the formula (IV):
wherein
or a pharmaceutically acceptable salt or solvate thereof.
In one embodiment, L1, A1, A2, L2, and L3 in the compound of formula (IV) are each independently as defined in any of the embodiments relating to the compound of the formula (I).
In one specifically contemplated embodiment, R3 is hydrogen.
In another specifically contemplated embodiment, R9 is acetyl.
In another specifically contemplated embodiment, R3 is hydrogen and R9 is acetyl.
In some embodiments, the method is for making a compound of the formula (IV), wherein L1 is C15 linear alkyl, R3 is hydrogen, R9 is Fmoc, and A1 is OH, and the method comprises reacting vinyl palmitate and Fmoc-Cys-OH.
In some embodiments, the amino protecting group is not Fmoc. In some embodiments, the amino protecting group is Boc.
In some embodiments, the amino acid-comprising conjugation partner is not Fmoc-Cys-OH.
In some embodiments, the peptide conjugate comprises 3 or more, 4 or more, or 5 or more contiguous amino acids. In some embodiments, the compound of formula (I) comprises 3 or more, 4 or more, or 5 or more contiguous amino acids.
In one embodiment, the conditions effective to conjugate the lipid-containing conjugation partner to the amino acid-comprising conjugation partner comprises the generation of one or more free radicals. In one embodiment, the conditions effective to conjugate the lipid-containing conjugation partner to the peptide-containing conjugation partner comprises the generation of one or more free radicals.
In some embodiments, the generation of one or more free radicals is initiated thermally and/or photochemically. In certain embodiments, the generation of one or more free radicals is initiated by the thermal and/or photochemical degradation of a free radical initiator. In exemplary embodiments, the generation of one or more free radicals is initiated by the thermal degradation of a thermal initiator or the photochemical degradation of a photochemical initiator.
In some embodiments, thermal degradation of the free radical initiator comprises heating the reaction mixture at a suitable temperature. In some embodiments, the reaction mixture is heated at a temperature is from about 40° C. to about 200° C., from about 50° C. to about 180° C., from about 60° C. to about 150° C., from about 65° C. to about 120° C., from about 70° C. to about 115° C., from about 75° C. to about 110° C., or from about 80° C. to about 100° C. In other embodiments, the reaction mixture is heated at a temperature of at least about 40° C., at least about 50° C., at least about 60° C., or at least about 65° C. In one specifically contemplated embodiment, the reaction mixture is heated at a temperature of about 90° C.
In some embodiments, photochemical degradation of the free radical initiator comprises irradiation with ultraviolet light. In a specifically contemplated embodiment, the ultraviolet light has a wavelength of about 365 nm. In exemplary embodiments, photochemical degradation of the free radical initiator is carried out at about ambient temperature.
In one specifically contemplated embodiment, the thermal initiator is 2,2′-azobisisobutyronitrile (AIBN). In one specifically contemplated embodiment, the photoinitiator is 2,2-dimethoxy-2-phenylacetophenone (DMPA).
In certain embodiments, the reaction is carried out in a liquid medium. In one embodiment, the liquid medium comprises a solvent. In one embodiment, the solvent is selected from the group consisting of N-methylpyrrolidone (NMP), dimethylsulfoxide (DMSO), N,N-dimethylformamide (DMF), dichloromethane (DCM), 1,2-dichloroethane, and mixtures thereof. In one specifically contemplated embodiment, the solvent comprises NMP, DMSO, or a mixture thereof.
In one specifically contemplated embodiment, the solvent comprises DMSO.
In some embodiments, the reaction is carried out in the presence of one or more additives that inhibit dimerisation, telomerisation, or polymerisation. In some exemplary embodiments, the additive is selected from the group consisting of reduced glutathione (GSH), 2,2′-(ethylenedioxy)diethanethiol (DODT), 1,4-dithiothreitol (DTT), and protein.
In a specifically contemplated embodiment, the additive is DTT. In some embodiments, the additive is DTT or tert-butyl mercaptan.
In some embodiments, the one or more additive is selected from the group consisting of TFA, tert-butyl mercaptan, and a combination thereof. In certain embodiments, the one or more additive is a combination of TFA and tert-butyl mercaptan. In some embodiments, the reaction is carried out for a period of time from about 5 minutes to about 48 h, 5 minutes to about 24 h, from about 5 minutes to about 12 hours, from about 5 minutes to about 6 hours, from about 5 minutes to about 3 hours, 5 minutes to 2 hours, or form about 5 minutes to about 1 hour. In exemplary embodiments, the reaction is carried out for a period of time from about 5 minutes to about 1 h. In some embodiments, the reaction is carried out until one of the conjugation partners is at least about 70%, 80%, 90%, 95%, 97%, 99%, or 100% consumed.
In certain embodiments, the reaction is carried out under substantially oxygen free conditions.
In some embodiments, the method comprises
In some embodiments, the method further comprises acylating the No-amino group of the amino acid of the amino acid conjugate or the amino acid to which the lipid-containing conjugation partner is conjugated of any one of the peptide conjugates.
In some embodiments, the method comprises cleaving the peptide conjugate from the solid phase support.
In some embodiments, the method comprises
In exemplary embodiments, the method comprises
In one embodiment, the peptide-containing conjugation partner is not purified prior to reaction with the lipid-containing conjugation partner.
In some embodiments, one or more protecting groups are removed on cleaving the peptide from the solid phase support. In certain embodiments, all of the protecting groups present in the peptide are removed.
In one embodiment, the SPPS is Fmoc-SPPS.
In some embodiments, the amino acid residue in the peptide of the peptide-containing conjugation partner bearing the carbon-carbon double bond or thiol to be reacted is an N-terminal amino acid residue and the method comprises acylating the N-terminal amino group prior to cleaving the peptide from the solid phase. In exemplary embodiments, the amino acid residue is an N-terminal residue. In specifically contemplated embodiments, the N-terminal residue is a cysteine residue.
In one embodiment, the method further comprises separating the peptide conjugate from the reaction medium and optionally purifying the peptide conjugate.
In another aspect, the present invention provides an amino acid conjugate or peptide conjugate made by a method of the present invention.
In another aspect, the present invention provides a peptide conjugate made by a method of the present invention.
In another aspect, the present invention provides a compound of the formula (V):
wherein
or a pharmaceutically acceptable salt or solvate thereof.
In another aspect, the present invention provides a compound of the formula (V):
wherein
or a pharmaceutically acceptable salt or solvate thereof.
In one embodiment, m, n, R6, R7, A1 and A2 are each independently as defined in any of the embodiments relating to the compound of formula (I).
In one embodiment, L1 is C5-21alkyl. In one embodiment, L1 is C5-21alkyl. In another embodiment, L1 is C9-21alkyl. In yet another embodiment, L1 is C11-21alkyl. In one exemplary embodiment, L1 is C11, C13, C15, C17, or C19alkyl. In one specifically contemplated embodiment, L1 is C15alkyl.
In one embodiment, L1 comprises a linear chain of 9-21 carbon atoms. In one specifically contemplated embodiment, L1 is linear C15alkyl.
In one embodiment, m is an integer from 0 to 2. In another embodiment, m is 0 or 1.
In one specifically contemplated embodiment, m is 0.
In one specifically contemplated embodiment, R1 and R2 at each instance of m are each independently hydrogen.
In one specifically contemplated embodiment, R3 is hydrogen.
In one specifically contemplated embodiment, R4 and R5 are each hydrogen.
In one specifically contemplated embodiment, n is 1.
In one specifically contemplated embodiment, R6 and R7 are each hydrogen.
In exemplary embodiments, R8 is hydrogen.
In some embodiments, R8 is hydrogen and R9 is hydrogen, an amino protecting group, L3-C(O), or A2. In one embodiment, R8 and R9 are each hydrogen; or R9 is L3-C(O) or A2. In one exemplary embodiment R8 is hydrogen and R9 is L3-C(O). In one specifically contemplated embodiment, L3 is methyl.
In some embodiments, A1 is OP1 or OH and R9 is hydrogen, an amino protecting group or L3-C(O).
In some embodiments, A1 and/or A2 is an amino acid or a peptide. In some embodiments, the peptide comprises an epitope.
In some embodiments, A1 is serine or a peptide comprising serine as the first N-terminal amino acid residue.
In some embodiments, A1 and/or A2 is a peptide comprising a solubilising group comprising an amino acid sequence comprising two or more hydrophilic amino acid residues in the peptide chain.
In some embodiments, A1 is a peptide comprising serine as the first N-terminal amino acid residue and a solubilising group comprising an amino acid sequence comprising two or more hydrophilic amino acid residues in the peptide chain adjacent to the serine.
In one embodiment, L1 is C11-21 alkyl; m is 0; R3 is hydrogen; and R4 and R5 are each hydrogen.
In one embodiment, n is 1; R6, R7, and R8 are each hydrogen; and R9 is hydrogen, L3-C(O), or A2. In one embodiment, n is 1; R6, R7, and R8 are each hydrogen; and R9 is hydrogen or L3-C(O). In one embodiment, n is 1; R6, R7, and R8 are each hydrogen; and R9 is hydrogen or L3-C(O), wherein L3 is methyl.
In one embodiment, L1 is C11-21 alkyl; m is 0; R3 is hydrogen; R4 and R5 are each hydrogen; n is 1; R6, R7, and R8 are each hydrogen; R9 is hydrogen, L3-C(O), or A2. In one embodiment, L1 is C11-21 alkyl; m is 0; R3 is hydrogen; R4 and R5 are each hydrogen; n is 1; R6, R7, and R8 are each hydrogen; R9 is hydrogen or L3-C(O).
In one embodiment, L1 is C11-21 alkyl; m is 0; R3 is hydrogen; R4 and R5 are each hydrogen; n is 1; R6, R7, and R8 are each hydrogen; R9 is hydrogen or L3-C(O), wherein L3 is methyl.
In some embodiments, L1 is C15 linear alkyl; m is 0; n is 1; R3, R4, R5, R6, R7, and R8 are each hydrogen; R9 is Fmoc, and A1 is OH in the compound of the formula (V).
In some embodiments, the amino protecting group of R9 is not Fmoc. In some embodiments, the amino protecting group of R9 is Boc.
In some embodiments, the compound of formula (V) comprises 3 or more, 4 or more, or 5 or more contiguous amino acids.
In some embodiments, the amino and/or carboxyl protecting groups are as defined in any of the embodiments relating to the compound of formula (I).
Those skilled in the art will appreciate that compound of formula (V) is a peptide conjugate and certain embodiments relating to the peptide conjugates of the conjugation method described herein also apply to the compounds of formula (V).
In some embodiments, the compound of formula (V) is a self adjuvanting peptide.
In some embodiments, the compound comprises a linker or one or more amino acids thereof. In some embodiments, the peptide comprises a linker or one or more amino acids thereof. In some embodiments, the peptide comprises a peptide epitope bound to via a linker to the amino acid to which L1 is bound. In some embodiments, the peptide comprises two or more epitopes. In some embodiments, the peptide comprises a peptide antigen. In some embodiments, the linker is an amino acid sequence from about 2 to 20, 2 to 18, 2 to 16, 2 to 14, 2 to 12, 2 to 10, or 2 to 8 amino acids in length.
In another aspect, the present invention provides an isolated, purified, or recombinant peptide comprising or consisting of 20 or more contiguous amino acids from the amino acid sequence of any one of SEQ ID NOs 1-5, 8-12, or 14-18.
In one embodiment, the peptide comprises, consists of, or consists essentially of an amino acid sequence selected from the group consisting of any one of SEQ ID NOs 1-5, 8-12, or 14-18.
In one embodiment, the peptide comprises, consists of, or consists essentially of an amino acid sequence selected from the group consisting of any one of SEQ ID NOs 4, 5, 11, 12, 17, and 18.
In another aspect, the present invention provides a pharmaceutical composition comprising an effective amount of a peptide conjugate of the present invention or a pharmaceutically acceptable salt or solvate thereof, and a pharmaceutically acceptable carrier.
In one embodiment, the pharmaceutical composition is an immunogenic composition.
In one embodiment, the composition does not include an extrinsic adjuvant.
In some embodiments, the composition is a vaccine.
In one embodiment, the pharmaceutical composition comprises an effective amount of two or more peptide conjugates of the present invention, for example the pharmaceutical composition comprises an effective amount of three or more peptide conjugates of the present invention.
In another aspect, the present invention provides a pharmaceutical composition comprising an effective amount of a peptide of the present invention or a pharmaceutically acceptable salt or solvate thereof, and a pharmaceutically acceptable carrier.
In one embodiment, the pharmaceutical composition comprises an effective amount of two or more peptides of the present invention, for example the pharmaceutical composition comprises an effective amount of three or more peptides of the present invention.
In one embodiment, the pharmaceutical composition comprises an effective amount of one or more peptide conjugates of the present invention together with one or more peptides of the present invention, or any combination thereof. For example, the pharmaceutical composition comprises an effective amount of two or more peptide conjugates of the present invention and one or more peptides of the present invention, or an effective amount of one or more peptide conjugates of the present invention and two or more peptides of the present invention.
In another aspect, the present invention provides a method of vaccinating or eliciting an immune response in a subject comprising administering to the subject an effective amount of a peptide conjugate or peptide of the present invention.
In another aspect, the present invention provides use of a peptide conjugate or peptide of the invention for vaccinating or eliciting an immune response in a subject.
In another aspect, the present invention provides use of a peptide conjugate or a peptide of the invention in the manufacture of a medicament for vaccinating or eliciting an immune response in a subject.
In another aspect, the present invention provides a method of vaccinating or eliciting an immune response in a subject comprising administering to the subject an effective amount of the pharmaceutical composition of the present invention.
In another aspect, the present invention provides use of a pharmaceutical composition of the invention for vaccinating or eliciting an immune response in a subject.
In another aspect, the present invention provides use of one or more peptides of the present invention or one or more peptide conjugates of the present invention in the manufacture of a medicament for vaccinating or eliciting an immune response in a subject.
In another aspect, the present invention provides a method of eliciting an immune response in a subject comprising administering to the subject an effective amount of a peptide conjugate of the present invention or a pharmaceutically acceptable salt or solvate thereof.
In another aspect, the present invention provides use of a peptide conjugate of the invention or a pharmaceutically acceptable salt or solvate thereof for eliciting an immune response in a subject.
In another aspect, the present invention provides use of a peptide conjugate of the invention or a pharmaceutically acceptable salt or solvate thereof in the manufacture of a medicament for eliciting an immune response in a subject.
In another aspect, the present invention provides a method of vaccinating a subject comprising administering to the subject an effective amount of a peptide conjugate of the present invention or a pharmaceutically acceptable salt or solvate thereof.
In another aspect, the present invention provides use of a peptide conjugate of the present invention for vaccinating a subject or a pharmaceutically acceptable salt or solvate thereof.
In another aspect, the present invention provides use of a peptide conjugate of the invention or a pharmaceutically acceptable salt or solvate thereof in the manufacture of a medicament for vaccinating a subject.
In some embodiments, the method comprises the administration of one or more peptides of the present invention and/or one or more peptide conjugates of the present invention, for example one or more peptides in combination with one or more peptide conjugates to the subject.
In some embodiments, one or more peptides of the present invention and/or one or more peptide conjugates of the present invention, for example one or more peptides in combination with one or more peptide conjugates are used for vaccinating or eliciting an immune response in the subject or in the manufacture of a medicament for vaccinating or eliciting an immune response in the subject.
In some embodiment, two or more peptides, two or more peptide conjugates, or one or more peptides and one or more peptide conjugates are used or administered. In some embodiments the two or more peptides, two or more peptide conjugates, or one or more peptides and one or more peptide conjugates are used or administered simultaneously, sequentially, or separately.
Asymmetric centers may exist in the compounds described herein. The asymmetric centers may be designated as (R) or (S), depending on the configuration of substituents in three dimensional space at the chiral carbon atom. All stereochemical isomeric forms of the compounds, including diastereomeric, enantiomeric, and epimeric forms, as well as d-isomers and l-isomers, and mixtures thereof, including enantiomerically enriched and diastereomerically enriched mixtures of stereochemical isomers, are within the scope of the invention.
Individual enantiomers can be prepared synthetically from commercially available enantiopure starting materials or by preparing enantiomeric mixtures and resolving the mixture into individual enantiomers. Resolution methods include conversion of the enantiomeric mixture into a mixture of diastereomers and separation of the diastereomers by, for example, recrystallization or chromatography, and any other appropriate methods known in the art. Starting materials of defined stereochemistry may be commercially available or made and, if necessary, resolved by techniques well known in the art.
The compounds described herein may also exist as conformational or geometric isomers, including cis, trans, syn, anti, entgegen (E), and zusammen (Z) isomers. All such isomers and any mixtures thereof are within the scope of the invention.
Also within the scope of the invention are any tautomeric isomers or mixtures thereof of the compounds described. As would be appreciated by those skilled in the art, a wide variety of functional groups and other structures may exhibit tautomerism. Examples include, but are not limited to, keto/enol, imine/enamine, and thioketone/enethiol tautomerism.
The compounds described herein may also exist as isotopologues and isotopomers, wherein one or more atoms in the compounds are replaced with different isotopes. Suitable isotopes include, for example, 1H, 2H (D), 3H (T), 12C, 13C, 14C, 16O, and 18O. Procedures for incorporating such isotopes into the compounds described herein will be apparent to those skilled in the art. Isotopologues and isotopomers of the compounds described herein are also within the scope of the invention.
Also within the scope of the invention are pharmaceutically acceptable salts and solvates, including hydrates of the compounds described herein. Such salts include, acid addition salts, base addition salts, and quaternary salts of basic nitrogen-containing groups.
Acid addition salts can be prepared by reacting compounds, in free base form, with inorganic or organic acids. Examples of inorganic acids include, but are not limited to, hydrochloric, hydrobromic, nitric, sulfuric, and phosphoric acid. Examples of organic acids include, but are not limited to, acetic, trifluoroacetic, propionic, succinic, glycolic, lactic, malic, tartaric, citric, ascorbic, maleic, fumaric, pyruvic, aspartic, glutamic, stearic, salicylic, methanesulfonic, benzenesulfonic, isethionic, sulfanilic, adipic, butyric, and pivalic.
Base addition salts can be prepared by reacting compounds, in free acid form, with inorganic or organic bases. Examples of inorganic base addition salts include alkali metal salts, alkaline earth metal salts, and other physiologically acceptable metal salts, for example, aluminium, calcium, lithium, magnesium, potassium, sodium, or zinc salts. Examples of organic base addition salts include amine salts, for example, salts of trimethylamine, diethylamine, ethanolamine, diethanolamine, and ethylenediamine.
Quaternary salts of basic nitrogen-containing groups in the compounds may be may be prepared by, for example, reacting the compounds with alkyl halides such as methyl, ethyl, propyl, and butyl chlorides, bromides, and iodides, dialkyl sulfates such as dimethyl, diethyl, dibutyl, and diamyl sulfates, and the like.
The general chemical terms used in the formulae herein have their usual meaning.
The term “aliphatic” is intended to include saturated and unsaturated, nonaromatic, straight chain, branched, acyclic, and cyclic hydrocarbons. Those skilled in the art will appreciate that aliphatic groups include, for example, alkyl, alkenyl, alkynyl, cycloalkyl, and cycloalkenyl groups. In some embodiments, the aliphatic group is saturated.
The term “heteroaliphatic” is intended to include aliphatic groups, wherein one or more chain carbon atoms are replaced with a heteroatom. In some embodiments, the heteroaliphatic is saturated.
The term “alkyl” is intended to include saturated or unsaturated straight chain and branched chain hydrocarbon groups. Examples of saturated hydrocarbon groups include methyl, ethyl, n-propyl, isopropyl, n-butyl, t-butyl, isobutyl, sec-butyl, and the like. Unsaturated alkyl groups have one or more carbon-carbon double bonds or triple bonds. Examples of unsaturated alkyl groups include vinyl, prop-2-enyl, crotyl, isopent-2-enyl, 2-butadienyl, penta-2,4-dienyl, penta-1,4-dienyl, ethynyl, prop-3-ynyl, but-3-ynyl, and the like. In some embodiments, the alkyl is saturated.
The term “heteroalkyl” is intended to include alkyl groups, wherein one or more chain carbon atoms are replaced with a heteroatom. In some embodiments, the heteroalkyl is saturated.
The term “cycloalkyl” is intended to include non-aromatic cyclic alkyl groups. Examples of cycloalkyl groups include but are not limited to cyclopentyl, cyclohexyl, cyclohex-1-enyl, cyclohex-3-enyl, cycloheptyl. In some embodiments, the cycloalkyl is saturated.
The term “heteroatom” is intended to include oxygen, nitrogen, sulfur, or phosphorus. In some embodiments, the heteroatom is selected from the group consisting of oxygen, nitrogen, and sulfur.
The term “aryl” is intended to include aromatic radicals. Examples include, but are not limited to, phenyl, tolyl, naphthyl, indanyl, and the like. In some embodiments, aryl groups comprise from 4 to 8 or from 6 to 8 carbon atoms in the aromatic ring system.
As used herein, the term “substituted” is intended to mean that one or more hydrogen atoms in the group indicated is replaced with one or more independently selected suitable substituents, provided that the normal valency of each atom to which the substituent/s are attached is not exceeded, and that the substitution results in a stable compound.
Examples of optional substituents for aliphatic, heteroaliphatic, alkyl, heteroalkyl, and cycloalkyl groups in the compounds described herein include but are not limited to halo, CN, NO2, OH, NH2, NHR1, NR1R2, C1-6haloalkyl, C1-6haloalkoxy, C(O)NH2, C(O)NHR1, C(O)NR1R1, SO2R1, OR1, SR1, S(O)R1, C(O)R1, and C1-6aliphatic; wherein R1 and R2 are each independently C1-6alkyl.
The term “carboxyl protecting group” as used herein is means a group that is capable of readily removed to provide the OH group of a carboxyl group and protects the carboxyl group against undesirable reaction during synthetic procedures. Such protecting groups are described in Protective Groups in Organic Synthesis edited by T. W. Greene et al. (John Wiley & Sons, 1999) and ‘Amino Acid-Protecting Groups’ by Fernando Albericio (with Albert Isidro-Llobet and Mercedes Alvarez) Chemical Reviews 2009 (109) 2455-2504. Examples include, but are not limited to, alkyl and silyl groups, for example methyl, ethyl, tert-butyl, methoxymethyl, 2,2,2-trichloroethyl, benzyl, diphenylmethyl, trimethylsilyl, and tert-butyldimethylsilyl, and the like.
The term “amine protecting group” as used herein means a group that is capable of being readily removed to provide the NH2 group of an amine group and protects the amine group against undesirable reaction during synthetic procedures. Such protecting groups are described in Protective Groups in Organic Synthesis edited by T. W. Greene et al. (John Wiley & Sons, 1999) and ‘Amino Acid-Protecting Groups’ by Fernando Albericio (with Albert Isidro-Llobet and Mercedes Alvarez) Chemical Reviews 2009 (109) 2455-2504. Examples include, but are not limited to, acyl and acyloxy groups, for example acetyl, chloroacetyl, trichloroacetyl, o-nitrophenylacetyl, o-nitrophenoxy-acetyl, trifluoroacetyl, acetoacetyl, 4-chlorobutyryl, isobutyryl, picolinoyl, aminocaproyl, benzoyl, methoxy-carbonyl, 9-fluorenylmethoxycarbonyl, 2,2,2-trifluoroethoxycarbonyl, 2-trimethylsilylethoxy-carbonyl, tert-butyloxycarbonyl, benzyloxycarbonyl, p-nitrobenzyloxycarbonyl, 2,4-dichloro-benzyloxycarbonyl, and the like. Further examples include Cbz (carboxybenzyl), Nosyl (o- or p-nitrophenylsulfonyl), Bpoc (2-(4-biphenyl)isopropoxycarbonyl) and Dde (1-(4,4-dimethyl-2,6-dioxohexylidene)ethyl).
As used herein, the term “and/or” means “and”, or “or”, or both.
The term “(s)” following a noun contemplates the singular and plural form, or both.
The term “comprising” as used in this specification means “consisting at least in part of”.
When interpreting each statement in this specification that includes the term “comprising”, features other than that or those prefaced by the term may also be present. Related terms such as “comprise” and “comprises” are to be interpreted in the same manner. The “containing” is also to be interpreted in the same manner.
The invention may also be said broadly to consist in the parts, elements and features referred to or indicated in the specification of the application, individually or collectively, in any or all combinations of two or more of said parts, elements or features, and where specific integers are mentioned herein which have known equivalents in the art to which the invention relates, such known equivalents are deemed to be incorporated herein as if individually set forth.
It is intended that reference to a range of numbers disclosed herein (for example, 1 to 10) also incorporates reference to all rational numbers within that range (for example, 1, 1.1, 2, 3, 3.9, 4, 5, 6, 6.5, 7, 8, 9, and 10) and also any range of rational numbers within that range (for example, 2 to 8, 1.5 to 5.5, and 3.1 to 4.7) and, therefore, all sub-ranges of all ranges expressly disclosed herein are hereby expressly disclosed. These are only examples of what is specifically intended and all possible combinations of numerical values between the lowest value and the highest value enumerated are to be considered to be expressly stated in this application in a similar manner.
Although the present invention is broadly as defined above, those persons skilled in the art will appreciate that the invention is not limited thereto and that the invention also includes embodiments of which the following description gives examples.
The invention will be described with reference to the accompanying figures in which:
FIG. 1 is a series of graphs showing CD80 response of Pam3CSK4, 22, 20, and 26 across five donors. MFI: mean fluorescence intensity; UT: untreated; Pam3CSK4=Pam3Cys [comprises SEQ ID NO: 22]; 22=8 [comprises SEQ ID NO: 22]; 20=9 [comprises SEQ ID NO: 22]; 26=11 [comprises SEQ ID NO: 21].
FIGS. 2a and 2b are HPLC chromatograms at 210 nm of pure 25 (2a) [SEQ ID NO: 22] and 26 (2b) [comprises SEQ ID NO: 21].
FIG. 2c is an ESI-MS of the major peak of the HPLC chromatogram of 26 [comprises SEQ ID NO: 21].
FIG. 3 is a graph showing the results of the T cell activation assay using CMV pp65495-503 [SEQ ID NO: 27] constructs and the CD8+ T cell clone 4D9 with allogeneic HLA-A2+ MoDC as APC, as described herein in Example 4. 142, 131, and 110 each comprise SEQ ID NO: 27.
FIG. 4 is a graph showing the results of the T cell activation assay using NY-ESO-1153-180 [SEQ ID NO: 18] constructs and the CD8+ T cell clone 2F2 with autologous LCL as APC, as described herein in Example 5. 143 [SEQ ID NO: 18]. 144 [SEQ ID NO: 17]. 112, 111, and 132 each comprise SEQ ID NO: 24.
FIG. 5 is a graph showing the results of the T cell activation assay using NY-ESO-1153-180 [SEQ ID NO: 18] constructs and the CD8+ T cell clone 2F2 with allogeneic HLA-A2+ HLA-DP4+ MoDC as APC, as described herein in Example 5. 143 [SEQ ID NO: 18]. 144 [SEQ ID NO: 17]. 112, 111, and 132 each comprise SEQ ID NO: 24.
FIG. 6 is a graph showing the results of the T cell activation assay using NY-ESO-1153-180 [SEQ ID NO: 18] constructs and the CD4+ T cell clone 1B7 with autologous LCL as APC, as described herein in Example 6. 143 [SEQ ID NO: 18]. 144 [SEQ ID NO: 17]. 112, 111, and 132 each comprise SEQ ID NO: 24.
FIG. 7 is a graph showing the results of the T cell activation assay using NY-ESO-1153-180 [SEQ ID NO: 18] constructs and the CD4+ T cell clone 1B7 with allogeneic HLA-A2+HLA-DP4+ MoDC as APC, as described herein in Example 6. 143 [SEQ ID NO: 18]. 144 [SEQ ID NO: 17]. 112, 111, and 132 each comprise SEQ ID NO: 24.
FIG. 8 is a graph showing the results of the T cell activation assay using NY-ESO-1153-180 [SEQ ID NO: 18] constructs and the CD4+ T cell clone 1C11 with allogeneic HLA-A2+ HLA-DP4+ MoDC as APC, as described herein in Example 6. 143 [SEQ ID NO: 18]. 144 [SEQ ID NO: 17]. 112, 111, and 132 each comprise SEQ ID NO: 24.
FIG. 9 is a graph showing the results of the T cell activation assay using NY-ESO-179-116 [SEQ ID NO: 5] constructs and the CD8+ T cell clone 1D7 with autologous LCL as APC, as described herein in Example 7. 145 [SEQ ID NO: 5]. 114 and 113 each comprise SEQ ID NO: 25.
FIG. 10 is a graph showing the results of the T cell activation assay using NY-ESO-179-116 [SEQ ID NO: 5] constructs and the CD8+ T cell clone 1F10 with autologous LCL as APC, as described herein in Example 7. 145 [SEQ ID NO: 5]. 114 and 113 each comprise SEQ ID NO: 25.
FIG. 11 is a graph showing the results of the T cell activation assay using NY-ESO-1118-143 [SEQ ID NO: 12] constructs and the CD8+ T cell clone 1C11 with autologous LCL as APC, as described herein in Example 8. 147 [SEQ ID NO: 12]. 116 and 115 each comprise SEQ ID NO: 26.
FIG. 12 is a graph showing the results of the T cell activation assay using NY-ESO-1118-143 [SEQ ID NO: 12] constructs and the CD4+ T cell clone 1E4 with autologous LCL as APC, as described herein in Example 9. 147 [SEQ ID NO: 12]. 116 and 115 each comprise SEQ ID NO: 26.
FIG. 13 is a graph showing the results of the T cell activation assay using NY-ESO-1118-143 [SEQ ID NO: 12] constructs and the CD4+ T cell clone 1D6 with autologous LCL as APC, as described herein in Example 9. 147 [SEQ ID NO: 12]. 116 and 115 each comprise SEQ ID NO: 26.
FIG. 14 is a graph showing the results of the TLR agonism assay using the NY-ESO-1 constructs and HekBlue™, as described herein in Example 10. 142, 131, and 110 each comprise SEQ ID NO: 27. 144 [SEQ ID NO: 17]. 112, 111, and 132 each comprise SEQ ID NO: 24. 114 and 113 each comprise SEQ ID NO: 25. 116 and 115 each comprise SEQ ID NO: 26.
FIG. 15 is four graphs showing the results of the TLR agonism using the NY-ESO-1 constructs and the IL-8 assay, as described herein in Example 10. 131 and 110 each comprise SEQ ID NO: 27. 112, 111, and 132 each comprise SEQ ID NO: 24. 114 and 113 each comprise SEQ ID NO: 25. 116 and 115 each comprise SEQ ID NO: 26.
The present invention relates to a method of making amino acid and peptide conjugates. The method comprises reacting an lipid-containing conjugation partner and an amino acid comprising conjugation partner under conditions effective to conjugate the lipid-containing conjugation partner to the amino acid-comprising conjugation partner in a thiol-ene reaction. In some embodiments, the method comprises reacting an lipid-containing conjugation partner and a peptide-containing conjugation partner under conditions effective to conjugate the lipid-containing conjugation partner to the peptide of the peptide-containing conjugation partner in a thiol-ene reaction.
The thiol-ene reaction involves the addition of a thiol across a non-aromatic carbon-carbon double bond (i.e. hydrothiolation of the carbon-carbon double bond). The reaction proceeds via a free radical mechanism. There are three distinct phases in the reaction: initiation, polymerisation or coupling, and termination. Radical generation gives rise to an electrophilic thiyl radical which propagates across the ene group, forming a carbon-centred radical. Chain transfer from an additional thiol molecule then quenches the radical on carbon to give the final product.
In the method the present invention, one conjugation partner comprises the thiol and the other comprises the carbon carbon double bond.
One or more free radicals may be generated in the method of the present invention by any method known in the art. The free radicals may be generated thermally and/or photochemically. One or more free radical initiators may be used to initiate the generation of free radicals. Suitable free radical initiators include thermal initiators and photoinitiators.
Free radicals are generated from thermal initiators by heating. The rate of degradation of the thermal initiator and resulting free radical formation depends on the initiator and the temperature at which the initiator is heated. Higher temperatures generally result in faster decomposition. A person skilled in the art will be able to select an appropriate temperature for heating the initiator without undue experimentation.
Numerous thermal initiators are commercially available. Examples of thermal initiators include but are not limited to tert-amyl peroxybenzoate, 1,1′-azobis(cyclohexanecarbonitrile), 2,2′-azobisisobutyronitrile (AIBN), benzoyl peroxide, tert-butyl hydroperoxide, tert-butyl peracetate, tert-butyl peroxide, tert-butyl peroxybenzoate, tert-butylperoxy isopropyl carbonate, lauroyl peroxide, peracetic acid, and potassium persulfate.
Free radicals may be generated from photoinitiators by irradiation with light. The frequency of light necessary to induce degradation of the photoinitiators and free radical formation depends on the initiator. Many photoinitiators can be initiated with ultraviolet light.
Light of a specific wavelength or wavelength range may be used to selectively irradiate the initiator, where the lipid-containing conjugation partner or amino acid-comprising conjugation partner, for example a peptide-containing conjugation partner, comprises photosensitive groups. In certain embodiments of the method of the present invention, a frequency of about 365 nm is used. Light of this frequency is generally compatible with the side chains of naturally occurring amino acids.
A wide range of photoinitiators are commercially available. Examples of photoinitiators include but are not limited to acetophenone, anisoin, anthraquinone, anthraquinone-2-sulfonic acid, benzil, benzoin, benzoin ethyl ether, benzoin isobutyl ether, benzoin methyl ether, benzophenone, 3,3′,4,4′-benzophenonetetracarboxylic dianhydride, 4-benzoylbiphenyl, 2-benzyl-2-(dimethylamino)-4′-morpholinobutyrophenone, 4′-bis(diethylamino)benzophenone, 4,4′-bis(dimethyla mino)benzophenone, camphorquinone, 2-chlorothioxanthen-9-one, dibenzosuberenone, 2,2-diethoxyacetophenone, 4,4′-dihydroxybenzophenone, 2,2-dimethoxy-2-phenylacetophenone (DMPA), 4-(dimethylamino)benzophenone, 4,4′-dimethylbenzil, 2,5-dimethylbenzophenone, 3,4-dimethylbenzophenone, 4′-ethoxyacetophenone, 2-ethylanthraquinone, 3′-hydroxyacetophenone, 4′-hydroxyacetophenone, 3-hydroxybenzophenone, 4-hydroxybenzophenone, 1-hydroxycyclohexyl phenyl ketone, 2-hydroxy-2-methylpropiophenone, 2-methylbenzophenone, 3-methylbenzophenone, methybenzoylformate, 2-methyl-4′-(methylthio)-2-morpholinopropiophenone, phenanthrenequinone, 4′-phenoxyacetophenone, and thioxanthen-9-one.
A person skilled in the art will be able to select appropriate free radical initiators for use in the method having regard to, for example, the nature of the lipid-containing conjugation partner, amino acid-comprising conjugation partner, for example a peptide-containing conjugation partner, and any other components present in the reaction mixture. In some embodiments, the initiator is present in the reaction in a stoichiometric ratio relative to the starting material comprising the thiol of from about 20:1 to about 0.05:1, from about 10:1 to about 0.05:1, from about 5:1 to about 0.05:1, from about 3:1 to about 0.5:1.
The lipid-containing conjugation partner and amino acid-comprising conjugation partner, for example a peptide-containing conjugation partner, in the reaction are as defined in any of the embodiments described herein.
The lipid-containing conjugation partner and amino acid-comprising conjugation partner, for example a peptide-containing conjugation partner, may be prepared using known synthetic chemistry techniques (for example, the methods generally described in Louis F Fieser and Mary F, Reagents for Organic Synthesis v. 1-19, Wiley, New York (1967-1999 ed.) or Beilsteins Handbuch der organischen Chemie, 4, Aufl. Ed. Springer-Verlag Berlin, including supplements (also available via the Beilstein online database)) or, in some embodiments, may be commercially available.
Lipid-containing conjugation partner compounds of the formula (II)
wherein m, R1, R2, R3, R4, R5, and L1 are each independently as defined in any of the embodiments described for the compound of formula (I) may be prepared by reacting a compound of the formula (VI)
L1-C(O)—X (VI)
wherein X is OH or a suitable leaving group with a compound of the formula (VII):
under conditions effective for esterification. Methods for esterification are well known in the art. For example, when X is chloro, the reaction may be carried out in the presence of a base, such as pyridine or triethylamine, in a suitable solvent. The acid chloride may be converted in situ to a more reactive species (e.g. to the corresponding iodide, using sodium iodide). The temperature at which the reaction is carried out depends on the reactivity of the acid species and the solvent used.
Numerous compounds of formula (VI) are commercially available. Others may be prepared using standard synthetic chemistry techniques from commercially available precursors. For example, compounds of formula (VI) wherein X is chloro may be prepared treating the corresponding carboxylic acid with thionyl chloride in a suitable solvent or mixture of solvents.
Lipid containing conjugation partner compounds of the formula (IIA)
wherein p, R11, R22, R33, R44, and L1 are as defined in the compound of formula (IA) may be prepared by reacting a compound of the formula (VI) as defined above with a compound of the formula (VIII):
wherein P is a suitable protecting group under conditions effective for esterification, and then removing the protecting group.
Alternatively, compounds of the formula (IIA) may be prepared by reacting a compound of the formula (VI) as defined above with a compound of the formula (IX):
wherein P is a suitable protecting group under conditions effective for esterification, removing the protecting group, and then converting the corresponding alcohol to a thiol. Suitable methods for converting the alcohol to a thiol will be apparent to those skilled in the art.
Preparation of the compounds may involve the protection and deprotection of various chemical groups. The need for protection and deprotection, and the selection of appropriate protecting groups, can be readily determined by a person skilled in the art. Protecting groups and methods for protection and deprotection are well known in the art (see e.g. T. W. Greene and P. G. M. Wuts, Protective Groups in Organic Synthesis, 34 Ed., Wiley & Sons, Inc., New York (1999)).
Similarly, compounds of formula (VII), (VIII), and (IX) are also commercially available or may be prepared from commercially available precursors using standard synthetic chemistry techniques.
The order in which the lipid-containing conjugation partner and amino acid-comprising conjugation partner, for example a peptide-containing conjugation partner, and any other components present in the reaction mixture are introduced into the reaction vessel may vary. The reaction may be carried out as a one-pot procedure.
The stoichiometry of the lipid-containing conjugation partner and amino acid-comprising conjugation partner, for example a peptide-containing conjugation partner, in the reaction may vary. In some embodiments, the stoichiometric ratio of amino acid-comprising conjugation partner to lipid-containing conjugation partner is from about 1:0.5 to about 1:20, from about 1:1 to about 1:10, from about 1:1 to about 1:5, from about 1:1 to about 1:3. In some embodiments, the stoichiometric ratio of peptide-containing conjugation partner to lipid-containing conjugation partner is from about 1:0.5 to about 1:20, from about 1:1 to about 1:10, from about 1:1 to about 1:5, from about 1:1 to about 1:3.
The reaction may be carried out at any suitable temperature. In some embodiments, the reaction is carried out at a temperature from about −25° C. to about 200° C., from about −10° C. to about 150° C., from about 0° C. to about 125° C., from about ambient temperature to about 100° C. In some embodiments, the reaction is carried out at a temperature of less than about 200° C., less than about 175° C., less than about 150° C., less than about 125° C., or less than about 100° C.
In some embodiments, the reaction is carried out at a temperature above ambient temperature. In one embodiment, the reaction is carried out at a temperature from 40 to 200° C., from 50 to 150° C., from 60 to 100° C., from 65 to 90° C., or from 70 to 80° C. In some embodiments, the reaction is carried out at a temperature greater than 40 OC, greater than 50° C., greater than 75° C., greater than 100 OC, or greater than 150 OC.
The temperature at which the reaction is carried out may depend on how free radicals are generated in the reaction. The temperature used may be selected to control the rate of the reaction. The temperature may be adjusted during the course of the reaction to control the rate of the reaction. By controlling the rate of the reaction it may be possible to minimise or obviate the formation of undesirable by products (e.g. telomerisation or polymerisation products).
If free radicals are generated thermally (e.g. using a thermal initiator), the reaction will generally be carried out at a temperature above ambient temperature. The temperature will depend on the reactivity of the species from which free radicals are generated.
If free radicals are generated photochemically the reaction may be carried out, advantageously, at ambient temperature. In certain embodiments, it may be desirable to cool the reaction mixture to slow the rate of reaction or conversely heat the reaction mixture to increase the rate of reaction.
A person skilled in the art will be able to select appropriate temperatures for carrying out the method having regard to the reactivity of the lipid-containing conjugation partner, amino acid-comprising conjugation partner, for example a peptide-containing conjugation partner, and free radical initiator if used.
The temperature at which the reaction is carried out may be controlled by heating or cooling the reaction mixture. The temperature of the reaction mixture may be controlled by suitable method known in the art. Heat may be applied to the reaction mixture, for example, using a heat exchanger within the reaction vessel, a heating jacket surrounding the reaction vessel, or by immersing the reaction vessel in a heated liquid (e.g. an oil or sand bath). In certain exemplary embodiments, the reaction mixture is heated by microwave irradiation.
The progress of the reaction may be monitored by any suitable means, for example, by thin layer chromatography (TLC) or high performance liquid chromatography (HPLC). The reaction may be allowed to proceed to substantial completion, as monitored by the consumption of at least one of the starting materials. In some embodiments, the reaction is allowed to proceed for a period of time from 1 minute to 7 days, 5 minutes to 72 hours, 10 minutes to 48 hours, 10 minutes to 24 hours. In other embodiments, the reaction is allowed to proceed for a period of time less than 72 h, less than 48 h, less than 24 h, less than 12 h, less than 6 h, less than 4 h, less than 2 h, or less than 1 h.
In some embodiments, the reaction is carried out until at least about 50%, at least about 60%0, at least about 70%0, at least about 75%0, at least about 80%0, at least about 850%, at least about 90%0, at least about 95%0, at least about 97%0, at least about 99%0 of the lipid-containing conjugation partner or amino acid-comprising conjugation partner, whichever is stoichiometrically less, has been consumed. In some embodiments, the reaction is carried out until at least about 50%, at least about 60%, at least about 70%, at least about 75%, at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 97%, at least about 99% of the lipid-containing conjugation partner or peptide-containing conjugation partner, whichever is stoichiometrically less, has been consumed. The consumption of starting materials may be monitored by any suitable method, for example, HPLC.
The reaction mixture may be mixed by any suitable method known in the art, for example, using a magnetic or mechanical stirrer. The method used may depend on the scale on which the reaction is carried out.
The reaction is generally carried out in a liquid reaction medium. The liquid reaction medium may comprise a solvent. Examples of suitable solvents include dimethylformamide, dichloromethane, 1,2-dichloroethane, chloroform, carbon tetrachloride, water, methanol, ethanol, dimethylsulfoxide, trifluoroacetic acid, acetic acid, acetonitrile, and mixtures thereof.
The solvent may be selected based on the solubility of the lipid-containing conjugation partner and amino acid-comprising conjugation partner, for example a peptide-containing conjugation partner, in the solvent. The solubility of the free radical initiator may also be relevant. In some embodiments, the lipid-containing conjugation partner is hydrophobic. The hydrophobicity or hydrophilicity of an amino acid-comprising conjugation partner, for example a peptide-containing conjugation partner, may vary depending on, for example, amino acid sequence of the peptide of a peptide-containing conjugation partner. The presence of a solubilising group in the peptide-containing conjugation partner may increase solubility in polar solvents, such as water. A person skilled in the art will be able to select an appropriate solvent without undue experimentation.
The reaction may be carried out under substantially oxygen-free conditions. Oxygen may quench free radicals formed in the reaction. The reaction mixture may be degassed with an inert gas (e.g. nitrogen or argon) that is substantially oxygen-free to remove any dissolved oxygen before free radicals are generated. Alternatively, individual components of the reaction mixture may be degassed with inert gas that is substantially oxygen-free prior to being combined in the reaction vessel. The reaction may be carried out under an atmosphere of inert gas that is substantially oxygen-free.
The method of the present invention may be carried out at ambient pressure.
If the rate of chain transfer relative to propagation in the thiol-ene reaction is slow, undesirable dimerisation, telomerisation, or polymerisation may occur.
An additive that inhibits dimerisation, telomerisation, or polymerisation may be included in the reaction mixture in the method of the present invention. The inventors have found that in some embodiments the inclusion of an extraneous thiol that facilitates chain transfer as an additive in the reaction mixture reduces the formation of undesirable by products. The extraneous thiol may, in some embodiments, increase the efficiency of the desired thiol ene reaction. Examples of suitable extraneous thiols include but are not limited to reduced glutathione, DODT, DTT, protein, and the like. The inventors have found that in some embodiments the inclusion of DTT resulted in no undesirable by products.
In certain embodiments, the extraneous thiol is a sterically hindered thiol. Non-limiting examples of a suitable sterically hindered extraneous thiol include tert-butyl mercaptan and 1-methylpropyl mercaptan.
The inclusion of an acid in some embodiments may also inhibit dimerisation, telomerisation, or polymerisation. The acid may be a strong inorganic acid, for example HCl, or organic acid, for example TFA. In certain embodiments, the additive is TFA.
The inventors have found that in some embodiments including both tert-butyl mercaptan and TFA as additives in the reaction mixture can reduce the the formation of oligomers, and increase the conversion of starting material to the desired product. Accordingly, in certain exemplary embodiments, the reaction mixture comprises a combination of TFA and tert-butyl mercaptan.
The additive is generally used in an amount sufficient to minimise the formation of undesirable by products without adversely affecting the reaction or any, optional, subsequent steps in the method. In some embodiments, the additive is present in the reaction a stoichiometric ratio relative to the starting material comprising the thiol of from about 20:1 to about 0.05:1, from about 10:1 to about 0.5:1, from about 5:1 to about 1:1, from about 3:1 to about 1:1.
In some embodiments, less than about 50%, less than about 40%, less than about 30%, less than about 25%, less than about 20%, less than about 15%, less than about 10%, less than about 5%, less than about 3%, or less than about 1% by weight of the lipid-containing conjugation partner and amino acid-comprising conjugation partner starting materials used in the reaction are undesirable by products resulting from dimerisation, telomerisation, or polymerisation. In some embodiments, less than about 50%, less than about 40%, less than about 30%, less than about 25%, less than about 20%, less than about 15%, less than about 10%, less than about 5%, less than about 3%, or less than about 1% by weight of the lipid-containing conjugation partner and peptide-containing conjugation partner starting materials used in the reaction are undesirable by products resulting from dimerisation, telomerisation, or polymerisation. The purity of the products of the reaction may be determined by, for example, HPLC.
The concentration of the lipid-containing conjugation partner and amino acid-comprising conjugation partner, for example a peptide-containing conjugation partner, respectively, in the reaction mixture may also affect the reaction. Those skilled in the art will be able to vary the concentration of the lipid-containing conjugation partner and peptide-containing conjugation partner in the reaction mixture to e.g. optimise yield and purity without undue experimentation.
In some embodiments, the starting material comprising the thiol is present in a concentration from about 0.05 mM to about 1 M, from about 0.5 mM to about 1 M, from about 1 mM to about 1 M. In some embodiments, the concentration is at least about 0.05 mM, 0.5 mM, or 1 mM.
In some embodiments, the concentration of the starting material comprising the alkene is at least about 0.05 mM, 0.5 mM, or 1 mM.
In some embodiments, the amino acid conjugate or peptide conjugate may be separated from the reaction medium after the reaction and optionally purified. In some embodiments, the peptide conjugate may be separated from the reaction medium after the reaction and optionally purified. The conjugate may be separated from the reaction medium using any suitable method known in the art, for example, by precipitation.
In some embodiments, the amino acid or peptide conjugate is purified after separating it from the reaction medium. In some embodiments, the peptide conjugate is purified after separating it from the reaction medium. In specifically contemplated embodiments, the conjugate is purified by HPLC using one or more suitable solvents.
The peptide conjugate produced by and/or the peptide-containing conjugation partner in the method of the present invention may comprise a synthetic peptide. Synthetic peptides may be prepared using solid phase peptide synthesis (SPPS).
The basic principle for solid phase peptide synthesis (SPPS) is a stepwise addition of amino acids to a growing polypeptide chain anchored via a linker molecule to a solid phase support, typically a resin particle, which allows for cleavage and purification once the polypeptide chain is complete. Briefly, a solid phase resin support and a starting amino acid are attached to one another via a linker molecule. Such resin-linker-acid matrices are commercially available.
The amino acid to be coupled to the resin is protected at its No-terminus by a chemical protecting group.
The amino acid may also have a side-chain protecting group. Such protecting groups prevent undesired or deleterious reactions from taking place during the process of forming the new peptide bond between the carboxyl group of the amino acid to be coupled and the unprotected Na-amino group of the peptide chain attached to the resin.
The amino acid to be coupled is reacted with the unprotected Na-amino group of the N-terminal amino acid of the peptide chain, increasing the chain length of the peptide chain by one amino acid. The carboxyl group of the amino acid to be coupled may be activated with a suitable chemical activating agent to promote reaction with the Na-amino group of the peptide chain. The Na-protecting group of N-terminal amino acid of the peptide chain is then removed in preparation for coupling with the next amino acid residue. This technique consists of many repetitive steps making automation attractive whenever possible. Those skilled in the art will appreciate that peptides may be coupled to the Na-amino group of the solid phase bound amino acid or peptide instead of an individual amino acid, for example where a convergent peptide synthesis is desired.
When the desired sequence of amino acids is achieved, the peptide is cleaved from the solid phase support at the linker molecule.
SPPS may be carried out using a continuous flow method or a batch flow method. Continuous flow permits real-time monitoring of reaction progress via a spectrophotometer, but has two distinct disadvantages—the reagents in contact with the peptide on the resin are diluted, and scale is more limited due to physical size constraints of the solid phase resin. Batch flow occurs in a filter reaction vessel and is useful because reactants are accessible and can be added manually or automatically.
The types of protecting groups are commonly used for protecting the N-alpha-amino terminus: “Boc” (tert-butyloxycarbonyl) and “Fmoc” (9-fluorenylmethyloxycarbonyl). Reagents for the Boc method are relatively inexpensive, but they are highly corrosive and require expensive equipment and more rigorous precautions to be taken. The Fmoc method, which uses less corrosive, although more expensive, reagents is typically preferred.
For SPPS, a wide variety of solid support phases are available. The solid phase support used for synthesis can be a synthetic resin, a synthetic polymer film or a silicon or silicate surface (e.g. controlled pore glass) suitable for synthesis purposes. Generally, a resin is used, commonly polystyrene suspensions, or polystyrene-polyethyleneglycol, or polymer supports for example polyamide. Examples of resins functionalized with linkers suitable for Boc-chemistry include PAM resin, oxime resin SS, phenol resin, brominated Wang resin and brominated PPOA resin. Examples of resins suitable for Fmoc chemistry include AMPB-BHA resin, Sieber amide resin, Rink acid resin, Tentagel S AC resin, 2-chlorotrityl chloride resin, 2-chlorotrityl alcohol resin, TentaGel S Trt-OH resin, Knorr-2-chlorotrityl resin, hydrazine-2-chlorotrityl resin, ANP resin, Fmoc photolable resin, HMBA-MBHA resin, TentaGel S HMB resin, Aromatic Safety Catch resinBAl resin and Fmoc-hydroxylamine 2 chlorotrityl resin. Other resins include PL Cl-Trt resin, PL-Oxime resin and PL-HMBA Resin.
For each resin appropriate coupling conditions are known in the literature for the attachment of the starting monomer or sub-unit.
Preparation of the solid phase support includes solvating the support in an appropriate solvent (e.g. dimethylformamide). The solid phase typically increases in volume during solvation, which in turn increases the surface area available to carry out peptide synthesis.
A linker molecule is then attached to the support for connecting the peptide chain to the solid phase support. Linker molecules are generally designed such that eventual cleavage provides either a free acid or amide at the C-terminus. Linkers are generally not resin-specific. Examples of linkers include peptide acids for example 4-hydroxymethylphenoxyacetyl-4′-methylbenzyhydrylamine (HMP), or peptide amides for example benzhydrylamine derivatives.
The first amino acid of the peptide sequence may be attached to the linker after the linker is attached to the solid phase support or attached to the solid phase support using a linker that includes the first amino acid of the peptide sequence. Linkers that include amino acids are commercially available.
The next step is to deprotect the Na-amino group of the first amino acid. For Fmoc SPPS, deprotection of the Na-amino group may be carried out with a mild base treatment (piperazine or piperidine, for example). Side-chain protecting groups may be removed by moderate acidolysis (trifluoroacetic acid (TFA), for example). For Boc SPPS, deprotection of the Na-amino group may be carried out using for example TFA.
Following deprotection, the amino acid chain extension, or coupling, proceeds by the formation of peptide bonds. This process requires activation of the C-α-carboxyl group of the amino acid to be coupled. This may be accomplished using, for example, in situ reagents, preformed symmetrical anhydrides, active esters, acid halides, or urethane-protected N-carboxyanhydrides. The in situ method allows concurrent activation and coupling. Coupling reagents include carbodiimide derivatives, for example N,N′-dicyclohexylcarbodiimide or N,N-diisopropylcarbodiimide. Coupling reagents also include uronium or phosphonium salt derivatives of benzotriazol. Examples of such uronium and phosphonium salts include HBTU (O-1H-benzotriazole-1-yl)-N,N,N′,N′-tetramethyluronium hexafluorophosphate), BOP (benzotriazole-1-yl-oxy-tris-(dimethylamino)-phosphonium hexafluorophosphate), PyBOP (Benzotriazole-1-yl-oxy-tripyrrolidinophosphonium hexafluorophosphate), PyAOP, HCTU (O-(1H-6-chloro-benzotriazole-1-yl)-1,1,3,3-tetramethyluronium hexafluorophosphate), TCTU (O-1H-6-chlorobenzotriazole-1-yl)-1,1,3,3-tetramethyluronium tetrafluoroborate), HATU (O-(7-azabenzotriazol-1-yl)-1,1,3,3-tetramethyluronium hexafluorophosphate), TATU (O-(7-azabenzotriazol-1-yl)-1,1,3,3-tetramethyluronium tetrafluoroborate), TOTU (O-[cyano(ethoxycarbonyl)methyleneamino]-N,N,N′,N″-tetramethyluronium tetrafluoroborate), and HAPyU (O-(benzotriazol-1-yl)oxybis-(pyrrolidino)-uronium hexafluorophosphate. In some embodiments, the coupling reagent is HBTU, HATU, BOP, or PyBOP.
After the desired amino acid sequence has been synthesized, the peptide is cleaved from the resin. The conditions used in this process depend on the sensitivity of the amino acid composition of the peptide and the side-chain protecting groups. Generally, cleavage is carried out in an environment containing a plurality of scavenging agents to quench the reactive carbonium ions that originate from the protective groups and linkers. Common cleaving agents include, for example, TFA and hydrogen fluoride (HF). In some embodiments, where the peptide is bound to the solid phase support via a linker, the peptide chain is cleaved from the solid phase support by cleaving the peptide from the linker.
The conditions used for cleaving the peptide from the resin may concomitantly remove one or more side-chain protecting groups.
The use of protective groups in SPPS is well established. Examples of common protective groups include but are not limited to acetamidomethyl (Acm), acetyl (Ac), adamantyloxy (AdaO), benzoyl (Bz), benzyl (Bzl), 2-bromobenzyl, benzyloxy (BzlO), benzyloxycarbonyl (Z), benzyloxymethyl (Bom), 2-bromobenzyloxycarbonyl (2-Br-Z), tert-butoxy (tBuO), tert-butoxycarbonyl (Boc), tert-butoxymethyl (Bum), tert-butyl (tBu), tert-buthylthio (tButhio), 2-chlorobenzyloxycarbonyl (2-Cl-Z), cyclohexyloxy (cHxO), 2,6-dichlorobenzyl (2,6-DiCl-Bzl), 4,4′-dimethoxybenzhydryl (Mbh), 1-(4,4-dimethyl-2,6-dioxo-cyclohexylidene)3-methyl-butyl (ivDde), 4-{N-[1-(4,4-dimethyl-2,6-dioxo-cyclohexylidene)3-methylbutyl]-amino) benzyloxy (ODmab), 2,4-dinitrophenyl (Dnp), fluorenylmethoxycarbonyl (Fmoc), formyl (For), mesitylene-2-sulfonyl (Mts), 4-methoxybenzyl (MeOBzl), 4-methoxy-2,3,6-trimethyl-benzenesulfonyl (Mtr), 4-methoxytrityl (Mmt), 4-methylbenzyl (MeBzl), 4-methyltrityl (Mtt), 3-nitro-2-pyridinesulfenyl (Npys), 2,2,4,6,7-pentamethyldihydrobenzofurane-5-sulfonyl (Pbf), 2,2,5,7,8-pentamethyl-chromane-6-sulfonyl (Pmc), tosyl (Tos), trifluoroacetyl (Tfa), trimethylacetamidomethyl (Tacm), trityl (Trt) and xanthyl (Xan).
Where one or more of the side chains of the amino acids of the peptide contains functional groups, such as for example additional carboxylic, amino, hydroxy or thiol groups, additional protective groups may be necessary. For example, if the Fmoc strategy is used, Mtr, Pmc, Pbf may be used for the protection of Arg; Trt, Tmob may be used for the protection of Asn and Gin; Boc may be used for the protection of Trp and Lys; tBu may be used for the protection of Asp, Glu, Ser, Thr and Tyr; and Acm, tBu, tButhio, Trt and Mmt may be used for the protection of Cys. A person skilled in the art will appreciate that there are numerous other suitable combinations.
The methods for SPPS outlined above are well known in the art. See, for example, Atherton and Sheppard, “Solid Phase Peptide Synthesis: A Practical Approach,” New York: IRL Press, 1989; Stewart and Young: “Solid-Phase Peptide Synthesis 2nd Ed.,” Rockford, Ill.: Pierce Chemical Co., 1984; Jones, “The Chemical Synthesis of Peptides,” Oxford: Clarendon Press, 1994; Merrifield, J. Am. Soc. 85:2146-2149 (1963); Marglin, A. and Merrifield, R. B. Annu. Rev. Biochem. 39:841-66 (1970); and Merrifield R. B. JAMA. 210(7):1247-54 (1969); and “Solid Phase Peptide Synthesis—A Practical Approach” (W. C. Chan and P. D. White, eds. Oxford University Press, 2000). Equipment for automated synthesis of peptides or polypeptides is readily commercially available from suppliers such as Perkin Elmer/Applied Biosystems (Foster City, Calif.) and may be operated according to the manufacturer's instructions.
Following cleavage from the resin, the peptide may be separated from the reaction medium, e.g. by centrifugation or filtration. The peptide may then be subsequently purified, e.g. by HPLC using one or more suitable solvents.
Advantageously, the inventors have found that in some embodiments the peptide-containing conjugation partner may be used in the method of the present invention without purification following cleavage of the peptide from the resin.
The inventors have also advantageously found that the method of the present invention can be carried out using a peptide-containing conjugation partner, wherein the peptide does not contain an No-amino group protecting group or any side chain protecting groups. The reaction is generally selective for reaction of a thiol and a non-aromatic carbon-carbon double bond.
It may be necessary to protect thiol groups present in the peptide-containing conjugation partner (e.g. in cysteine residues of the peptide) with a protective group to prevent undesirable competing reactions in the method of the present invention. The thiol groups may be protected with a protective group that is not removable under the conditions used to remove one or more other protecting groups present in the peptide or to cleave the peptide from the resin. Typically, the peptide will be synthesised using amino acids bearing the appropriate protecting groups. A person skilled in the art will be able to select appropriate protecting groups without undue experimentation.
In certain embodiments, the amino acid-comprising conjugation partner and lipid-containing conjugation partner comprise one or more unsaturated carbon-carbon bonds in addition to the carbon-carbon double bond to be reacted. In certain embodiments, the peptide-containing conjugation partner and lipid-containing conjugation partner comprise one or more unsaturated carbon-carbon bonds in addition to the carbon-carbon double bond to be reacted. Those skilled in the art will appreciate that the selectivity of the thiol for the carbon-carbon double bond to be reacted in such embodiments may depend on, for example, the steric and/or electronic environment of the carbon-carbon double bond relative to the one or more unsaturated carbon-carbon bonds. In certain embodiments, the carbon-carbon double bond to be reacted is activated relative to any other unsaturated carbon-carbon bonds in the amino acid-comprising conjugation partner and lipid-containing conjugation partner. In certain embodiments, the carbon-carbon double bond to be reacted is activated relative to any other unsaturated carbon-carbon bonds in the peptide-containing conjugation partner and lipid-containing conjugation partner.
In some embodiments, the No-amino group of the amino acid of the amino acid-comprising conjugation partner comprising the carbon-carbon double bond or thiol is acylated, for example acetylated. In some embodiments, the method of the present invention may comprise acylating, for example acetylating, the No-amino group of the amino acid of the amino acid-comprising conjugation partner comprising the carbon-carbon double bond or thiol to be reacted.
Where a peptide-containing conjugation partner has been synthesised by SPPS, acylation may be carried out prior to or after cleavage from the resin. In some embodiments, the amino acid residue of the peptide-containing conjugation partner bearing the carbon-carbon double bond or thiol to be reacted is an N-terminal amino acid residue, and the method comprises acylating the N-terminal amino group prior to cleaving the peptide.
In some embodiments, the method further comprises acylating the No-amino group of the amino acid of the amino acid conjugate or the amino acid residue of the peptide conjugate to which the lipid-containing conjugation partner is conjugated.
Acylation of the No-amino group of an amino acid may be carried out by reacting an amino acid or peptide with an acylating agent in the presence of base in a suitable solvent, for example DMF. Non-limiting examples of acylating agents include acid halides, for example acid chlorides such as acetyl chloride, and acid anhydrides, for example acetic anhydride. Such agents maybe commercially available or may be prepared by methods well known in the art. Non-limiting examples of suitable bases include triethylamine, diisopropylethylamine, 4-methylmorpholine, and the like.
In other embodiments, the synthesising the peptide of the peptide-containing conjugation partner comprises coupling an amino acid or a peptide comprising an amino acid that is acylated at the Na-amino group and comprises the carbon-carbon double bond or thiol to be reacted to one or more amino acids and/or one or more peptides.
In some embodiments, the method comprises coupling the amino acid of the amino acid conjugate to an amino acid or a peptide to provide a peptide conjugate. In some embodiments, the method comprises coupling the amino acid of the amino acid conjugate to an amino acid or peptide bound to a solid phase resin support by SPPS. In some embodiments, the method comprises coupling the amino acid of the amino acid conjugate to a peptide bound to a solid phase resin support by SPPS. The method may comprise synthesising the peptide bound to the solid phase resin support by SPPS.
In some embodiments, the method further comprises coupling the amino acid of the amino acid conjugate or an amino acid of the peptide conjugate to an amino acid or a peptide so as to provide a peptide conjugate comprising a peptide epitope. In some embodiments, the peptide to be coupled comprises a peptide epitope. In other embodiments, a peptide epitope is formed on coupling. The coupling may be carried out by SPPS as described herein.
In some embodiments, the method comprises coupling the amino acid of the amino acid conjugate to a peptide bound to a solid phase resin support by SPPS so as to provide a peptide conjugate comprising a peptide epitope.
In one embodiment, the peptide of the peptide conjugate to be coupled is bound to a solid phase resin support, and the method comprises coupling an amino acid of the peptide conjugate to be coupled to an amino acid or a peptide so as to provide a peptide conjugate comprising a peptide epitope.
In an alternate embodiment, the method comprises coupling an amino acid of the peptide conjugate to an amino acid or peptide bound to a solid phase resin support by SPPS so as to provide peptide conjugate comprising a peptide epitope.
In some embodiments, the method further comprises coupling an epitope, for example a peptide epitope, to the amino acid conjugate or peptide conjugate. Where the method comprises coupling a peptide epitope, the coupling may be carried out by SPPS as described herein.
In certain embodiments, the epitope, for example a peptide epitope, is coupled or bound via a linker group. In certain embodiments, the linker group is an amino sequence, for example a sequence of two or more, three or more, or four or more contiguous amino acids. In certain embodiments, the linker comprises from about 2 to 20, 2 to 18, 2 to 16, 2 to 14, 2 to 12, 2 to 10, 4 to 20, 4 to 18, 4 to 16, 4 to 14, 4 to 12, or 4 to 10 amino acids.
It will be appreciate by those skilled in the art that coupling an amino acid or a peptide to another amino acid or peptide as described herein may comprise forming a peptide bond between the No-terminus of the amino acid or an amino acid of the peptide of one coupling partner and the C-terminus of the amino acid or an amino acid of the peptide of the other coupling partner.
In some embodiments, the method of the present invention comprises synthesising the amino acid sequence of the peptide of the peptide-containing conjugation partner by SPPS; and reacting the lipid-containing conjugation partner with the peptide-containing conjugation partner.
In some embodiments, synthesising the amino acid sequence of the peptide of the peptide-containing conjugation partner by SPPS comprises coupling an amino acid or peptide to an amino acid or peptide bound to a solid phase resin support to provide the amino acid sequence of the peptide or a portion thereof. In certain embodiments, the amino acid sequence of the entire peptide of the peptide-containing conjugation partner is synthesised by SPPS.
The peptide-containing conjugation partner may be reacted with the lipid-containing conjugation partner while bound to a solid phase resin support. Alternatively, the peptide may be cleaved from the solid phase resin support, and optionally purified, prior to reaction with the lipid-containing conjugation partner.
The peptide conjugate and/or amino acid-comprising conjugation partner, for example a peptide-containing conjugation partner, may comprise one or more solubilising groups. The one or more solubilising groups increase the solubility of, for example, the peptide-containing conjugation partner in polar solvents, such as water. In exemplary embodiments, the solubilising group does not adversely affect the biological activity of the peptide conjugate.
The presence of a solubilising group may be advantageous for formulation and/or administration of the peptide conjugate as a pharmaceutical composition.
In some embodiments, the solubilising group is bound to the peptide of the peptide conjugate and/or peptide-containing conjugation partner. In some embodiments, the solubilising group is bound to the peptide of the peptide-containing conjugation partner. In some embodiments, the peptide of the peptide conjugate and/or the peptide of the peptide-containing partner comprises a solubilising group. In some embodiments, the peptide of the peptide-containing partner comprises a solubilising group.
In some embodiments, the solubilising group is bound to the side chain of an amino acid in the peptide chain. In some embodiments, the solubilising group is bound to the C- or N-terminus of the peptide chain. In some embodiments, the solubilising group is bound between two amino acid residues in the peptide chain. In some embodiments, the solubilising group is bound to the Na-amino group of one amino acid residue in the peptide chain and the carboxyl group of another amino acid residue in the peptide chain.
Examples of suitable solubilising groups include, but are not limited to, hydrophilic amino acid sequences or polyethylene glycols (PEGs).
In one embodiment, the solubilising group is a hydrophilic amino acid sequence comprising two or more hydrophilic amino acid residues in the peptide chain. In some embodiments, the solubilising group is an amino acid sequence comprising a sequence of two or more consecutive hydrophilic amino acid residues in the peptide chain. Such solubilising groups may be formed by adding each amino acid of the solubilising group to the peptide chain by SPPS.
In another embodiment, the solubilising group is a polyethylene glycol. In some embodiments, the polyethylene glycol is bound to the Na-amino group of one amino acid residue in the peptide chain and the carboxyl group of another amino acid residue in the peptide chain.
In some embodiments, the polyethylene glycol comprises from about 1 to about 100, about 1 to about 50, about 1 to about 25, about 1 to about 20, about 1 to about 15, about 1 to about 15, about 1 to about 10, about 2 to about 10, or about 2 to about 4 ethylene glycol monomer units. Methods for coupling polyethylene glycols to peptides are known.
In some embodiments, the peptide conjugate and/or peptide-containing conjugation partner comprises an antigen, for example, an antigenic peptide. In one embodiment, the peptide of the peptide conjugate or peptide-containing conjugation partner is or comprises an antigen; or an antigen is bound to peptide, optionally via a linker. In some embodiments, the peptide-containing conjugation partner comprises an antigen, for example, an antigenic peptide. In one embodiment, the peptide of the peptide-containing conjugation partner is or comprises an antigen; or an antigen is bound to peptide, optionally via a linker.
In one embodiment, the antigen comprises a peptide comprising an epitope. In one embodiment, the peptide comprising an epitope is a glycopeptide comprising an epitope. In one embodiment, the antigen comprises a glycopeptide comprising an epitope.
In some embodiments, the peptide conjugate and/or peptide-containing conjugation partner comprises an epitope. In some embodiments, the peptide of the peptide conjugate and/or peptide-containing conjugation partner comprises an epitope. In some embodiments, the peptide-containing conjugation partner comprises an epitope. In some embodiments, the peptide of the peptide-containing conjugation partner comprises an epitope.
In some embodiments, the peptide conjugate and/or peptide-containing conjugation partner comprises two or more epitopes, for example, the peptide of the peptide conjugate and/or peptide-containing conjugation partner comprises two or more epitopes.
In some embodiments, the peptide conjugate and/or peptide-containing conjugation partner is or comprises a glycopeptide comprising an epitope. In some embodiments, the peptide of the peptide conjugate and/or peptide-containing conjugation partner is a glycopeptide. In some embodiments, the peptide conjugate and/or peptide-containing conjugation partner comprises a glycopeptide comprising an epitope bound to the peptide of the peptide conjugate and/or peptide-containing conjugation partner. In some embodiments, the peptide-containing conjugation partner is or comprises a glycopeptide comprising an epitope. In some embodiments, the peptide of the peptide-containing conjugation partner is a glycopeptide. In some embodiments, the peptide-containing conjugation partner comprises a glycopeptide comprising an epitope bound to the peptide of the peptide-containing conjugation partner.
In some embodiments, the peptide conjugate and/or peptide-containing conjugation partner comprises a proteolytic cleavage site. In some embodiments, the peptide of the peptide conjugate and/or peptide-containing conjugation partner comprises a proteolytic cleavage site. In some embodiments, the peptide-containing conjugation partner comprises a proteolytic cleavage site. In some embodiments, the peptide of the peptide-containing conjugation partner comprises a proteolytic cleavage site.
In some embodiments, the peptide of the peptide conjugate and/or peptide-containing conjugation partner comprises one or more linker groups. In some embodiments, the peptide of the peptide-containing conjugation partner comprises one or more linker groups.
In some embodiments, the peptide conjugate and/or peptide-containing conjugation partner comprises a linker group. In some embodiments, the peptide-containing conjugation partner comprises a linker group.
In some embodiments, the peptide conjugate and/or peptide-containing conjugation partner comprises an epitope bound to the peptide of the peptide conjugate and/or peptide-containing conjugation partner via a linker group. In some embodiments, the peptide-containing conjugation partner comprises an epitope bound to the peptide of the peptide-containing conjugation partner via a linker group.
Examples of linker groups include but are not limited to amino acid sequences (for example, a peptide), polyethylene glycol, alkyl amino acids, and the like. In some embodiments, the linker is or comprises a proteolytic cleavage site. In some embodiments, the linker is or comprises a solubilising group.
In some embodiments, the linker is bound between two amino acid residues in the peptide chain.
In some embodiments, the linker group is bound to the Na-amino group of one amino acid residue in the peptide conjugate and/or peptide-containing conjugation partner and the carboxyl group of another amino acid residue in the peptide-containing conjugation partner. In some embodiments, the linker group is bound to the Na-amino group of one amino acid residue in the peptide-containing conjugation partner and the carboxyl group of another amino acid residue in the peptide-containing conjugation partner.
In certain embodiments, the linker group is cleavable in vivo from the amino acids to which it is bound. In certain embodiments, the linker group is cleavable by hydrolysis in vivo. In certain embodiments, the linker group is cleavable by enzymatic hydrolysis in vivo. Linker groups may be introduced by any suitable method known in the art.
The method may further comprise coupling an epitope to the amino acid of the amino acid conjugate or the peptide of the peptide conjugate. The epitope may be bound via a linker group, as described above. In some embodiments, the epitope is a peptide epitope. In some embodiments, the method comprises coupling a glycopeptide comprising an epitope.
It will be appreciated that in certain desirable embodiments, the peptide conjugates of the invention maintain appropriate uptake, processing, and presentation by antigen presenting cells. Desirably, the lipid-containing conjugate does not interfere with presentation of any antigenic peptide present in the conjugate by antigen presenting cells. The examples presented herein establish that conjugates of the invention are presented by antigen presenting cells comparably with non-conjugated, related peptides.
Confirmation of the identity of the peptides synthesized may be conveniently achieved by, for example, amino acid analysis, mass spectrometry, Edman degradation, and the like.
The method of the present invention may further comprise separating the amino acid conjugate from the liquid reaction medium. Alternatively, the method of the present invention may further comprise separating the peptide conjugate from the liquid reaction medium. Any suitable separation methods known in the art may be used, for example, precipitation and filtration. The conjugate may be subsequently purified, for example, by HPLC using one or more suitable solvents.
The present invention also relates to amino acid conjugates and peptide conjugates made by the method of the present invention. The conjugates are as defined in any of the embodiments described herein.
The present invention also relates to a compound of the formula (V), which is an amino acid conjugate.
The present invention also relates to a compound of the formula (V), which is a peptide conjugate.
The peptide conjugates may be pure or purified, or substantially pure.
As used herein “purified” does not require absolute purity; rather, it is intended as a relative term where the material in question is more pure than in the environment it was in previously. In practice the material has typically, for example, been subjected to fractionation to remove various other components, and the resultant material has substantially retained its desired biological activity or activities. The term “substantially purified” refers to materials that are at least about 60% free, preferably at least about 75% free, and most preferably at least about 90% free, at least about 95% free, at least about 98% free, or more, from other components with which they may be associated during manufacture.
The term “α-amino acid” or “amino acid” refers to a molecule containing both an amino group and a carboxyl group bound to a carbon which is designated the α-carbon. Suitable amino acids include, without limitation, both the D- and L-isomers of the naturally-occurring amino acids, as well as non-naturally occurring amino acids prepared by organic synthesis or other metabolic routes. Unless the context specifically indicates otherwise, the term amino acid, as used herein, is intended to include amino acid analogs.
In certain embodiments the peptide-containing conjugation partner comprises only natural amino acids. The term “naturally occurring amino acid” refers to any one of the twenty amino acids commonly found in peptides synthesized in nature, and known by the one letter abbreviations A, R, N, C, D, Q, E, G, H, I, L, K, M, F, P, S, T, W, Y and V.
The term “amino acid analog” or “non-naturally occurring amino acid” refers to a molecule which is structurally similar to an amino acid and which can be substituted for an amino acid. Amino acid analogs include, without limitation, compounds which are structurally identical to an amino acid, as defined herein, except for the inclusion of one or more additional methylene groups between the amino and carboxyl group (e.g., a-amino β-carboxy acids), or for the substitution of the amino or carboxy group by a similarly reactive group (e.g., substitution of the primary amine with a secondary or tertiary amine, or substitution or the carboxy group with an ester).
Unless otherwise indicated, conventional techniques of molecular biology, microbiology, cell biology, biochemistry and immunology, which are within the skill of the art may be employed in practicing the methods described herein. Such techniques are explained fully in the literature, such as, Molecular Cloning: A Laboratory Manual, second edition (Sambrook et al., 1989); Oligonucleotide Synthesis (M. J. Gait, ed., 1984); Animal Cell Culture (R. I. Freshney, ed., 1987); Handbook of Experimental Immunology (D. M. Weir & C. C. Blackwell, eds.); Gene Transfer Vectors for Mammalian Cells (J. M. Miller & M. P. Calos, eds., 1987); Current Protocols in Molecular Biology (F. M. Ausubel et al., eds., 1987); PCR: The Polymerase Chain Reaction, (Mullis et al., eds., 1994); Current Protocols in Immunology (J. E. Coligan et al., eds., 1991); The Immunoassay Handbook (David Wild, ed., Stockton Press NY, 1994); Antibodies: A Laboratory Manual (Harlow et al., eds., 1987); and Methods of Immunological Analysis (R. Masseyeff, W. H. Albert, and N. A. Staines, eds., Weinheim: VCH Verlags gesellschaft mbH, 1993).
The term “peptide” and the like is used herein to refer to any polymer of amino acid residues of any length. The polymer can be linear or non-linear (e.g., branched), it can comprise modified amino acids or amino acid analogs. The term also encompasses amino acid polymers that have been modified naturally or by intervention, for example, by disulfide bond formation, glycosylation, lipidation, acetylation, phosphorylation, or any other modification or manipulation, for example conjugation with labeling or bioactive component.
The inventors have found that the certain peptide conjugates of the present invention have immunological activity.
Cell-mediated immunity is primarily mediated by T-lymphocytes. Pathogenic antigens are expressed on the surface of antigen presenting cells (such as macrophages, B-lymphocytes, and dendritic cells), bound to either major histocompatibility MHC Class I or MHC Class II molecules. Presentation of pathogenic antigen coupled to MHC Class II activates a helper (CD4+) T-cell response. Upon binding of the T-cell to the antigen-MHC II complex, CD4+ T-cells, release cytokines and proliferate.
Presentation of pathogenic antigens bound to MHC Class I molecules activates a cytotoxic (CD8+) T-cell response. Upon binding of the T-cell to the antigen-MHC I complex, CD8+ cells secrete perforin and other mediators, resulting in target cell death. Without wishing to be bound by any theory, the applicants believe that in certain embodiments an enhanced response by CD8+ cells is achieved in the presence of one or more epitopes recognised by CD4+ cells.
Methods to assess and monitor the onset or progression of a cell-mediated response in a subject are well known in the art. Convenient exemplary methods include those in which the presence of or the level of one or more cytokines associated with a cell-mediated response, such as those identified herein, is assessed. Similarly, cell-based methods to assess or monitor the onset and progression of a cell-mediated response are amenable to use in the present invention, and may include cell proliferation or activation assays, including assays targeted at identifying activation or expansion of one or more populations of immune cells, such as T-lymphocytes.
In certain embodiments, methods of the invention elicit both a cell-mediated immune response and a humoral response.
The humoral immune response is mediated by secreted antibodies produced by B cells. The secreted antibodies bind to antigens presented on the surface of invading pathogens, flagging them for destruction.
Again, methods to assess and monitor the onset or progression of a humoral response are well known in the art. These include antibody binding assays, ELISA, skin-prick tests and the like.
Without wishing to be bound by theory, the inventors believe that the peptide conjugates in some embodiments stimulate Toll like receptors (TLRs).
Toll-like receptors (TLRs) are highly conserved pattern recognition receptors (PRRs) that recognise pathogen-associated molecular patterns and transmit danger signals to the cell (Kawai, T., Akira, S., Immunity 2011, 34, 637-650). TLR2 is a cell-surface receptor expressed on a range of different cell types, including dendritic cells, macrophages and lymphocytes (Coffman, R. L., Sher, A., Seder, R. A., Immunity 2010, 33, 492-503).
TLR2 recognises a wide range of microbial components including lipopolysaccharides, peptidoglycans and lipoteichoic acid. It is unique amongst TLRs in that it forms heterodimers, with either TLR1 or TLR6; the ability to form complexes with other PRRs may explain the wide range of agonists for TLR2 (Feldmann, M., Steinman, L., Nature 2005, 435, 612-619). Upon ligand binding and heterodimerisation, signalling takes place via the MyD88 pathway, leading to NFκB activation and consequent production of inflammatory and effector cytokines.
Di- and triacylated lipopeptides derived from bacterial cell-wall components have been extensively studied as TLR2 agonists (Eriksson, E. M. Y., Jackson, D. C., Curr. Prot. and Pept. Sci. 2007, 8, 412-417). Lipopeptides have been reported to promote dendritic cell maturation, causing the up-regulation of co-stimulatory molecules on the cell surface and enhanced antigen-presentation. Lipopeptides have also been reported to stimulate macrophages to release cytokines and promote the activation of lymphocytes including B cells and CD8+ T cells.
In some embodiments, the peptide conjugate has TLR2 agonist activity. In some embodiments, the peptide conjugate has TLR2 agonist activity comparable to Pam3CSK4 [comprises SEQ ID NO: 22]. In some embodiments, the peptide conjugate has TLR2 agonist activity at least about 50%, about 60%, about 70%, about 80%, about 90% that of Pam3CSK4 [comprises SEQ ID NO: 22]. In some embodiments, for example in embodiments where a modulated immune response is desirable, the peptide conjugate has TLR2 agonist activity less that that of Pam3CSK4 [comprises SEQ ID NO: 22]. For example, the peptide conjugate has TLR2 agonist activity less than about 50%, less than about 40%, less than about 30%, less than about 20%, or less than about 10% that of Pam3CSK4 [comprises SEQ ID NO: 22].
In some embodiments, the peptide of the peptide conjugate and/or peptide-containing conjugation partner comprises a serine amino acid residue adjacent to the amino acid through which the lipid-containing conjugation partner is conjugated to the peptide. In some embodiments, the peptide of the peptide containing conjugation partner comprises a serine amino acid residue adjacent to the amino acid through which the lipid-containing conjugation partner is conjugated to the peptide. The presence of the serine amino acid residue in this position may enhance TLR2 binding. In some embodiments, the serine amino acid residue is bound to the C-termini of the amino acid through which the lipid-containing conjugation partner is conjugated to the peptide.
As will be appreciated by those skilled in the art on reading this disclosure, the peptide conjugate may comprise an epitope, including, for example two or more epitopes. In some embodiments, the epitope is a peptide epitope. A person skilled in the art will appreciate that a wide range of peptide epitopes may be employed in the present invention.
Antigens
It will be appreciated that a great many antigens, for example tumour antigens or antigens from various pathogenic organisms, have been characterised and are suitable for use in the present invention. All antigens, whether or not presently characterized, that are capable of eliciting an immune response are contemplated.
Accordingly, depending on the choice of antigen the conjugates of the present invention find application in a wide range of immunotherapies, including but not limited to the treatment and prevention of infectious disease, the treatment and prevention of cancer, and the treatment of viral re-activation during or following immunosuppression, for example in patients who have had bone marrow transplants or haematopoietic stem cell transplants.
Also contemplated are antigens comprising one or more amino acid substitutions, such as one or more conservative amino acid substitutions.
A “conservative amino acid substitution” is one in which an amino acid residue is replaced with another residue having a chemically similar or derivatised side chain. Families of amino acid residues having similar side chains, for example, have been defined in the art. These families include, for example, amino acids with basic side chains (e.g., lysine, arginine, histidine), acidic side chains (e.g., aspartic acid, glutamic acid), uncharged polar side chains (e.g., glycine, asparagine, glutamine, serine, threonine, tyrosine, cysteine), nonpolar side chains (e.g., alanine, valine, leucine, isoleucine, proline, phenylalanine, methionine, tryptophan), beta-branched side chains (e.g., threonine, valine, isoleucine) and aromatic side chains (e.g., tyrosine, phenylalanine, tryptophan, histidine). Amino acid analogs (e.g., phosphorylated or glycosylated amino acids) are also contemplated in the present invention, as are peptides substituted with non-naturally occurring amino acids, including but not limited to N-alkylated amino acids (e.g. N-methyl amino acids), D-amino acids, 1-amino acids, and γ-amino acids.
Fragments and variants of antigens are also specifically contemplated.
A “fragment” of a peptide, is a subsequence of the peptide that performs a function that is required for the enzymatic or binding activity and/or provides three dimensional structure of the peptide, such as the three dimensional structure of a polypeptide.
The term “variant” as used herein refers to peptide sequences, including for example peptide sequences different from the specifically identified sequences, wherein one or more amino acid residues is deleted, substituted, or added. Variants are naturally-occurring variants, or non-naturally occurring variants. Variants are from the same or from other species and may encompass homologues, paralogues and orthologues. In certain embodiments, variants of peptides including peptides possess biological activities that are the same or similar to those of the wild type peptides. The term “variant” with reference to peptides encompasses all forms of peptides as defined herein.
Those of skill in the art will appreciate that the conjugates of the present invention are in certain embodiments particularly suited for stimulating T-cell responses, for example in the treatment of neoplastic diseases, including cancer. Conjugates of the present invention comprising one or more tumour antigens are specifically contemplated. It will be appreciated that tumour antigens contemplated for use in the preparation of peptide conjugates of the invention will generally comprise one or more peptides. In certain embodiments of the invention, including for example pharmaceutical compositions of the invention, one or more additional tumour antigens may be present, wherein the one or more tumour antigens does not comprise peptide. Tumour antigens are typically classified as either unique antigens, or shared antigens, with the latter group including differentiation antigens, cancer-specific antigens, and over-expressed antigens. Examples of each class of antigens are amenable to use in the present invention. Representative tumour antigens for use in the treatment, for example immunotherapeutic treatment, or vaccination against neoplastic diseases including cancer, are discussed below. Compounds, vaccines and compositions comprising one or more antigens prepared using those methods of immunisation are specifically contemplated.
In certain embodiments, the tumour antigen is a peptide-containing tumour antigen, such as a polypeptide tumour antigen or glycoprotein tumour antigens. In certain embodiments, the tumour antigen is a saccharide-containing tumour antigen, such as a glycolipid tumour antigen or a ganglioside tumour antigen. In certain embodiments, the tumour antigen is a polynucleotide-containing tumour antigen that expresses a polypeptide-containing tumour antigen, for instance, an RNA vector construct or a DNA vector construct, such as plasmid DNA.
Tumour antigens appropriate for the use in the present invention encompass a wide variety of molecules, such as (a) peptide-containing tumour antigens, including peptide epitopes (which can range, for example, from 8-20 amino acids in length, although lengths outside this range are also common), lipopolypeptides and glycoproteins, (b) saccharide-containing tumour antigens, including poly-saccharides, mucins, gangliosides, glycolipids and glycoproteins, including and (c) polynucleotides that express antigenic polypeptides. Again, those skilled in the art will recognise that a tumour antigen present in a conjugate or composition of the present invention will typically comprise peptide. However, embodiments of the invention where one or more conjugates comprises a tumour antigen that does not itself comprise peptide, but for example is bound to the amino acid-comprising or peptide-containing conjugation partner, are contemplated. Similarly, compositions of the invention in which one or more tumour antigens that does not itself comprise peptide is present are contemplated.
In certain embodiments, the tumour antigens are, for example, (a) full length molecules associated with cancer cells, (b) homologues and modified forms of the same, including molecules with deleted, added and/or substituted portions, and (c) fragments of the same, provided said fragments remain antigenic or immunogenic. In certain embodiments, the tumour antigens are provided in recombinant form. In certain embodiments, the tumour antigens include, for example, class I-restricted antigens recognized by CD8+ lymphocytes or class II-restricted antigens recognized by CD4+ lymphocytes.
Shared tumour antigens are generally considered to be native, unmutated sequences that are expressed by tumours due to epigenetic changes that allow de-repression of developmentally-repressed genes. Accordingly, shared antigens are typically considered preferable to over-expressed or differentiation-associated antigens because there is no expression in normal tissues. Also, the same antigens can be targeted in a number of cancer patients. For example, the cancer-testis antigen NY-ESO-1 is present in the majority of patients with many tumours, and a sizeable minority of patients with other tumours. In another example, breast differentiation tumour antigens NYBR-1 and NYBR-1.1 are found in a proportion of breast cancer sufferers. Shared tumour antigens thus represent an attractive target for development.
The use of shared tumour antigens, such cancer-testis antigens including NY-ESO-1, CTSP-1, CTSP-2, CTSP-3, CTSP-4, SSX2, and SCP1, and breast cancer antigens NYBR-1 and NYBR-1.1, in conjugates of the present invention is specifically contemplated herein.
In one exemplary embodiment, the peptide of the peptide-containing conjugation partner or of the peptide conjugate comprises one or more epitopes derived from NY-ESO-1. In one embodiment, the peptide comprises one or more epitopes derived from NY-ESO-1 residues 79-116 [SEQ ID NO: 5]. In one embodiment, the peptide comprises one or more epitopes derived from NY-ESO-1 residues 118-143 [SEQ ID NO: 12]. In one embodiment, the peptide comprises one or more epitopes derived from NY-ESO-1 residues 153-180 [SEQ ID NO: 18].
In one specifically contemplated embodiment, the peptide of the peptide-containing conjugation partner or of the peptide conjugate, comprises, consists essentially of, or consists of an amino acid sequence selected from the group consisting of 8 or more contiguous, 10 or more contiguous, 12 or more contiguous, 15 or more contiguous, 20 or more contiguous, or 25 or more contiguous amino acids from any one of SEQ ID NOs: 1 to 20.
In various embodiments, the peptide comprises more that one amino acid sequence selected from the group consisting of any one of SEQ ID NOs: 1 to 20. In one embodiment, the peptide comprises one or more amino acid sequences selected from the group consisting of SEQ ID NOs: 4-7, 12, 13, and 18-20.
Similarly, the prostate vaccine Sipuleucel-T (APC8015, Provengem), which comprises the antigen prostatic acid phosphatase (PAP), is present in 95% of prostate cancer cells. At least in part due to this potential for efficacy in a significant proportion of prostate cancer sufferers, Sipuleucel-T was approved by the FDA in 2010 for use in the treatment of asymptomatic, hormone-refractory prostate cancer. The use of PAP antigen in conjugates of the present invention is specifically contemplated in the present invention.
Unique antigens are considered to be those antigens that are unique to an individual or are shared by a small proportion of cancer patients, and typically result from mutations leading to unique protein sequences. Representative examples of unique tumour antigens include mutated Ras antigens, and mutated p53 antigens. As will be appreciated by those skilled in the art having read this specification, the methods of the present invention enable the ready preparation of conjugates comprising one or more unique tumour antigens, for example to elicit specific T-cell responses to one or more unique tumour antigens, for example in the preparation of patient-specific therapies.
Accordingly, representative tumour antigens include, but are not limited to, (a) antigens such as RAGE, BAGE, GAGE and MAGE family polypeptides, for example, GAGE-1, GAGE-2, MAGE-1, MAGE-2, MAGE-3, MAGE-4, MAGE-5, MAGE-6, and MAGE-12 (which can be used, for example, to address melanoma, lung, head and neck, NSCLC, breast, gastrointestinal, and bladder tumours), (b) mutated antigens, for example, p53 (associated with various solid tumours, for example, colorectal, lung, head and neck cancer), p21/Ras (associated with, for example, melanoma, pancreatic cancer and colorectal cancer), CDK4 (associated with, for example, melanoma), MUM1 (associated with, for example, melanoma), caspase-8 (associated with, for example, head and neck cancer), CIA 0205 (associated with, for example, bladder cancer), HLA-A2-R1701, beta catenin (associated with, for example, melanoma), TCR (associated with, for example, T-cell non-Hodgkins lymphoma), BCR-abl (associated with, for example, chronic myelogenous leukemia), triosephosphate isomerase, MA 0205, CDC-27, and LDLR-FUT, (c) over-expressed antigens, for example, Galectin 4 (associated with, for example, colorectal cancer), Galectin 9 (associated with, for example, Hodgkin's disease), proteinase 3 (associated with, for example, chronic myelogenous leukemia), Wilm's tumour antigen-1 (WT 1, associated with, for example, various leukemias), carbonic anhydrase (associated with, for example, renal cancer), aldolase A (associated with, for example, lung cancer), PRAME (associated with, for example, melanoma), HER-2/neu (associated with, for example, breast, colon, lung and ovarian cancer), alpha-fetoprotein (associated with, for example, hepatoma), KSA (associated with, for example, colorectal cancer), gastrin (associated with, for example, pancreatic and gastric cancer), telomerase catalytic protein, MUC-1 (associated with, for example, breast and ovarian cancer), G-250 (associated with, for example, renal cell carcinoma), p53 (associated with, for example, breast, colon cancer), and carcinoembryonic antigen (associated with, for example, breast cancer, lung cancer, and cancers of the gastrointestinal tract such as colorectal cancer), (d) shared antigens, for example, melanoma-melanocyte differentiation antigens such as MART-1/Melan A, gp100, MC1R, melanocyte-stimulating hormone receptor, tyrosinase, tyrosinase related protein-1/TRP1 and tyrosinase related protein-2/TRP2 (associated with, for example, melanoma), (e) prostate associated antigens such as PAP, prostatic serum antigen (PSA), PSMA, PSH-P1, PSM-P1, PSM-P2, associated with for example, prostate cancer, (f) immunoglobulin idiotypes (associated with myeloma and B cell lymphomas, for example), and (g) other tumour antigens, such as polypeptide- and saccharide-containing antigens including (i) glycoproteins such as sialyl Tn and sialyl Le.sup.x (associated with, for example, breast and colorectal cancer) as well as various mucins; glycoproteins are coupled to a carrier protein (for example, MUC-1 are coupled to KLH); (ii) lipopolypeptides (for example, MUC-1 linked to a lipid moiety); (iii) polysaccharides (for example, Globo H synthetic hexasaccharide), which are coupled to a carrier proteins (for example, to KLH), (iv) gangliosides such as GM2, GM12, GD2, GD3 (associated with, for example, brain, lung cancer, melanoma), which also are coupled to carrier proteins (for example, KLH).
Other representative tumour antigens amenable to use in the present invention include TAG-72, (See, e.g., U.S. Pat. No. 5,892,020; human carcinoma antigen (See, e.g., U.S. Pat. No. 5,808,005); TP1 and TP3 antigens from osteocarcinoma cells (See, e.g., U.S. Pat. No. 5,855,866); Thomsen-Friedenreich (TF) antigen from adenocarcinoma cells (See, e.g., U.S. Pat. No. 5,110,911); KC-4 antigen from human prostrate adenocarcinoma (See, e.g., U.S. Pat. No. 4,743,543); a human colorectal cancer antigen (See, e.g., U.S. Pat. No. 4,921,789); CA125 antigen from cystadenocarcinoma (See, e.g., U.S. Pat. No. 4,921,790); DF3 antigen from human breast carcinoma (See, e.g., U.S. Pat. Nos. 4,963,484 and 5,053,489); a human breast tumour antigen (See, e.g., U.S. Pat. No. 4,939,240); p97 antigen of human melanoma (See, e.g., U.S. Pat. No. 4,918,164); carcinoma or orosomucoid-related antigen (CORA) (See, e.g., U.S. Pat. No. 4,914,021); T and Tn haptens in glycoproteins of human breast carcinoma, MSA breast carcinoma glycoprotein; MFGM breast carcinoma antigen; DU-PAN-2 pancreatic carcinoma antigen; CA125 ovarian carcinoma antigen; YH206 lung carcinoma antigen, Alphafetoprotein (AFP) hepatocellular carcinoma antigen; Carcinoembryonic antigen (CEA) bowel cancer antigen; Epithelial tumour antigen (ETA) breast cancer antigen; Tyrosinase; the raf oncogene product; gp75; gp100; EBV-LMP 1 & 2; EBV-EBNA 1, 2 & 3C; HPV-E4, 6, 7; C017-1A; GA733; gp72; p53; proteinase 3; telomerase; and melanoma gangliosides. These and other tumour antigens, whether or not presently characterized, are contemplated for use in the present invention.
In certain embodiments, the tumour antigens are derived from mutated or altered cellular components. Representative examples of altered cellular components include, but are not limited to ras, p53, Rb, altered protein encoded by the Wilms' tumour gene, ubiquitin, mucin, protein encoded by the DCC, APC, and MCC genes, as well as receptors or receptor-like structures such as neu, thyroid hormone receptor, platelet derived growth factor (PDGF) receptor, insulin receptor, epidermal growth factor (EGF) receptor, and the colony stimulating factor (CSF) receptor.
Polynucleotide-containing antigens used in the present invention include polynucleotides that encode polypeptide tumour antigens such as those listed above. In certain embodiments, the polynucleotide-containing antigens include, but are not limited to, DNA or RNA vector constructs, such as plasmid vectors (e.g., pCMV), which are capable of expressing polypeptide tumour antigens in vivo.
The present invention also contemplates the preparation of conjugates comprising viral antigens that are capable of stimulating T-cell to elicit effective anti-viral immunity in patients who are or have been immunosuppressed, for example patients who have had bone marrow transplants, haematopoietic stem cell transplants, or are otherwise undergoing immunosuppression.
Similarly, antigens derived from viruses associated with increased incidence of cancer, or that are reported to be cancer-causing, such as human papillomavirus, hepatitis A virus, and hepatitis B virus, are contemplated for use in the present invention.
For example, in certain embodiments, the tumour antigens include, but are not limited to, p15, Hom/Mel-40, H-Ras, E2A-PRL, H4-RET, IGH-IGK, MYL-RAR, Epstein Barr virus antigens, human papillomavirus (HPV) antigens, including E6 and E7, hepatitis B and C virus antigens, human T-cell lymphotropic virus antigens, TSP-180, p185erbB2, p180erbB-3, c-met, mn-23H1, TAG-72-4, CA 19-9, CA 72-4, CAM 17.1, NuMa, K-ras, p16, TAGE, PSCA, CT7, 43-9F, 5T4, 791 Tgp72, beta-HCG, BCA225, BTAA, CA 125, CA 15-3 (CA 27.29\BCAA), CA 195, CA 242, CA-50, CAM43, CD68\KP1, CO-029, FGF-5, Ga733 (EpCAM), HTgp-175, M344, MA-50, MG7-Ag, MOV18, NB/70K, NY-CO-1, RCAS1, SDCCAG16, TA-90 (Mac-2 binding protein\cyclophilin C-associated protein), TAAL6, TAG72, TLP, TPS, and the like.
Representative antigens for use in vaccination against pathogenic organisms are discussed below. Compounds, vaccines and compositions comprising one or more antigens prepared using those methods of immunisation are specifically contemplated.
Tuberculosis Antigens
It will be appreciated that a great many M. tuberculosis antigens have been characterised and are suitable for use in the present invention. All M. tuberculosis antigens, whether or not presently characterized, that are capable of eliciting an immune response are contemplated.
Exemplary M. tuberculosis antigens suitable for use include early secretary antigen target (ESAT)-6, Ag85A, Ag85B (MPT59), Ag85B, Ag85C, MPT32, MPT51, MPT59, MPT63, MPT64, MPT83, MPB5, MPB59, MPB64, MTC28, Mtb2, Mtb8.4, Mtb9.9, Mtb32A, Mtb39, Mtb41, TB10.4, TB10C, TB11B, TB12.5, TB13A, TB14, TB15, TB15A, TB16, TB16A, TB17, TB18, TB21, TB20.6, TB24, TB27B, TB32, TB32A, TB33, TB38, TB40.8, TB51, TB54, TB64, CFP6, CFP7, CFP7A, CFP7B, CFP8A, CFP8B, CFP9, CFP10, CFP11, CFP16, CFP17, CFP19, CFP19A, CFP19B, CFP20, CFP21, CFP22, CFP22A, CFP23, CFP23A, CFP23B, CFP25, CFP25A, CFP27, CFP28, CFP28B, CFP29, CFP30A, CFP30B, CFP50, CWP32, hspX (alpha-crystalline), APA, Tuberculin purified protein derivative (PPD), ST-CF, PPE68, LppX, PstS-1, PstS-2, PstS-3, HBHA, GroEL, GroEL2, GrpES, LHP, 19 kDa lipoprotein, 71 kDa, RD1-ORF2, RD1-ORF3, RD1-ORF4, RD1-ORF5, RD1-ORF8, RD1-ORF9A, RD1-ORF9B, Rv1984c, Rv0577, Rv1827, BfrB, Tpx. Rv1352, Rv1810, PpiA, Cut2, FbpB, FbpA, FbpC, DnaK, FecB, Ssb, RplL, FixA, FixB, AhpC2, Rv2626c, Rv1211, Mdh, Rv1626, Adk, CIpP, SucD (Belisle et al, 2005; U.S. Pat. No. 7,037,510; US 2004/0057963; US 2008/0199493; US 2008/0267990), or at least one antigenic portion or T-cell epitope of any of the above mentioned antigens.
Hepatitis Antigens
A number of hepatitis antigens have been characterised and are suitable for use in the present invention. Exemplary hepatitis C antigens include C—p22, E1—gp35, E2—gp70, NS1—p7, NS2—p23, NS3—p70, NS4A—p8, NS4B—p27, NS5A—p56/58, and NS5B—p68, and together with one or more antigenic portions or epitopes derived therefrom are each (whether alone or in combination) suitable for application in the present invention. All hepatitis antigens, whether or not presently characterized, that are capable of eliciting an immune response are contemplated.
Influenza Antigens
Many influenza antigens have been characterised and are suitable for use in the present invention. Exemplary influenza antigens suitable for use in the present invention include PB, PB2, PA, any of the hemagglutinin (HA) or neuramimidase (NA) proteins, NP, M, and NS, and together with one or more antigenic portions or epitopes derived therefrom are each (whether alone or in combination) suitable for application in the present invention. All influenza antigens, whether or not presently characterized, that are capable of eliciting an immune response are contemplated.
Anthrax Antigens
A number of B. anthracis antigens have been identified as potential candidates for vaccine development and are useful in the present invention. For example, PA83 is one such antigen for vaccine development. Currently, only one FDA licensed vaccine for anthrax is available called “Anthrax Vaccine Adsorbed” (AVA) or BioThrax®. This vaccine is derived from the cell-free supernatant of a non-encapsulated strain of B. anthracis adsorbed to aluminum adjuvant. PA is the primary immunogen in AVA. Other exemplary anthrax antigens suitable for use in the present invention include Protective antigen (PA or PA63), LF and EF (proteins), poly-gamma-(D-glutamate) capsule, spore antigen (endospore specific components), BcIA (exosporium specific protein), BxpB (spore-associated protein), and secreted proteins. All anthrax antigens together with one or more antigenic portions or epitopes derived therefrom, whether or not presently characterized, that are capable of eliciting an immune response are contemplated.
Tularemia Antigens
A number of F. tularensis antigens have been identified as potential candidates for vaccine development and are useful in the present invention. For example, AcpA and IgIC are antigens suitable for vaccine development. Other exemplary Tularemia antigens suitable for use in the present invention include O-antigen, CPS, outer membrane proteins (e.g. FopA), lipoproteins (e.g. Tul4), secreted proteins and lipopolysaccharide. All tularemia antigens together with one or more antigenic portions or epitopes derived therefrom, whether or not presently characterized, that are capable of eliciting an immune response are contemplated.
Brucellosis Antigens
A number of B. abortusis antigens have been identified as potential candidates for vaccine development and are useful in the present invention. For example, Omp16 is one such antigen for vaccine development. Other exemplary Brucellosis antigens suitable for use in the present invention include O-antigen, lipopolysaccharide, outer membrane proteins (e.g. Omp16), secreted proteins, ribosomal proteins (e.g. L7 and L12), bacterioferritin, p39 (a putative periplasmic binding protein), groEL (heat-shock protein), lumazine synthase, BCSP31 surface protein, PAL16.5 OM lipoprotein, catalase, 26 kDa periplasmic protein, 31 kDa Omp31, 28 kDa Omp, 25 kDa Omp, and 10 kDA Om lipoprotein. All brucellosis antigens together with one or more antigenic portions or epitopes derived therefrom, whether or not presently characterized, that are capable of eliciting an immune response are contemplated.
Meningitis Antigens
A number of N. meningitidis antigens have been identified as potential candidates for vaccine development and are useful in the present invention. For example, Cys6, PorA, PorB, FetA, and ZnuD are antigens suitable for vaccine development. Other exemplary Meningitis antigens suitable for use in the present invention include O-antigen, factor H binding protein (fHbp), TbpB, NspA, NadA, outer membrane proteins, group B CPS, secreted proteins and lipopolysaccharide. All menigitis antigens together with one or more antigenic portions or epitopes derived therefrom, whether or not presently characterized, that are capable of eliciting an immune response are contemplated.
Dengue Antigens
A number of Flavivirus antigens have been identified as potential candidates for vaccine development to treat dengue fever and are useful in the present invention. For example, dengue virus envelope proteins E1-E4 and the membrane proteins M1-M4 are antigens suitable for vaccine development. Other exemplary dengue antigens suitable for use in the present invention include C, preM, 1, 2A, 2B, 3, 4A, 4B and 5. All dengue antigens together with one or more antigenic portions or epitopes derived therefrom, whether or not presently characterized, that are capable of eliciting an immune response are contemplated.
Ebola Antigens
A number of ebola virus antigens have been identified as potential candidates for vaccine development to treat ebola infection and are useful in the present invention. For example, Filoviridae Zaire ebolavirus and Sudan ebolavirus virion spike glycoprotein precursor antigens ZEBOV-GP, and SEBOV-GP, respectively, are suitable for vaccine development. Other exemplary ebola antigens suitable for use in the present invention include NP, vp35, vp40, GP, vp30, vp24 and L. All ebola antigens together with one or more antigenic portions or epitopes derived therefrom, whether or not presently characterized, that are capable of eliciting an immune response are contemplated.
West Nile Antigens
A number of West Nile virus antigens have been identified as potential candidates for vaccine development to treat infection and are useful in the present invention. For example, Flavivirus envelope antigen (E) from West Nile virus (WNV) is a non-toxic protein expressed on the surface of WNV virions (WNVE) and are suitable for vaccine development. Other exemplary WNV antigens suitable for use in the present invention include Cp, Prm, NS1, NS2A, NS2B, NS3, NS4A, NS4B and NS5.
All West Nile antigens together with one or more antigenic portions or epitopes derived therefrom, whether or not presently characterized, that are capable of eliciting an immune response are contemplated.
The above-listed or referenced antigens are exemplary, not limiting, of the present invention.
The present invention also relates to pharmaceutical composition comprising an effective amount of a peptide conjugate of the present invention or a pharmaceutically acceptable salt or solvent thereof, and a pharmaceutically acceptable carrier.
The present invention relates to a pharmaceutical composition comprising an effective amount of a peptide of the present invention or a pharmaceutically acceptable salt or solvate thereof, and a pharmaceutically acceptable carrier.
The pharmaceutical compositions may comprise an effective amount of two or more peptides of the invention, two or more peptide conjugates of the invention, or one more peptides of the invention and one or more peptide conjugates of the invention in combination.
The term “pharmaceutically acceptable carrier” refers to a carrier (adjuvant or vehicle) that may be administered to a subject together with the peptide or peptide conjugate of the present invention, or a pharmaceutically acceptable salt or solvent thereof, and a pharmaceutically acceptable carrier.
Pharmaceutically acceptable carriers that may be used in the compositions include, but are not limited to, ion exchangers, alumina, aluminum stearate, lecithin, self-emulsifying drug delivery systems (SEDDS) such as d-α-tocopherol polyethyleneglycol 1000 succinate, surfactants used in pharmaceutical dosage forms such as Tweens or other similar polymeric delivery matrices, serum proteins, such as human serum albumin, buffer substances such as phosphates, glycine, sorbic acid, potassium sorbate, partial glyceride mixtures of saturated vegetable fatty acids, water, salts or electrolytes, such as protamine sulfate, disodium hydrogen phosphate, potassium hydrogen phosphate, sodium chloride, zinc salts, colloidal silica, magnesium trisilicate, polyvinyl pyrrolidone, cellulose-based substances, polyethylene glycol, sodium carboxymethylcellulose, polyacrylates, waxes, polyethylene-polyoxypropylene-block polymers, polyethylene glycol and wool fat. Cyclodextrins such as α-, β-, and γ-cyclodextrin, or chemically modified derivatives such as hydroxyalkylcyclodextrins, including 2- and 3-hydroxypropyl-β-cyclodextrins, or other solubilized derivatives may also be advantageously used to enhance delivery. Oil solutions or suspensions may also contain a long-chain alcohol diluent or dispersant, or carboxymethyl cellulose or similar dispersing agents, which are commonly used in the formulation of pharmaceutically acceptable dosage forms such as emulsions and or suspensions.
The compositions are formulated to allow for administration to a subject by any chosen route, including but not limited to oral or parenteral (including topical, subcutaneous, intramuscular and intravenous) administration.
For example, the compositions may be formulated with an appropriate pharmaceutically acceptable carrier (including excipients, diluents, auxiliaries, and combinations thereof) selected with regard to the intended route of administration and standard pharmaceutical practice. For example, the compositions may be administered orally as a powder, liquid, tablet or capsule, or topically as an ointment, cream or lotion. Suitable formulations may contain additional agents as required, including emulsifying, antioxidant, flavouring or colouring agents, and may be adapted for immediate-, delayed-, modified-, sustained-, pulsed- or controlled-release.
The compositions may be formulated to optimize bioavailability, immunogenicity, or to maintain plasma, blood, or tissue concentrations within the immunogenic or therapeutic range, including for extended periods. Controlled delivery preparations may also be used to optimize the antigen concentration at the site of action, for example.
The compositions may be formulated for periodic administration, for example to provide continued exposure. Strategies to elicit a beneficial immunological response, for example those that employ one or more “booster” vaccinations, are well known in the art, and such strategies may be adopted.
The compositions may be administered via the parenteral route. Examples of parenteral dosage forms include aqueous solutions, isotonic saline or 5% glucose of the active agent, or other well-known pharmaceutically acceptable excipients. Cyclodextrins, for example, or other solubilising agents well-known to those familiar with the art, can be utilized as pharmaceutical excipients for delivery of the therapeutic agent.
Examples of dosage forms suitable for oral administration include, but are not limited to tablets, capsules, lozenges, or like forms, or any liquid forms such as syrups, aqueous solutions, emulsions and the like, capable of providing a therapeutically effective amount of the composition. Capsules can contain any standard pharmaceutically acceptable materials such as gelatin or cellulose. Tablets can be formulated in accordance with conventional procedures by compressing mixtures of the active ingredients with a solid carrier and a lubricant. Examples of solid carriers include starch and sugar bentonite.
Active ingredients can also be administered in a form of a hard shell tablet or a capsule containing a binder, e.g., lactose or mannitol, a conventional filler, and a tabletting agent.
Examples of dosage forms suitable for transdermal administration include, but are not limited, to transdermal patches, transdermal bandages, and the like.
Examples of dosage forms suitable for topical administration of the compositions include any lotion, stick, spray, ointment, paste, cream, gel, etc., whether applied directly to the skin or via an intermediary such as a pad, patch or the like.
Examples of dosage forms suitable for suppository administration of the compositions include any solid dosage form inserted into a bodily orifice particularly those inserted rectally, vaginally and urethrally.
Examples of dosage of forms suitable for injection of the compositions include delivery via bolus such as single or multiple administrations by intravenous injection, subcutaneous, subdermal, and intramuscular administration or oral administration.
Examples of dosage forms suitable for depot administration of the compositions and include pellets of the peptides or peptide conjugates or solid forms wherein the peptides or peptide conjugates are entrapped in a matrix of biodegradable polymers, microemulsions, liposomes or are microencapsulated.
Examples of infusion devices for the compositions include infusion pumps for providing a desired number of doses or steady state administration, and include implantable drug pumps.
Examples of implantable infusion devices for compositions include any solid form in which the peptides or peptide conjugates are encapsulated within or dispersed throughout a biodegradable polymer or synthetic, polymer such as silicone, silicone rubber, silastic or similar polymer.
Examples of dosage forms suitable for transmucosal delivery of the compositions include depositories solutions for enemas, pessaries, tampons, creams, gels, pastes, foams, nebulised solutions, powders and similar formulations containing in addition to the active ingredients such carriers as are known in the art to be appropriate. Such dosage forms include forms suitable for inhalation or insufflation of the compositions, including compositions comprising solutions and/or suspensions in pharmaceutically acceptable, aqueous, or organic solvents, or mixture thereof and/or powders. Transmucosal administration of the compositions may utilize any mucosal membrane but commonly utilizes the nasal, buccal, vaginal and rectal tissues. Formulations suitable for nasal administration of the compositions may be administered in a liquid form, for example, nasal spray, nasal drops, or by aerosol administration by nebulizer, including aqueous or oily solutions of the polymer particles. Formulations may be prepared as aqueous solutions for example in saline, solutions employing benzyl alcohol or other suitable preservatives, absorption promoters to enhance bio-availability, fluorocarbons, and/or other solubilising or dispersing agents known in the art.
Examples of dosage forms suitable for buccal or sublingual administration of the compositions include lozenges, tablets and the like. Examples of dosage forms suitable for opthalmic administration of the compositions include inserts and/or compositions comprising solutions and/or suspensions in pharmaceutically acceptable, aqueous, or organic solvents.
Examples of formulations of compositions, including vaccines, may be found in, for example, Sweetman, S. C. (Ed.). Martindale. The Complete Drug Reference, 33rd Edition, Pharmaceutical Press, Chicago, 2002, 2483 pp.; Aulton, M. E. (Ed.) Pharmaceutics. The Science of Dosage Form Design. Churchill Livingstone, Edinburgh, 2000, 734 pp.; and, Ansel, H. C., Allen, L. V. and Popovich, N. G. Pharmaceutical Dosage Forms and Drug Delivery Systems, 7th Ed., Lippincott 1999, 676 pp. Excipients employed in the manufacture of drug delivery systems are described in various publications known to those skilled in the art including, for example, Kibbe, E. H. Handbook of Pharmaceutical Excipients, 3rd Ed., American Pharmaceutical Association, Washington, 2000, 665 pp. The USP also provides examples of modified-release oral dosage forms, including those formulated as tablets or capsules. See, for example, The United States Pharmacopeia 23/National Formulary 18, The United States Pharmacopeial Convention, Inc., Rockville Md., 1995 (hereinafter “the USP”), which also describes specific tests to determine the drug release capabilities of extended-release and delayed-release tablets and capsules. The USP test for drug release for extended-release and delayed-release articles is based on drug dissolution from the dosage unit against elapsed test time. Descriptions of various test apparatus and procedures may be found in the USP. Further guidance concerning the analysis of extended release dosage forms has been provided by the F.D.A. (See Guidance for Industry. Extended release oral dosage forms: development, evaluation, and application of in vitro/in vivo correlations. Rockville, Md.: Center for Drug Evaluation and Research, Food and Drug Administration, 1997).
While the composition may comprise one or more extrinsic adjuvants, advantageously in some embodiments this is not necessary. In some embodiments, the peptide conjugate comprises an epitope and is self adjuvanting.
The present invention provides a method of vaccinating or eliciting an immune response in a subject comprising administering to the subject an effective amount of a peptide conjugate or peptide of the present invention. The present invention also relates to use of a peptide conjugate or peptide of the invention for vaccinating or eliciting an immune response in a subject, and to use of a peptide conjugate or a peptide of the invention in the manufacture of a medicament for vaccinating or eliciting an immune response in a subject.
The present invention also provides a method of vaccinating or eliciting an immune response in a subject comprising administering to the subject an effective amount of the pharmaceutical composition of the present invention. The present invention also relates to use of a pharmaceutical composition of the invention for vaccinating or eliciting an immune response in a subject, and to the use of one or more peptides of the present invention or one or more peptide conjugates of the present invention in the manufacture of a medicament for vaccinating or eliciting an immune response in a subject.
The present invention provides a method of eliciting an immune response in a subject comprising administering to the subject an effective amount of a peptide of the present invention. The present invention also relates to use of a conjugate of the invention for eliciting an immune response, and to use of a peptide conjugate of the invention in the manufacture of a medicament for eliciting an immune response in a subject.
The present invention provides a method of vaccinating a subject comprising administering to the subject an effective amount of a peptide of the present invention. The present invention also relates to use of a conjugate of the invention for eliciting an immune response, and to use of a peptide conjugate of the invention in the manufacture of a medicament for eliciting an immune response in a subject.
The administration or use of one or more peptides of the present invention and/or one or more peptide conjugates of the present invention, for example one or more peptide in together with one or more peptide conjugates, for vaccinating or eliciting an immune response in the subject is contemplated herein.
Where two or more peptides, two or more peptide conjugates, or one or more peptides and one or more peptide conjugates are administered or used, the two or more peptides, two or more peptide conjugates, or one or more peptides and one or more peptide conjugates may be administered or used simultaneously, sequentially, or separately.
A “subject” refers to a vertebrate that is a mammal, for example, a human. Mammals include, but are not limited to, humans, farm animals, sport animals, pets, primates, mice and rats.
An “effective amount” is an amount sufficient to effect beneficial or desired results including clinical results. An effective amount can be administered in one or more administrations by various routes of administration.
The effective amount will vary depending on, among other factors, the disease indicated, the severity of the disease, the age and relative health of the subject, the potency of the compound administered, the mode of administration and the treatment desired. A person skilled in the art will be able to determine appropriate dosages having regard to these any other relevant factors.
The efficacy of a composition can be evaluated both in vitro and in vivo. For example, the composition can be tested in vitro or in vivo for its ability to induce a cell-mediated immune response. For in vivo studies, the composition can be fed to or injected into an animal (e.g., a mouse) and its effects on eliciting an immune response are then assessed. Based on the results, an appropriate dosage range and administration route can be determined.
The composition may be administered as a single dose or a multiple dose schedule. Multiple doses may be used in a primary immunisation schedule and/or in a booster immunisation schedule.
In certain embodiments, eliciting an immune response comprises raising or enhancing an immune response. In exemplary embodiments, eliciting an immune response comprises eliciting a humoral and a cell mediated response.
In certain embodiments, eliciting an immune response provides immunity.
The immune response is elicited for treating a disease or condition. A person skilled in the art will appreciate that the peptides and peptide conjugates described herein are useful for treating a variety of diseases and conditions, depending, for example, on the nature of epitope.
In some embodiments, the diseases or conditions are selected from those associated with the various antigens described herein.
In some embodiments an infectious disease, cancer, or viral re-activation post-bone marrow transplant or following induction of profound immunosuppression for any other reason.
The term “treatment”, and related terms such as “treating” and “treat”, as used herein relates generally to treatment, of a human or a non-human subject, in which some desired therapeutic effect is achieved. The therapeutic effect may, for example, be inhibition, reduction, amelioration, halt, or prevention of a disease or condition.
The compositions may be used to elicit systemic and/or mucosal immunity. Enhanced systemic and/or mucosal immunity may be reflected in an enhanced TH1 and/or TH2 immune response. The enhanced immune response may include an increase in the production of IgG1 and/or IgG2a and/or IgA.
1.1 General Details
Commercially available starting materials were purchased from Acros Organics, Ajax Finechem, Alfa Aesar, CEM, GL-Biochem, Merck, NOVA Biochem, Sigma Aldrich and TCI and were used as supplied. Dried solvents were prepared through distillation under N2 or argon atmosphere. Tetrahydrofuran (THF) was freshly distilled over sodium/benzophenone ketyl. Methanol (MeOH) and toluene were freshly distilled over calcium hydride. Yields refer to chromatographically and spectroscopically (1H NMR) homogenous materials unless otherwise stated.
Thin layer chromatography (TLC) was performed on Merck Kieselgel F254 200 μm silica plates. Ultraviolet light was used as a visualising agent and the general developing agents of potassium permanganate in an aqueous basic solution and vanillin in an ethanolic solution. Specific developing agents used were ethanolic solutions of ninhydrin with acid for the identification of primary amines. Heating was applied when using any developing agent. Silica gel (0.063-0.100 mm) was used for flash column chromatography.
Nuclear magnetic resonance (NMR) spectra were acquired at room temperature in CDCl3 or D2O on a Bruker DRX400 spectrometer operating at 400 MHz for 1H nuclei and 100 MHz for 13C nuclei. Reference peaks for 1H and 13C spectra were respectively set to 50.00 and δ 77.0 for CDCl3 and δ4.79 for 1H spectra in D2O. NMR data were reported in values of chemical shift as parts per million (ppm) on the δ scale, and coupling constants in hertz (Hz). Multiplicities were reported as s=singlet, d=doublet, t=triplet, q=quartet, dd=doublet of doublets, dt=doublet of triplets, tt=triplet of triplets, dq=doublet of quartets, dqn=doublet of quintets, sx=sextet, br s=broad singlet, and m=multiplet. The assignment of Cq was used to denote a quaternary carbon.
High resolution mass spectra were obtained on a Bruker microOTOF-Q II mass spectrometer at a nominal resolution of 5000. Analytical high-performance liquid chromatography (HPLC) and liquid chromatography-mass spectrometry (LC-MS) chromatograms were acquired on either a Dionex UltiMate 3000 HPLC system with a Finnigan Surveyor MSQ Plus mass spectrometer or an Agilent 1120 Compact LC system with a Hewlett Packard Series 1100 MSD mass spectrometer. Analytical reverse phase (RP) HPLC was performed using the MeCN/H2O+0.1% TFA solvent system. Semipreparative RP HPLC was performed on a Dionex UltiMate 3000 HPLC system using the MeCN/H2O+0.1% TFA solvent system. Microwave reactions were performed using a CEM Liberty Automated Microwave system.
1.2 General Method for Peptide Chain Elongation
Manual Synthesis Method
Swelled peptide-resin was treated with 20% v/v/piperidine in DMF (5.0 mL) and shaken for 20 min at r.t. The solution was drained and the resin washed with DMF (×2) and DCM (×2). A coupling mixture of Fmoc-AA-OH (2.0 eq.), HBTU (2.0 eq) and iPr2NEt (4.0 eq.) in DMF (1 mL) was added and the resin shaken for 1 hr. Resin was drained and washed again. The procedure was repeated for the remaining residues in the sequence.
Automated Synthesis Method (Standard, 0.2 Mmol Scale)
Peptido-resin was transferred to the reaction vessel of a Tribute automated peptide synthesiser. Automated synthesis was undertaken with cycles of Fmoc deprotection and Fmoc-AA-OH coupling steps. Deprotection was undertaken by addition of 20% v/v piperidine in DMF (6.0 mL) and agitation (2×7 min). Following resin drainage and DMF washing (4 mL×3), a coupling step was performed with 5 eq. Fmoc-AA-OH dissolved in HBTU (0.24 mM, in DMF, 4 mL). 2 M N-methylmorpholine (NMM) in DMF (4 mL) was utilised in the base-addition step. Coupling proceeded for 1 hr. After DMF washing steps, the next cycle of deprotection and coupling commenced, repeating until all amino acids were coupled.
Procedure for Coupling of Cysteine Derivatives (0.1 Mmol Scale)
Peptido-resin was swelled in 1:1 CH2Cl2: DMF for 30 min, then drained. A coupling mixture of a Cys amino acid (0.2 mmol, 2 eq.), BOP (0.4 mmol, 4 eq.) and HOBt.H2O (0.4 mmol, 4 eq.) was dissolved in 1:1 CH2Cl2: DMF (2 mL). 2,4,6-collidine (0.4 mmol, 4 eq.) was then added and the resultant solution added to the peptido-resin. The resin was agitated for 1 hr, or until ninhydrin test indicated no free amines. The resin was then drained, washed with DMF (2×) and CH2Cl2 (2×), and dried.
Ninhydrin Test Procedure
A small portion of resin was taken, washed with CH2Cl2 and allowed to dry. 1 drop each of solutions of 5% v/v ninhydrin in EtOH, 80% w/v phenol in EtOH and 2% v/v KCN in pyridine were added to the resin and the mixture heated at 90° C. for 2 minutes. Blue-coloured beads and solution indicated the presence of free primary amines, while a yellow colour indicated no free amino groups present.
1.3 Preparation of Amino Add Conjugate 200
N-Fluorenylmethoxycarbonyl-[R]-cysteine
Fmoc-Cys(Trt)-OH (1.0 g, 1.7 mmol) was dissolved in CH2Cl2 (50 mL). TFA (1.5 mL, 19.6 mmol) and iPr3SiH (0.75 mL) were added, causing the solution to turn yellow. The solution was agitated for 2 hrs at room temperature, at which point the solution had turned colourless. The mixture was basified to pH 9 by addition of Na2CO3.H2O and washed with EtOAc. The solution was acidified with 10M HCl, extracted with EtOAc and concentrated in vacuo to give a white powder and a pink residue. The powder and residue were dissolved in 4:1 MeCN: H2O and lyophilised, giving a crude pink-white powder (424 mg, crude yield 73.1%). This crude product was carried through to the thiol-ene reactions described below.
Thermal Initiation (Li, J. Dong, S. et al. Chemistry as an Expanding Resource in Protein Science: Fully Synthetic and Fully Active Human Parathyroid Hormone-Related Protein (1-141). Angewandte Chemie International Edition 2012, 51 (49), 12263-12267).
Fmoc-Cys-OH (100 mg, 0.29 mmol), vinyl palmitate (476 μL, 1.5 mmol) and AIBN (9.6 mg, 59 μmol) were dissolved in degassed 1,2-dichloroethane (3 mL). The reaction mixture was then heated under reflux (90° C.) for 24 hr, after which TLC indicated complete consumption of Fmoc-Cys-OH. The solution was then allowed to cool to r.t. The solvent was removed under reduced pressure. Presence of the desired product 200 in the crude reaction mixture was confirmed by mass spectrometry.
MS (ESI−): For C36H51NO6S− [M−H]− m/z calcd. 625.96 found 626.0
Photo-Initiation
Fmoc-Cys-OH (100 mg, 0.29 mmol) was dissolved in degassed, anhydrous DMF (500 μL). Vinyl palmitate (90 μL, 0.3 mmol) and DMPA (5.0 mg, 20 μmol) were dissolved in degassed CH2Cl2 (200 μL). The two solutions were combined and the resultant mixture irradiated for 6 hr (365 nm UV) in a standard photochemical apparatus. When no further change in the reaction mixture could be observed by TLC, solvent was removed under reduced pressure. The crude product was purified by silica gel flash chromatography (3:1 EtOAc:n-hexanes+2% AcOH), followed by lyophilization from 1:1 H2O:MeCN+0.1% TFA to afford the title compound as a powdery white solid (24 mg, 13%). Structure of the desired product 200 was confirmed by mass spectrometry.
MS (ESI−): For C36H51NO6S− [M−H]− m/z calcd. 625.96 found 626.0
1.4 Preparation of Peptide Conjugates 20, 22, and 26
Peptides
To aminomethyl polystyrene (PS) resin (0.20 g, 1.0 mmol/g loading, 0.2 mmol scale) pre-swelled in 1:1 CH2Cl2: DMF was added a coupling mixture of Fmoc-L-Val-O—CH2-phi-OCH2-CH2—COOH (155.2 mg, 0.3 mmol), HBTU (113.8 mg, 0.3 mmol) and iPr2NEt (104 μL, 0.6 mmol) in DMF (3 mL). The resin was shaken for 2 hrs at r.t., after which a ninhydrin test indicated complete coupling. The Fmoc-Val amino group was then deprotected by treatment of the resin with 20% v/v piperidine in DMF (5 mL) for 20 mins at r.t. The resin was transferred to a Tribute automated peptide synthesiser. Chain elongation up to and including the Ser residue was performed using the general automated coupling method. Coupling of the Fmoc-Cys(Trt)-OH residue was performed manually with addition of a mixture of Fmoc-Cys(Trt)-OH (235 mg, 0.4 mmol), BOP (360 mg, 0.8 mmol), HOBt.H2O (120 mg, 0.8 mmol) and 2,4,6-collidine (120 μL, 0.8 mmol) in 1:1 CH2Cl2: DMF (2 mL). The resin was shaken for 1 hr at r.t., after which a ninhydrin test indicated complete coupling. Final Fmoc deprotection was accomplished by treatment of the resin with 20% v/v piperidine in DMF (5 mL) for 20 mins at r.t.
After Fmoc deprotection, N-acetylation was performed by adding acetic anhydride (50 μL) and iPr2NEt (50 μL) in DMF (3 mL) to the resin. The resin was then shaken for 30 min at r.t., after which a ninhydrin test indicated no remaining free amines. The resin was drained, washed with DMF and CH2Cl2 and air dried. A cleavage cocktail of TFA:H2O:DODT:iPr3SiH (94:2.5:2.5:1% v/v, 10.0 mL) was added to the dry resin and the mixture shaken for 4 hr at r.t. The cleavage cocktail was then treated with cold diethyl ether to precipitate the crude peptide, which was centrifuged at 4000 rpm for 5 minutes. The supernatant was discarded and the pellet washed with diethyl ether, before repeating the spinning step. The ether phase was then discarded and the peptide dried with N2 flow. The crude peptide was then lyophilised from H2O+0.1% TFA. The crude product was carried through to the thiol-ene reaction step outlined below.
MS (ESI+): For C74H14N20O20S2+ [M+H]+ m/z calcd. 1688.11 found 1688.8
To aminomethyl polystyrene (PS) resin (0.20 g, 1.0 mmol/g loading, 0.2 mmol scale) pre-swelled in 1:1 CH2Cl2: DMF was added a coupling mixture of Fmoc-Rink-Amide-OH (216 mg, 0.4 mmol), HBTU (151.8 mg, 0.4 mmol) and iPr2NEt (140 μL, 0.8 mmol) in DMF (2 mL). The resin was shaken for 1 hr at r.t., after which a ninhydrin test indicated complete coupling. The linker amino group was then deprotected by treatment of the resin with 20% v/v piperidine in DMF (5 mL) for 20 mins at r.t. The resin was transferred to a Tribute automated peptide synthesiser. Chain elongation up to and including the Ser residue was performed using the general automated coupling method. Coupling of the Cys residue was performed manually with addition of a mixture of Fmoc-Cys(Trt)-OH (235 mg, 0.4 mmol), BOP (360 mg, 0.8 mmol), HOBt.H2O (120 mg, 0.8 mmol) and 2,4,6-collidine (120 μL, 0.8 mmol) in 1:1 CH2Cl2: DMF (2 mL). The resin was shaken for 1 hr at r.t., after which a ninhydrin test indicated complete coupling. Final Fmoc deprotection was accomplished by treatment of the resin with 20% v/v piperidine in DMF (5 mL) for 20 mins at r.t. The resin was drained, washed with DMF and CH2Cl2 and air dried. A cleavage cocktail of TFA:H2O:DODT:iPr3SiH (94:2.5:2.5:1% v/v, 10.0 mL) was added to the dry resin and the mixture shaken for 2 hr at r.t. The cleavage cocktail was then treated with cold diethyl ether to precipitate the crude peptide, which was centrifuged at 4000 rpm for 5 minutes. The supernatant was discarded and the pellet washed with diethyl ether, before repeating the spinning step. The ether phase was then discarded and the peptide dried with N2 flow. The crude peptide was then lyophilised from H2O+0.1% TFA. The crude product was carried through to the thiol-ene reaction step outlined below.
MS (ESI+): For C30H61N11O7S+ [M+H]+ m/z calcd. 719.94 found 720.0
To aminomethyl polystyrene (PS) resin (0.20 g, 1.0 mmol/g loading, 0.2 mmol scale) pre-swelled in 1:1 CH2Cl2: DMF was added a coupling mixture of Fmoc-Rink-Amide-OH (216 mg, 0.4 mmol), HBTU (151.8 mg, 0.4 mmol) and iPr2NEt (140 μL, 0.8 mmol) in DMF (2 mL). The resin was shaken for 1 hr at r.t., after which a ninhydrin test indicated complete coupling. The linker amino group was then deprotected by treatment of the resin with 20% v/v piperidine in DMF (5 mL) for 20 mins at r.t. The resin was transferred to a Tribute automated peptide synthesiser. Chain elongation up to and including the Ser(Trt) residue was performed using the general automated coupling method. Coupling of the Cys residue was performed manually with addition of a mixture of Fmoc-Cys(Trt)-OH (235 mg, 0.4 mmol), BOP (360 mg, 0.8 mmol), HOBt.H2O (120 mg, 0.8 mmol) and 2,4,6-collidine (120 μL, 0.8 mmol) in 1:1 CH2Cl2: DMF (2 mL). The resin was shaken for 1 hr at r.t., after which a ninhydrin test indicated complete coupling. After Fmoc deprotection, N-acetylation was performed by adding acetic anhydride (50 μL) and iPr2NEt (50 μL) in DMF (3 mL) to the resin. The resin was then shaken for 30 min at r.t., after which a ninhydrin test indicated no remaining free amines. The resin was drained, washed with DMF and CH2Cl2 and air dried. A cleavage cocktail of TFA:H2O:DODT:iPr3SiH (94:2.5:2.5:1% v/v, 10.0 mL) was added to the dry resin and the mixture shaken for 2 hr at r.t. The cleavage cocktail was then treated with cold diethyl ether to precipitate the crude peptide, which was centrifuged at 4000 rpm for 5 minutes. The supernatant was discarded and the pellet washed with diethyl ether, before repeating the spinning step. The ether phase was then discarded and the peptide dried with N2 flow. The crude peptide was then lyophilised from H2O+0.1% TFA. The crude product was carried through to the thiol-ene reaction step outlined below.
MS (ESI+): For C32H63N11O8S+ [M+H]+ m/z calcd. 761.98 found 762.0
Peptide Conjugates
Thiol-ene Reaction Product of Ac-Cys-Ser-Lys-Lys-Lys-Lys-NH2 24 [SEQ ID NO: 22] and Vinyl Palmitate 22
To crude peptide 24 [SEQ ID NO: 22] (25 mg, 32.6 μmol) and DMPA (3.3 mg, 13.1 μmol) in a solution of NMP (4 mL) was added vinyl palmitate (52.9 μL, 0.16 mmol). The resultant mixture was irradiated, with agitation, at 365 nm for 1 hr in a standard UV photochemical apparatus. The desired product 22 [comprises SEQ ID NO: 22] was detected by mass analysis. The crude product 22 [comprises SEQ ID NO: 22] was purified via semi-preparative RP HPLC on a Phenomenex Gemini C18 column running a gradient of 5-65% MeCN:H2O+0.1% TFA (3% MeCN per min, 50° C.). Mass spectrometry confirmed the structure of the desired product 22 [comprises SEQ ID NO: 22] (5.1 mg, 14.94% ‘from crude’).
Rt=11.50 min on a Phenomenex Gemini C18 3μ 110 Å 2.0×50 mm column using a 5-95% MeCN:H2O+0.1% TFA, 3% MeCN per min gradient; MS (ESI+): For C50H97N11O10S+ [M+H]+ m/z calcd. 1044.4 found 1044.9
Thiol-ene Reaction Product of Cys-Ser-Lys-Lys-Lys-Lys-NH2 [SEQ ID NO: 22] and Vinyl Palmitate 20
The thiol-ene reaction of crude Cys-Ser-Lys-Lys-Lys-Lys-NH2 [SEQ ID NO: 22] with 5 eq. vinyl palmitate, 0.4 eq. DMPA in NMP, 1 hr irradiation at 365 nm gave the desired product 20 (Pam-CSK4) [comprises SEQ ID NO: 22] by MS analysis.
Thiol-ene Reaction Product of Ac-Cys-Ser-Lys-Lys-Lys-Lys-Asn-Leu-Val-Pro-Met-Val-Ala-Thr-Val-OH 25 [SEQ ID NO: 21] and Vinyl Palmitate 26
To crude peptide 25 [SEQ ID NO: 21] (20 mg, 11.9 μmol) and DMPA (1.2 mg, 4.74 μmol) in a solution of NMP (3 mL) was added vinyl palmitate (19.2 μL, 59.3 μmol). The resultant mixture was irradiated, with agitation, at 365 nm for 1 hr in a standard photochemical apparatus. The desired product 26 [comprises SEQ ID NO: 21] was detected by mass analysis. The crude product 26 [comprises SEQ ID NO: 21] was purified via semi-preparative RP HPLC on a Phenomenex Gemini C18 column running a gradient of 5-65% MeCN:H2O+0.1% TFA (3% MeCN per min, 50° C.). Mass spectrometry confirmed the structure of the desired product 26 [comprises SEQ ID NO: 21] and the oxidised Met(O) by-product (1.67 mg, 7.15% ‘from crude’—including Met(O) product).
Rt=11.90 min on a Phenomenex Gemini C18 3μ 110 Å 2.0×50 mm column using a 5-95% MeCN:H2O+0.1% TFA, 3% MeCN per min gradient; MS (ESI+): For C92H168N20O2S2+ [M+2H]2+ m/z calcd. 985.1 found 993.6 (Met(O))
1.5 General Method for Thiol-Ene Reaction on Peptides
To crude or purified peptide (10 mM), DTT (30 mM) and DMPA (4 mM) in a solution of DMSO was added vinyl palmitate (50 mM). The resultant mixture was irradiated, with agitation, at 365 nm for 15 min in a standard UV photochemical apparatus. The desired product was detected by ESI mass analysis. To achieve full conversion, further addition of DMPA photoinitiator was sometimes required. The crude product was purified via semi-preparative RP HPLC on a Phenomenex Gemini C18 column running a gradient of 1-65% MeCN:H2O+0.1% TFA (3% MeCN per min). Pooled fractions were lyophilised to afford the pure products as white powders.
1.6 Discussion
The thermal reaction of Fmoc-Cys-OH with vinyl palmitate was conducted in 1,2-dichloroethane, using 5 equivalents of alkene and 0.2 eq. of AIBN as radical initiator.
The reaction was performed under reflux (90 degrees) for 24 hrs. Microwave heating (100W, 1 hr) produced the same result. The desired product was detected by TLC. A number of by-products were also formed.
Photo-initiation of the reaction was conducted with 1 eq. vinyl palmitate and 0.2 eq. DMPA as the photo-initiator. Reactions were conducted in a degassed DMF:DCM solvent mixture, irradiated for 1 hr with 365 nm UV light in a standard photo-chemical apparatus. Near complete conversion of the Fmoc-Cys-OH was observed by TLC. Minimal by-products were formed. Purification provided the product 200 in about 15% yield. Using 2 eq. vinyl palmitate provided 200 in 44% yield after purification.
The thiol-ene reaction was carried out using NAc-CSK4 [comprises SEQ ID NO: 22]. The required peptide motif 24 [SEQ ID NO: 22] was synthesised as described above. Following attachment of Rink-Amide linker to aminomethyl resin, the SK4 sequence was built up using automated Fmoc-SPPS (standard coupling conditions). Fmoc-Cys(Trt)-OH was then coupled manually using conditions to reduce epimerisation. N-acetylation was then carried out.
Mass analysis indicated that that by-product formation was occurring upon cleavage of the peptide from the resin, due to tert-butylation (+56) of cysteine. Repeating the synthesis of NAc-CSK4 [comprises SEQ ID NO: 22] utilising Fmoc-Ser(Trt)-OH, instead of Fmoc-Ser(t-Bu)-OH, resulted in a product free of the cysteine-alkylation product. The peptide was cleaved and then lyophilised.
The thiol-ene reaction of crude peptide 24 [SEQ ID NO: 22] with vinyl palmitate was then carried out. N-methylpyrrolidone (NMP) effectively solvated both the hydrophilic CSK4 peptide [SEQ ID NO: 22] and the hydrophobic vinyl palmitate molecule.
Thermal initiation using AIBN and microwave heating was carried out on both crude and purified peptide using excess of vinyl palmitate (up to 20 eq.). Photo-initiation of the reaction provided better results. Using crude peptide with DMPA as photo-initiator, the reaction proceeded to completion following 1 hr of irradiation (5 eq. vinyl palmitate, 0.4 eq. DMPA in 2 mL NMP). The desired product was confirmed by MS (>90% conversion, 60% purity by HPLC).
Advantageously, no purification after cleavage was required before the thiol-ene coupling. Purification by RP-HPLC is typically inefficient, with >50% loss of material being common. Generally, it is advantageous to reduce the number of HPLC purification steps required wherever possible.
Purification of the N-acetylated monoacyl lipopeptide 22 [comprises SEQ ID NO: 22] was achieved by semi-preparative RP-HPLC using a Phenomenex C18 column, running a gradient of 5-95% MeCN:H2O+0.1% TFA, 3% MeCN per min. The purified peptide was then lyophilised to afford the desired product as a white powder (5.1 mg, 14.9% from crude peptide). The relatively low yield may be due to by-product formation in the thiol-ene reaction.
Increasing the peptide concentration to 25 mM led to a small decrease in by-product formation (>90% conversion, 80% purity by HPLC). Decreasing the concentration to 5 mM had the opposite effect.
Carrying out the reaction in a mixture of NMP:H2O:DMSO (4:2:1) in the presence of glutathione (GSH) (3 eq.) with a peptide concentration of 5 mM resulted in mixed disulfide formation (50% conversion, 75% purity by HPLC). Using 2,2′-(ethylenedioxy)diethanethiol (DODT) (3 eq.) in NMP with a peptide concentration of 5 mM led to a complex mixture of products (80% conversion by HPLC).
Advantageously, upon addition of 3 eq. DTT to the reaction mixture (10 mM peptide in NMP) no by-products resulting from vinyl palmitate telomerisation, or mixed disulfides, were observed and the reaction proceeded with high conversion (>90%0 conversion, 85% purity by HPLC). Using DTT it was also possible to conduct the reaction (25 mM peptide) in DMSO, a benign and more versatile solvent (90% conversion, >95% purity by HPLC).
The thiol-ene reaction was also carried out using non-acetylated analogue CSK4 [SEQ ID NO: 22]. Synthesis of the CSK4 [SEQ ID NO: 22] motif was carried out utilising the procedure described above. The peptide was then cleaved from resin and lyophilised. The thiol-ene reaction of the crude product with vinyl palmitate proceeded smoothly using 5 eq. vinyl palmitate, 0.4 eq. DMPA in NMP, 1 hr irradiation at 365 nm to give the desired product 20 (Pam-CSK4) [comprises SEQ ID NO: 22] by MS analysis.
The thiol-ene reaction of vinyl palmitate with an immunodominant A*0200 restricted epitope derived from the cytomeglovirus (CMV) ppUL83 protein (‘NLV peptide’) (Kopycinski, J. et al., Sequence flexibility of the immunodominant HLA A* 0201 restricted ppUL83 CD8 T-cell of human cytomegalovirus. Journal of medical virology 2009, 82 (1) 94-103) was also carried out.
The NLV sequence was built up by automated Fmoc-SPPS, using standard conditions. A K4 tag and a serine residue were then coupled to the N-terminus of the sequence. The peptidyl resin was then removed from the synthesiser and the cysteine residue coupled manually, using standard conditions. N-acetylation was then carried out. The peptide was then cleaved from the resin and lyophilised to give a white powder in good yield.
The thiol-ene reaction of the unprotected peptide 25 [SEQ ID NO: 21] and vinyl palmitate was carried out using photo-initiation, as described for peptides 20 [comprises SEQ ID NO: 22] and 22 [comprises SEQ ID NO: 22]. Mass analysis indicated conversion to the palmitoylated product 26 [comprises SEQ ID NO: 21]. Purification was accomplished by semi-preparative RP-HPLC using a Phenomenex C18 column, running a gradient of 5-95% MeCN:H2O with 0.1% TFA. The purified peptide was lyophilised to provide the desired product as a white powder (7.5%), along with the corresponding Met(O) product (˜30%).
The thiol-ene reaction of crude 25 [SEQ ID NO: 21] with vinyl palmitate was also carried out following the general procedure described above. ESI-MS and HPLC analysis indicated good conversion to the palmitoylated product 26 [comprises SEQ ID NO: 21](FIGS. 2a and 2b). Purification was accomplished by semi-preparative RP-HPLC, to give the desired product in >95% purity (FIGS. 2b and 2c).
2.1 Procedures
Activation of Human Monocytes in Whole Blood
100 μl of heparinised whole blood (WB) was incubated with 100 nM, 1 μM and 10 μM of each compound, in duplicate, and incubated overnight at 37° C. in a 5% CO2 humidified incubator. Pam3CSK4 [comprises SEQ ID NO: 22] (10 μM; EMC Microcollections) was used as a positive control. To detect activation of monocytes, WB samples were stained with anti-CD14-FITC, anti-HLA-DR-Alexa700, anti-CD80-PE-Cy7, anti-CD40-PE, anti-CD86-APC, anti-CD16-APC-Cy7 (all from Biolegend) for 20 mins at RT, protected from light. Following incubation, 2 ml of BD FACS lyse (BD Biosciences) was added, incubated for 15 mins at RT, then washed twice with ice cold wash buffer (PBS, 1% Human Serum). Data acquisition was performed on a BD FACS Aria II (Becton Dickinson) and analysed using FlowJo software version 7.6.5 (TreeStar). CD80 receptor expression on monocytes was detected by gating on CD14+ HLADR+ cells.
2.2 Discussion
The bioactivity of lipopeptides 20 [comprises SEQ ID NO: 22], 22 [comprises SEQ ID NO: 22], and 26 [comprises SEQ ID NO: 21], was assessed by flow cytometry to measure up-regulation of the co-stimulatory molecule CD80 on human monocytes in fresh blood samples (FIG. 1).
Monocytes were identified in five donor samples by characteristic cell surface markers, and the expression of CD80 determined before and after exposure to each compound at three dosages, with commercially available Pam3CSK4 [comprises SEQ ID NO: 22] (10 μM) serving as a positive control.
22 [comprises SEQ ID NO: 22] and 26 [comprises SEQ ID NO: 21] both strongly upregulated expression of CD80 at all doses tested, demonstrating equivalent potency to Pam3CSK4 [comprises SEQ ID NO: 22] at the 10 μM dose in most donors.
In three donors, 20 [comprises SEQ ID NO: 22] showed lower potency than 22 [comprises SEQ ID NO: 22] and 26 [comprises SEQ ID NO: 21], consistent with acetylation of the cysteine amino group improving potency of TLR2 agonism in human cells. The potency of 26 [comprises SEQ ID NO: 21] demonstrates that conjugation of antigenic peptides does not affect TLR2 agonism.
3.1 General Details
Protected amino acids and coupling reagents were purchased from GL-Biochem (Shanghai). The resins used in the solid-supported syntheses were preloaded tentagel resins from Rapp Polymere GmbH (Tuebingen) and other solvents and reagents were obtained from Sigma (St Louis, Mo.) and Novabiochem.
The peptide syntheses described below were carried out using standard iterative Fmoc Solid-Phase Peptide Synthesis techniques on a Tribute peptide synthesiser (Protein Technologies International, Tucson, Ariz.). A typical deprotection and coupling cycle carried out on a 0.1 mmol scale entailed removal of the Fmoc protecting group from the resin-bound amino-acid using two treatments of 20% piperidine in DMF (4 mL×5 min) then washing the resin with DMF. In a separate vessel the Fmoc amino acid (0.5 mmol) and coupling agent (1-[bis(dimethylamino)methylene]-1H-1,2,3-triazolo[4,5-b]pyridinium 3-oxid hexafluorophosphate (HATU), 0.45 mmol) were dissolved in DMF (1.5 mL) and base (4-methylmorpholine, 1 mmol) added. After mixing for 1 minute, this solution was transferred to the resin, which was agitated at RT for 1 hour, drained and washed.
Cleavage of the peptide (0.1 mmol scale) was achieved by suspending the resin in 5 mL trifluoroacetic acid (TFA) containing 5% (v/v) ethanedithiol (EDT) and agitating at room room temperature for 3 hours. Triisopropylsilane (TIPS) was then added to 1% (v/v) and agitation continued for a further five minutes before draining the TFA into chilled diethyl ether (40 mL). The precipitated material was pelleted by centrifugation, the ether discarded, the pellet washed once with ether (25 mL) and air-dried or lyophilised.
Reverse phase (RP)-HPLC was carried out using a Dionex Ultimate 3000 HPLC system. For semi-preparative purifications, a peptide sample was injected into a reverse-phase Phenomenex Gemini C18 column (5μ, 110 Å; 10×250 mm) equilibrated in a suitable mixture of eluent A (water/0.1% TFA) and eluent B (MeCN/0.1% TFA) then an increasing gradient of eluent B was generated to elute the constituent components. Analytical HPLC was performed similarly, using a Phenomenex Gemini C18 column (3μ, 110 Å; 4.6×150 mm).
Low-resolution mass spectra were obtained using an Agilent Technologies 6120 Quadrapole mass spectrometer.
NMR spectra were obtained using a Bruker BRX400 spectrometer operating at 400 MHz for 1H NMR and at 100 MHz for 13C NMR.
In the amino acid conjugates and peptide conjugates described below the abbreviations AcN-C(Pam-1)- and H2N—C(Pam-1)-means
wherein R is Ac or H as appropriate.
3.2 Preparation of Peptide Conjugates by Direct Conjugation
Peptides
Peptides 100 [SEQ ID NO: 23], 102 [SEQ ID NO: 24], 103 [SEQ ID NO: 25], 104 [SEQ ID NO: 25], 105 [SEQ ID NO: 26] and 106 [SEQ ID NO: 26] (Table 1) were synthesised as described and depicted below (Scheme 1).
Following synthesis of the peptide sequence up to the penultimate amino acid using iterative Fmoc-SPPS, Fmoc-cysteine was introduced as the N-terminal residue of the on-resin peptide by reaction with Fmoc-Cys(Trt)-OH, HATU, and 4-methylmorpholine in DMF. The Fmoc group was removed using 20% piperidine in DMF. As required, the resulting amine group was converted to an acetamide by treatment with a mixture of 20% acetic anhydride in DMF (2 mL) and 4-methylmorpholine (1 mmol).
Following cleavage of the peptide from resin with TFA/EDT and its precipitation in ether, the solid was dissolved in 1:1 water/MeCN and lyophilised. If the peptide contained a methionine residue the solution was heated at 60° C. for 1 hour prior to freeze-drying to reverse any S-alkylation that may have occurred during cleavage. The peptides were then purified by RP-HPLC to give material of >95%.
Peptide 102 [SEQ ID NO: 24] was synthesised with the side-chain of the non-terminal cysteine residue as a tert-butyl thioether so as to avoid unwanted side reactions at this location.
| TABLE 1 | |||
| Peptide | |||
| SEQ ID | m/z | ||
| Sequence | NO | [M + 3H+] | |
| 100 | AcHN-CSKKKVKNLVPMVATVK(Ac)-C(O)NH2 | 23 | 619.7 |
| 102 | AcHN- | 24 | 1357.8 |
| CSKKKKLQQLSLLMWITQC(tBu)FLPVFLAQPPSGQRR- | |||
| OH | |||
| 103 | H2N- | 25 | 1625.5 |
| CSKKKKGARGPESRLLEFYLAMPFATPMEAELARRSLAQDAPPL- | |||
| OH | |||
| 104 | AcHN- | 25 | 1639.9 |
| CSKKKKGARGPESRLLEFYLAMPFATPMEAELARRSLAQDAPPL- | |||
| OH | |||
| 105 | H2N-CSKKKKVPGVLLKEFTVSGNILTIRLTAADHR-OH | 26 | 1174.8 |
| 106 | AcHN-CSKKKKVPGVLLKEFTVSGNILTIRLTAADHR-OH | 26 | 1188.8 |
Peptide Conjugates
The thiol-ene reaction was then performed on peptides 100 [SEQ ID NO: 24], 102 [SEQ ID NO: 24], 103 [SEQ ID NO: 25], 104 [SEQ ID NO: 25], 105 [SEQ ID NO: 26] and 106 [SEQ ID NO: 26] to generate the corresponding peptide conjugates 110 [comprises SEQ ID NO: 27], 112A [comprises SEQ ID NO: 24], 113 [comprises SEQ ID NO: 25], 114 [comprises SEQ ID NO: 25], 115 [comprises SEQ ID NO: 26] and 116 [comprises SEQ ID NO: 26] (Table 2).
DMPA (2.6 mg), dithiothreitol (9.2 mg), and vinyl palmitate (40 mg, mmol) were dissolved in degassed NMP (2 mL). 100 μL of this solution was then added to 1 μmol of the peptide weighed into a small polypropylene vessel to give a solution containing 10 mM peptide, 5 mM DMPA, 30 mM DTT and 50 mM vinyl palmitate. NMP was compatible with the reaction conditions and effectively solvated all of the components of the reaction mixture.
The reaction vessel was flushed with nitrogen and the vigorously stirred mixture irridiated with a hand-held 6 watt UV lamp (Spectronics, NY) operating at 365 nm. After 30 minutes the reaction was analysed by HPLC and showed conversion to the desired product. The product was then isolated by RP-HPLC and unreacted starting material recovered.
Following purification of 112A [comprises SEQ ID NO: 24] the tert-butyl protecting group of cysteine was removed by treatment with a mixture of triflic acid and trifluoroacetic acid (1:16 v/v) for 3 minutes to cleanly give the fully deprotected lipopeptide 112 [comprises SEQ ID NO: 24] (Table 2A).
The peptides with non-acetylated N-terminal cysteine formed significant amounts of the disulfide dimer, despite the presence of the reducing agent DTT. This was not observed with the corresponding N-acetylated peptides.
Peptide conjugates 110 [comprises SEQ ID NO: 27] and 113 [comprises SEQ ID NO: 25], 114 [comprises SEQ ID NO: 25], 115 [comprises SEQ ID NO: 26] and 116 [comprises SEQ ID NO: 26] were also prepared from peptides 100 [SEQ ID NO: 24], and 103 [SEQ ID NO: 25], 104 [SEQ ID NO: 25], 105 [SEQ ID NO: 26] and 106 [SEQ ID NO: 26] by the following alternative procedure (Table 2B).
In this procedure, tert-butyl mercaptan (tBuSH) thiol was used in place of DTT. This resulted in increased and cleaner conversion of the substrate peptides to the desired peptide conjugate.
Trifluoroacetic acid (TFA) was also introduced to the reaction mixture. This further improved the reaction profile. The formation of oligomers, minor-by-products formed by reaction of the product peptide conjugate with a second molecule of vinyl palmitate to give a bis-palmitoylated species, was largely suppressed by the addition of TFA.
Due to the apparent propensity of methionine to oxidise to the corresponding sulfoxide under these conditions, the crude product mixtures of those peptides possessing methionine groups were lyophilised, dissolved in TFA and treated with tetrabutylammonium iodide to reduce methionine oxide back to methionine.
A typical procedure was as follows. DMPA (6.5 mg) was dissolved in degassed NMP (0.5 mL) and tert-butyl mercaptan (17 μL) added and in a separate vessel vinyl palmitate (11.3 mg) was dissolved in degassed N-methylpyrrolidinone (NMP) (0.5 mL). The peptide (1 μmol) was weighed into a small polypropylene vessel equipped with a small stirrer and 10 μL of the DMPA/tBuSH solution added followed by 100 μL of the vinyl palmitate solution, to give a solution of approximately 10 mM peptide, 5 mM DMPA, 30 mM DTT and 80 mM vinyl palmitate. TFA (5.5 μL) was then added, to give a 5% solution. The reaction vessel was flushed with nitrogen and the vigorously stirred mixture irradiated with a hand-held 6 watt UV lamp (Spectronics, NY) operating at 365 nm. After 20 minutes further DMPA (10 μL) and vinyl palmitate (50 μL) were added and irradiation continued for 20 min.
For those peptides containing methionine, water (0.5 mL) and MeCN (0.5 mL) were added and the mixture lyophilised. The resultant solid was dissolved in neat TFA (150 μL), cooled to 0° C. and tetra-n-butylammonium iodide (3.7 mg, 10 μmol) in 25 μL TFA was added. After 1 minute chilled diethyl ether (0.5 mL) was added to precipitate the reduced lipopeptide, which was pelleted by centrifugation and lyophilised.
The reactions were analysed by HPLC to show conversion to the desired products (Table 2B), which were then isolated by RP-HPLC.
| TABLE 2 | ||||
| Peptide | m/z | |||
| Sequence | SEQ ID NO | Conversion | [M + 4H+] | |
| 110 | AcHN-C(Pam-1)SKKKVKNLVPMVATVK(Ac)-C(O)NH2 | 23 | 54% | 535.6 |
| 112A | AcHN-C(Pam-1)SKKKKLQQLSLLMWITQC(tBu)FLPVFLAQPPSGQRR-OHa | 24 | 44% | 1089.1 |
| 113 | H2N-C(Pam-1)SKKKKGARGPESRLLEFYLAMPFATPMEAELARRSLAQDAPPL- | 25 | 26% | 1289.9 |
| OH | ||||
| 114 | AcHN-C(Pam-1)SKKKKGARGPESRLLEFYLAMPFATPMEAELARRSLAQDAPPL- | 25 | 42% | 1300.4 |
| OH | ||||
| 115 | H2N-C(Pam-1)SKKKKVPGVLLKEFTVSGNILTIRLTAADHR-OH | 26 | 20% | 952.0 |
| 116 | AcHN-C(Pam-1)SKKKKVPGVLLKEFTVSGNILTIRLTAADHR-OH | 26 | 47% | 962.5 |
| aSubsequent deprotection of the Cys(tBu) residue afforded fully deprotected lipopeptide 112 |
| TABLE 2A | |||
| Peptide | |||
| SEQ ID | m/z | ||
| Sequence | NO | [M +4H+] | |
| 112 | AcHN-C(Pam-1)SKKKKLQQLSLLMWITQCFLPVFLAQPPSGQRR- | 24 | 1075.0 |
| OH | |||
| TABLE 2B | ||||
| Peptide | ||||
| SEQ ID | m/z | |||
| Sequence | NO | Conversion | [M + 4H+] | |
| 110 | AcHN-C(Pam-1)SKKKVKNLVPMVATVK(Ac)-C(O)NH2 | 23 | 75% | 535.6 |
| 113 | H2N-C(Pam-1)SKKKKGARGPESRLLEFYLAMPFATPMEAELARRSLAQDAPPL- | 25 | 35% | 1289.9 |
| OH | ||||
| 114 | AcHN-C(Pam-1)SKKKKGARGPESRLLEFYLAMPFATPMEAELARRSLAQDAPPL- | 25 | 41% | 1300.4 |
| OH | ||||
| 116 | AcHN-C(Pam-1)SKKKKVPGVLLKEFTVSGNILTIRLTAADHR-OH | 26 | 74% | 962.5 |
3.3 Preparation of Amino Add Conjugates
Amino acid conjugates 200, 120, and 121 were prepared from N-α-Fmoc-, N-α-acetyl-, and N-α-Boc-protected cysteine, respectively, as described and depicted below (Scheme 2).
(i) Radical initiator, hu (365 nm) or heat PG-71,C3
Solid N-α-protected cysteine was dissolved or suspended to a concentration of 100 mg/mL in the indicated solvent (Table 3) and vinyl palmitate (1.5 molar equivalents) added followed by the indicated quantity of initiator. For reactions conducted under photolytic conditions the solution was prepared in a polypropylene vessel, DMPA added in the indicated molar proportions (Table 3) and the stirred mixture then irradiated at 365 nm. For reactions carried out under thermal conditions, the solution was prepared in a glass tube, the indicated quantity of AIBN (azobisisobutyronitrile) added and the stirred mixture heated either in an oil bath or in a microwave oven.
Reaction progress was monitored using thin-layer chromatography and was allowed to proceed to completion based on consumption of the cysteine starting material. The solvent was then removed and the residue purified by flash column chromatography on silica gel, eluting with hexane/ethyl acetate mixtures. The identities of Fmoc-Cys(Pam-1)-OH (200), Ac-Cys(Pam-1)-OH (120) and Boc-Cys(Pam-1)-OH (121), were confirmed by 1H and 13C NMR and by mass spectrometry.
N-Fmoc-Cys(Pam-1)-OH (200)
1H NMR (400 MHz, CDCl3): δ7.76 (d, J 7.61 Hz, 2H), 7.60 (br s, J 6.80 Hz, 2H), 7.39 (t, J 7.50 Hz, 2H), 7.31 (dt, J1 0.77 J2 7.50 Hz, 2H), 6.92-6.42 (br s, 1H, COOH), 5.72 (d, J 7.66 Hz, 1H, FmocNH), 4.70-4.62 (m, 1H), 4.45-4.38 (m, 2H), 4.26-4.18 (m, 3H), 3.14 (dd, J1 4.67 J2 13.66 Hz, 1H), 3.06 (dd, J1 5.36, J2 13.84 Hz, 1H), 2.78 (t, J 6.40 Hz, 2H), 2.29 (t, J 7.50 Hz, 2H), 1.59 (m, 2H), 1.28-1.21 (m, 24H), 0.88 (t, J 6.87 Hz, 3H); 13C NMR (100 MHz, CDCl3): δ174.1, 173.9, 155.9, 143.69, 143.62, 143.5, 141.3, 127.7, 127.0, 125.0, 119.9, 67.3, 63.0, 53.5, 47.0, 34.3, 34.1, 31.9, 31.2, 29.67, 29.64, 29.60, 29.4, 29.3, 29.2, 29.1, 24.8, 22.6, 14.0; HRMS Found (ESI): [M+Na]+ 648.3328, C36H51NO6SNa requires 648.3329.
N—Ac-Cys(Pam-1)-OH (120)
1H NMR (400 MHz, CDCl3): δ 8.21-7.70 (br s, 1H, COOH), 6.29 (d, J 7.51 Hz, 1H, NHAc), 4.79 (ddd, J1 5.06 J2 5.49 J3 6.94 Hz, 1H), 4.22 (t, J 6.72 Hz, 1H), 4.21 (t, J 6.53 Hz, 1H), 3.12 (dd, J1 4.72 J2 14.08 Hz, 1H), 3.05 (dd, J1 5.80 J2 13.93 Hz, 1H), 2.78 (t, J 6.60 Hz, 1H), 2.77 (t, J 6.76 Hz, 1H), 2.33 (t, J 7.50 Hz, 2H), 2.09 (s, 3H), 1.65-1.55 (m, 2H), 1.27-1.22 (s, 24H), 0.87 (t, J 6.92 Hz, 3H); 13C NMR (100 MHz, CDCl3): δ 174.0, 172.7, 171.4, 62.9, 52.1, 34.2, 33.8, 31.8, 31.2, 29.6, 29.63, 29.60, 29.4, 29.3, 29.2, 29.1, 24.8, 22.8, 22.6, 14.0; HRMS Found (ESI): [M+Na]+ 468.2750, C23H43NO5SNa requires 468.2754.
N-Boc-Cys(Pam-1)-OH (121)
1H NMR (400 MHz, CDCl3): δ 9.71-8.84 (br s, 1H, COOH), 5.43-5.36 (m, 1H, BocNH), 4.60-4.49 (m, 1H), 4.21 (t, J 6.80 Hz, 2H), 3.14-2.93 (m, 2H), 2.78 (t, J 6.73 Hz, 2H), 2.30 (t, J 7.46 Hz, 2H), 1.64-1.56 (m, 2H), 1.44 (s, 9H), 1.24 (s, 24H), 0.56 (t, J 6.82 Hz, 3H); 13C NMR (100 MHz, CDCl3): δ 174.7, 173.8, 155.4, 63.1, 53.2, 34.4, 34.2, 31.9, 31.2, 29.69, 29.66, 29.62, 29.4, 29.3, 29.2, 29.1, 28.2, 28.1, 24.9, 22.6, 14.1; HRMS Found (ESI): [M+Na]+ 526.3176, C26H49NO6SNa requires 526.3173.
The conjugation reaction was carried out under a variety of conditions, which are summarised in Table 3.
| TABLE 3 | ||||||
| N-α- | Product | |||||
| protecting | Initiator | Time | (% | |||
| Entry | group | (mol eq.) | Solvent | Conditions a | (min) | yield)b |
| 1 | Fmoc | DMPA | DCM | hu (365 nm) | 60 | 200 (67) |
| (0.2) | ||||||
| 2 | Fmoc | DMPA | DCM | hu (365 nm) | 60 | 200 (82) |
| (1) | ||||||
| 3 | Fmoc | AIBN | DCM | Microwave | 80 | 200 (41)c |
| (1) | (70° C.) | |||||
| 4 | Ac | DMPA | DCM | hu (365 nm) | 60 | 120 (87) |
| (0.2) | ||||||
| 5 | Ac | DMPA | DCM | hu (365 nm), | 60 | 120 (74) |
| (0.2) | DTT | |||||
| 6 | Ac | DMPA | DCM | hu (365 nm) | 60 | 120 (88) |
| (1) | ||||||
| 7 | Ac | AIBN | DCM | Microwave | 80 | 120 (100) |
| (1) | (70° C.) | |||||
| 8 | Boc | DMPA | DCM | hu (365 nm) | 60 | 121 (78) |
| (0.2) | ||||||
| 9 | Boc | DMPA | DCM | hu (365 nm) | 60 | 121 (82) |
| (1) | ||||||
| 10 | Boc | AIBN | DCM | Microwave | 80 | 121 (77) |
| (1) | (70° C.) | |||||
| a UV irradiation used a hand-held Spectronics 6 watt lamp operating at 365 nm; microwave reactions were carried out using a CEM Discover microwave reactor operating at 100 w and 70° C. | ||||||
| bYield is based on isolated material after chromatography. | ||||||
| cReaction incomplete after this time, based on residual Fmoc-cysteine substrate. |
As can be seen from Table 3, the use of photolytic conditions generated the desired products with relatively consistent yields, regardless of the N-protecting group of the cysteine substrate and the relative concentration of the photoinitiator.
Under thermal conditions using AIBN as the initiator yields varied considerably. The N-acetylated substrate afforded superior yields of the desired product 120 (entry 9). Using microwave heating was particularly effective, giving a quantitative yield of acetylated product 120 (entry 7) and a high yield of the Boc product 121 (entry 10).
3.4 Preparation of Peptide Conjugates Via Coupling of Amino Add Conjugates
Peptide conjugates 110 [comprises SEQ ID NO: 27], 111 [comprises SEQ ID NO: 24], 112 [comprises SEQ ID NO: 24], 113 [comprises SEQ ID NO: 25], 114 [comprises SEQ ID NO: 25], 115 [comprises SEQ ID NO: 26] and 116 [comprises SEQ ID NO: 26](Table 4) were prepared as described and depicted below (Scheme 3).
The desired peptide sequence was synthesised using standard iterative Fmoc SPPS techniques using a Tribute peptide synthesiser as previously described. After coupling the penultimate amino acid residue, the resin-bound peptide chain was then derivatised with the amino acid conjugate N-Fmoc-Cys(Pam-1)-OH 200 using PyBOP and collidine in DMF. The Fmoc group was then removed using 20% piperidine in DMF.
The resulting peptide was then cleaved from resin using TFA/EDT, with concomitant removal of protecting groups, to afford peptide conjugates 111 [comprises SEQ ID NO: 24], 113 [comprises SEQ ID NO: 25] and 115 [comprises SEQ ID NO: 26].
Alternatively, the resulting peptide was converted to the corresponding acetamide by treatment with a mixture of 20% acetic anhydride in DMF (2 mL) and 4-methylmorpholine (1 mmol) and then cleaved from resin to afford peptide conjugates 110 [comprises SEQ ID NO: 27], 112 [comprises SEQ ID NO: 24], 114 [comprises SEQ ID NO: 25] and 116 [comprises SEQ ID NO: 26].
Alternatively, the resin-bound peptides were derivatised with either the amino acid conjugate N-Boc-Cys(Pam-1)-OH 121 or N—Ac-Cys(Pam-1)-OH 120. On cleavage from resin this afforded the peptide conjugates 110 [comprises SEQ ID NO: 27], 111 [comprises SEQ ID NO: 24], 112 [comprises SEQ ID NO: 24], 113 [comprises SEQ ID NO: 25], 114 [comprises SEQ ID NO: 25], 115 [comprises SEQ ID NO: 26] and 116 [comprises SEQ ID NO: 26] directly, without the additional manipulations necessary due to the Fmoc group.
The conditions for coupling of the amino acid conjugate reduced the propensity of the α-carbon of the amino acid to racemise on activation. The amino acid conjugate (0.075 mmol) and PyBOP (benzotriazol-1-yl-oxytripyrrolidinophosphonium hexafluorophosphate) (0.1 mmol) were combined and dissolved in DMF (0.3 mL). Neat 2,4,6-trimethylpyridine (0.1 mmol) was added and after mixing for 30 seconds the solution transferred to 0.025 mmol of resin, which was then agitated for 90 minutes, drained and washed (DMF).
The peptide was then cleaved by agitating 0.015 mmol of the resin in 1 mL of trifluoroacetic acid containing 5% (v/v) ethanedithiol at room temperature for 3 hours. The supernatant was then drained through a sinter into chilled diethyl ether (10 mL) and the resin washed with a further 1 mL of TFA, which was also added to the ether.
The precipitated material was pelleted by centrifugation and the pellet washed once with ether (5 mL) before being dissolved in 1:1 MeCN/Water (+0.1% tfa) and lyophilised. If the peptide contained a methionine residue the solution was heated at 60° C. for 1 hour prior to freeze-drying. The peptides were then purified (>95%) by RP-HPLC and their identities confirmed by analytical RP-HPLC and mass spectrometry.
| TABLE 4 | ||||
| Peptide | ||||
| SEQ ID | m/z | Yield | ||
| Sequence | NO | [M + 4H+] | (%) | |
| 110 | AcHN-C(Pam-1)SKKKKNLVPMVATVK(Ac)-(CO)NH2 | 27 | 535.6 | 27 |
| 111 | H2N-C(Pam-1)SKKKKLQQLSLLMWITQCFLPVFLAQPPSGQRR-OH | 24 | 1064.6 | 15 |
| 112 | AcHN-C(Pam-1)SKKKKLQQLSLLMWITQCFLPVFLAQPPSGQRR-OH | 24 | 1075.0 | 20 |
| 113 | H2N-C(Pam-1)SKKKKGARGPESRLLEFYLAMPFATPMEAELARRSLAQDAPPL- | 25 | 1289.9 | 21 |
| OH | ||||
| 114 | AcHN-C(Pam-1)SKKKKGARGPESRLLEFYLAMPFATPMEAELARRSLAQDAPPL- | 25 | 1300.4 | 23 |
| OH | ||||
| 115 | H2N-C(Pam-1)SKKKKVPGVLLKEFTVSGNILTIRLTAADHR-OH | 26 | 952.0 | 16 |
| 116 | AcHN-C(Pam-1)SKKKKVPGVLLKEFTVSGNILTIRLTAADHR-OH | 26 | 962.5 | 18 |
These examples describes the assessment of the efficacy of the peptides and peptide conjugates of the present invention in supporting the processing and presentation of various antigenic peptide constructs to a various T cell clones by by antigen presenting cells (APC).
Materials
The peptide s and peptide conjugate constructs used in the following examples are outlined in Table 5 below.
| TABLE 5 |
| Peptide and peptide conjugate constructs |
| Peptide | ||
| SEQ ID NO | ||
| Peptide epitope CMV pp65 residues 495-503 [SEQ ID NO: 27] |
| Peptide | ||
| construct | Sequence | |
| 110 | Pam1Cys(Ac)-SKKKKNLVPMVATVK(Ac)-NH2 | 27 |
| 131 | Pam2Cys-SKKKKNLVPMVATVK(Ac)-NH2 | 27 |
| 142 | Ac-Cys-SKKKKNLVPMVATVK(Ac)-NH2 | 27 |
| Peptide epitope NY-ESO-1 residues 153-180 [SEQ ID NO: 18] |
| Peptide | ||
| construct | Sequence | |
| 143 | LQQLSLLMWITQCFLPVFLAQPPSGQRR-OH | 18 |
| 144 | SKKKKLQQLSLLMWITQCFLPVFLAQPPSGQRR-OH | 17 |
| 132 | Pam2Cys-SKKKKLQQLSLLMWITQCFLPVFLAQPPSGQRR-OH | 24 |
| 111 | PamlCys(NH2)-SKKKKLQQLSLLMWITQCFLPVFLAQPPSGQRR-OH | 24 |
| 112 | Pam1Cys(Ac)-SKKKKLQQLSLLMWITQCFLPVFLAQPPSGQRR-OH | 24 |
| Peptide epitope NY-ESO-1 residues 79-116 [SEQ ID NO: 5] |
| Peptide | ||
| construct | Sequence | |
| 145 | GARGPESRLLEFYLAMPFATPMEAELARRSLAQDAPPL-OH | 5 |
| 133 | Pam2Cys-SKKKKGARGPESRLLEFYLAMPFATPMEAELARRSLAQDAPPL-OH | 25 |
| 113 | Pam1Cys(NH2)-SKKKKGARGPESRLLEFYLAMPFATPMEAELARRSLAQDAPPL-OH | 25 |
| 114 | Pam1Cys(Ac)-SKKKKGARGPESRLLEFYLAMPFATPMEAELARRSLAQDAPPL-OH | 25 |
| Peptide epitope NY-ESO-1 residues 118-143 [SEQ ID NO: 12] |
| Patent | ||
| Designation | Sequence | |
| 147 | VPGVLLKEFTVSGNILTIRLTAADHR-OH | 12 |
| 134 | Pam2Cys-SKKKKVPGVLLKEFTVSGNILTIRLTAADHR-OH | 26 |
| 115 | Pam1Cys(NH2)-SKKKKVPGVLLKEFTVSGNILTIRLTAADHR-OH | 26 |
| 116 | Pam1Cys(Ac)-SKKKKVPGVLLKEFTVSGNILTIRLTAADHR-OH | 26 |
General Methods
T Cell Clone Maintenance
Human CD4+ and CD8+ T cell clones were maintained at a concentration of 1-3×106/ml in RPMI 1640 supplemented with Glutamax, Penicillin/Streptomycin and 5% v/v human serum (“RS5”, all reagents from Life Technologie). Media was refreshed 50% v/v twice weekly. RS5 for CD4+ T cell clones was supplemented with IL-7 and IL-21, and RS5 for CD8+ T cell clones was supplemented with IL-7+IL-15 (all cytokines from PeproTech, used at a final concentration of 5 ng/ml).
Lymphoblastoid Cell Line (“LCL”) Generation and Maintenance
Epstein-Barr Virus (“EBV”)-producing B95-8 MM cells were grown in RPMI 1640 supplemented with Glutamax, Penicillin/Streptomycin and 10% v/v fetal bovine serum (“RF10”, all reagents from Invitrogen) in T75 flasks (BD Biosciences). EBV-containing medium was collected and centrifuged to pellet non-adherent cells, and the EBV-containing supernatant then filter-sterilised (0.22 μm). 10×106 donor Peripheral Blood Mononuclear Cells (“PBMC”) were suspended in 1.5 ml RF10 in aT25 flask (BD Biosciences). 2.5 ml B95-8 cell culture supernatant was added and cells incubated for 2 hours. 1 ml fresh RF10 containing 5% v/v Phytohemaglutanin (“PHA”, Gibco) was then added (1% v/v final concentration). Flasks were monitored for outgrowth of B cell LCL, typically over 4-6 weeks, with transfer to a T75 flask (BD Biosciences) when required. LCL lines were cryopreserved and working stocks maintained in RF10 at 0.5-1.5×106/ml.
Culture of Monocyte-Derived Dendritic Cells (“MoDC”)
Blood was taken from healthy donors with informed consent. PBMC were purified by density centrifugation using Lymphoprep (Axis Shield). Monocytes were isolated from PBMC using the Monocyte Isolation Kit II (Miltenyi Biotec) and MoDC were generated by culture in RF10 supplemented with 100 ng/ml GM-CSF and 50 ng/ml IL-4 (both Peprotech) for 6 days. Medium was refreshed 50% v/v every two days.
CD8+ T Cell Done Activation Assays
Donor LCL or MoDC (also referred to herein as antigen presenting cells or “APC”) were incubated for 16h in RF10+ peptide/construct at desired concentration. In samples where Pam3Cys (“P3C”) and peptide moieties were both present but unconjugated, LCL were pre-treated with P3C for 30 minutes, and media then refreshed with RF10 containing both P3C and peptide. Untreated APC were incubated in RF10 only. APC/construct incubation was performed in 96well plates (U-bottom, BD Biosciences) or in 48wp (flat bottom, BD Biosciences) depending of the nature of the assay and the numbers of APC required per treatment. Following incubation, APC were washed with RPMI 1640 4 times, to remove unbound construct/P3C.
To enable flow cytometric detection, CD8+ T cell clones were pre-stained with 0.5 μM CellTrace™ Violet (“CTV”) (Life Technologies) following manufacturer's protocols prior to seeding into APC wells, or were stained with anti-CD8 antibody following co-incubation as described below.
Pulsed/washed APC and CTV-stained T cell clones were seeded in 96well plate wells (U-bottom) at a ratio of 4:1 (APC:T cell) in duplicate (typical numbers of cells used were 1.25×104 cells/ml T cells and 5×104 cells/ml APC). Following seeding, APC/T cell plates were gently centrifuged (≤300×g, 3 minutes) to allow immediate interaction, and co-incubated for 26 hours in a standard cell culture incubator.
To detect T cell activation, samples were stained with the antibodies shown in Table 6 below (anti-CD8 only used if cells not pre-stained with CTV) in 50 μl total volume of wash buffer (PBS/FCS (1% v/v).
| TABLE 6 |
| Antibodies for CD8+ assay |
| DOSE | |||||
| ANTI- | FLUORO- | (μL PER | |||
| CD | PHORE | CLONE | 50 μL) | SUPPLIER | CATALOG# |
| 8 | FITC | RPA-T8 | 0.5 | BIOLEGEND | 301006 |
| 137 | APC | 4B4.1 | 1.25 | BIOLEGEND | 309810 |
Samples were incubated on ice for 30 minutes in the dark, and then washed twice with wash buffer to remove unbound antibody. DAPI (1 μg/ml final concentration) was added to each sample immediately prior to acquisition to allow live/dead exclusion.
Data acquisition was performed using a BD FACSAria II with FACSDiva software, and data analysis was performed using FlowJo software (Treestar). Data were presented as the mean %+SD of live clonal cells positive for CD137 expression.
CD4+ T Cell Done Activation Assays
All APC pulsing/washing/seeding; T cell clone CTV staining; and APC/T cell co-incubation setup steps were performed as described for “CD8+ T cell clone activation assays” above.
To detect T cell activation, samples were stained with the antibodies shown in Table 7 below (anti-CD4 only used if cells not pre-stained with CTV) in 50 μl total volume of wash buffer (PBS/FCS (1% v/v).
| TABLE 7 |
| Antibodies for CD4+ assay |
| DOSE | |||||
| FLUORO- | (μL PER | ||||
| CD | PHORE | CLONE | 50 μL) | SUPPLIER | CATALOG# |
| 4 | FITC | RPA-T4 | 0.5 | BIOLEGEND | 300506 |
| 25 | APC- | BC96 | 2.5 | BIOLEGEND | 302614 OR |
| CY7 OR | 302610 | ||||
| APC | |||||
| 134 | PE | ACT35 | 1.25 | BIOLEGEND | 350004 |
Samples were incubated on ice for 30 minutes in the dark, and then washed twice with wash buffer to remove unbound antibody. DAPI (1 pg/ml final concentration) was added to each sample immediately prior to acquisition to allow live/dead exclusion.
Data acquisition was performed using a BD FACSAria II with FACSDiva software, and data analysis was performed using FlowJo software (Treestar). Data were presented as the median fluorescence intensity (MFI)+SD of CD25 and CD134 expression on live clonal cells.
These examples describe an assessment of the efficacy of the peptides and peptide conjugates of the present invention in supporting the processing and presentation of various antigenic peptide constructs to various T cell clone by antigen presenting cells (APC).
Materials
The peptide epitope recognised by the CD8+ T cell clone (clone 4D9) used in this example, p495-503 [SEQ ID NO: 27], is shown within the construct sequence in bold below:
| 142: | |
| [SEQ ID NO: 27] | |
| Ac-Cys-SKKKK-NLVPMVATVK(Ac)-NH2 | |
| 131: | |
| [SEQ ID NO: 27] | |
| Pam2Cys-SKKKK-NLVPMVATVK(Ac)-NH2 | |
| 110: | |
| [SEQ ID NO: 27] | |
| Pam1Cys(Ac)-SKKKK-NLVPMVATVK(Ac)-NH2 |
MoDC preparation and CD8+ T cell clone activation assay carried out as described in the methods below.
Results
As shown in FIG. 3, T cell activation was detected for all peptide constructs at 10 μM, but only for peptide constructs 131 [comprises SEQ ID NO: 27] and 110 [comprises SEQ ID NO: 27] at 100 nM.
At both concentrations, constructs 131 [comprises SEQ ID NO: 27] and 110 [comprises SEQ ID NO: 27] elicited greater T cell activation than construct 142 [SEQ ID NO: 27]. These results support the efficacy of the peptide conjugates of the invention to—maintain and possibly improve presentation of this epitope when conjugated to a TLR-agonist using the methods of the invention.
This example describes an assessment of the efficacy of the peptides and peptide conjugates of the present invention in supporting the processing and presentation of NY-ESO-1153-180 [SEQ ID NO: 18] constructs to a CD8+ T cell clone by autologous LCL and by allogeneic HLA-A2+ HLA-DP4+ MoDC.
Materials
The peptide epitope recognised by the CD8+ T cell clone (clone 2F2) used in this example, p157-165 [SEQ ID NO: 20], is shown within the construct sequence in bold below:
| 143: |
| [SEQ ID NO: 18 |
| LQQLSLLMWITOCFLPVFLAQPPSGQRR-OH |
| 144: |
| [SEQ ID NO: 17] |
| SKKKK-LQQLSLLMWITOCFLPVFLAQPPSGQRR-OH |
| 112: |
| [SEQ ID NO: 24] |
| Pam1Cys(Ac)-SKKKK-LQQLSLLMWITOCFLPVFLAQPPSGQRR-OH |
| 111: |
| [SEQ ID NO: 24] |
| Pam1Cys(NH2)-SKKKK-LQQLSLLMWITOCFLPVFLAQPPSGQRR-OH |
| 132: |
| [SEQ ID NO: 24] |
| Pam2Cys-SKKKK-LQQLSLLMWITOCFLPVFLAQPPSGQRR-OH |
LCL/MoDC preparation and CD8+ T cell clone activation assay carried out using the methods as described in Example 4.
Results
100% T cell activation was elicited with all constructs (+/−P3C) at 10 μM using LCL (see FIG. 4). 50-100% T cell activation was observed at 100 nM using constructs 143 [SEQ ID NO: 18] and 144 [SEQ ID NO: 17] (+/−exogenous P3C). Only peptide construct 143 [SEQ ID NO: 18] elicited 100% T cell activation at 100 nM (FIG. 4, first columns), suggesting that the presence of the N-terminal SKKKK [amino acids 2-6 of SEQ ID NO: 22] motif may have impaired processing of epitope p157-165 [SEQ ID NO: 20]. Peptide constructs 112 [comprises SEQ ID NO: 24], 111 [comprises SEQ ID NO: 24] and 132 [comprises SEQ ID NO: 24] elicited <20% T cell activation at 100 nM, suggesting that although TLR agonist conjugation still allowed presentation of the p157-165 epitope [SEQ ID NO: 20] to CD8+ T cells, it did not improve the epitope's processing and presentation.
As shown in FIG. 5,T cell activation was also detectable when MoDC were used as APC, reaching levels of 55-95% at 10 μM.
This example describes an assessment of the efficacy of the peptides and peptide conjugates of the present invention in supporting the processing and presentation of NY-ESO-1153-180 [SEQ ID NO: 18] antigenic peptide constructs to CD4+ T cell clones by autologous LCL and by allogeneic HLA-A2+ HLA-DP4+ MoDC.
Materials
The peptide epitope recognised by the CD4+ T cell clones 1B7 and 1C11 used in this example, p157-170 [SEQ ID NO: 19], is shown within the construct sequence in bold below:
| 143: |
| [SEQ ID NO: 18] |
| LQQLSLLMWITOCFLPVFLAQPPSGQRR-OH |
| 144: |
| [SEQ ID NO: 17] |
| SKKKK-LQQLSLLMWITOCFLPVFLAQPPSGQRR-OH |
| 112: |
| [SEQ ID NO: 24] |
| Pam1Cys(Ac)-SKKKK-LQQLSLLMWITOCFLPVFLAQPPSGQRR-OH |
| 111: |
| [SEQ ID NO: 24] |
| Pam1Cys(NH2)-SKKKK-LQQLSLLMWITOCFLPVFLAQPPSGQRR-OH |
| 132: |
| [SEQ ID NO: 24] |
| Pam2Cys-SKKKK-LQQLSLLMWITOCFLPVFLAQPPSGQRR-OH |
LCL/MoDC preparation and CD4+ T cell clone activation assays were carried out as described in the methods of Example 4.
Results
As can be seen in FIGS. 6-8, T cell activation (as determined by an increase in CD25 expression over untreated background) was detectable for all constructs at both 10 μM and 100 nM when LCL (clone 1B7 only, FIG. 6) or MoDC (clone 1B7, FIG. 7 and clone 1C11, FIG. 8) were used. Autologous LCL appeared to elicit higher levels of CD25 upregulation than allogeneic MoDC, as shown by a comparison of FIG. 6 compared to each of FIGS. 7 and 8.
TLR agonist conjugation gave equivalent epitope processing and presentation on MHC class II when compared to free peptide for this epitope (p157-170 [SEQ ID NO: 20]). These results confirm that conjugation with a TLR agonist using the methods of the invention maintains antigen processing and presentation to CD4+ T cells.
The combined results of FIGS. 4-8 show that conjugation with a TLR agonist using the methods of the invention retains processing and presentation of epitopes within the peptide antigen NY-ESO-1153-180 [SEQ ID NO: 18] to both CD4+ and CD8+ human T cells.
This example describes an assessment of the efficacy of the peptides and peptide conjugates of the present invention in supporting the processing and presentation of NY-NY-ESO-179-116 [SEQ ID NO: 5] constructs to CD8+ T cell clones by autologous LCL.
Materials
The peptide epitope recognised by the CD8+ T cell clone 1D7 used in this example, p92-100 [SEQ ID NO: 6], is shown within the construct sequence in bold below:
| 145: |
| [SEQ ID NO: 5] |
| GARGPESRLLEFYLAMPFATPMEAELARRSLAQDAPPL-OH |
| 114: |
| [SEQ ID NO: 25] |
| Pam1Cys(Ac)-SKKKK-GARGPESRLLEFYLAMPFATPMEAELARRS |
| LAQDAPPL-OH |
| 113: |
| [SEQ ID NO: 25] |
| Pam1Cys(NH2)-SKKKK-GARGPESRLLEFYLAMPFATPMEAELARR |
| SLAQDAPPL-OH |
The peptide epitope recognised by the CD8+ T cell clone 1F10 used in this example, p96-104 [SEQ ID NO: 7], is shown within the construct sequence in bold below:
| 145: |
| [SEQ ID NO: 5] |
| GARGPESRLLEFYLAMPFATPMEAELARRSLAQDAPPL-OH |
| 114: |
| [SEQ ID NO: 25] |
| Pam1Cys(Ac)-SKKKK-GARGPESRLLEFYLAMPFATPMEAELARRS |
| LAQDAPPL-OH |
| 113: |
| [SEQ ID NO: 25] |
| Pam1Cys(NH2)-SKKKK-GARGPESRLLEFYLAMPFATPMEAELARR |
| SLAQDAPPL-OH |
LCL preparation and CD8+ T cell activation assays were carried out as described in the methods of Example 4. LCL pulsed with 100 nM minimal peptide epitope acted as positive control (data not shown).
Results
Clone 1D7 (p92-100) [SEQ ID NO: 6] responded to all constructs at all concentrations tested (see FIG. 9). Responses to peptide constructs 114 [comprises SEQ ID NO: 25] and 113 [comprises SEQ ID NO: 25] were slightly inferior to those with peptide construct 145 [SEQ ID NO: 5]+/−P3C at matched concentrations, particularly at lpM/100 nM.
Clone 1F10 (p96-104) [SEQ ID NO: 7] responded to all constructs at all concentrations tested (FIG. 10). Responses to peptide constructs 114 [comprises SEQ ID NO: 25] and 113 [comprises SEQ ID NO: 25] were equivalent to, or slightly better than those with peptide construct 145 [SEQ ID NO: 5]+/−P3C, especially at 10 μM (best demonstrated by an increase in CD137 MFI; data not shown).
These results establish that after conjugation with a TLR agonist using the methods of the invention, peptide NY-ESO-17-116 [SEQ ID NO: 5] retains its ability to be processed and presented to two different CD8+ T cell lines recognizing two different epitopes (p92-100 [SEQ ID NO: 6] and p96-104 [SEQ ID NO: 7]).
This example describes an assessment of the efficacy of the peptides and peptide conjugates of the present invention in supporting the processing and presentation of NY-NY-ESO-1118-143 [SEQ ID NO: 12] constructs to the CD8+ T cell clone 1C11 by autologous LCL.
Materials
The peptide epitope recognised by the CD8+ T cell clone 1C11 used in this example, p125-133 [SEQ ID NO: 13], is shown within the construct sequence in bold below:
| 147: |
| [SEQ ID NO: 12] |
| VPGVLLKEFTVSGNILTIRLTAADHR-OH |
| 116: |
| [SEQ ID NO: 26] |
| Pam1Cys(Ac)-SKKKK-VPGVLLKEFTVSGNILTIRLTAADHR-OH |
| 115: |
| [SEQ ID NO: 26] |
| Pam1Cys(NH2)-SKKKK-VPGVLLKEFTVSGNILTIRLTAADHR-OH |
LCL preparation and CD8+ T cell activation assays were carried out as described in the methods of Example 4 above. LCL pulsed with 1 μM NY-ESO-1121-138 [amino acids 4-21 of SEQ ID NO: 12] acted as positive control (data not shown).
Results
As shown in FIG. 11, greater than 95% T cell activation was elicited with all constructs (+/−P3C) at 10 μM. At 1 μM, T cell activation by peptide construct 147 [SEQ ID NO: 12](+/−exogenous P3C) dropped to 75%/60% respectively, but remained at >90% for peptide constructs 116 [comprises SEQ ID NO:26] and 115 [comprises SEQ ID NO:26]. No or negligible T cell activation was observed for peptide construct 147 [SEQ ID NO: 12]at 100 nM, whereas peptide constructs 116 [comprises SEQ ID NO:26] and 115 [comprises SEQ ID NO:26] elicited >30% and 20% respectively.
The superiority of peptide constructs 116 [comprises SEQ ID NO:26] and 115 [comprises SEQ ID NO:26] at inducing T cell activation suggests that conjugation to a TLR-agonist improves processing and -presentation of this epitope (p125-133) [SEQ ID NO: 13].
This example describes an assessment of the efficacy of the peptides and peptide conjugates of the present invention in supporting the processing and presentation of NY-NY-ESO-1118-143 [SEQ ID NO: 12] constructs to CD4+ T cell clones 1E4 and 1D6 by autologous LCL.
Materials
The peptide constructs used in this example are shown below:
| 147: |
| [SEQ ID NO: 12] |
| VPGVLLKEFTVSGNILTIRLTAADHR-OH |
| 116: |
| [SEQ ID NO: 26] |
| Pam1Cys(Ac)-SKKKK-VPGVLLKEFTVSGNILTIRLTAADHR-OH |
| 115: |
| [SEQ ID NO: 26] |
| Pam1Cys(NH2)-SKKKK-VPGVLLKEFTVSGNILTIRLTAADHR-OH |
The putative peptide epitope recognised by the CD4+ clone 1E4 used in this example, p127-138 [amino acids 10-21 of SEQ ID NO: 12], is shown within the construct sequence in bold below:
| 147: |
| [SEQ ID NO: 12] |
| VPGVLLKEFTVSGNILTIRLTAADHR-OH |
| 116: |
| [SEQ ID NO: 26] |
| Pam1Cys(Ac)-SKKKK-VPGVLLKEFTVSGNILTIRLTAADHR-OH |
| 115: |
| [SEQ ID NO: 26] |
| Pam1Cys(NH2)-SKKKK-VPGVLLKEFTVSGNILTIRLTAADHR-OH |
The putative peptide epitope recognised by the CD4+ clone 1D6 used in this example, p121-132 [amino acids 4-15 of SEQ ID NO: 12], is shown within the construct sequence in bold below:
| 147: |
| [SEQ ID NO: 12] |
| VPGVLLKEFTVSGNILTIRLTAADHR-OH |
| 116: |
| [SEQ ID NO: 26] |
| Pam1Cys(Ac)-SKKKK-VPGVLLKEFTVSGNILTIRLTAADHR-OH |
| 115: |
| [SEQ ID NO: 26] |
| Pam1Cys(NH2)-SKKKK-VPGVLLKEFTVSGNILTIRLTAADHR-OH |
LCL preparation and CD4+ T cell activation assays were carried out as described in the methods of Example 4 above. LCL pulsed with 1 μM NY-ESO-1121-138 [amino acids 4-21 of SEQ ID NO: 12] acted as positive control (data not shown).
Results
Clone 1E4 responded to all constructs (+/−exogenous P3C) at all concentrations tested, as can clearly be seen in FIG. 12. These results suggest that the processing of the cognate epitope for this clone from p118-143 [SEQ ID NO: 12] is efficient, and is not dependent on or influenced by TLR agonist ligation.
As shown in FIG. 13, clone 1D6 responds well to LCL pulsed with p121-138 [amino acids 4-21 of SEQ ID NO: 12] (data not shown), but does not respond to peptide construct 147 (p118-143 [SEQ ID NO: 12])+/−P3C, suggesting impairment in processing of its cognate epitope. It is proposed that this may be either due to the presence of N-terminal VPG or C-terminal TAADHR, in the absence of TLR agonist conjugation. This processing defect is not rescued by concurrent TLR ligation in trans.
However, clone 1D6 does respond to peptide constructs 116 [comprises SEQ ID NO:26] and 115 [comprises SEQ ID NO:26] (with 116 [comprises SEQ ID NO:26] eliciting a greater response than 115 [comprises SEQ ID NO:26]) in a titratable fashion (see FIG. 13). This suggests that efficient targeting of the peptide moiety to a late endosomal/lysosomal pathway through conjugation to a TLR agonist alleviates the processing block observed with the non-conjugated peptide construct 147 [SEQ ID NO: 12]. Without wishing to be bound by any theory, applicants propose this may be at least partly by exposure to a late endosome or lysosome-specific protease or processing pathway.
The example investigates TLR agonism by the peptide constructs of the present invention.
Methods
The TLR assays were carried out as described below, using the constructs set out in the preceding Examples.
Toll-Like Receptor 2 (TLR2) Agonism Using HekBlue Cells
HEK-Blue™-hTLR2 and HEK-Blue™-mTLR2 were purchased from Invivogen. These HEK-Blue cells were produced by co-transfection of both reporter gene SEAP (secreted embryonic alkaline phosphatase) and either human or murine TLR2, respectively. The SEAP reporter gene is under the control of the IFN-B minimal promoter fused to five AP-1 and five NFkB binding sites. Cells were cultured according to manufacturer's instructions. On the day of the assay, the constructs were added at the indicated concentrations in 20 μl volume of endotoxin free water in a 96-well plate. HEK-Blue™-hTLR2 or HEK-Blue™-hTLR2 cells were resuspended at ˜2.83×104 cells/ml in HEK-Blue™ Detection medium and immediately add 180 ml of the cell suspension (˜5×104 cells per well.) The cells were incubated overnight at 37° C. in 5% CO2. SEAP expression was quantified using an EnSpire plate reader (PerkinElmer) at 635 nM.
Method for Detection of IL-8 Secretion from TLR2-Transiently Transfected Hek293 Cells
Hek-293 cells were plated 3×104 cells in 50 μl per well in 96-well plate with DMEM containing 10% FBS (the medium was not supplemented with antibiotics). Cells were transfected with either a combination of pFLAG-TLR2 plasmid and pcDNA3.1 (a kind gift from Shimizu, as reported in Shimizu, T., Y. Kida and K. Kuwano (2005). “A dipalmitoylated lipoprotein from Mycoplasma pneumoniae activates NF-kappa B through TLR1, TLR2, and TLR6.” J Immunol 175(7): 4641-4646), or the control plasmid only (pcDNA3.1). Master mix of Lipofectamine/DNA complexes were constituted in Opti-MEM at 100ngDNA in 0.3 μl Lipofectamine in a volume of 50p1 per sample. Following an incubation of 20 mins, the plasmid mix was added to the cells. Protein expression was induced for 24 hours prior to the addition of constructs.
The constructs were added to the wells at the indicated concentrations to make a final volume of 200p1 per well. Following 18-hours of stimulation, the supernatant was harvested from each sample and stored at −20° C. until required. IL-8 secretion was determined by Cytometric Bead Array (BD Biosciences) according to manufacturer's protocol with only one modification: 25p1 of conditioned medium was used instead of 50p1. To accurately determine the concentration of secreted IL-8, an 11-point standard curve (1-5000 ng/ml) was performed. Samples were analysed using a BD-FACS Aria II (BD Biosciences) and the data analysed using FCAP ARRAY Software and (version 1.0.1)
Result
As shown in FIGS. 14 and 15, all constructs tested demonstrated TLR agonism in both HekBlue™ (FIG. 14) and IL-8 (FIG. 15) reporter systems. TLR agonism was titratable, and was detectable above background at both concentrations tested.
In both assay systems, Pam1C(Ac) constructs elicited stronger responses than matched Pam1C(NH2) constructs.
It is not the intention to limit the scope of the invention to the abovementioned examples only. As would be appreciated by a skilled person in the art, many variations are possible without departing from the scope of the invention.
1-93. (canceled)
94: A compound of the formula (V):
wherein
m is an integer from 0 to 4;
n is 1 or 2;
R1 and R2 at each instance of m are each independently hydrogen, C1-6alkyl, or C3-6cycloalkyl;
R3, R4, R5, R8, and R9 are each independently hydrogen, C1-6alkyl, or C3-6cycloalkyl; or R9 is an amino protecting group, L3-C(O), or A2;
R6 and R7 at each instance of n are each independently hydrogen, C1-6alkyl, or C3-6cycloalkyl,
L1 is C5-21alkyl or C4-20heteroalkyl;
L3 is C1-6alkyl or C3-6cycloalkyl;
A1 and A2 are each independently an amino acid or a peptide; or A1 is OH or OP1, wherein P1 is a carboxyl protecting group;
wherein any alkyl, cycloalkyl or heteroalkyl present in any of R1, R2, R4, R5, R6, R7, R8, R9, L1, and L3 and any cycloalkyl in R3 is optionally substituted with one or more substituents independently selected from the group consisting of halo, CN, NO2, OH, NH2, NH(C1-6alkyl), N(C1-6alkyl) (C1-6alkyl), C1-6haloalkyl, C1-6haloalkoxy, C(O)NH2, C(O)NH(C1-6alkyl), C(O)N(C1-6alkyl) (C1-6alkyl), SO2(C1-6alkyl), O(C1-6alkyl), S(C1-6alkyl), S(O) (C1-6alkyl), C(O) (C1-6alkyl), and C1-6aliphatic,
wherein 1) A1 is a peptide comprising an epitope or 2) R9 is A2 and is a peptide comprising an epitope; and
wherein the peptide comprising the epitope comprises at least 8 amino acids,
or a pharmaceutically acceptable salt or solvate thereof.
95: The compound of claim 94, wherein R9 is independently hydrogen, C1-6alkyl, or C3-6cycloalkyl; or R9 is L3-C(O) or A2; and
A1 and A2 are each independently a peptide; or A1 is OH;
provided that:
at least one of A1 and A2 comprises an epitope; and
when R9 is not A2, A1 is a peptide.
96: The compound of claim 94, wherein L1 is C5-21alkyl.
97: The compound of claim 94, wherein m is an integer from 0 to 2.
98: The compound of claim 94, wherein R1 and R2 at each instance of m are each independently hydrogen.
99: The compound of claim 94, wherein R3 is hydrogen.
100: The compound of claim 94, wherein R4 and R5 are each hydrogen.
101: The compound of claim 94, wherein R6 and R7 are each hydrogen.
102: The compound of claim 94, wherein R8 is hydrogen and R9 is hydrogen, an amino protecting group, L3-C(O), or A2.
103: The compound of claim 94, wherein L3 is Me.
104: The compound of claim 94, wherein the peptide comprises a peptide epitope.
105: The compound of claim 94, wherein A1 is serine or a peptide comprising serine as the first N-terminal amino acid residue.
106: The compound of claim 94, wherein A1 and/or A2 is a peptide comprising a solubilising group comprising an amino acid sequence comprising two or more hydrophilic amino acid residues in the peptide chain.
107: The compound of claim 94 wherein the peptide comprises, consists essentially of, or consists of an amino acid sequence selected from the group consisting of
a. 8 or more contiguous amino acid residues from the sequence Xaa1Xaa2Xaa3Xaa4GARGPESRLLEFYLAMPFATPMEAELARRSLAQDAPPL [SEQ ID NO:1], wherein Xaa1 is absent or is S, Xaa2 is absent or is a hydrophilic amino acid, Xaa3 is absent or is a hydrophilic amino acid, and Xaa4 is absent or is one or more hydrophilic amino acids,
b. 8 or more contiguous amino acid residues from the sequence Xaa1Xaa2Xaa3GARGPESRLLEFYLAMPFATPMEAELARRSLAQDAPPL [SEQ ID NO:2], wherein Xaa1 is absent or is S, Xaa2 is absent or is a hydrophilic amino acid, and Xaa3 is absent or is from one to ten hydrophilic amino acids,
c. 8 or more contiguous amino acid residues from the sequence Xaa1Xaa2GARGPESRLLEFYLAMPFATPMEAELARRSLAQDAPPL [SEQ ID NO:3], wherein Xaa1 is absent or is S, and Xaa2 is absent or is from one to four hydrophilic amino acids,
d. 8 or more contiguous amino acid residues from the sequence SKKKKGARGPESRLLEFYLAMPFATPMEAELARRSLAQDAPPL [SEQ ID NO:4],
e. 8 or more contiguous amino acid residues from the sequence GARGPESRLLEFYLAMPFATPMEAELARRSLAQDAPPL [SEQ ID NO:5],
f. 8 or more contiguous amino acid residues from the sequence LAMPFATPM [SEQ ID NO:6],
g. 8 or more contiguous amino acid residues from the sequence FATPMEAEL [SEQ ID NO:7],
h. 8 or more contiguous amino acid residues from the sequence Xaa1Xaa2Xaa3Xaa4VPGVLLKEFTVSGNILTIRLTAADHR [SEQ ID NO:8], wherein Xaa1 is absent or is S, Xaa2 is absent or is a hydrophilic amino acid, Xaa3 is absent or is a hydrophilic amino acid, and Xaa4 is absent or is one or more hydrophilic amino acids,
i. 8 or more contiguous amino acid residues from the sequence Xaa1Xaa2Xaa3VPGVLLKEFTVSGNILTIRLTAADHR [SEQ ID NO:9], wherein Xaa1 is absent or is S, Xaa2 is absent or is a hydrophilic amino acid, and Xaa3 is absent or is from one to ten hydrophilic amino acids,
j. 8 or more contiguous amino acid residues from the sequence Xaa1Xaa2VPGVLLKEFTVSGNILTIRLTAADHR [SEQ ID NO:10], wherein Xaa1 is absent or is S, and Xaa2 is absent or is from one to four hydrophilic amino acids,
k. 8 or more contiguous amino acid residues from the sequence SKKKKVPGVLLKEFTVSGNILTIRLTAADHR [SEQ ID NO:11],
l. 8 or more contiguous amino acid residues from the sequence VPGVLLKEFTVSGNILTIRLTAADHR [SEQ ID NO:12],
m. 8 or more contiguous amino acid residues from the sequence EFTVSGNIL [SEQ ID NO:13],
n. 8 or more contiguous amino acid residues from the sequence Xaa1Xaa2Xaa3Xaa4LQQLSLLMWITQCFLPVFLAQPPSGQRR [SEQ ID NO:14], wherein Xaa1 is absent or is S, Xaa2 is absent or is a hydrophilic amino acid, Xaa3 is absent or is a hydrophilic amino acid, and Xaa4 is absent or is one or more hydrophilic amino acids
o. 8 or more contiguous amino acid residues from the sequence Xaa1Xaa2Xaa3LQQLSLLMWITQCFLPVFLAQPPSGQRR [SEQ ID NO:15], wherein Xaa1 is absent or is S, Xaa2 is absent or is a hydrophilic amino acid, and Xaa3 is absent or is from one to ten hydrophilic amino acids,
p. 8 or more contiguous amino acid residues from the sequence Xaa1Xaa2LQQLSLLMWITQCFLPVFLAQPPSGQRR [SEQ ID NO:16], wherein Xaa1 is absent or is S, and Xaa2 is absent or is from one to four hydrophilic amino acids,
q. 8 or more contiguous amino acid residues from the sequence SKKKKLQQLSLLMWITQCFLPVFLAQPPSGQRR [SEQ ID NO:17],
r. 8 or more contiguous amino acid residues from the sequence LQQLSLLMWITQCFLPVFLAQPPSGQRR [SEQ ID NO:18],
s. 8 or more contiguous amino acid residues from the sequence SLLMWITQCFLPVF [SEQ ID NO:19],
t. 8 or more contiguous amino acid residues from the sequence SLLMWITQC [SEQ ID NO:20],
u. the sequence of any one of SEQ ID NOs: 1 to 20,
v. or any combination of two or more of (a) to (u) above.
108: A pharmaceutical composition comprising an effective amount of a peptide conjugate of claim 94 or a pharmaceutically acceptable salt or solvate thereof, and a pharmaceutically acceptable carrier.
109: A method of vaccinating or eliciting an immune response in a subject comprising administering to the subject an effective amount of a peptide conjugate of claim 94 or a pharmaceutically acceptable salt or solvate thereof or an effective amount of a pharmaceutical composition comprising a peptide conjugate of claim 94 or a pharmaceutically acceptable salt or solvate thereof, and a pharmaceutically acceptable carrier.
110: The compound of claim 94, wherein L1 is C11-C21alkyl; m is 0; R3 is hydrogen; R4 and R5 are each hydrogen; n is 1, R6, R7, and R8 are each hydrogen; R9 is hydrogen or L3-C(O), wherein L3 is methyl.
111: A method for making a peptide conjugate according to claim 94, the method comprising reacting
a lipid-containing conjugation partner, and
an amino acid-comprising conjugation partner
under conditions effective to conjugate the lipid-containing conjugation partner to the amino acid-comprising conjugation partner by the hydrothiolation of a carbon-carbon double bond with a thiol.