US20200368337A1
2020-11-26
16/859,252
2020-04-27
Disclosed herein in one aspect is a pharmaceutical composition comprising a plurality of neoantigenic peptides and a pharmaceutically acceptable carrier, each neoantigenic peptide comprising a tumor-specific neoepitope capable of binding to an HLA protein in a subject, each tumor-specific neoepitope comprising a tumor-specific mutation present in a tumor, wherein (a) the composition comprises neoantigenic peptides comprising tumor-specific mutations present in at least 1% of subjects in a population of subjects suffering from cancer; (b) the composition comprises neoantigenic peptides comprising tumor-specific neoepitopes which bind to HLA proteins present in at least 5% of subjects in the population; and (c) the composition comprises at least one neoantigenic peptide capable of eliciting an immune response against a tumor present in at least 5% of the subjects in the population of subjects suffering from cancer.
Get notified when new applications in this technology area are published.
A61K39/0011 » CPC main
Medicinal preparations containing antigens or antibodies; Vertebrate antigens Cancer antigens
G01N2800/7028 » CPC further
Detection or diagnosis of diseases; Mechanisms involved in disease identification (Hyper)proliferation Cancer
A61K39/001104 » CPC further
Medicinal preparations containing antigens or antibodies; Vertebrate antigens; Cancer antigens; Receptors, cell surface antigens or cell surface determinants; Receptors for growth factors Epidermal growth factor receptors [EGFR]
A61K39/001151 » CPC further
Medicinal preparations containing antigens or antibodies; Vertebrate antigens; Cancer antigens; Regulators of development; Apoptosis related proteins, e.g. survivin, livin p53
A61K39/001164 » CPC further
Medicinal preparations containing antigens or antibodies; Vertebrate antigens; Cancer antigens; Enzymes GTPases, e.g. Ras, Rho
A61K39/001152 » CPC further
Medicinal preparations containing antigens or antibodies; Vertebrate antigens; Cancer antigens Transcription factors, e.g. SOX, c-MYC
A61K39/001106 » CPC further
Medicinal preparations containing antigens or antibodies; Vertebrate antigens; Cancer antigens; Receptors, cell surface antigens or cell surface determinants; Receptors for growth factors Her-2/neu/ErbB2, Her-3/ErbB3, Her 4/ErbB4
A61K39/001197 » CPC further
Medicinal preparations containing antigens or antibodies; Vertebrate antigens; Cancer antigens; Fusion proteins originating from gene translocation in cancer cells Breakpoint cluster region-abelson tyrosine kinase [BCR-ABL]
C07K14/4748 » CPC further
Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates from mammals not used Tumour specific antigens; Tumour rejection antigen precursors [TRAP], e.g. MAGE
A61K2039/70 » CPC further
Medicinal preparations containing antigens or antibodies Multivalent vaccine
A61K2039/515 » CPC further
Medicinal preparations containing antigens or antibodies comprising whole cells, viruses or DNA/RNA Animal cells
C12N2320/31 » CPC further
Applications; Uses; Special therapeutic applications Combination therapy
C12N2320/34 » CPC further
Applications; Uses; Special therapeutic applications Allele or polymorphism specific uses
C12Q2600/158 » CPC further
Oligonucleotides characterized by their use Expression markers
G01N2800/56 » CPC further
Detection or diagnosis of diseases Staging of a disease; Further complications associated with the disease
G01N2800/60 » CPC further
Detection or diagnosis of diseases Complex ways of combining multiple protein biomarkers for diagnosis
A61K39/001162 » CPC further
Medicinal preparations containing antigens or antibodies; Vertebrate antigens; Cancer antigens; Enzymes Kinases, e.g. Raf, Src
A61K39/00 IPC
Medicinal preparations containing antigens or antibodies
A61P35/00 » CPC further
Antineoplastic agents
C07K14/47 IPC
Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates from mammals
C12Q1/6886 » CPC further
Measuring or testing processes involving enzymes, nucleic acids or microorganisms ; Compositions therefor; Processes of preparing such compositions involving nucleic acids; Nucleic acid products used in the analysis of nucleic acids, e.g. primers or probes for diseases caused by alterations of genetic material for cancer
This application is a Continuation of Application U.S. application Ser. No. 15/575,328 filed on Nov. 17, 2017, which is a § 371 of international patent application Serial No. PCT/US2016/033452 filed May 20, 2016, which published as PCT Publication No. WO 2016/187508 on Nov. 24, 2016, which claims priority and benefit of U.S. Provisional application Ser. No. 62/179,877 filed May 20, 2015 and U.S. Provisional application Ser. No. 62/389,377 filed Feb. 23, 2016.
The foregoing applications, and all documents cited therein or during their prosecution (āappin cited documentsā) and all documents cited or referenced in the appin cited documents, and all documents cited or referenced herein (āherein cited documentsā), and all documents cited or referenced in herein cited documents, together with any manufacturer's instructions, descriptions, product specifications, and product sheets for any products mentioned herein or in any document incorporated by reference herein, are hereby incorporated herein by reference, and may be employed in the practice of the invention. More specifically, all referenced documents are incorporated by reference to the same extent as if each individual document was specifically and individually indicated to be incorporated by reference.
The instant application contains a ālengthyā Sequence Listing which has been submitted electronically in ASCII format and is hereby incorporated by reference in its entirety. Said ASCII format, created on Aug. 11, 2016, is named 47608_99_2007 SL.txt and is 10,252,288 bytes in size.
The present invention relates to methods and compositions for treating neoplasias, e.g. tumors, particularly using at least one neoantigenic peptide which is suitable for treating a significant proportion of subjects in a population suffering from cancer.
Approximately 1.6 million Americans are diagnosed with neoplasia every year, and approximately 580,000 people in the United States are expected to die of the disease in 2013. Over the past few decades there been significant improvements in the detection, diagnosis, and treatment of neoplasia, which have significantly increased the survival rate for many types of neoplasia. However, only about 60% of people diagnosed with neoplasia are still alive 5 years after the onset of treatment, which makes neoplasia the second leading cause of death in the United States.
Currently, there are a number of different existing cancer therapies, including ablation techniques (e.g., surgical procedures, cryogenic/heat treatment, ultrasound, radiofrequency, and radiation) and chemical techniques (e.g., pharmaceutical agents, cytotoxic/chemotherapeutic agents, monoclonal antibodies, and various combinations thereof). Unfortunately, such therapies are frequently associated with serious risk, toxic side effects, and extremely high costs, as well as uncertain efficacy.
There is a growing interest in cancer therapies that seek to target cancerous cells with a patient's own immune system (e.g., cancer vaccines) because such therapies may mitigate/eliminate some of the herein-described disadvantages. Cancer vaccines are typically composed of tumor antigens and immunostimulatory molecules (e.g., cytokines or TLR ligands) that work together to induce antigen-specific cytotoxic T cells that target and destroy tumor cells. Current cancer vaccines may contain shared tumor antigens, which are native proteins (i.e. āproteins encoded by the DNA of all the normal cells in the individual) that are selectively expressed or over-expressed in tumors found in many individuals. While such shared tumor antigens are useful in identifying particular types of tumors, they are not ideal as immunogens for targeting a T-cell response to a particular tumor type because they are subject to the immune dampening effects of self-tolerance. Vaccines containing tumor-specific and patient-specific neoantigens can overcome some of the disadvantages of vaccines containing shared tumor antigens. However, the use of patient-specific neoantigens requires sequencing of individual subject's genomes, as well as the production of personalized compositions comprising a combination of neoantigens present in that individual subject. Accordingly, there is still a need for improved methods and compositions for delivering cancer vaccines.
Citation or identification of any document in this application is not an admission that such document is available as prior art to the present invention.
Preferred statements (features) and embodiments of this invention are set herein below. Each statements and embodiments of the invention so defined may be combined with any other statement and/or embodiments unless clearly indicated to the contrary. In particular, any feature indicated as being preferred or advantageous may be combined with any other feature or features or statements indicated as being preferred or advantageous. Hereto, the present invention is in particular captured by any one or any combination of one or more of the below statements and embodiments, with any other statement and/or embodiments.
It is an objective of the invention to provide methods and compositions for the treatment of a population of cancer patients by eliciting an immune response targeting the cancer. In one aspect, the present invention relates to a pharmaceutical composition comprising at least one neoantigenic peptide and a pharmaceutically acceptable carrier, each at least one neoantigenic peptide comprising a tumor-specific neoepitope capable of binding to an HLA protein in a subject, each tumor-specific neoepitope comprising a tumor-specific mutation present in a tumor. The composition may include one neoantigenic peptide. In other embodiments, the composition may include more than 100 neoantigenic peptides. Preferably, the composition includes about 20 neoantigenic peptides. The at least one neoantigenic peptide may include a tumor-specific mutation. The mutation may be recurrent. Preferably, the mutation is present in a large proportion of a population. A recurrent mutation may be based on the mutation being present in a tumor in at least 1% of subjects in a population of subjects suffering from cancer. The composition may include at least one neoantigenic peptide containing a tumor-specific neoepitope which binds to an HLA protein present in at least 5% of subjects in the population of subjects suffering from cancer. Additionally, the composition may contain at least one neoantigenic peptide capable of eliciting an immune response against a tumor present in at least 5% of the subjects in the population of subjects suffering from cancer. The ability to elicit an immune response refers to the ability of the immune system to present an antigen to a lymphocyte. In order for the immune system to present an antigen, the antigen needs to be presented by a subjects HLA proteins. In order to elicit an immune response against a tumor, the tumor needs to contain the mutations leading to expression of the antigen. In order for the composition to provide a benefit to a population in need thereof, the population has to include subjects that express an HLA allele capable of binding the at least one neoantigenic peptide present in the composition and the population has to include subjects containing tumors with mutations that lead to neoantigenic epitopes present in the neoantigenic peptides.
The composition may be specific to a population of subjects suffering from cancer that share a characteristic. The population may have cancer or may have a specific cancer. The population may share a common set of HLA subtypes. They may share HLA subtypes based on ethnicity. Not being bound by a theory the percentage of HLA types in a population can be predicted based on ethnicity without testing. Not being bound by a theory, different populations express different HLA types capable of binding different neoantigenic peptides. Therefore a composition can be formulated to provide a benefit to a large proportion of that population, whereas the composition would not provide a benefit to another population. Not being bound by a theory, different cancers contain different mutations and thus compositions tailored to specific cancers can be used to provide a greater benefit to a population with one type of cancer as compared to a population that includes more than one type. In one embodiment, the population is suffering from adrenocortical carcinoma (ACC), bladder urothelial carcinoma (BLCA), breast invasive carcinoma (BRCA), cervical squamous cell carcinoma and endocervical adenocarcinoma (CESC), colon adenocarcinoma (COAD), Chronic lymphocytic Leukaemia (CLL), colorectal cancer (CRC), Diffuse large B-cell lymphoma (DLBCL), glioblastoma multiforme (GBM), head and neck squamous cell carcinoma (HNSC), kidney chromophobe (KICH), kidney renal clear cell carcinoma (KIRC), kidney renal papillary cell carcinoma (KIRP), acute myeloid leukemia (LAML), liver hepatocellular carcinoma (LIHC), lung adenocarcinoma (LUAD), lung squamous cell carcinoma (LUSC), multiple myeloma (MM), ovarian serous cystadenocarcinoma (OV), pancreatic adenocarcinoma (PAAD), prostate adenocarcinoma (PRAD), rectum adenocarcinoma (READ), skin cutaneous melanoma (SKCM), stomach adenocarcinoma (STAD), testicular germ cell tumors (TGCT), thyroid adenocarcinoma (THCA), uterine corpus endometrioid carcinoma (UCEC), or uterine carcinosarcoma (UCS).
In one embodiment, the population of subjects is suffering from CLL; the at least one tumor-specific mutation comprises any combination of mutations in Table 8 with an exemplary disease of āCLLā; and at least one of a set of six of the at least one tumor-specific mutation will be found in 17.49% of subjects in the CLL population. The population of subjects may be suffering from BLCA, the at least one tumor-specific mutation comprises any combination of mutations in Table 8 with an exemplary disease of āBLCAā; and at least one of a set of six of the at least one tumor-specific mutation will be found in 26.92% of subjects in the population. The population of subjects may be suffering from BRCA; the at least one tumor-specific mutation comprises any combination of mutations in Table 8 with an exemplary disease of āBRCAā; and at least one of a set of 18 of the at least one tumor-specific mutation will be found in 36.04% of subjects in the population. The population of subjects may be suffering from COAD; the at least one tumor-specific mutation comprises any combination of mutations in Table 8 with an exemplary disease of āCOADā; and at least one of a set of three of the at least one tumor-specific mutation will be found in 27.14% of subjects in the population. The population of subjects may be suffering from GBM; the at least one tumor-specific mutation comprises any combination of mutations in Table 8 with an exemplary disease of āGBMā; and at least one of a set of 14 of the at least one tumor-specific mutation will be found in 34.36% of subjects in the population. The population of subjects may be suffering from HNSC; the at least one tumor-specific mutation comprises any combination of mutations in Table 8 with an exemplary disease of āHNSCā; and at least one of a set of 10 of the at least one tumor-specific mutation will be found in 21.61% of subjects in the population. The population of subjects may be suffering from KIRC; the at least one tumor-specific mutation comprises any combination of mutations in Table 8 with an exemplary disease of āKIRCā; and at least one of a set of four of the at least one tumor-specific mutation will be found in 6% of subjects in the population. The population of subjects may be suffering from LAML; the at least one tumor-specific mutation comprises any combination of mutations in Table 8 with an exemplary disease of āLAMLā; and at least one of a set of 11 of the at least one tumor-specific mutation will be found in 47.45% of subjects in the population. The population of subjects may be suffering from LUAD; the at least one tumor-specific mutation comprises any combination of mutations in Table 8 with an exemplary disease of āLUADā; and at least one of a set of 11 of the at least one tumor-specific mutation will be found in 33.42% of subjects in the population. The population of subjects may be suffering from LUSC; the at least one tumor-specific mutation comprises any combination of mutations in Table 8 with an exemplary disease of āLUSCā; and at least one of a set of two of the at least one tumor-specific mutation will be found in 7.87% of subjects in the population. The population of subjects may be suffering from OV; the at least one tumor-specific mutation comprises any combination of mutations in Table 8 with an exemplary disease of āOVā; and at least one of a set of ten of the at least one tumor-specific mutation will be found in 22.78% of subjects in the population. The population of subjects may be suffering from READ; the at least one tumor-specific mutation comprises any combination of mutations in Table 8 with an exemplary disease of āREADā; and at least one of a set of two of the at least one tumor-specific mutation will be found in 20.51% of subjects in the population. The population of subjects may be suffering from SKCM; the at least one tumor-specific mutation comprises any combination of mutations in Table 8 with an exemplary disease of āSKCMā; and at least one of a set 64 of the at least one tumor-specific mutation will be found in 90.91% of subjects in the population. The population of subjects may be suffering from UCEC; the at least one tumor-specific mutation comprises any combination of mutations in Table 8 with an exemplary disease of āUCECā; and at least one of a set of 30 of the at least one tumor-specific mutation will be found in 67.74% of subjects in the population. The population of subjects may be suffering from ACC; the at least one tumor-specific mutation comprises any combination of mutations in Table 8 with an exemplary disease ofāACCā; and at least one of a set of 161 of the at least one tumor-specific mutation will be found in 50% of subjects in the population. The population of subjects may be suffering from CESC; the at least one tumor-specific mutation comprises any combination of mutations in Table 8 with an exemplary disease ofāCESCā; and at least one of a set of four of the at least one tumor-specific mutation will be found in 23.71% of subjects in the population. The population of subjects may be suffering from CRC; the at least one tumor-specific mutation comprises any combination of mutations in Table 8 with an exemplary disease ofāCRCā; and at least one of a set of 15 of the at least one tumor-specific mutation will be found in 56.65% of subjects in the population. The population of subjects may be suffering from DLBCL; the at least one tumor-specific mutation comprises any combination of mutations in Table 8 with an exemplary disease ofāDLBCLā; and at least one of a set of 2 of the at least one tumor-specific mutation will be found in 13.79% of subjects in the population. The population of subjects may be suffering from KICH; the at least one tumor-specific mutation comprises any combination of mutations in Table 8 with an exemplary disease ofāKICHā; and at least one of a set of 24 of the at least one tumor-specific mutation will be found in 50% of subjects in the population. The population of subjects may be suffering from KIRP; the at least one tumor-specific mutation comprises any combination of mutations in Table 8 with an exemplary disease ofāKIRPā; and at least one of a set of nine of the at least one tumor-specific mutation will be found in 42.24% of subjects in the population. The population of subjects may be suffering from LIHC; the at least one tumor-specific mutation comprises any combination of mutations in Table 8 with an exemplary disease ofāLIHCā; and at least one of a set of 2 of the at least one tumor-specific mutation will be found in 6.57% of subjects in the population. The population of subjects may be suffering from MM; the at least one tumor-specific mutation comprises any combination of mutations in Table 8 with an exemplary disease ofāMMā; and at least one of a set of 6 of the at least one tumor-specific mutation will be found in 23.9% of subjects in the population. The population of subjects may be suffering from PRAD; the at least one tumor-specific mutation comprises any combination of mutations in Table 8 with an exemplary disease ofāPRADā; and at least one of a set of 24 of the at least one tumor-specific mutation will be found in 39.85% of subjects in the population. The population of subjects may be suffering from STAD; the at least one tumor-specific mutation comprises any combination of mutations in Table 8 with an exemplary disease ofāSTADā; and at least one of a set of 150 of the at least one tumor-specific mutation will be found in 48.79% of subjects in the population. The population of subjects may be suffering from TGCT; the at least one tumor-specific mutation comprises any combination of mutations in Table 8 with an exemplary disease ofāTGCTā; and at least one of a set of 14 of the at least one tumor-specific mutation will be found in 51.61% of subjects in the population. The population of subjects may be suffering from THCA; the at least one tumor-specific mutation comprises any combination of mutations in Table 8 with an exemplary disease ofāTHCAā; and at least one of a set of five of the at least one tumor-specific mutation will be found in 69.88% of subjects in the population. The population of subjects may be suffering from UCS; the at least one tumor-specific mutation comprises any combination of mutations in Table 8 with an exemplary disease ofāUCSā; and at least one of a set of two of the at least one tumor-specific mutation will be found in 16.07% of subjects in the population. The population of subjects may be suffering from PAAD; the at least one tumor-specific mutation comprises any combination of mutations in Table 8 with an exemplary disease ofāPAADā; and at least one of a set of 53 of the at least one tumor-specific mutation will be found in 50% of subjects in the population. The population of subjects may also be suffering from a solid tumor. The solid tumor may be clear cell Renal Cell Carcinoma (ccRCC), melanoma, sarcoma, or a cancer of the bladder, colon, brain, breast, head and neck, endometrium, lung, ovary, pancreas or prostate. The population of subjects may be suffering from a liquid tumor. The liquid tumor may be Non-Hodgkin's lymphoma or leukemia.
In another embodiment, the at least one tumor-specific mutation has an incidence of at least 500 patients a year in the population of subjects suffering from cancer, and wherein the at least one mutation may be a mutation listed for the population in Table 9. The at least one neoantigenic peptide may be at least one peptide listed in Table 9.
In another embodiment, the population suffering from cancer is being treated with a drug or therapy. The population suffering from cancer may have been previously treated with, is currently being treated with, or is selected to treated with ibrutinib, erlotinib, imatinib, gefitinib, crizotinib, trastuzumab, vemurafenib, RAF/MEK or antiestrogen therapy.
In another embodiment, the composition comprises at least one neoantigenic peptide capable of eliciting an immune response against a tumor present in at least 5%, 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, 90%, 95% or 99% of subjects in a population of subjects suffering from cancer.
In another embodiment, at least 5%, 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, 90%, 95% or 99% of subjects in the population has at least one tumor-specific mutation present in the composition; and at least 5%, 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, 90%, 95% or 99% of subjects in the population has at least one HLA protein which binds to a tumor-specific neoepitope present in the composition.
In one embodiment, the tumor-specific mutations comprise splice-variant mutations, point mutations, and/or frameshift mutations. In another embodiment, the tumor-specific mutations comprise drug resistance mutations. In one embodiment, the neoantigenic peptides include not only the resulting mutated neoantigen protein sequence, but a long peptide region surrounding and including the mutation and includes all contiguous segments within it (see Tables 1-4). In one embodiment, the tumor-specific mutations are present in one or more genes encoding a protein selected from the group consisting of Programmed Death-Ligand 1 (PD-L1), androgen receptor (AR), Bruton's Tyrosine Kinase (BTK), Epidermal Growth Factor Receptor (EGFR), BCR-Abl, c-kit, PIK3CA, HER2, EML4-ALK, KRAS, ALK, ROS1, AKT1, BRAF, MEK1, MEK2, NRAS, RAC1, and ESR1. In one embodiment, the tumor-specific mutations are present in one or more genes listed in any of the Tables presented herein. In one embodiment, the at least one tumor-specific mutation is derived from alternative splicing of PD-L1 or AR. In one embodiment, the at least one tumor-specific mutation is derived from splice variant sPD-L1, AR-V1 or AR-V7. In one embodiment, the least one tumor-specific mutation is a drug resistance mutation selected from the group consisting of BTK/C481S, EGFR/T790M, BCR-Abl/T315I, BCR-Abl/Y253H, BCR-Abl/E255K, BCR-Abl/E255V, c-kit/T670I, PIK3CA/E545K, PIK3CA/E542K, HER2/G776(YVMA), HER2/E545K, EML4-ALK/G1269A, KRAS/G12V/D, ALK/L1196M, ALK/G1202R, ALK/S1206Y, ALK/1151T(ins), ALK/F1174C, ROS1/G2032R, AKT1/E17K, BRAF/V600E, MEK1/Q56P, MEK1/E203K, MEK1/C121S, MEK1/V60E, MEK1/G128V, MEK1/V154I, MEK1/P124S, MEK1/P124L, NRAS/Q61K/L/R, NRAS/T58I, MEK2/C125S, RAC1/P29S, ESR1/S463P, AR/V534E, AR/P535H, AR/L536Q, AR/L536R, AR/Y537C, AR/Y537S, AR/Y537N, AR/D538G and AR/F876L. In one embodiment, the drug resistance mutation is induced by treatment with ibrutinib, erlotinib, imatinib, gefitinib, crizotinib, trastuzumab, vemurafenib, RAF/MEK or antiestrogen therapy. In another embodiment, a subject has a drug resistance mutation before treatment.
In another embodiment, the composition comprises at least 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19 or 20 neoantigenic peptides. The composition may include 15 to 20 neoantigenic peptides. The composition may include greater than 100, 200, or 300 neoantigenic peptides. Each neoantigenic peptide may be from about 5 to about 50 amino acids in length.
In another embodiment, the pharmaceutical composition is an immunogenic or vaccine composition. The pharmaceutical composition may further comprise an immunomodulator or adjuvant. The immunodulator or adjuvant may be selected from the group consisting of poly-ICLC, 1018 ISS, aluminum salts, Amplivax, AS15, BCG, CP-870,893, CpG7909, CyaA, cyclic di-nucleotides such as STING, dSLIM, GM-CSF, IC30, IC31, Imiquimod, ImuFact IMP321, IS Patch, ISS, ISCOMATRIX, Juvlmmune, LipoVac, MF59, monophosphoryllipid A, Montanide IMS 1312, Montanide ISA 206, Montanide ISA 50V, Montanide ISA-51, OK-432, OM-174, OM-197-MP-EC, ONTAK, PepTelĀ®, vector system, PLGA microparticles, resiquimod, SRL172, Virosomes and other Virus-like particles, YF-17D, VEGF trap, R848, beta-glucan, Pam3Cys, and Aquila's QS21 stimulon.
In another embodiment, the pharmaceutical composition comprises one or more neoantigenic peptides as defined in Table 1, 2, 3 or 4.
In one embodiment, each tumor-specific neoepitope binds to HLA-A, -B or -C or to HLADRB, HLADBM XXXXX with a KD of less than 500 nM.
In another aspect, the present invention relates to a method of treating or preventing a tumor in a subject in need thereof by administering to the subject any pharmaceutical composition as described herein.
In one embodiment, a method of treating or preventing a tumor in a patient in need thereof is provided, comprising administering to a patient a composition comprising at least one neoantigenic peptide and a pharmaceutically acceptable carrier, each at least one neoantigenic peptide comprising a tumor-specific neoepitope capable of binding to an HLA protein in a subject, each tumor-specific neoepitope comprising a tumor-specific mutation present in a tumor, wherein the composition comprises at least one neoantigenic peptide comprising a tumor-specific mutation present in a tumor in at least 1% of subjects in a population of subjects suffering from cancer; the composition comprises at least one neoantigenic peptide comprising a tumor-specific neoepitope which binds to an HLA protein present in at least 5% of subjects in the population of subjects suffering from cancer; and the composition comprises at least one neoantigenic peptide capable of eliciting an immune response against a tumor present in at least 5% of the subjects in the population of subjects suffering from cancer.
In one embodiment, the population of subjects is suffering from adrenocortical carcinoma (ACC), bladder urothelial carcinoma (BLCA), breast invasive carcinoma (BRCA), cervical squamous cell carcinoma and endocervical adenocarcinoma (CESC), colon adenocarcinoma (COAD), Chronic lymphocytic Leukaemia (CLL), colorectal cancer (CRC), Diffuse large B-cell lymphoma (DLBCL), glioblastoma multiforme (GBM), head and neck squamous cell carcinoma (HNSC), kidney chromophobe (KICH), kidney renal clear cell carcinoma (KIRC), kidney renal papillary cell carcinoma (KIRP), acute myeloid leukemia (LAML), liver hepatocellular carcinoma (LIHC), lung adenocarcinoma (LUAD), lung squamous cell carcinoma (LUSC), multiple myeloma (MM), ovarian serous cystadenocarcinoma (OV), pancreatic adenocarcinoma (PAAD), prostate adenocarcinoma (PRAD), rectum adenocarcinoma (READ), skin cutaneous melanoma (SKCM), stomach adenocarcinoma (STAD), testicular germ cell tumors (TGCT), thyroid adenocarcinoma (THCA), uterine corpus endometrioid carcinoma (UCEC), or uterine carcinosarcoma (UCS). In one embodiment, the population of subjects is suffering from a solid tumor. The solid tumor may be clear cell Renal Cell Carcinoma (ccRCC), melanoma, sarcoma, or a cancer of the bladder, colon, brain, breast, head and neck, endometrium, lung, ovary, pancreas or prostate. In one embodiment, the population of subjects is suffering from a liquid tumor. The liquid tumor may be Non-Hodgkin's lymphoma or leukemia.
In one embodiment, the population suffering from cancer was treated with, is being treated with, or is selected to treated with ibrutinib, erlotinib, imatinib, gefitinib, crizotinib, trastuzumab, vemurafenib, RAF/MEK or antiestrogen therapy.
In one embodiment, the at least one neoantigenic peptide is capable of eliciting an immune response against a tumor present in at least 5%, 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, 90%, 95% or 99% of subjects in the population of subjects suffering from cancer. In one embodiment, at least 5%, 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, 90%, 95% or 99% of subjects in the population has at least one tumor-specific mutation present in the composition and, at least 5%, 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, 90%, 95% or 99% of subjects in the population has at least one HLA protein which binds to a tumor-specific neoepitope present in the composition.
In another embodiment, the tumor-specific mutations comprise splice-variant mutations, point mutations, and/or frameshift mutations. The tumor-specific mutations may be drug resistance mutations. The tumor-specific mutations may be present in one or more genes encoding a protein selected from the group consisting of Programmed Death-Ligand 1 (PD-L1), androgen receptor (AR), Bruton's Tyrosine Kinase (BTK), Epidermal Growth Factor Receptor (EGFR), BCR-Abl, c-kit, PIK3CA, HER2, EML4-ALK, KRAS, ALK, ROS1, AKT1, BRAF, MEK1, MEK2, NRAS, RAC1, and ESR1. The tumor-specific mutations may be present in one or more genes listed in any of the Tables. The at least one tumor-specific mutation may be derived from alternative splicing of PD-L1 or AR. The at least one tumor-specific mutation may be derived from splice variant sPD-L1, AR-V1 or AR-V7.
In one embodiment, the at least one tumor-specific mutation is a drug resistance mutation selected from the group consisting of BTK/C481S, EGFR/T790M, BCR-Abl/T315I, BCR-Abl/Y253H, BCR-Abl/E255K, BCR-Abl/E255V, c-kit/T670I, PIK3CA/E545K, PIK3CA/E542K, HER2/G776(YVMA), HER2/E545K, EML4-ALK/G1269A, KRAS/G12V/D, ALK/L1196M, ALK/G1202R, ALK/S1206Y, ALK/1151T(ins), ALK/F1174C, ROS1/G2032R, AKT1/E17K, BRAF/V600E, MEK1/Q56P, MEK1/E203K, MEK1/C121S, MEK1/V60E, MEK1/G128V, MEK1/V154I, MEK1/P124S, MEK1/P124L, NRAS/Q61K/L/R, NRAS/T58I, MEK2/C125S, RAC1/P29S, ESR1/S463P, AR/V534E, AR/P535H, AR/L536Q, AR/L536R, AR/Y537C, AR/Y537S, AR/Y537N, AR/D538G and AR/F876L. The drug resistance mutation may be induced by treatment with ibrutinib, erlotinib, imatinib, gefitinib, crizotinib, trastuzumab, vemurafenib, RAF/MEK or antiestrogen therapy.
In another embodiment, the composition comprises at least 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19 or 20 neoantigenic peptides. In a preferred embodiment, the composition comprises 15 to 20 neoantigenic peptides.
In another embodiment, each neoantigenic peptide is from about 5 to about 50 amino acids in length.
In another embodiment, the composition is an immunogenic or vaccine composition. For instance, the immunogenic or vaccine composition may comprise an immunomodulator or adjuvant. The immunodulator or adjuvant may be selected from the group consisting of poly-ICLC, 1018 ISS, aluminum salts, Amplivax, AS15, BCG, CP-870,893, CpG7909, CyaA, cyclic di-nucleotides such as STING, dSLIM, GM-CSF, IC30, IC31, Imiquimod, ImuFact IMP321, IS Patch, ISS, ISCOMATRIX, Juvlmmune, LipoVac, MF59, monophosphoryllipid A, Montanide IMS 1312, Montanide ISA 206, Montanide ISA 50V, Montanide ISA-51, OK-432, OM-174, OM-197-MP-EC, ONTAK, PepTelĀ®, vector system, PLGA microparticles, resiquimod, SRL172, Virosomes and other Virus-like particles, YF-17D, VEGF trap, R848, beta-glucan, Pam3Cys, and Aquila's QS21 stimulon.
In one embodiment, the composition comprises one or more neoantigenic peptides as defined in Table 1, 2, 3 or 4.
In one embodiment, each tumor-specific neoepitope binds to HLA-A, -B or -C or to HLADRB, HLADBM XXXXX with a KD of less than 500 nM.
In another aspect, the present invention provides a method of prophylactic cancer treatment comprising selecting a cancer drug for a patient in need thereof, the drug selected from the group consisting of ibrutinib, erlotinib, imatinib, gefitinib, crizotinib, trastuzumab, vemurafenib, RAF/MEK and antiestrogen therapy; and administering prophylactically to the subject, before drug resistant mutations can be detected, a pharmaceutical composition comprising neoantigenic peptides derived from drug resistant mutations associated with the selected cancer drug.
The shared neoantigen immunogenic composition can be administered via subcompositions, each containing a portion of the neoantigens, and sub-compositions can be administered to different places on the subject or patient; for instance, a composition comprising 20 different neoantigens, can be administered in four (4) subcompositions, each containing 5 of the 20 different neoantigens, and the four (4) subcompositions can be administered so as to endeavor to deliver each subcomposition to a separate set of draining lymph nodes of the patient, e.g., to each of the arms and legs (e.g., thigh or upper thigh or near buttocks or lower back on each side of the patient) so as to endeavor to deliver fewer neoantigens to each set of draining lymph nodes of the patient or subject and thereby limit competition between neoantigens. Of course, the number of locations and hence number of subcompositions can vary, e.g., the skilled practitioner could consider administration at or near the spleen to have a fifth point of administration, and the skilled practitioner can vary the locations such that only one, two or three are used (e.g., each arm and a leg, each of legs and one arm, each of the legs and no arms, or only both arms). The shared neoantigen immunogenic composition administered at the aforementioned various intervals can be different formulations, and the subcompositions administered at different places on the subject or patient during a single administration can be different compositions. For instance, a first administration can be of a whole shared neoantigen immunogenic composition and a next or later administration can be of a vector (e.g., viral vector or plasmid) that has expression of antigen(s) in vivo. Likewise, in the administration of different subcompositions to different locations on the patient or subject, some of the subcompositions can comprise a whole antigen and some of the subcompositions can comprise a vector (e.g., viral vector or plasmid) that has expression of antigen(s) in vivo. And some compositions and subcompositions can comprise both vector(s) (e.g., viral vector or plasmid) that has/have expression of antigen(s) in vivo and whole antigens. Some vectors (e.g., poxvirus) that have expression of antigen(s) in vivo can have an immunostimulatory or adjuvanting effect, and hence compositions or subcompositions that contain such vectors can be self-adjuvanting. Also, by changing up the nature of how the antigens are presented to the immune system, the administrations can āprimeā and then āboostā the immune system. And in this text, when there is mention of a āvaccineā it is intended that the invention comprehends immunogenic compositions, and when there is mention of a patient or subject it is intended that such an individual is a patient or subject in need of the herein disclosed treatments, administrations, compositions, and generally the subject invention.
Moreover, the invention applies to the use of any type of expression vector, such as a viral expression vector, e.g., poxvirus (e.g., orthopoxvirus or avipoxvirus such as vaccinia virus, including Modified Vaccinia Ankara or MVA, MVA-BN, NYVAC according to WO-A-92/15672, fowlpox, e.g., TROVAX, canarypox, e.g., ALVAC (WO-A-95/27780 and WO-A-92/15672) pigeonpox, swinepox and the like), adenovirus, AAV, herpesvirus, and lentivirus; or a plasmid or DNA or nucleic acid molecule vector. Some vectors that are cytoplasmic, such as poxvirus vectors, may be advantageous. However adenovirus, AAV and lentivirus can also be advantageous to use in the practice of the invention.
In a ready-for-use, especially reconstituted, shared neoantigen immunogenic composition, the vector, e.g., viral vector, is present in the quantities within the ambit of the skilled person from this disclosure and the knowledge in the art (such as in patent and scientific literature cited herein).
Whole antigen or vector, e.g., recombinant live vaccines may exist in a freeze-dried form allowing their storage and are reconstituted immediately before use in a solvent or excipient, which can include an adjuvant as herein discussed.
The subject of the invention is therefore also a vaccination or immunization set or kit comprising, packaged separately, freeze-dried vaccine and a solution, advantageously including an adjuvant compound as herein discussed for the reconstitution of the freeze-dried vaccine.
The subject of the invention is also a method of vaccination or immunization comprising or consisting essentially of or consisting of administering, e.g., by the parenteral, preferably subcutaneous, intramuscular or intradermal, route or by the mucosal route a vaccine or immunogenic composition in accordance with the invention at the rate of one or more administrations. Optionally this method includes a preliminary step of reconstituting the freeze-dried shared neoantigen immunogenic composition (e.g., if lyophilized whole antigen or vector) in a solution, advantageously also including an adjuvant.
In one embodiment, the shared neoantigen immunogenic composition is administered at a dose of about 10 μg to 1 mg per 70 kg individual as to each neoantigenic peptide. In another embodiment, the shared neoantigen immunogenic composition is administered at an average weekly dose level of about 10 μg to 2000 μg per 70 kg individual as to each neoantigenic peptide. In another related embodiment, the administration is intravenous. In one embodiment, the shared neoantigen immunogenic composition is administered intravenously or subcutaneously.
In another embodiment, the method further comprises (a) obtaining a sample of tumor tissue from each subject; (b) detecting one or more of the tumor-specific mutations in the sample; and (c) selecting a subject from the population of subjects for treatment with the at least one neoantigenic peptides if at least one of the tumor-specific mutations are detected in the sample from the subject.
In another embodiment, the method further comprises (a) determining HLA allotypes present in each subject; and (b) selecting a subject from the population of subjects for treatment with the at least one neoantigenic peptides if one or more HLA allotypes present in the subject binds to one or more of the tumor-specific neoepitopes present in the at least one neoantigenic peptides.
Embodiments of the present invention relate to compositions and methods using shared neoantigens, which (unlike shared native (non-mutated) antigens derived from genes differentially expressed in tumors) have desirable properties such as not being subject to the immune-dampening effects of central tolerance and high tumor specificity. This is because the neoantigens are expressed only in tumor tissue, e.g. are generated by tumor-specific mutations or splicing defects. Such splice variants or mutations may generate immunogenic epitopes across a variety of HLA alleles, thus covering a significant proportion of the population. Moreover, because these mutations may be present in a significant proportion of subjects suffering from cancer, the compositions described herein do not require sequencing of whole genomes of subjects and may be used as an āoff-the-shelfā product to treat multiple subjects. For instance, the method may simply involve detecting in a tumor sample from the subject one or more of the specific mutations present in the composition, and administering the composition to subjects in which at least one mutation is present. This is in contrast to methods using patient-specific neoantigen mixtures, which require whole genome or whole exome sequencing of each subject and the production of personalized treatment compositions.
Other embodiments relate to a combination therapy wherein the methods of treatment using a shared neoantigen composition of the present invention are used in concert with a current drug regimen. The shared neoantigen composition may be administered prophylactically. In one embodiment, a patient in need thereof is treated with chemotherapy and/or a targeted therapy in combination with a shared neoantigen immunogenic composition before a drug resistance mutation can be detected. The shared neoantigen immunogenic composition can be tailored to include neoantigen peptides specific to the resistance mutations associated with a chosen therapy. In another embodiment, the shared neoantigen composition is administered before the subject is treated with a chemotherapy and/or a targeted therapy, to generate an immune response to cells harboring a drug resistance mutation before such cells develop. The administering can be serially or sequentially or at substantially the same time or substantially simultaneously. For example, the administering of the shared neoantigen immunogenic composition and the administering of a cancer therapy can be at about the same time or substantially simultaneously. Alternatively, the administering of the shared neoantigen immunogenic composition can be on one time schedule, e.g., weekly, biweekly, every three weeks, monthly, bimonthly, every quarter year (every three months), every third of a year (every four months), every five months, twice yearly (every six months), every seven months, every eight months, every nine months, every ten months, every eleven months, annually or the like, and the administering of the cancer therapy can be on a different schedule that is typical for the therapy such that the subject or patient has two different treatment schedules running concomitantly and the administering of the shared neoantigen immunogenic composition and the administering of the cancer therapy can be sequentially or serially. In preferred embodiments the subject may be treated with ibrutinib, erlotinib, imatinib, gefitinib, crizotinib, trastuzumab, vemurafenib, RAF/MEK or antiestrogen therapy.
In another aspect the present invention provides a diagnostic method for early detection and tracking of cancer progression by determining the presence of at least one neoantigenic peptide of the present invention in a patient sample. The patient sample may be derived from blood, sputum, saliva, urine, tumor tissue, lymphatic fluid, semen or feces.
In one embodiment, the diagnostic method is used before administering the shared neoantigen composition as described herein. The diagnostic method may include comparing the amount of shared neoantigen mutations in a series of at least two samples taken during treatment with a cancer therapy and/or shared neoantigen composition. Not being bound by a theory, an increase or decrease in shared neoantigen mutations can be used to determine treatment efficacy.
In one embodiment, the mutated genes can be detected using PCR based methods or sequencing. Reverse transcription PCR (RT-PCR) can be used to detect mutations in transcribed neoantigen genes. Additionally, any sequencing technique can be used to determine the presence of a mutation. In a preferred embodiment, pyrosequencing is used. The present invention also provides for a kit that includes primers that are specific to sequences encompassing the neoantigen mutations.
In another embodiment the mutated genes are detected by immunological detection methods. Antibodies specific to the shared neoantigen mutations can be used to detect the muations. The antibodies may be bound to an array. The array may include antibodies to detect more than one of the shared neoantigen mutations of the present invention. The antibodies can be configured for use in an ELISA assay. Therefore, a composition or kit may be provided that includes antibodies specifically recognizing the shared neoantigens of the present invention.
In another aspect the present invention provides a method of treating or preventing a tumor in a population of subjects in need thereof, comprising administering to a subject an agent comprising an extracellular ligand-binding domain recognizing a tumor-specific neoepitope comprising a tumor-specific mutation having an incidence of at least 1% of subjects in the population. The agent may be an antibody, antibody fragment, antibody drug conjugate, aptamer, CAR, or T cell receptor. The antibody or antibody fragment may be humanized, fully humanized, or chimeric. The antibody fragment may be a nanobody, Fab, Fabā², (Fabā²)2, Fv, ScFv, diabody, triabody, tetrabody, Bis-scFv, minibody, Fab2, or Fab3 fragment. The tumor-specific mutation may be a mutation listed for any population in Table 9. The tumor-specific mutation may be within a gene containing an extracellular domain. The tumor-specific mutation may be FGFR3 S249C, ERBB3 V104M, EGFR L858R, MUC4 H4205Q, PDGFRA R483fs, TMEM52 23_26LLPL>L, or PODXL 28_30PSP>P. The tumor-specific mutation may be within the extracellular domain. The tumor-specific mutation comprises FGFR3 S249C or ERBB3 V104M. Not being bound by a theory, the presence of a neoepitope in a protein with an extracellular domain allows the neoepitope to be presented on the surface of a cell. Not being bound by a theory, the presence of a neoepitope in the extracellular domain allows the neoepitope to be presented on the surface of a cell.
The invention is further described by the following numbered paragraphs:
1. An isolated neoantigenic peptide comprising a tumor-specific neoepitope defined in Tables 1-9, wherein the isolated neoantigenic peptide is not a native polypeptide.
2. An isolated neoantigenic peptide 100 amino acids or less in length which comprises a tumor-specific neoepitope defined in Tables 1-9.
3. The isolated neoantigenic peptide of paragraph 1 or 2, which is between about 5 to about 50 amino acids in length.
4. The isolated neoantigenic peptide of any of paragraphs 1-3, which is between about 15 to about 35 amino acids in length.
5. The isolated neoantigenic peptide of paragraph 4, which is about 15 amino acids or less in length.
6. The isolated neoantigenic peptide of paragraph 5, which is between about 8 and about 11 amino acids in length.
7. The isolated neoantigenic peptide of paragraph 6, which is 9 or 10 amino acids in length.
8. The isolated neoantigenic peptide of any of paragraphs 1-7, which binds major histocompatibility complex (MHC) class I.
9. The isolated neoantigenic peptide of paragraph 8, which binds MHC class I with a binding affinity of less than about 500 nM.
10. The isolated neoantigenic peptide of any of paragraphs 1-3, which is about 30 amino acids or less in length.
11. The isolated neoantigenic peptide of paragraph 10, which is between about 6 and about 25 amino acids in length.
12. The isolated neoantigenic peptide of paragraph 11, which is between about 15 and about 24 amino acids in length.
13. The isolated neoantigenic peptide of paragraph 11, which is between about 9 and about 15 amino acids in length.
14. The isolated neoantigenic peptide of any of paragraphs 1-3 and 10-13, which binds MHC class II.
15. The isolated neoantigenic peptide of paragraph 14, which binds MHC class II with a binding affinity of less than about 1000 nM.
16. The isolated neoantigenic peptide of any of paragraphs 1-15, further comprising flanking amino acids.
17. The isolated neoantigenic peptide of paragraph 16, wherein the flanking amino acids are not native flanking amino acids.
18. The isolated neoantigenic peptide of any of paragraphs 1-17, which is linked to at least a second neoantigenic peptide.
19. The isolated neoantigenic peptide of paragraph 18, wherein peptides are linked using a poly-glycine or poly-serine linker.
20. The isolated neoantigenic peptide of paragraph 18 or 19, wherein the second neoantigenic peptide binds MHC class I or class II with a binding affinity of less than about 1000 nM.
21. The isolated neoantigenic peptide of paragraph 20, wherein the second neoantigenic peptide binds MHC class I or class II with a binding affinity of less than about 500 nM.
22. The isolated neoantigenic peptide of paragraph 20 or 21, wherein both of the neoepitopes bind to human leukocyte antigen (HLA)-A, -B, -C, -DP, -DQ, or -DR.
23. The isolated neoantigenic peptide of any of paragraphs 20-22, wherein the isolated neoantigenic peptide and the second neoantigenic peptide binds a class I HLA or the isolated neoantigenic peptide and the second neoantigenic peptide binds a class II HLA.
24. The isolated neoantigenic peptide of any of paragraphs 20-22, wherein the isolated neoantigenic peptide binds a class II HLA and the second neoantigenic peptide binds a class I HLA or the isolated neoantigenic peptide binds a class I HLA and the second neoantigenic peptide binds a class II HLA.
25. The isolated neoantigenic peptide of any of paragraphs 1-24, further comprising modifications which increase in vivo half-life, cellular targeting, antigen uptake, antigen processing, MHC affinity, MHC stability, or antigen presentation.
26. The isolated neoantigenic peptide of paragraph 25, wherein the modification is conjugation to a carrier protein, conjugation to a ligand, conjugation to an antibody, PEGylation, polysialylation HESylation, recombinant PEG mimetics, Fc fusion, albumin fusion, nanoparticle attachment, nanoparticulate encapsulation, cholesterol fusion, iron fusion, acylation, amidation, glycosylation, side chain oxidation, phosphorylation, biotinylation, the addition of a surface active material, the addition of amino acid mimetics, or the addition of unnatural amino acids.
27. The isolated neoantigenic peptide of paragraph 25, wherein the cells that are targeted are antigen presenting cells.
28. The isolated neoantigenic peptide of paragraph 27, wherein the antigen presenting cells are dendritic cells.
29. The isolated neoantigenic peptide of paragraph 29, wherein the dendritic cells are targeted using the CD141, DEC205, or XCR1 marker.
30. A pharmaceutical composition comprising at least one neoantigenic peptide and a pharmaceutically acceptable carrier, each at least one neoantigenic peptide comprising a tumor-specific neoepitope capable of binding to an HLA protein in a subject, each tumor-specific neoepitope comprising a tumor-specific mutation present in a tumor, wherein:
(c) the composition comprises at least one neoantigenic peptide capable of eliciting an immune response against a tumor present in at least 5% of the subjects in the population of subjects suffering from cancer.
31. The pharmaceutical composition of paragraph 30, wherein the population of subjects is suffering from adrenocortical carcinoma (ACC), bladder urothelial carcinoma (BLCA), breast invasive carcinoma (BRCA), cervical squamous cell carcinoma and endocervical adenocarcinoma (CESC), colon adenocarcinoma (COAD), Chronic lymphocytic Leukaemia (CLL), colorectal cancer (CRC), Diffuse large B-cell lymphoma (DLBCL), glioblastoma multiforme (GBM), head and neck squamous cell carcinoma (HNSC), kidney chromophobe (KICH), kidney renal clear cell carcinoma (KIRC), kidney renal papillary cell carcinoma (KIRP), acute myeloid leukemia (LAML), liver hepatocellular carcinoma (LIHC), lung adenocarcinoma (LUAD), lung squamous cell carcinoma (LUSC), multiple myeloma (MM), ovarian serous cystadenocarcinoma (OV), pancreatic adenocarcinoma (PAAD), prostate adenocarcinoma (PRAD), rectum adenocarcinoma (READ), skin cutaneous melanoma (SKCM), stomach adenocarcinoma (STAD), testicular germ cell tumors (TGCT), thyroid adenocarcinoma (THCA), uterine corpus endometrioid carcinoma (UCEC), or uterine carcinosarcoma (UCS).
32. The pharmaceutical composition of paragraph 30 or 31, wherein the population suffering from cancer was treated with, is being treated with, or is selected to be treated with a cancer therapeutic, optionally ibrutinib, erlotinib, imatinib, gefitinib, crizotinib, trastuzumab, vemurafenib, RAF/MEK inhibitor or antiestrogen therapy.
33. The pharmaceutical composition of any of paragraphs 30-33, wherein the tumor-specific mutations comprise splice-variant mutations, point mutations, and/or frameshift mutations.
34. The pharmaceutical composition of any of paragraphs 30-33, wherein the at least one neoantigenic peptide comprises at least one neoantigenic peptide derived from a long peptide region flanking and including the tumor specific mutation, and wherein all contiguous segments within the long peptide are included.
35. The pharmaceutical composition of any of paragraphs 30-34, wherein the tumor-specific mutations are present in one or more genes listed in Tables 1-9.
36. The pharmaceutical composition of any of paragraphs 30-35, wherein the composition comprises at least one neoantigenic peptide as defined in any of Tables 1-9.
37. The pharmaceutical composition of any of paragraphs 30-36, wherein the tumor-specific mutations are present in one or more genes encoding a protein selected from the group consisting of Programmed Death-Ligand 1 (PD-L1), androgen receptor (AR), Bruton's Tyrosine Kinase (BTK), Epidermal Growth Factor Receptor (EGFR), BCR-Abl, c-kit, PIK3CA, HER2, EML4-ALK, KRAS, ALK, ROS1, AKT1, BRAF, MEK1, MEK2, NRAS, RAC1, and ESR1.
38. The pharmaceutical composition of paragraph 37, wherein at least one tumor-specific mutation is derived from alternative splicing of PD-L1 or AR.
39. The pharmaceutical composition of paragraph 38, wherein at least one tumor-specific mutation is derived from splice variant sPD-L1, AR-V1 or AR-V7.
40. The pharmaceutical composition of any of paragraphs 30-39, wherein the tumor-specific mutations comprise drug resistance mutations.
41. The pharmaceutical composition of paragraph 40, wherein at least one tumor-specific mutation is a drug resistance mutation selected from the group consisting of BTK/C481S, EGFR/T790M, BCR-Abl/T315I, BCR-Abl/Y253H, BCR-Abl/E255K, BCR-Abl/E255V, c-kit/T670I, PIK3CA/E545K, PIK3CA/E542K, HER2/G776(YVMA), HER2/E545K, EML4-ALK/G1269A, KRAS/G12V/D, ALK/L1196M, ALK/G1202R, ALK/S1206Y, ALK/1151T(ins), ALK/F1174C, ROS1/G2032R, AKT1/E17K, BRAF/V600E, MEK1/Q56P, MEK1/E203K, MEK1/C121S, MEK1/V60E, MEK1/G128V, MEK1N154I, MEK1/P124S, MEK1/P124L, NRAS/Q61K/L/R, NRAS/T58I, MEK2/C125S, RAC1/P29S, ESR1/S463P, AR/V534E, AR/P535H, AR/L536Q, AR/L536R, AR/Y537C, AR/Y537S, AR/Y537N, AR/D538G and AR/F876L.
42. The pharmaceutical composition of any of paragraphs 30-41, wherein the at least one tumor-specific mutation has an incidence of at least 500 patients a year in the population of subjects suffering from cancer, and wherein the at least one mutation comprises a mutation listed for the population in Table 9.
43. The pharmaceutical composition of paragraph 42, wherein the at least one neoantigenic peptide comprises at least one peptide listed in Table 9.
44. The pharmaceutical composition of any of paragraphs 30-36, wherein:
45. The pharmaceutical composition of any of paragraphs 30-36, wherein:
46. The pharmaceutical composition of any of paragraphs 30-43, wherein:
47. The pharmaceutical composition of any of paragraphs 30-36, wherein:
48. The pharmaceutical composition of any of paragraphs 30-36, wherein:
49. The pharmaceutical composition of any of paragraphs 30-36, wherein:
50. The pharmaceutical composition of any of paragraphs 30-36, wherein:
51. The pharmaceutical composition of any of paragraphs 30-36, wherein:
52. The pharmaceutical composition of any of paragraphs 30-36, wherein:
53. The pharmaceutical composition of any of paragraphs 30-36, wherein:
54. The pharmaceutical composition of any of paragraphs 30-36, wherein:
55. The pharmaceutical composition of any of paragraphs 30-36, wherein:
56. The pharmaceutical composition of any of paragraphs 30-36, wherein:
57. The pharmaceutical composition of any of paragraphs 30-36, wherein:
58. The pharmaceutical composition of any of paragraphs 30-36, wherein:
59. The pharmaceutical composition of any of paragraphs 30-36, wherein:
60. The pharmaceutical composition of any of paragraphs 30-36, wherein:
61. The pharmaceutical composition of any of paragraphs 30-36, wherein:
62. The pharmaceutical composition of any of paragraphs 30-36, wherein:
63. The pharmaceutical composition of any of paragraphs 30-36, wherein:
64. The pharmaceutical composition of any of paragraphs 30-36, wherein:
65. The pharmaceutical composition of any of paragraphs 30-36, wherein:
66. The pharmaceutical composition of any of paragraphs 30-36, wherein:
67. The pharmaceutical composition of any of paragraphs 30-36, wherein:
68. The pharmaceutical composition of any of paragraphs 30-36, wherein:
69. The pharmaceutical composition of any of paragraphs 30-36, wherein:
70. The pharmaceutical composition of any of paragraphs 30-36, wherein:
71. The pharmaceutical composition of any of paragraphs 30-36, wherein:
72. The pharmaceutical composition of any of paragraphs 30-36, wherein:
73. The pharmaceutical composition of any of paragraphs 30-72, wherein the composition comprises at least 2, at least 3, at least 4, at least 5, at least 6, at least 7, at least 8, at least 9, at least 10, at least 11, at least 12, at least 13, at least 14, at least 15, at least 16, at least 17, at least 18, at least 19, at least 20, at least 21, at least 22, at least 23, at least 24, at least 25, at least 26, at least 27, at least 28, at least 29, or at least 30 neoantigenic peptides.
74. The pharmaceutical composition of paragraph 73, wherein the composition comprises 15 to 20 neoantigenic peptides.
75. The pharmaceutical composition of paragraphs 73 or 74, further comprising at least one additional neoantigenic peptide which is specific for an individual patient's tumor.
76. The pharmaceutical composition of paragraph 75, wherein the patient specific neoantigenic peptide is selected by identifying sequence differences between the genome, exome, and/or transcriptome of the patient's tumor sample and the genome, exome, and/or transcriptome of a non-tumor sample.
77. The pharmaceutical composition of paragraph 75, wherein the samples are fresh or formalin-fixed paraffin embedded tumor tissues, freshly isolated cells, or circulating tumor cells.
78. The pharmaceutical composition of paragraph 75, wherein the sequence differences are determined by Next Generation Sequencing.
79. The pharmaceutical composition of any of paragraphs 30-78, wherein each neoantigenic peptide is from about 5 to about 50 amino acids in length.
80. The pharmaceutical composition of paragraph 79, wherein each neoantigenic peptide is between about 15 to about 35 amino acids in length; is about 15 amino acids or less in length; is about 8 and about 11 amino acids in length; or is 9 or 10 amino acids in length.
81. The pharmaceutical composition of paragraph 79 or 80, wherein each neoantigenic peptide binds major histocompatibility complex (MHC) class I.
82. The pharmaceutical composition of any one of paragraphs 30-81, wherein each neoantigenic peptide binds to MHC class I with a binding affinity of less than about 500 nM, or optionally each neoantigenic peptide binds to HLA-A, -B or -C with a KD of less than 500 nM.
83. The pharmaceutical composition of paragraph 79, wherein each neoantigenic peptide is about 30 amino acids or less in length; is between about 6 and about 25 amino acids in length; is between about 15 and about 24 amino acids in length; or is between about 9 and about 15 amino acids in length.
84. The pharmaceutical composition of paragraph 79, 82 or 83, wherein each neoantigenic peptide binds major histocompatibility complex (MHC) class II.
85. The pharmaceutical composition of paragraph 84, wherein each neoantigenic peptide binds to MEW class I with a binding affinity of less than about 500 nM, or optionally each neoantigenic peptide binds to HLA-A, -B or -C with a KD of less than 500 nM.
86. The pharmaceutical composition of any of paragraphs 30-85, wherein at least one neoantigenic peptide further comprises flanking amino acids.
87. The pharmaceutical composition of paragraph 86, wherein the flanking amino acids are not native flanking amino acids.
88. The pharmaceutical composition of any of paragraphs 30-87, which at least one neoantigenic peptide is linked to at least a second neoantigenic peptide.
89. The pharmaceutical composition of paragraph 88, wherein peptides are linked using a poly-glycine or poly-serine linker.
90. The pharmaceutical composition of paragraph 88 or 89, wherein the second neoantigenic peptide binds MEW class I or class II with a binding affinity of less than about 1000 nM.
91. The pharmaceutical composition of any of paragraphs 88-90, wherein the second neoantigenic peptide binds MHC class I or class II with a binding affinity of less than about 500 nM.
92. The pharmaceutical composition of any of paragraphs 88-91, wherein both of the neoepitopes bind to human leukocyte antigen (HLA)-A, -B, -C, -DP, -DQ, or -DR.
93. The pharmaceutical composition of any of paragraphs 88-92, wherein the isolated neoantigenic peptide and the second neoantigenic peptide binds a class I HLA or the isolated neoantigenic peptide and the second neoantigenic peptide binds a class II HLA.
94. The pharmaceutical composition of any of paragraphs 88-92, wherein the isolated neoantigenic peptide binds a class II HLA and the second neoantigenic peptide binds a class I HLA or the isolated neoantigenic peptide binds a class I HLA and the second neoantigenic peptide binds a class II HLA.
95. The pharmaceutical composition of any of paragraphs 30-94, wherein at least one neoantigenic peptide further comprises modifications which increase in vivo half-life, cellular targeting, antigen uptake, antigen processing, MHC affinity, MHC stability, or antigen presentation.
96. The pharmaceutical composition of paragraph 95, wherein the modification is conjugation to a carrier protein, conjugation to a ligand, conjugation to an antibody, PEGylation, polysialylation HESylation, recombinant PEG mimetics, Fc fusion, albumin fusion, nanoparticle attachment, nanoparticulate encapsulation, cholesterol fusion, iron fusion, acylation, amidation, glycosylation, side chain oxidation, phosphorylation, biotinylation, the addition of a surface active material, the addition of amino acid mimetics, or the addition of unnatural amino acids.
97. The pharmaceutical composition of paragraph 95, wherein the cells that are targeted are antigen presenting cells.
98. The pharmaceutical composition of paragraph 97, wherein the antigen presenting cells are dendritic cells.
99. The pharmaceutical composition of paragraph 98, wherein the dendritic cells are targeted using DEC205, XCR1, CD197, CD80, CD86, CD123, CD209, CD273, CD283, CD289, CD184, CD85h, CD85j, CD85k, CD85d, CD85g, CD85a, CD141, CD11c, CD83, TSLP receptor, or CD1a marker.
100. The pharmaceutical composition of paragraph 99, wherein the dendritic cells are targeted using the CD141, DEC205, or XCR1 marker.
101. The pharmaceutical composition of any of paragraphs 30-100, which is an immunogenic or vaccine composition.
102. The pharmaceutical composition of paragraph 101, further comprising an immunomodulator or adjuvant.
103. The pharmaceutical composition of paragraph 102, wherein the immunodulator or adjuvant is selected from the group consisting of Poly(I:C), Poly-ICLC, STING agonist, 1018 ISS, aluminium salts, Amplivax, AS15, BCG, CP-870,893, CpG7909, CyaA, dSLIM, GM-CSF, IC30, IC31, Imiquimod, ImuFact IMP321, IS Patch, ISS, ISCOMATRIX, Juvlmmune, LipoVac, MF59, monophosphoryl lipid A, Montanide IMS 1312 VG, Montanide ISA 206 VG, Montanide ISA 50 V2, Montanide ISA 51 VG, OK-432, OM-174, OM-197-MP-EC, ISA-TLR2 agonist, ONTAK, PepTelĀ®. vector system, PLG microparticles, resiquimod, SRL172, virosomes and other virus-like particles, YF-17D, VEGF trap, R848, beta-glucan, Pam3Cys, Pam3CSK4, acrylic or methacrylic polymers, copolymers of maleic anhydride, and QS21 stimulon.
104. An isolated polynucleotide encoding the isolated neoantigenic peptide of any of paragraphs 1-24.
105. The isolated polynucleotide of paragraph 104, which is RNA.
106. The isolated polynucleotide of paragraph 105, wherein the RNA is modified to increase stability, increase cellular targeting, increase translation efficiency, adjuvanticity, cytosol accessibility, and/or decrease cytotoxicity.
107. The isolated polynucleotide of paragraph 106, wherein the modification is conjugation to a carrier protein, conjugation to a ligand, conjugation to an antibody, codon optimization, increased GC-content, incorporation of modified nucleosides, incorporation of 5ā²-cap or cap analog, and/or incorporation of an unmasked poly-A sequence.
108. A cell comprising the polynucleotide of any of paragraphs 104-107.
109. A vector comprising the polynucleotide of any one of paragraphs 104-107.
110. The vector of paragraph 110, in which the polynucleotide is operably linked to a promoter.
111. The vector of paragraphs 109 or 110, which is a plasmid, phage, transposon, cosmid, virus, or virion.
112. The vector of paragraph 111, which is an adeno-associated virus, herpesvirus, lentivirus, or pseudotypes thereof.
113. An in vivo delivery system comprising the isolated polynucleotide of any of paragraphs 104-107.
114. The delivery system of paragraph 113, wherein the delivery system includes spherical nucleic acids, viruses, virus-like particles, plasmids, bacterial plasmids, or nanoparticles.
115. A cell comprising the vector or delivery system of any of paragraphs 109-114.
116. The cell of paragraph 115, which is an antigen presenting cell.
117. The cell of paragraph 116, which is a dendritic cell.
118. The cell of paragraph 117, which is an immature dendritic cell.
119. A composition comprising at least one polynucleotide of any of paragraphs 104-107.
120. The composition of paragraph 119, wherein the composition comprises at least 2, at least 3, at least 4, at least 5, at least 6, at least 7, at least 8, at least 9, at least 10, at least 11, at least 12, at least 13, at least 14, at least 15, at least 16, at least 17, at least 18, at least 19, at least 20, at least 21, at least 22, at least 23, at least 24, at least 25, at least 26, at least 27, at least 28, at least 29, or at least 30 of the isolated polynucleotides.
121. The composition of paragraph 120, wherein the composition comprises between about 2 and about 20 polynucleotides.
122. The composition of any one of paragraphs 119-121, wherein the composition further comprises at least 1, at least 2, at least 3, at least 4, at least 5, at least 6, at least 7, at least 8, at least 9, at least 10, at least 11, at least 12, at least 13, at least 14, at least 15, at least 16, at least 17, at least 18, at least 19, at least 20, at least 21, at least 22, at least 23, at least 24, at least 25, at least 26, at least 27, at least 28, at least 29, or at least 30 additional neoantigenic polynucleotides encoding for additional neoantigenic peptides.
123. The composition of paragraph 122, wherein the composition comprises between about 4 and about 20 additional neoantigenic polynucleotides.
124. The composition of paragraph 122, wherein the isolated polynucleotides and the additional neoantigenic polynucleotides are linked.
125. The composition of paragraph 124, wherein the polynucleotides are linked using nucleic acids that encode a poly-glycine or poly-serine linker.
126. The composition of any of paragraphs 122-125, wherein at least one of the additional neoantigenic peptide is specific for an individual patient's tumor.
127. The composition of paragraph 126, wherein the patient specific neoantigenic peptide is selected by identifying sequence differences between the genome, exome, and/or transcriptome of the patient's tumor sample and the genome, exome, and/or transcriptome of a non-tumor sample.
128. The composition of paragraph 127, wherein the samples are fresh or formalin-fixed paraffin embedded tumor tissues, freshly isolated cells, or circulating tumor cells.
129. The composition of paragraphs 127 or 128, wherein the sequence differences are determined by Next Generation Sequencing.
130. A T cell receptor (TCR) capable of binding at least one neoantigenic peptide listed in any of paragraphs 1-27, optionally a neoantigenic peptide comprising FGFR3 S249C, ERBB3 V104M, EGFR L858R, MUC4 H4205Q, PDGFRA R483fs, TMEM52 23_26LLPL>L, or PODXL 28_30PSP>P.
131. The TCR of paragraph 130, which is capable of binding the isolated neoantigenic peptide in the context of MHC class I or class II.
132. A chimeric antigen receptor comprising: (i) a T cell activation molecule; (ii) a transmembrane region; and (iii) an antigen recognition moiety capable of binding an isolated neoantigenic peptide of any one of paragraphs 1-27.
133. The chimeric antigen receptor of paragraph 132, wherein CD3-zeta is the T cell activation molecule.
134. The chimeric antigen receptor of paragraph 132 or 133, further comprising at least one costimulatory signaling domain.
135. The chimeric antigen receptor of any of paragraphs 132-134, wherein the signaling domain is CD28, 4-1BB, ICOS, OX40, ITAM, or Fc epsilon RI-gamma.
136. The chimeric antigen receptor of any of paragraphs 132-135, wherein the antigen recognition moiety is capable of binding the isolated neoantigenic peptide in the context of MHC class I or class II.
137. The chimeric antigen receptor of any of paragraphs 132-136, comprising the CD3-zeta, CD28, CTLA-4, ICOS, BTLA, KIR, LAG3, CD137, OX40, CD27, CD40L, Tim-3, A2aR, or PD-1 transmembrane region.
138. The chimeric antigen receptor of any of paragraphs 132-137, wherein the tumor-specific epitope is located in the extracellular domain of a tumor associated polypeptide, optionally the tumor-specific epitope comprises FGFR3 S249C, ERBB3 V104M, EGFR L858R, MUC4 H4205Q, PDGFRA R483fs, TMEM52 23_26LLPL>L, or PODXL 28_30PSP>P.
139. A T cell comprising the T cell receptor or chimeric antigen receptor of any of paragraphs 130-138.
140. The T cell of paragraph 139, which is a helper or cytotoxic T cell.
141. A nucleic acid comprising a promoter operably linked to a polynucleotide encoding the T cell receptor of paragraph 130 or 131.
142. The nucleic acid of paragraph 141, wherein the TCR is capable of binding the at least one neoantigenic peptide in the context of major histocompatibility complex (WIC) class I or class II.
143. A nucleic acid comprising a promoter operably linked to a polynucleotide encoding the chimeric antigen receptor of any of paragraphs 132-138.
144. The nucleic acid of paragraph 143, wherein the antigen recognition moiety is capable of binding the at least one neoantigenic peptide in the context of major histocompatibility complex (MHC) class I or class II.
145. The nucleic acid of paragraphs 143 or 144, wherein the tumor-specific epitope is located in the extracellular domain of a tumor associated polypeptide.
146. The nucleic acid of any of paragraphs 143-145, comprising the CD3-zeta, CD28, CTLA-4, ICOS, BTLA, KIR, LAG3, CD137, OX40, CD27, CD40L, Tim-3, A2aR, or PD-1 transmembrane region.
147. An antibody capable of binding at least one neoantigenic peptide listed in Tables 1-9.
148. A modified cell transfected or transduced with the nucleic acid of any one of paragraphs 141-146.
149. The modified cell of paragraph 148, wherein the modified cell is a T cell, tumor infiltrating lymphocyte, NK-T cell, TCR-expressing cell, CD4+ T cell, CD8+ T cell, or NK cell.
150. A composition comprising the T cell receptor or chimeric antigen receptor of any of paragraphs 130-138.
151. A composition comprising autologous patient T cells containing the T cell receptor or chimeric antigen receptor of any of paragraphs 130-138.
152. The composition of paragraph 150 or 151, further comprising an immune checkpoint inhibitor.
153. The composition of paragraph 150 of 151, further comprising at least two immune checkpoint inhibitors.
154. The composition of paragraph 152 or 153, wherein the immune checkpoint inhibitor inhibits a checkpoint protein selected from the group consisting of CTLA-4, PDL1, PDL2, PD1, B7-H3, B7-H4, BTLA, HVEM, TIM3, GAL9, LAG3, VISTA, KIR, 2B4, CD160, CGEN-15049, CHK 1, CHK2, A2aR, and B-7 family ligands or a combination thereof.
155. The composition of paragraph 154, wherein the immune checkpoint inhibitor interacts with a ligand of a checkpoint protein selected from the group consisting of CTLA-4, PDL1, PDL2, PD1, B7-H3, B7-H4, BTLA, HVEM, TIM3, GAL9, LAG3, VISTA, KIR, 2B4, CD160, CGEN-15049, CHK 1, CHK2, A2aR, and B-7 family ligands or a combination thereof.
156. The composition of any of paragraphs 119-129 or 150-156, further comprising an immune modulator or adjuvant.
157. The composition of paragraph 156, wherein the immune modulator is a co-stimulatory ligand, a TNF ligand, an Ig superfamily ligand, CD28, CD80, CD86, ICOS, CD40L, OX40, CD27, GITR, CD30, DR3, CD69, or 4-1BB.
158. The composition of paragraph 156, wherein the immune modulator is at least one cancer cell or cancer cell extract.
159. The composition of paragraph 158, wherein the cancer cell is autologous to the subject in need of the composition.
160. The composition of paragraph 159, wherein the cancer cell has undergone lysis or been exposed to UV radiation.
161. The composition of paragraph 156, wherein the composition further comprises an adjuvant.
162. The composition of paragraph 161, wherein the adjuvant is selected from the group consisting of: Poly(I:C), Poly-ICLC, STING agonist, 1018 ISS, aluminium salts, Amplivax, AS15, BCG, CP-870,893, CpG7909, CyaA, dSLIM, GM-CSF, IC30, IC31, Imiquimod, ImuFact IMP321, IS Patch, ISS, ISCOMATRIX, Juvlmmune, LipoVac, MF59, monophosphoryl lipid A, Montanide IMS 1312 VG, Montanide ISA 206 VG, Montanide ISA 50 V2, Montanide ISA 51 VG, OK-432, OM-174, OM-197-MP-EC, ISA-TLR2 agonist, ONTAK, PepTelĀ®. vector system, PLG microparticles, resiquimod, SRL172, virosomes and other virus-like particles, YF-17D, VEGF trap, R848, beta-glucan, Pam3Cys, Pam3CSK4, acrylic or methacrylic polymers, copolymers of maleic anhydride, and QS21 stimulon.
163. The composition of paragraph 161 or 162, wherein the adjuvant induces a humoral immune response when administered to a subject.
164. The composition of paragraph 162, wherein the adjuvant induces a T helper cell type 1 response when administered to a subject.
165. An in vivo delivery system comprising the pharmaceutical composition of any of paragraphs 30-103.
166. The delivery system of paragraph 165, wherein the delivery system includes cell-penetrating peptides, nanoparticulate encapsulation, virus like particles, or liposomes.
167. The delivery system of paragraph 166, wherein the cell-penetrating peptide is TAT peptide, herpes simplex virus VP22, transportan, or Antp.
168. A cell comprising the isolated neoantigenic peptide of any of paragraphs 1-29.
169. The cell of paragraph 168, which is an antigen presenting cell.
170. The cell of paragraph 169, which is a dendritic cell.
171. A method of treating cancer or initiating, enhancing, or prolonging an anti-tumor responses in a subject in need thereof comprising administering to the subject the peptide, polynucleotide, vector, composition, antibody, or cells of any of paragraphs 1-164.
172. A method of prophylactic cancer treatment comprising:
173. A method of treating or preventing a tumor in a population of subjects in need thereof, comprising administering to a subject an agent comprising an extracellular ligand-binding domain recognizing a tumor-specific neoepitope comprising a tumor-specific mutation having an incidence of at least 1% of subjects in the population.
174. The method according to any of paragraphs 171-173, wherein the tumor-specific mutation comprises a mutation listed for any population in Table 9.
175. The method according to any of paragraphs 171-173, wherein the tumor-specific mutation is within a gene containing an extracellular domain.
176. The method according to paragraph 175, wherein the tumor-specific mutation comprises FGFR3 S249C, ERBB3 V104M, EGFR L858R, MUC4 H4205Q, PDGFRA R483fs, TMEM52 23_26LLPL>L, or PODXL 28_30PSP>P.
177. The method according to paragraph 176, wherein the tumor-specific mutation is within the extracellular domain.
178. The method according to paragraph 177, wherein the tumor-specific mutation comprises FGFR3 S249C or ERBB3 V104M.
179. The method of any of paragraph 171-178, wherein the subject is a human.
180. The method of paragraph 179, wherein the subject has cancer.
181. The method of paragraph 180, wherein the cancer is selected from the group consisting of urogenital, gynecological, lung, gastrointestinal, head and neck cancer, malignant glioblastoma, malignant mesothelioma, non-metastatic or metastatic breast cancer, malignant melanoma, Merkel Cell Carcinoma or bone and soft tissue sarcomas, haematologic neoplasias, multiple myeloma, acute myelogenous leukemia, chronic myelogenous leukemia, myelodysplastic syndrome and acute lymphoblastic leukemia, non-small cell lung cancer (NSCLC), breast cancer, metastatic colorectal cancers, hormone sensitive or hormone refractory prostate cancer, colorectal cancer, ovarian cancer, hepatocellular cancer, renal cell cancer, pancreatic cancer, gastric cancer, oesophageal cancers, hepatocellular cancers, cholangiocellular cancers, head and neck squamous cell cancer soft tissue sarcoma, and small cell lung cancer.
182. The method of any of paragraphs 171-181, wherein the subject has undergone surgical removal of the tumor.
183. The method of any of paragraphs 171-182, wherein the peptide, polynucleotide, vector, composition, or cells is administered via intravenous, intraperitoneal, intratumoral, intradermal, or subcutaneous administration.
184. The method of paragraph 183, wherein the peptide, polynucleotide, vector, composition, or cells is administered into an anatomic site that drains into a lymph node basin.
185. The method of paragraph 184, wherein administration is into multiple lymph node basins.
186. The method of any one of paragraphs 183-185, wherein administration is by a subcutaneous or intradermal route.
187. The method of paragraph 183, wherein peptide is administered.
188. The method of paragraph 187, wherein administration is intratumorally.
189. The method of paragraph 183, wherein polynucleotide, optionally RNA, is administered.
190. The method of paragraph 189, wherein the polynucleotide is administered intravenously.
191. The method of paragraph 183, wherein the cell is a T cell or dendritic cell.
192. The method of paragraph 191, wherein the peptide or polynucleotide comprises an antigen presenting cell targeting moiety.
193. The method of any of paragraphs 171-192, further comprising administering at least one immune checkpoint inhibitor to the subject.
194. The method of paragraph 193, wherein the checkpoint inhibitor is a biologic therapeutic or a small molecule.
195. The method of paragraph 193 or 194, wherein the checkpoint inhibitor is selected from the group consisting of a monoclonal antibody, a humanized antibody, a fully human antibody and a fusion protein or a combination thereof.
196. The method of any of paragraphs 193-195, wherein the checkpoint inhibitor inhibits a checkpoint protein selected from the group consisting of CTLA-4, PDL1, PDL2, PD1, B7-H3, B7-H4, BTLA, HVEM, TIM3, GAL9, LAG3, VISTA, KIR, 2B4, CD160, CGEN-15049, CHK 1, CHK2, A2aR, and B-7 family ligands or a combination thereof.
197. The method of any of paragraphs 193-196, wherein the checkpoint inhibitor interacts with a ligand of a checkpoint protein selected from the group consisting of CTLA-4, PDL1, PDL2, PD1, B7-H3, B7-H4, BTLA, HVEM, TIM3, GAL9, LAG3, VISTA, KIR, 2B4, CD160, CGEN-15049, CHK 1, CHK2, A2aR, and B-7 family ligands or a combination thereof.
198. The method of any of paragraphs 193-197, wherein two or more checkpoint inhibitors are administered.
199. The method of paragraph 198, wherein the checkpoint inhibitors are: (i) ipilimumab or tremelimumab, and (ii) nivolumab.
200. The method of any of paragraphs 193-199, wherein the checkpoint inhibitor and the composition are administered simultaneously or sequentially in any order.
201. The method of paragraph 200, wherein the peptide, polynucleotide, vector, composition, or cells is administered prior to the checkpoint inhibitor.
202. The method of paragraph 200, wherein the peptide, polynucleotide, vector, composition, or cells is administered after the checkpoint inhibitor.
203. The method of paragraph 200, wherein administration of the checkpoint inhibitor is continued throughout neoantigen peptide, polynucleotide, vector, composition, or cell therapy.
204. The method of any of paragraphs 193-203, wherein the neoantigen peptide, polynucleotide, vector, composition, or cell therapy is administered to subjects that only partially respond or do not respond to checkpoint inhibitor therapy.
205. The method of any one of paragraphs 193-204, wherein the checkpoint inhibitor is administered intravenously or subcutaneously.
206. The method of paragraph 205, wherein the checkpoint inhibitor is administered subcutaneously within about 2 cm of the site of administration of the composition.
207. The method of paragraph 206, wherein the composition is administered into the same draining lymph node as the checkpoint inhibitor.
208. The method of any of paragraphs 171-207, further comprising administering an additional therapeutic agent to the subject either prior to, simultaneously with, or after treatment with the peptide, polynucleotide, vector, composition, or cells.
209. The method of paragraph 208, wherein the additional agent is a chemotherapeutic agent, an immunomodulatory drug, an immune metabolism modifying drug, a targeted therapy, radiation an anti-angiogenesis agent, or an agent that reduces immune-suppression.
210. The method of paragraph 209, wherein the chemotherapeutic agent is an alkylating agent, a topoisomerase inhibitor, an anti-metabolite, or an anti-mitotic agent.
211. The method of paragraph 208, wherein the additional agent is an anti-glucocorticoid induced tumor necrosis factor family receptor (GITR) agonistic antibody or antibody fragment, ibrutinib, docetaxeol, cisplatin, or cyclophosphamide.
212. The method of any of paragraphs 171-211, which elicits a CD4+ T cell immune response.
213. The method of any of paragraphs 171-212, which elicits a CD4+ T cell immune response and a CD8+ T cell immune response.
214. A method for stimulating an immune response in a subject, comprising administering an effective amount of modified cells or composition of any of paragraphs 30-103, 108, 115-129, 139, 140, 148-164, and 168-170.
215. The method of paragraph 214, wherein the immune response is cytotoxic and/or humoral immune response.
216. The method of paragraph 214, wherein the method stimulates a T cell-mediated immune response in a subject.
217. The method of paragraph 216, wherein the T cell-mediated immune response is directed against a target cell.
218. The method of paragraph 217, wherein the target cell is a tumor cell.
219. The method of any of paragraphs 214-218, wherein the modified cells are transfected or transduced in vivo.
220. The method of any of paragraphs 214-219, wherein the modified cells are transfected or transduced ex vivo.
221. The method of any of paragraphs 214-220, wherein the modified cells are autologous patient T cells.
222. The method of paragraph 221, wherein the autologous patient T cells are obtained from a patient that has received a neoantigen peptide or nucleic acid vaccine.
223. The method of paragraph 222, wherein the neoantigen peptide or nucleic acid vaccine comprises at least one personalized neoantigen.
224. The method of paragraph 223, wherein the neoantigen peptide or nucleic acid vaccine comprises at least one additional neoantigenic peptide listed in Tables 1-9.
225. The method of paragraph 224, wherein the patient received a chemotherapeutic agent, an immunomodulatory drug, an immune metabolism modifying drug, targeted therapy or radiation prior to and/or during receipt of the neoantigen peptide or nucleic acid vaccine.
226. The method of any of paragraphs 222-225, wherein the patient receives treatment with at least one checkpoint inhibitor.
227. The method of any of paragraphs 222-226, wherein the autologous T cells are obtained from a patient that has already received at least one round of T cell therapy containing a neoantigen.
228. The method of any of paragraphs 222-227, wherein the method further comprises adoptive T cell therapy.
229. The method of paragraph 228, wherein the adoptive T cell therapy comprises autologous T-cells.
230. The method of paragraph 229, wherein the autologous T-cells are targeted against tumor antigens.
231. The method of paragraph 228 or 229 wherein the adoptive T cell therapy further comprises allogenic T-cells.
232. The method of paragraph 231, wherein the allogenic T-cells are targeted against tumor antigens.
233. The method of any of paragraphs 227-231, wherein the adoptive T cell therapy is administered before the checkpoint inhibitor.
234. A method for evaluating the efficacy of any of paragraphs 171-213, comprising: (i) measuring the number or concentration of target cells in a first sample obtained from the subject before administering the modified cell, (ii) measuring the number concentration of target cells in a second sample obtained from the subject after administration of the modified cell, and (iii) determining an increase or decrease of the number or concentration of target cells in the second sample compared to the number or concentration of target cells in the first sample.
235. The method of paragraph 234, wherein treatment efficacy is determined by monitoring a clinical outcome; an increase, enhancement or prolongation of anti-tumor activity by T cells; an increase in the number of anti-tumor T cells or activated T cells as compared with the number prior to treatment; B cell activity; CD4 T cell activity; or a combination thereof.
236. The method of paragraph 235, wherein treatment efficacy is determined by monitoring a biomarker.
237. The method of paragraph 236, wherein the biomarker is selected from the group consisting of CEA, Her-2/neu, bladder tumor antigen, thyroglobulin, alpha-fetoprotein, PSA, CA 125, CA19.9, CA 15.3, leptin, prolactin, osteopontin, IGF-II, CD98, fascin, sPIgR, 14-3-3 eta, troponin I, and b-type natriuretic peptide.
238. The method of paragraph 235, wherein clinical outcome is selected from the group consisting of tumor regression; tumor shrinkage; tumor necrosis; anti-tumor response by the immune system; tumor expansion, recurrence or spread; or a combination thereof.
239. The method of paragraph 235, wherein the treatment effect is predicted by presence of T cells or by presence of a gene signature indicating T cell inflammation or a combination thereof.
240. A kit comprising a neoantigen therapeutic of any of paragraphs 1-164.
Accordingly, it is an object of the invention not to encompass within the invention any previously known product, process of making the product, or method of using the product such that Applicants reserve the right and hereby disclose a disclaimer of any previously known product, process, or method. It is further noted that the invention does not intend to encompass within the scope of the invention any product, process, or making of the product or method of using the product, which does not meet the written description and enablement requirements of the USPTO (35 U. S.C. § 112, first paragraph) or the EPO (Article 83 of the EPC), such that Applicants reserve the right and hereby disclose a disclaimer of any previously described product, process of making the product, or method of using the product. It may be advantageous in the practice of the invention to be in compliance with Art. 53(c) EPC and Rule 28(b) and (c) EPC. All rights to explicitly disclaim any embodiments that are the subject of any granted patent(s) of applicant in the lineage of this application or in any other lineage or in any prior filed application of any third party is explicitly reserved Nothing herein is to be construed as a promise.
It is noted that in this disclosure and particularly in the claims and/or paragraphs, terms such as ācomprisesā, ācomprisedā, ācomprisingā and the like can have the meaning attributed to it in U.S. Patent law; e.g., they can mean āincludesā, āincludedā, āincludingā, and the like; and that terms such as āconsisting essentially ofā and āconsists essentially ofā have the meaning ascribed to them in U.S. Patent law, e.g., they allow for elements not explicitly recited, but exclude elements that are found in the prior art or that affect a basic or novel characteristic of the invention. Nothing herein is intended as a promise.
These and other embodiments are disclosed or are obvious from and encompassed by, the following Detailed Description.
To facilitate an understanding of the present invention, a number of terms and phrases are defined herein:
Unless specifically stated or obvious from context, as used herein, the term āaboutā is understood as within a range of normal tolerance in the art, for example within 2 standard deviations of the mean. About can be understood as within 50%, 45%, 40%, 35%, 30%, 25%, 20%, 15%, 10%, 9%, 8%, 7%, 6%, 5%, 4%, 3%, 2%, 1%, 0.5%, 0.1%, 0.05%, or 0.01% of the stated value. Unless otherwise clear from context, all numerical values provided herein are modified by the term about.
Unless specifically stated or obvious from context, as used herein, the term āorā is understood to be inclusive. Unless specifically stated or obvious from context, as used herein, the terms āa,ā āan,ā and ātheā are understood to be singular or plural.
All gene name symbols refer to the gene as commonly known in the art. Gene symbols may be those refered to by the HUGO Gene Nomenclature Committee (HGNC). Any reference to the gene symbol is a reference made to the entire gene or variants of the gene. The HUGO Gene Nomenclature Committee is responsible for providing human gene naming guidelines and approving new, unique human gene names and symbols. All human gene names and symbols can be searched at www.genenames.org, the HGNC website, and the guidelines for their formation are available there (www.genenames.org/guidelines).
By āagentā is meant any small molecule chemical compound, antibody, nucleic acid molecule, or polypeptide, or fragments thereof.
By āameliorateā is meant decrease, suppress, attenuate, diminish, arrest, or stabilize the development or progression of a disease (e.g., a neoplasia, tumor, etc.).
By āalterationā is meant a change (increase or decrease) in the expression levels oractivity of a gene or polypeptide as detected by standard art known methods such as those described herein. As used herein, an alteration includes a 10% change in expression levels, preferably a 25% change, more preferably a 40% change, and most preferably a 50% or greater change in expression levels.
By āanalogā is meant a molecule that is not identical, but has analogous functional or structural features. For example, a tumor specific neo-antigen polypeptide analog retains the biological activity of a corresponding naturally-occurring tumor specific neo-antigen polypeptide, while having certain biochemical modifications that enhance the analog's function relative to a naturally-occurring polypeptide. Such biochemical modifications could increase the analog's protease resistance, membrane permeability, or half-life, without altering, for example, ligand binding. An analog may include an unnatural amino acid.
āCombination therapyā is intended to embrace administration of therapeutic agents (e.g. neoantigenic peptides described herein) in a sequential manner, that is, wherein each therapeutic agent is administered at a different time, as well as administration of these therapeutic agents, or at least two of the therapeutic agents, in a substantially simultaneous manner. Substantially simultaneous administration can be accomplished, for example, by administering to the subject a single capsule having a fixed ratio of each therapeutic agent or in multiple, single capsules for each of the therapeutic agents. For example, one combination of the present invention may comprise a pooled sample of neoantigenic peptides administered at the same or different times, or they can be formulated as a single, co-formulated pharmaceutical composition comprising the peptides. As another example, a combination of the present invention (e.g., a pooled sample of tumor specific neoantigens) may be formulated as separate pharmaceutical compositions that can be administered at the same or different time. As used herein, the term āsimultaneouslyā is meant to refer to administration of one or more agents at the same time. For example, in certain embodiments, the neoantigenic peptides are administered simultaneously. Simultaneously includes administration contemporaneously, that is during the same period of time. In certain embodiments, the one or more agents are administered simultaneously in the same hour, or simultaneously in the same day. Sequential or substantially simultaneous administration of each therapeutic agent can be effected by any appropriate route including, but not limited to, oral routes, intravenous routes, sub-cutaneous routes, intramuscular routes, direct absorption through mucous membrane tissues (e.g., nasal, mouth, vaginal, and rectal), and ocular routes (e.g., intravitreal, intraocular, etc.). The therapeutic agents can be administered by the same route or by different routes. For example, one component of a particular combination may be administered by intravenous injection while the other component(s) of the combination may be administered orally. The components may be administered in any therapeutically effective sequence. The phrase ācombinationā embraces groups of compounds or non-drug therapies useful as part of a combination therapy.
The term āneoantigenā or āneoantigenicā means a class of tumor antigens that arises from a tumor-specific mutation(s) which alters the amino acid sequence of genome encoded proteins.
By āneoplasiaā is meant any disease that is caused by or results in inappropriately high levels of cell division, inappropriately low levels of apoptosis, or both. For example, cancer is an example of a neoplasia. Examples of cancers include, without limitation, leukemia (e.g., acute leukemia, acute lymphocytic leukemia, acute myelocytic leukemia, acute myeloblastic leukemia, acute promyelocytic leukemia, acute myelomonocytic leukemia, acute monocytic leukemia, acute erythroleukemia, chronic leukemia, chronic myelocytic leukemia, chronic lymphocytic leukemia), polycythemia vera, lymphoma (e.g., Hodgkin's disease, non-Hodgkin's disease), Waldenstrom's macroglobulinemia, heavy chain disease, and solid tumors such as sarcomas and carcinomas (e.g., fibrosarcoma, myxosarcoma, liposarcoma, chondrosarcoma, osteogenic sarcoma, chordoma, angiosarcoma, endotheliosarcoma, lymphangiosarcoma, lymphangioendotheliosarcoma, synovioma, mesothelioma, Ewing's tumor, leiomyosarcoma, rhabdomyosarcoma, colon carcinoma, pancreatic cancer, breast cancer, ovarian cancer, prostate cancer, squamous cell carcinoma, basal cell carcinoma, adenocarcinoma, sweat gland carcinoma, sebaceous gland carcinoma, papillary carcinoma, papillary adenocarcinomas, cystadenocarcinoma, medullary carcinoma, bronchogenic carcinoma, renal cell carcinoma, hepatoma, nile duct carcinoma, choriocarcinoma, seminoma, embryonal carcinoma, Wilm's tumor, cervical cancer, uterine cancer, testicular cancer, lung carcinoma, small cell lung carcinoma, bladder carcinoma, epithelial carcinoma, glioma, astrocytoma, medulloblastoma, craniopharyngioma, ependymoma, pinealoma, hemangioblastoma, acoustic neuroma, oligodenroglioma, schwannoma, meningioma, melanoma, neuroblastoma, and retinoblastoma). Lymphoproliferative disorders are also considered to be proliferative diseases.
The term āvaccineā is meant to refer in the present context to a pooled sample of tumor-specific neoantigenic peptides, for example at least two, at least three, at least four, at least five, or more neoantigenic peptides. A āvaccineā is to be understood as meaning a composition for generating immunity for the prophylaxis and/or treatment of diseases (e.g., neoplasia/tumor). Accordingly, vaccines are medicaments which comprise antigens and are intended to be used in humans or animals for generating specific defense and protective substance by vaccination. A āvaccine compositionā can include a pharmaceutically acceptable excipient, carrier or diluent.
The term āpharmaceutically acceptableā refers to approved or approvable by a regulatory agency of the Federal or a state government or listed in the U.S. Pharmacopeia or other generally recognized pharmacopeia for use in animals, including humans.
A āpharmaceutically acceptable excipient, carrier or diluentā refers to an excipient, carrier or diluent that can be administered to a subject, together with an agent, and which does not destroy the pharmacological activity thereof and is nontoxic when administered in doses sufficient to deliver a therapeutic amount of the agent.
A āpharmaceutically acceptable saltā of pooled tumor specific neoantigens as recited herein may be an acid or base salt that is generally considered in the art to be suitable for use in contact with the tissues of human beings or animals without excessive toxicity, irritation, allergic response, or other problem or complication. Such salts include mineral and organic acid salts of basic residues such as amines, as well as alkali or organic salts of acidic residues such as carboxylic acids. Specific pharmaceutical salts include, but are not limited to, salts of acids such as hydrochloric, phosphoric, hydrobromic, malic, glycolic, fumaric, sulfuric, sulfamic, sulfanilic, formic, toluenesulfonic, methanesulfonic, benzene sulfonic, ethane disulfonic, 2-hydroxyethylsulfonic, nitric, benzoic, 2-acetoxybenzoic, citric, tartaric, lactic, stearic, salicylic, glutamic, ascorbic, pamoic, succinic, fumaric, maleic, propionic, hydroxymaleic, hydroiodic, phenylacetic, alkanoic such as acetic, HOOCā(CH2)n-COOH where n is 0-4, and the like. Similarly, pharmaceutically acceptable cations include, but are not limited to sodium, potassium, calcium, aluminum, lithium and ammonium. Those of ordinary skill in the art will recognize from this disclosure and the knowledge in the art that further pharmaceutically acceptable salts for the pooled tumor specific neoantigens provided herein, including those listed by Remington's Pharmaceutical Sciences, 17th ed., Mack Publishing Company, Easton, Pa., p. 1418 (1985). In general, a pharmaceutically acceptable acid or base salt can be synthesized from a parent compound that contains a basic or acidic moiety by any conventional chemical method. Briefly, such salts can be prepared by reacting the free acid or base forms of these compounds with a stoichiometric amount of the appropriate base or acid in an appropriate solvent.
By a āpolypeptideā or āpeptideā is meant a polypeptide that has been separated from components that naturally accompany it. Typically, the polypeptide is isolated when it is at least 60%, by weight, free from the proteins and naturally-occurring organic molecules with which it is naturally associated. Preferably, the preparation is at least 75%, more preferably at least 90%, and most preferably at least 99%, by weight, a polypeptide. An isolated polypeptide may be obtained, for example, by extraction from a natural source, by expression of a recombinant nucleic acid encoding such a polypeptide; or by chemically synthesizing the protein. Purity can be measured by any appropriate method, for example, column chromatography, polyacrylamide gel electrophoresis, or by HPLC analysis.
As used herein, the terms āprevent,ā āpreventing,ā āprevention,ā āprophylactic treatment,ā and the like, refer to reducing the probability of developing a disease or condition in a subject, who does not have, but is at risk of or susceptible to developing a disease or condition.
The term āprime/boostā or āprime/boost dosing regimenā is meant to refer to the successive administrations of a vaccine or immunogenic or immunological compositions. The priming administration (priming) is the administration of a first vaccine or immunogenic or immunological composition type and may comprise one, two or more administrations. The boost administration is the second administration of a vaccine or immunogenic or immunological composition type and may comprise one, two or more administrations, and, for instance, may comprise or consist essentially of annual administrations. In certain embodiments, administration of the neoplasia vaccine or immunogenic composition is in a prime/boost dosing regimen.
Ranges provided herein are understood to be shorthand for all of the values within the range. For example, a range of 1 to 50 is understood to include any number, combination of numbers, or sub-range from the group consisting of 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, or 50, as well as all intervening decimal values between the aforementioned integers such as, for example, 1.1, 1.2, 1.3, 1.4, 1.5, 1.6, 1.7, 1.8, and 1.9. With respect to sub-ranges, ānested sub-rangesā that extend from either end point of the range are specifically contemplated. For example, a nested sub-range of an exemplary range of 1 to 50 may comprise 1 to 10, 1 to 20, 1 to 30, and 1 to 40 in one direction, or 50 to 40, 50 to 30, 50 to 20, and 50 to 10 in the other direction.
A āreceptorā is to be understood as meaning a biological molecule or a molecule grouping capable of binding a ligand. A receptor may serve, to transmit information in a cell, a cell formation or an organism. The receptor comprises at least one receptor unit and frequently contains two or more receptor units, where each receptor unit may consist of a protein molecule, in particular a glycoprotein molecule. The receptor has a structure that complements the structure of a ligand and may complex the ligand as a binding partner. Signaling information may be transmitted by conformational changes of the receptor following binding with the ligand on the surface of a cell. According to the invention, a receptor may refer to particular proteins of MHC classes I and II capable of forming a receptor/ligand complex with a ligand, in particular a peptide or peptide fragment of suitable length.
The term āsubjectā refers to an animal which is the object of treatment, observation, or experiment. By way of example only, a subject includes, but is not limited to, a mammal, including, but not limited to, a human or a non-human mammal, such as a non-human primate, bovine, equine, canine, ovine, or feline.
The terms ātreat,ā ātreated,ā ātreating,ā ātreatment,ā and the like are meant to refer to reducing or ameliorating a disorder and/or symptoms associated therewith (e.g., a neoplasia or tumor). āTreatingā may refer to administration of the therapy to a subject after the onset, or suspected onset, of a cancer. āTreatingā includes the concepts of āalleviatingā, which refers to lessening the frequency of occurrence or recurrence, or the severity, of any symptoms or other ill effects related to a cancer and/or the side effects associated with cancer therapy. The term ātreatingā also encompasses the concept of āmanagingā which refers to reducing the severity of a particular disease or disorder in a patient or delaying its recurrence, e.g., lengthening the period of remission in a patient who had suffered from the disease. It is appreciated that, although not precluded, treating a disorder or condition does not require that the disorder, condition, or symptoms associated therewith be completely eliminated.
The term ātherapeutic effectā refers to some extent of relief of one or more of the symptoms of a disorder (e.g., a neoplasia or tumor) or its associated pathology. āTherapeutically effective amountā as used herein refers to an amount of an agent which is effective, upon single or multiple dose administration to the cell or subject, in prolonging the survivability of the patient with such a disorder, reducing one or more signs or symptoms of the disorder, preventing or delaying, and the like beyond that expected in the absence of such treatment. āTherapeutically effective amountā is intended to qualify the amount required to achieve a therapeutic effect. A physician or veterinarian having ordinary skill in the art can readily determine and prescribe the ātherapeutically effective amountā (e.g., ED50) of the pharmaceutical composition required. For example, the physician or veterinarian could start doses of the compounds of the invention employed in a pharmaceutical composition at levels lower than that required in order to achieve the desired therapeutic effect and gradually increase the dosage until the desired effect is achieved.
The terms āspacerā or ālinkerā as used in reference to a fusion protein refers to a peptide that joins the proteins comprising a fusion protein. Generally, a spacer has no specific biological activity other than to join or to preserve some minimum distance or other spatial relationship between the proteins or RNA sequences. However, in certain embodiments, the constituent amino acids of a spacer may be selected to influence some property of the molecule such as the folding, net charge, or hydrophobicity of the molecule.
Suitable linkers for use in an embodiment of the present invention are well known to those of skill in the art and include, but are not limited to, straight or branched-chain carbon linkers, heterocyclic carbon linkers, or peptide linkers. The linker is used to separate two neoantigenic peptides by a distance sufficient to ensure that, in a preferred embodiment, each neoantigenic peptide properly folds. Preferred peptide linker sequences adopt a flexible extended conformation and do not exhibit a propensity for developing an ordered secondary structure. Typical amino acids in flexible protein regions include Gly, Asn and Ser. Virtually any permutation of amino acid sequences containing Gly, Asn and Ser would be expected to satisfy the above criteria for a linker sequence. Other near neutral amino acids, such as Thr and Ala, also may be used in the linker sequence. Still other amino acid sequences that may be used as linkers are disclosed in Maratea et al. (1985), Gene 40: 39-46; Murphy et al. (1986) Proc. Nat'l. Acad. Sci. USA 83: 8258-62; U.S. Pat. Nos. 4,935,233; 4,751,180.
The recitation of a listing of chemical groups in any definition of a variable herein includes definitions of that variable as any single group or combination of listed groups. The recitation of an embodiment for a variable or aspect herein includes that embodiment as any single embodiment or in combination with any other embodiments or portions thereof.
Any compositions or methods provided herein can be combined with one or more of any of the other compositions and methods provided herein.
The therapy disclosed herein constitutes a new method for treating various types of cancer. The therapy described herein also provides a method of therapy for achieving clinical benefit without an unacceptable level of side effects.
In one aspect the present invention relates to methods for the treatment of neoplasia, and more particularly tumors, by administering to a subject a vaccine or immunogenic composition comprising a plurality of tumor specific neoantigenic peptides. As described in more detail herein, in some embodiments the composition provides a specific, optimized subset of tumor-specific neoantigens suitable for the treatment of tumors in a high proportion of subjects suffering from cancer. In some embodiments, the tumor specific neoantigens may together bind to a high overall proportion of HLA allotypes present in the subject population.
The immune system can be classified into two functional subsystems: the innate and the acquired immune system. The innate immune system is the first line of defense against infections, and most potential pathogens are rapidly neutralized by this system before they can cause, for example, a noticeable infection. The acquired immune system reacts to molecular structures, referred to as antigens, of the intruding organism. There are two types of acquired immune reactions, which include the humoral immune reaction and the cell-mediated immune reaction. In the humoral immune reaction, antibodies secreted by B cells into bodily fluids bind to pathogen-derived antigens, leading to the elimination of the pathogen through a variety of mechanisms, e.g. complement-mediated lysis. In the cell-mediated immune reaction, T-cells capable of destroying other cells are activated. For example, if proteins associated with a disease are present in a cell, they are fragmented proteolytically to peptides within the cell. Specific cell proteins then attach themselves to the antigen or peptide formed in this manner and transport them to the surface of the cell, where they are presented to the molecular defense mechanisms, in particular T-cells, of the body. Cytotoxic T cells recognize these antigens and kill the cells that harbor the antigens.
The molecules that transport and present peptides on the cell surface are referred to as proteins of the major histocompatibility complex (MEW). MHC proteins are classified into two types, referred to as MEW class I and MEW class II. The structures of the proteins of the two MEW classes are very similar; however, they have very different functions. Proteins of MHC class I are present on the surface of almost all cells of the body, including most tumor cells. MEW class I proteins are loaded with antigens that usually originate from endogenous proteins or from pathogens present inside cells, and are then presented to naĆÆve or cytotoxic T-lymphocytes (CTLs). MHC class II proteins are present on dendritic cells, B-lymphocytes, macrophages and other antigen-presenting cells. They mainly present peptides, which are processed from external antigen sources, i.e. outside of the cells, to T-helper (Th) cells. Most of the peptides bound by the MHC class I proteins originate from cytoplasmic proteins produced in the healthy host cells of an organism itself, and do not normally stimulate an immune reaction. Accordingly, cytotoxic T-lymphocytes that recognize such self-peptide-presenting MHC molecules of class I are deleted in the thymus (central tolerance) or, after their release from the thymus, are deleted or inactivated, i.e. tolerized (peripheral tolerance). MHC molecules are capable of stimulating an immune reaction when they present peptides to non-tolerized T-lymphocytes. Cytotoxic T-lymphocytes have both T-cell receptors (TCR) and CD8 molecules on their surface. T-Cell receptors are capable of recognizing and binding peptides complexed with the molecules of MHC class I. Each cytotoxic T-lymphocyte expresses a unique T-cell receptor which is capable of binding specific MHC/peptide complexes.
The peptide antigens attach themselves to the molecules of MHC class I by competitive affinity binding within the endoplasmic reticulum, before they are presented on the cell surface. Here, the affinity of an individual peptide antigen is directly linked to its amino acid sequence and the presence of specific binding motifs in defined positions within the amino acid sequence. If the sequence of such a peptide is known, it is possible to manipulate the immune system against diseased cells using, for example, peptide vaccines.
One of the critical barriers to developing curative and tumor-specific immunotherapy is the identification and selection of highly specific and restricted tumor antigens to avoid autoimmunity. Tumor neoantigens, which arise as a result of genetic change (e.g., inversions, translocations, deletions, missense mutations, splice site mutations, etc.) within malignant cells, represent the most tumor-specific class of antigens. Neoantigens have rarely been used in cancer vaccine or immunogenic compositions due to technical difficulties in identifying them, selecting optimized neoantigens, and producing neoantigens for use in a vaccine or immunogenic composition. These problems may be addressed by:
For example, translating sequencing information into a therapeutic vaccine may include:
(1) Prediction of Mutated Peptides that can Bind to HLA Molecules of a High Proportion of Individuals.
Efficiently choosing which particular mutations to utilize as immunogen requires the ability to predict which mutated peptides would efficiently bind to a high proportion of patient's HLA alleles. Recently, neural network based learning approaches with validated binding and non-binding peptides have advanced the accuracy of prediction algorithms for the major HLA-A and -B Alleles.
(2) Formulating the drug as a multi-epitope vaccine of long peptides.
Targeting as many mutated epitopes as practically possible takes advantage of the enormous capacity of the immune system, prevents the opportunity for immunological escape by down-modulation of a particular immune targeted gene product, and compensates for the known inaccuracy of epitope prediction approaches. Synthetic peptides provide a particularly useful means to prepare multiple immunogens efficiently and to rapidly translate identification of mutant epitopes to an effective vaccine. Peptides can be readily synthesized chemically and easily purified utilizing reagents free of contaminating bacteria or animal substances. The small size allows a clear focus on the mutated region of the protein and also reduces irrelevant antigenic competition from other components (unmutated protein or viral vector antigens).
(3) Combination with a Strong Vaccine Adjuvant.
Effective vaccines require a strong adjuvant to initiate an immune response. As described below, poly-ICLC, an agonist of TLR3 and the RNA helicase-domains of MIDAS and RIG3, has shown several desirable properties for a vaccine adjuvant. These properties include the induction of local and systemic activation of immune cells in vivo, production of stimulatory chemokines and cytokines, and stimulation of antigen-presentation by DCs. Furthermore, poly-ICLC can induce durable CD4+ and CD8+ responses in humans. Importantly, striking similarities in the upregulation of transcriptional and signal transduction pathways were seen in subjects vaccinated with poly-ICLC and in volunteers who had received the highly effective, replication-competent yellow fever vaccine. Furthermore, >90% of ovarian carcinoma patients immunized with poly-ICLC in combination with a NYES0-1 peptide vaccine (in addition to Montanide) showed induction of CD4+ and CD8+ T cell, as well as antibody responses to the peptide in a recent phase 1 study. At the same time, polyICLC has been extensively tested in more than 25 clinical trials to date and exhibited a relatively benign toxicity profile.
The Above-Described Advantages of the Invention are Described Further Herein.
As described herein, there is a large body of evidence in both animals and humans that mutated epitopes are effective in inducing an immune response and that cases of spontaneous tumor regression or long term survival correlate with CD8+ T-cell responses to mutated epitopes (Buckwalter and Srivastava PK. āIt is the antigen(s), stupidā and other lessons from over a decade of vaccitherapy of human cancer. Seminars in immunology 20:296-300 (2008); Karanikas et al, High frequency of cytolytic T lymphocytes directed against a tumor-specific mutated antigen detectable with HLA tetramers in the blood of a lung carcinoma patient with long survival. Cancer Res. 61:3718-3724 (2001); Lennerz et al, The response of autologous T cells to a human melanoma is dominated by mutated neoantigens. Proc Natl Acad Sci USA.102:16013 (2005)) and that āimmunoeditingā can be tracked to alterations in expression of dominant mutated antigens in mice and man (Matsushita et al, Cancer exome analysis reveals a T-cell-dependent mechanism of cancer immunoediting Nature 482:400 (2012); DuPage et al, Expression of tumor-specific antigens underlies cancer immunoediting Nature 482:405 (2012); and Sampson et al, Immunologic escape after prolonged progression-free survival with epidermal growth factor receptor variant III peptide vaccination in patients with newly diagnosed glioblastoma J Clin Oncol. 28:4722-4729 (2010)).
Sequencing technology has revealed that each tumor contains multiple, patient-specific mutations that alter the protein coding content of a gene. Such mutations create altered proteins, ranging from single amino acid changes (caused by missense mutations) to addition of long regions of novel amino acid sequence due to frame shifts, read-through of termination codons or translation of intron regions (novel open reading frame mutations; neoORFs). These mutated proteins are valuable targets for the host's immune response to the tumor as, unlike native proteins, they are not subject to the immune-dampening effects of self-tolerance. Therefore, mutated proteins are more likely to be immunogenic and are also more specific for the tumor cells compared to normal cells of the patient.
In one embodiment, the neoantigenic peptides in the composition together have affinity to a plurality of MHC molecules, e.g. which together cover a large proportion of the target population. Efficiently choosing which particular mutations to utilize as immunogen requires the ability to predict which mutated peptides would efficiently bind to the HLA alleles present in the patient population. Recently, neural network based learning approaches with validated binding and non-binding peptides have advanced the accuracy of prediction algorithms for the major HLA-A and -B alleles. Utilizing the recently improved algorithms for predicting which missense mutations create strong binding peptides to cognate MHC molecules, a set of peptides representative of optimal mutated epitopes (both neoORF and missense) for the patient population may be identified and prioritized (Zhang et al, Machine learning competition in immunologyāPrediction of HLA class I binding peptides J Immunol Methods 374:1 (2011); Lundegaard et al Prediction of epitopes using neural network based methods J Immunol Methods 374:26 (2011)).
Targeting as many mutated epitopes as practically possible takes advantage of the enormous capacity of the immune system, prevents the opportunity for immunological escape by down-modulation of a particular immune targeted gene product, and compensates for the known inaccuracy of epitope prediction approaches. Synthetic peptides provide a particularly useful means to prepare multiple immunogens efficiently and to rapidly translate identification of mutant epitopes to an effective vaccine or immunogenic composition. Peptides can be readily synthesized chemically and easily purified utilizing reagents free of contaminating bacteria or animal substances. The small size allows a clear focus on the mutated region of the protein and also reduces irrelevant antigenic competition from other components (unmutated protein or viral vector antigens).
In one embodiment the drug formulation is a multi-epitope vaccine or immunogenic composition of long peptides. Such ālongā peptides undergo efficient internalization, processing and cross-presentation in professional antigen-presenting cells such as dendritic cells, and have been shown to induce CTLs in humans (Melief and van der Burg, Immunotherapy of established (pre) malignant disease by synthetic long peptide vaccines Nature Rev Cancer 8:351 (2008)). In one embodiment at least 2 peptides are prepared for immunization. In some embodiments 20 or more peptides are prepared for immunization. In one embodiment the neoantigenic peptide ranges from about 5 to about 50 amino acids in length. In another embodiment peptides from about 15 to about 35 amino acids in length is synthesized. In preferred embodiment the neoantigenic peptide ranges from about 20 to about 35 amino acids in length.
The present invention is based, at least in part, on the ability to present the immune system of the patient with a pool of tumor specific neoantigens. One of skill in the art from this disclosure and the knowledge in the art will appreciate that there are a variety of ways in which to produce such tumor specific neoantigens. In general, such tumor specific neoantigens may be produced either in vitro or in vivo. Tumor specific neoantigens may be produced in vitro as peptides or polypeptides, which may then be formulated into a neoplasia vaccine or immunogenic composition and administered to a subject. As described in further detail herein, such in vitro production may occur by a variety of methods known to one of skill in the art such as, for example, peptide synthesis or expression of a peptide/polypeptide from a DNA or RNA molecule in any of a variety of bacterial, eukaryotic, or viral recombinant expression systems, followed by purification of the expressed peptide/polypeptide. Alternatively, tumor specific neoantigens may be produced in vivo by introducing molecules (e.g., DNA, RNA, viral expression systems, and the like) that encode tumor specific neoantigens into a subject, whereupon the encoded tumor specific neoantigens are expressed. The methods of in vitro and in vivo production of neoantigens is also further described herein as it relates to pharmaceutical compositions and methods of delivery of the therapy.
In certain embodiments the present invention includes modified neoantigenic peptides. As used herein in reference to neoantigenic peptides, the terms āmodifiedā, āmodificationā and the like refer to one or more changes that enhance a desired property of the neoantigenic peptide, where the change does not alter the primary amino acid sequence of the neoantigenic peptide. āModificationā includes a covalent chemical modification that does not alter the primary amino acid sequence of the neoantigenic peptide itself. Such desired properties include, for example, prolonging the in vivo half-life, increasing the stability, reducing the clearance, altering the immunogenicity or allergenicity, enabling the raising of particular antibodies, cellular targeting, antigen uptake, antigen processing, MHC affinity, MHC stability, or antigen presentation. Changes to a neoantigenic peptide that may be carried out include, but are not limited to, conjugation to a carrier protein, conjugation to a ligand, conjugation to an antibody, PEGylation, polysialylation HESylation, recombinant PEG mimetics, Fc fusion, albumin fusion, nanoparticle attachment, nanoparticulate encapsulation, cholesterol fusion, iron fusion, acylation, amidation, glycosylation, side chain oxidation, phosphorylation, biotinylation, the addition of a surface active material, the addition of amino acid mimetics, or the addition of unnatural amino acids.
The clinical effectiveness of protein therapeutics is often limited by short plasma half-life and susceptibility to protease degradation. Studies of various therapeutic proteins (e.g., filgrastim) have shown that such difficulties may be overcome by various modifications, including conjugating or linking the polypeptide sequence to any of a variety of non-proteinaceous polymers, e.g., polyethylene glycol (PEG), polypropylene glycol, or polyoxyalkylenes (see, for example, typically via a linking moiety covalently bound to both the protein and the nonproteinaceous polymer, e.g., a PEG). Such PEG-conjugated biomolecules have been shown to possess clinically useful properties, including better physical and thermal stability, protection against susceptibility to enzymatic degradation, increased solubility, longer in vivo circulating half-life and decreased clearance, reduced immunogenicity and antigenicity, and reduced toxicity.
PEGs suitable for conjugation to a polypeptide sequence are generally soluble in water at room temperature, and have the general formula R(0-CH2āCH2)nOāR, where R is hydrogen or a protective group such as an alkyl or an alkanol group, and where n is an integer from 1 to 1000. When R is a protective group, it generally has from 1 to 8 carbons. The PEG conjugated to the polypeptide sequence can be linear or branched. Branched PEG derivatives, āstar-PEGsā and multi-armed PEGs are contemplated by the present disclosure. A molecular weight of the PEG used in the present disclosure is not restricted to any particular range, but certain embodiments have a molecular weight between 500 and 20,000 while other embodiments have a molecular weight between 4,000 and 10,000.
The present disclosure also contemplates compositions of conjugates wherein the PEGs have different n values and thus the various different PEGs are present in specific ratios. For example, some compositions comprise a mixture of conjugates where n=1, 2, 3 and 4. In some compositions, the percentage of conjugates where n=1 is 18-25%, the percentage of conjugates where n=2 is 50-66%, the percentage of conjugates where n=3 is 12-16%, and the percentage of conjugates where n=4 is up to 5%. Such compositions can be produced by reaction conditions and purification methods know in the art. For example, cation exchange chromatography may be used to separate conjugates, and a fraction is then identified which contains the conjugate having, for example, the desired number of PEGs attached, purified free from unmodified protein sequences and from conjugates having other numbers of PEGs attached.
PEG may be bound to a polypeptide of the present disclosure via a terminal reactive group (a āspacerā). The spacer is, for example, a terminal reactive group which mediates a bond between the free amino or carboxyl groups of one or more of the polypeptide sequences and polyethylene glycol. The PEG having the spacer which may be bound to the free amino group includes N-hydroxysuccinylimide polyethylene glycol which may be prepared by activating succinic acid ester of polyethylene glycol with N-hydroxy succinylimide. Another activated polyethylene glycol which may be bound to a free amino group is 2,4-bis(0-methoxypolyethyleneglycol)-6-chloro-s-triazine which may be prepared by reacting polyethylene glycol monomethyl ether with cyanuric chloride. The activated polyethylene glycol which is bound to the free carboxyl group includes polyoxyethylenediamine.
Conjugation of one or more of the polypeptide sequences of the present disclosure to PEG having a spacer may be carried out by various conventional methods. For example, the conjugation reaction can be carried out in solution at a pH of from 5 to 10, at temperature from 4° C. to room temperature, for 30 minutes to 20 hours, utilizing a molar ratio of reagent to protein of from 4:1 to 30:1. Reaction conditions may be selected to direct the reaction towards producing predominantly a desired degree of substitution. In general, low temperature, low pH (e.g., pH=5), and short reaction time tend to decrease the number of PEGs attached, whereas high temperature, neutral to high pH (e.g., pH>7), and longer reaction time tend to increase the number of PEGs attached. Various means known in the art may be used to terminate the reaction. In some embodiments the reaction is terminated by acidifying the reaction mixture and freezing at, e.g., ā20° C.
The present disclosure also contemplates the use of PEG Mimetics. Recombinant PEG mimetics have been developed that retain the attributes of PEG (e.g., enhanced serum half-life) while conferring several additional advantageous properties. By way of example, simple polypeptide chains (comprising, for example, Ala, Glu, Gly, Pro, Ser and Thr) capable of forming an extended conformation similar to PEG can be produced recombinantly already fused to the peptide or protein drug of interest (e.g., Amunixā XTEN technology; Mountain View, Calif.). This obviates the need for an additional conjugation step during the manufacturing process. Moreover, established molecular biology techniques enable control of the side chain composition of the polypeptide chains, allowing optimization of immunogenicity and manufacturing properties.
For purposes of the present disclosure, āglycosylationā is meant to broadly refer to the enzymatic process that attaches glycans to proteins, lipids or other organic molecules. The use of the term āglycosylationā in conjunction with the present disclosure is generally intended to mean adding or deleting one or more carbohydrate moieties (either by removing the underlying glycosylation site or by deleting the glycosylation by chemical and/or enzymatic means), and/or adding one or more glycosylation sites that may or may not be present in the native sequence. In addition, the phrase includes qualitative changes in the glycosylation of the native proteins involving a change in the nature and proportions of the various carbohydrate moieties present. Glycosylation can dramatically affect the physical properties of proteins and can also be important in protein stability, secretion, and subcellular localization. Proper glycosylation can be essential for biological activity. In fact, some genes from eucaryotic organisms, when expressed in bacteria (e.g., E. coli) which lack cellular processes for glycosylating proteins, yield proteins that are recovered with little or no activity by virtue of their lack of glycosylation.
Addition of glycosylation sites can be accomplished by altering the amino acid sequence. The alteration to the polypeptide may be made, for example, by the addition of, or substitution by, one or more serine or threonine residues (for O-linked glycosylation sites) or asparagine residues (for N-linked glycosylation sites). The structures of N-linked and O-linked oligosaccharides and the sugar residues found in each type may be different. One type of sugar that is commonly found on both is N-acetylneuraminic acid (hereafter referred to as sialic acid). Sialic acid is usually the terminal residue of both N-linked and O-linked oligosaccharides and, by virtue of its negative charge, may confer acidic properties to the glycoprotein. A particular embodiment of the present disclosure comprises the generation and use of N-glycosylation variants.
The polypeptide sequences of the present disclosure may optionally be altered through changes at the DNA level, particularly by mutating the DNA encoding the polypeptide at preselected bases such that codons are generated that will translate into the desired amino acids. Another means of increasing the number of carbohydrate moieties on the polypeptide is by chemical or enzymatic coupling of glycosides to the polypeptide.
Removal of carbohydrates may be accomplished chemically or enzymatically, or by substitution of codons encoding amino acid residues that are glycosylated. Chemical deglycosylation techniques are known, and enzymatic cleavage of carbohydrate moieties on polypeptides can be achieved by the use of a variety of endo- and exo-glycosidases.
Dihydrofolate reductase (DHFR)ādeficient Chinese Hamster Ovary (CHO) cells are a commonly used host cell for the production of recombinant glycoproteins. These cells do not express the enzyme beta-galactoside alpha-2,6-sialyltransferase and therefore do not add sialic acid in the alpha-2,6 linkage to N-linked oligosaccharides of glycoproteins produced in these cells.
The present disclosure also contemplates the use of polysialylation, the conjugation of peptides and proteins to the naturally occurring, biodegradable a-(2ā8) linked polysialic acid (āPSAā) in order to improve their stability and in vivo pharmacokinetics. PSA is a biodegradable, non-toxic natural polymer that is highly hydrophilic, giving it a high apparent molecular weight in the blood which increases its serum half-life. In addition, polysialylation of a range of peptide and protein therapeutics has led to markedly reduced proteolysis, retention of activity in vivo activity, and reduction in immunogenicity and antigenicity (see, e.g., G. Gregoriadis et al., Int. J. Pharmaceutics 300(1-2): 125-30). As with modifications with other conjugates (e.g., PEG), various techniques for site-specific polysialylation are available (see, e.g., T. Lindhout et al., PNAS 108(18)7397-7402 (2011)).
Additional suitable components and molecules for conjugation include, for example, thyroglobulin; albumins such as human serum albumin (HAS); tetanus toxoid; Diphtheria toxoid; polyamino acids such as poly(D-lysine:D-glutamic acid); VP6 polypeptides of rotaviruses; influenza virus hemaglutinin, influenza virus nucleoprotein; Keyhole Limpet Hemocyanin (KLH); and hepatitis B virus core protein and surface antigen; or any combination of the foregoing.
Fusion of albumin to one or more polypeptides of the present disclosure can, for example, be achieved by genetic manipulation, such that the DNA coding for HSA, or a fragment thereof, is joined to the DNA coding for the one or more polypeptide sequences. Thereafter, a suitable host can be transformed or transfected with the fused nucleotide sequences in the form of, for example, a suitable plasmid, so as to express a fusion polypeptide. The expression may be effected in vitro from, for example, prokaryotic or eukaryotic cells, or in vivo from, for example, a transgenic organism. In some embodiments of the present disclosure, the expression of the fusion protein is performed in mammalian cell lines, for example, CHO cell lines. Transformation is used broadly herein to refer to the genetic alteration of a cell resulting from the direct uptake, incorporation and expression of exogenous genetic material (exogenous DNA) from its surroundings and taken up through the cell membrane(s). Transformation occurs naturally in some species of bacteria, but it can also be effected by artificial means in other cells.
Furthermore, albumin itself may be modified to extend its circulating half-life. Fusion of the modified albumin to one or more Polypeptides can be attained by the genetic manipulation techniques described above or by chemical conjugation; the resulting fusion molecule has a half-life that exceeds that of fusions with non-modified albumin. (See WO2011/051489).
Several albumin-binding strategies have been developed as alternatives for direct fusion, including albumin binding through a conjugated fatty acid chain (acylation). Because serum albumin is a transport protein for fatty acids, these natural ligands with albumin-binding activity have been used for half-life extension of small protein therapeutics. For example, insulin determir (LEVEMIR), an approved product for diabetes, comprises a myristyl chain conjugated to a genetically-modified insulin, resulting in a long-acting insulin analog.
Another type of modification is to conjugate (e.g., link) one or more additional components or molecules at the N- and/or C-terminus of a polypeptide sequence, such as another protein (e.g., a protein having an amino acid sequence heterologous to the subject protein), or a carrier molecule. Thus, an exemplary polypeptide sequence can be provided as a conjugate with another component or molecule.
A conjugate modification may result in a polypeptide sequence that retains activity with an additional or complementary function or activity of the second molecule. For example, a polypeptide sequence may be conjugated to a molecule, e.g., to facilitate solubility, storage, in vivo or shelf half-life or stability, reduction in immunogenicity, delayed or controlled release in vivo, etc. Other functions or activities include a conjugate that reduces toxicity relative to an unconjugated polypeptide sequence, a conjugate that targets a type of cell or organ more efficiently than an unconjugated polypeptide sequence, or a drug to further counter the causes or effects associated with a disorder or disease as set forth herein (e.g., diabetes).
A Polypeptide may also be conjugated to large, slowly metabolized macromolecules such as proteins; polysaccharides, such as sepharose, agarose, cellulose, cellulose beads; polymeric amino acids such as polyglutamic acid, polylysine; amino acid copolymers; inactivated virus particles; inactivated bacterial toxins such as toxoid from diphtheria, tetanus, cholera, leukotoxin molecules; inactivated bacteria; and dendritic cells.
Additional candidate components and molecules for conjugation include those suitable for isolation or purification. Particular non-limiting examples include binding molecules, such as biotin (biotin-avidin specific binding pair), an antibody, a receptor, a ligand, a lectin, or molecules that comprise a solid support, including, for example, plastic or polystyrene beads, plates or beads, magnetic beads, test strips, and membranes.
Purification methods such as cation exchange chromatography may be used to separate conjugates by charge difference, which effectively separates conjugates into their various molecular weights. For example, the cation exchange column can be loaded and then washed with ā20 mM sodium acetate, pH ā4, and then eluted with a linear (0 M to 0.5 M) NaCl gradient buffered at a pH from about 3 to 5.5, e.g., at pH ā4.5. The content of the fractions obtained by cation exchange chromatography may be identified by molecular weight using conventional methods, for example, mass spectroscopy, SDS-PAGE, or other known methods for separating molecular entities by molecular weight.
In certain embodiments, the amino- or carboxyl-terminus of a polypeptide sequence of the present disclosure can be fused with an immunoglobulin Fc region (e.g., human Fc) to form a fusion conjugate (or fusion molecule). Fc fusion conjugates have been shown to increase the systemic half-life of biopharmaceuticals, and thus the biopharmaceutical product may require less frequent administration.
Fc binds to the neonatal Fc receptor (FcRn) in endothelial cells that line the blood vessels, and, upon binding, the Fc fusion molecule is protected from degradation and re-released into the circulation, keeping the molecule in circulation longer. This Fc binding is believed to be the mechanism by which endogenous IgG retains its long plasma half-life. More recent Fc-fusion technology links a single copy of a biopharmaceutical to the Fc region of an antibody to optimize the pharmacokinetic and pharmacodynamic properties of the biopharmaceutical as compared to traditional Fc-fusion conjugates.
The present disclosure contemplates the use of other modifications, currently known or developed in the future, of the Polypeptides to improve one or more properties. One such method for prolonging the circulation half-life, increasing the stability, reducing the clearance, or altering the immunogenicity or allergenicity of a polypeptide of the present disclosure involves modification of the polypeptide sequences by hesylation, which utilizes hydroxyethyl starch derivatives linked to other molecules in order to modify the molecule's characteristics. Various aspects of hesylation are described in, for example, U.S. Patent Appln. Nos. 2007/0134197 and 2006/0258607.
Proteins or peptides may be made by any technique known to those of skill in the art, including the expression of proteins, polypeptides or peptides through standard molecular biological techniques, the isolation of proteins or peptides from natural sources, in vitro translation, or the chemical synthesis of proteins or peptides. The nucleotide and protein, polypeptide and peptide sequences corresponding to various genes have been previously disclosed, and may be found at computerized databases known to those of ordinary skill in the art. One such database is the National Center for Biotechnology Information's Genbank and GenPept databases located at the National Institutes of Health website. The coding regions for known genes may be amplified and/or expressed using the techniques disclosed herein or as would be known to those of ordinary skill in the art. Alternatively, various commercial preparations of proteins, polypeptides and peptides are known to those of skill in the art.
Peptides can be readily synthesized chemically utilizing reagents that are free of contaminating bacterial or animal substances (Merrifield RB: Solid phase peptide synthesis. I. The synthesis of a tetrapeptide. J. Am. Chem. Soc. 85:2149-54, 1963). In certain embodiments, neoantigenic peptides are prepared by (1) parallel solid-phase synthesis on multi-channel instruments using uniform synthesis and cleavage conditions; (2) purification over a RP-HPLC column with column stripping; and re-washing, but not replacement, between peptides; followed by (3) analysis with a limited set of the most informative assays. The Good Manufacturing Practices (GMP) footprint can be defined around the set of peptides for an individual patient, thus requiring suite changeover procedures only between syntheses of peptides for different patients.
Alternatively, a nucleic acid (e.g., a polynucleotide) encoding a neoantigenic peptide of the invention may be used to produce the neoantigenic peptide in vitro. The polynucleotide may be, e.g., DNA, cDNA, PNA, CNA, RNA, either single- and/or double-stranded, or native or stabilized forms of polynucleotides, such as e.g. polynucleotides with a phosphorothiate backbone, or combinations thereof and it may or may not contain introns so long as it codes for the peptide. In one embodiment in vitro translation is used to produce the peptide. Many exemplary systems exist that one skilled in the art could utilize (e.g., Retic Lysate IVT Kit, Life Technologies, Waltham, Mass.).
An expression vector capable of expressing a polypeptide can also be prepared. Expression vectors for different cell types are well known in the art and can be selected without undue experimentation. Generally, the DNA is inserted into an expression vector, such as a plasmid, in proper orientation and correct reading frame for expression. If necessary, the DNA may be linked to the appropriate transcriptional and translational regulatory control nucleotide sequences recognized by the desired host (e.g., bacteria), although such controls are generally available in the expression vector. The vector is then introduced into the host bacteria for cloning using standard techniques (see, e.g., Sambrook et al. (1989) Molecular Cloning, A Laboratory Manual, Cold Spring Harbor Laboratory, Cold Spring Harbor, N.Y.).
Expression vectors comprising the isolated polynucleotides, as well as host cells containing the expression vectors, are also contemplated. The neoantigenic peptides may be provided in the form of RNA or cDNA molecules encoding the desired neoantigenic peptides. One or more neoantigenic peptides of the invention may be encoded by a single expression vector.
The term āpolynucleotide encoding a polypeptideā encompasses a polynucleotide which includes only coding sequences for the polypeptide as well as a polynucleotide which includes additional coding and/or non-coding sequences. Polynucleotides can be in the form of RNA or in the form of DNA. DNA includes cDNA, genomic DNA, and synthetic DNA; and can be double-stranded or single-stranded, and if single stranded can be the coding strand or non-coding (anti-sense) strand.
In embodiments, the polynucleotides may comprise the coding sequence for the tumor specific neoantigenic peptide fused in the same reading frame to a polynucleotide which aids, for example, in expression and/or secretion of a polypeptide from a host cell (e.g., a leader sequence which functions as a secretory sequence for controlling transport of a polypeptide from the cell). The polypeptide having a leader sequence is a preprotein and can have the leader sequence cleaved by the host cell to form the mature form of the polypeptide.
In embodiments, the polynucleotides can comprise the coding sequence for the tumor specific neoantigenic peptide fused in the same reading frame to a marker sequence that allows, for example, for purification of the encoded polypeptide, which may then be incorporated into the personalized neoplasia vaccine or immunogenic composition. For example, the marker sequence can be a hexa-histidine tag (SEQ ID NO: 33733) supplied by a pQE-9 vector to provide for purification of the mature polypeptide fused to the marker in the case of a bacterial host, or the marker sequence can be a hemagglutinin (HA) tag derived from the influenza hemagglutinin protein when a mammalian host (e.g., COS-7 cells) is used. Additional tags include, but are not limited to, Calmodulin tags, FLAG tags, Myc tags, S tags, SBP tags, Softag 1, Softag 3, V5 tag, Xpress tag, Isopeptag, SpyTag, Biotin Carboxyl Carrier Protein (BCCP) tags, GST tags, fluorescent protein tags (e.g., green fluorescent protein tags), maltose binding protein tags, Nus tags, Strep-tag, thioredoxin tag, TC tag, Ty tag, and the like.
In embodiments, the polynucleotides may comprise the coding sequence for one or more of the tumor specific neoantigenic peptides fused in the same reading frame to create a single concatamerized neoantigenic peptide construct capable of producing multiple neoantigenic peptides.
In certain embodiments, isolated nucleic acid molecules having a nucleotide sequence at least 60% identical, at least 65% identical, at least 70% identical, at least 75% identical, at least 80% identical, at least 85% identical, at least 90% identical, at least 95% identical, or at least 96%, 97%, 98% or 99% identical to a polynucleotide encoding a tumor specific neoantigenic peptide of the present invention, can be provided.
By a polynucleotide having a nucleotide sequence at least, for example, 95% āidenticalā to a reference nucleotide sequence is intended that the nucleotide sequence of the polynucleotide is identical to the reference sequence except that the polynucleotide sequence can include up to five point mutations per each 100 nucleotides of the reference nucleotide sequence. In other words, to obtain a polynucleotide having a nucleotide sequence at least 95% identical to a reference nucleotide sequence, up to 5% of the nucleotides in the reference sequence can be deleted or substituted with another nucleotide, or a number of nucleotides up to 5% of the total nucleotides in the reference sequence can be inserted into the reference sequence. These mutations of the reference sequence can occur at the amino- or carboxy-terminal positions of the reference nucleotide sequence or anywhere between those terminal positions, interspersed either individually among nucleotides in the reference sequence or in one or more contiguous groups within the reference sequence.
As a practical matter, whether any particular nucleic acid molecule is at least 80% identical, at least 85% identical, at least 90% identical, and in some embodiments, at least 95%, 96%, 97%, 98%, or 99% identical to a reference sequence can be determined conventionally using known computer programs such as the Bestfit program (Wisconsin Sequence Analysis Package, Version 8 for Unix, Genetics Computer Group, University Research Park, 575 Science Drive, Madison, Wis. 53711). Bestfit uses the local homology algorithm of Smith and Waterman, Advances in Applied Mathematics 2:482-489 (1981), to find the best segment of homology between two sequences. When using Bestfit or any other sequence alignment program to determine whether a particular sequence is, for instance, 95% identical to a reference sequence according to the present invention, the parameters are set such that the percentage of identity is calculated over the full length of the reference nucleotide sequence and that gaps in homology of up to 5% of the total number of nucleotides in the reference sequence are allowed.
The isolated tumor specific neoantigenic peptides described herein can be produced in vitro (e.g., in the laboratory) by any suitable method known in the art. Such methods range from direct protein synthetic methods to constructing a DNA sequence encoding isolated polypeptide sequences and expressing those sequences in a suitable transformed host. In some embodiments, a DNA sequence is constructed using recombinant technology by isolating or synthesizing a DNA sequence encoding a wild-type protein of interest. Optionally, the sequence can be mutagenized by site-specific mutagenesis to provide functional analogs thereof. See, e.g. Zoeller et al., Proc. Nat'l. Acad. Sci. USA 81:5662-5066 (1984) and U.S. Pat. No. 4,588,585.
In embodiments, a DNA sequence encoding a polypeptide of interest would be constructed by chemical synthesis using an oligonucleotide synthesizer. Such oligonucleotides can be designed based on the amino acid sequence of the desired polypeptide and selecting those codons that are favored in the host cell in which the recombinant polypeptide of interest is produced. Standard methods can be applied to synthesize an isolated polynucleotide sequence encoding an isolated polypeptide of interest. For example, a complete amino acid sequence can be used to construct a back-translated gene. Further, a DNA oligomer containing a nucleotide sequence coding for the particular isolated polypeptide can be synthesized. For example, several small oligonucleotides coding for portions of the desired polypeptide can be synthesized and then ligated. The individual oligonucleotides typically contain 5ā² or 3ā² overhangs for complementary assembly.
Once assembled (e.g., by synthesis, site-directed mutagenesis, or another method), the polynucleotide sequences encoding a particular isolated polypeptide of interest is inserted into an expression vector and optionally operatively linked to an expression control sequence appropriate for expression of the protein in a desired host. Proper assembly can be confirmed by nucleotide sequencing, restriction mapping, and expression of a biologically active polypeptide in a suitable host. As well known in the art, in order to obtain high expression levels of a transfected gene in a host, the gene can be operatively linked to transcriptional and translational expression control sequences that are functional in the chosen expression host.
Recombinant expression vectors may be used to amplify and express DNA encoding the tumor specific neoantigenic peptides. Recombinant expression vectors are replicable DNA constructs which have synthetic or cDNA-derived DNA fragments encoding a tumor specific neoantigenic peptide or a bioequivalent analog operatively linked to suitable transcriptional or translational regulatory elements derived from mammalian, microbial, viral or insect genes. A transcriptional unit generally comprises an assembly of (1) a genetic element or elements having a regulatory role in gene expression, for example, transcriptional promoters or enhancers, (2) a structural or coding sequence which is transcribed into mRNA and translated into protein, and (3) appropriate transcription and translation initiation and termination sequences, as described in detail herein. Such regulatory elements can include an operator sequence to control transcription. The ability to replicate in a host, usually conferred by an origin of replication, and a selection gene to facilitate recognition of transformants can additionally be incorporated. DNA regions are operatively linked when they are functionally related to each other. For example, DNA for a signal peptide (secretory leader) is operatively linked to DNA for a polypeptide if it is expressed as a precursor which participates in the secretion of the polypeptide; a promoter is operatively linked to a coding sequence if it controls the transcription of the sequence; or a ribosome binding site is operatively linked to a coding sequence if it is positioned so as to permit translation. Generally, operatively linked means contiguous, and in the case of secretory leaders, means contiguous and in reading frame. Structural elements intended for use in yeast expression systems include a leader sequence enabling extracellular secretion of translated protein by a host cell. Alternatively, where recombinant protein is expressed without a leader or transport sequence, it can include an N-terminal methionine residue. This residue can optionally be subsequently cleaved from the expressed recombinant protein to provide a final product.
Useful expression vectors for eukaryotic hosts, especially mammals or humans include, for example, vectors comprising expression control sequences from SV40, bovine papilloma virus, adenovirus and cytomegalovirus. Useful expression vectors for bacterial hosts include known bacterial plasmids, such as plasmids from Escherichia coli, including pCR 1, pBR322, pMB9 and their derivatives, wider host range plasmids, such as M13 and filamentous single-stranded DNA phages.
Suitable host cells for expression of a polypeptide include prokaryotes, yeast, insect or higher eukaryotic cells under the control of appropriate promoters. Prokaryotes include gram negative or gram positive organisms, for example E. coli or bacilli. Higher eukaryotic cells include established cell lines of mammalian origin. Cell-free translation systems could also be employed. Appropriate cloning and expression vectors for use with bacterial, fungal, yeast, and mammalian cellular hosts are well known in the art (see Pouwels et al., Cloning Vectors: A Laboratory Manual, Elsevier, N.Y., 1985).
Various mammalian or insect cell culture systems are also advantageously employed to express recombinant protein. Expression of recombinant proteins in mammalian cells can be performed because such proteins are generally correctly folded, appropriately modified and completely functional. Examples of suitable mammalian host cell lines include the COS-7 lines of monkey kidney cells, described by Gluzman (Cell 23:175, 1981), and other cell lines capable of expressing an appropriate vector including, for example, L cells, C127, 3T3, Chinese hamster ovary (CHO), 293, HeLa and BHK cell lines. Mammalian expression vectors can comprise nontranscribed elements such as an origin of replication, a suitable promoter and enhancer linked to the gene to be expressed, and other 5ā² or 3ā² flanking nontranscribed sequences, and 5ā² or 3ā² nontranslated sequences, such as necessary ribosome binding sites, a polyadenylation site, splice donor and acceptor sites, and transcriptional termination sequences. Baculovirus systems for production of heterologous proteins in insect cells are reviewed by Luckow and Summers, Bio/Technology 6:47 (1988).
The proteins produced by a transformed host can be purified according to any suitable method. Such standard methods include chromatography (e.g., ion exchange, affinity and sizing column chromatography, and the like), centrifugation, differential solubility, or by any other standard technique for protein purification. Affinity tags such as hexahistidine (SEQ ID NO: 33733), maltose binding domain, influenza coat sequence, glutathione-S-transferase, and the like can be attached to the protein to allow easy purification by passage over an appropriate affinity column. Isolated proteins can also be physically characterized using such techniques as proteolysis, nuclear magnetic resonance and x-ray crystallography.
For example, supernatants from systems which secrete recombinant protein into culture media can be first concentrated using a commercially available protein concentration filter, for example, an Amicon or Millipore Pellicon ultrafiltration unit. Following the concentration step, the concentrate can be applied to a suitable purification matrix. Alternatively, an anion exchange resin can be employed, for example, a matrix or substrate having pendant diethylaminoethyl (DEAE) groups. The matrices can be acrylamide, agarose, dextran, cellulose or other types commonly employed in protein purification. Alternatively, a cation exchange step can be employed. Suitable cation exchangers include various insoluble matrices comprising sulfopropyl or carboxymethyl groups. Finally, one or more reversed-phase high performance liquid chromatography (RP-HPLC) steps employing hydrophobic RP-HPLC media, e.g., silica gel having pendant methyl or other aliphatic groups, can be employed to further purify a cancer stem cell protein-Fc composition. Some or all of the foregoing purification steps, in various combinations, can also be employed to provide a homogeneous recombinant protein.
Recombinant protein produced in bacterial culture can be isolated, for example, by initial extraction from cell pellets, followed by one or more concentration, salting-out, aqueous ion exchange or size exclusion chromatography steps. High performance liquid chromatography (HPLC) can be employed for final purification steps. Microbial cells employed in expression of a recombinant protein can be disrupted by any convenient method, including freeze-thaw cycling, sonication, mechanical disruption, or use of cell lysing agents.
The present invention also contemplates the use of nucleic acid molecules as vehicles for delivering neoantigenic peptides/polypeptides to the subject in need thereof, in vivo, in the form of, e.g., DNA/RNA vaccines (see, e.g., WO2012/159643, and WO2012/159754, hereby incorporated by reference in their entirety).
In one embodiment neoantigens may be administered to a patient in need thereof by use of a plasmid. These are plasmids which usually consist of a strong viral promoter to drive the in vivo transcription and translation of the gene (or complementary DNA) of interest (Mor, et al., (1995). The Journal of Immunology 155 (4): 2039-2046). Intron A may sometimes be included to improve mRNA stability and hence increase protein expression (Leitner et al. (1997).The Journal of Immunology 159 (12): 6112-6119). Plasmids also include a strong polyadenylation/transcriptional termination signal, such as bovine growth hormone or rabbit beta-globulin polyadenylation sequences (Alarcon et al., (1999). Adv. Parasitol. Advances in Parasitology 42: 343-410; Robinson et al., (2000). Adv. Virus Res. Advances in Virus Research 55: 1-74; Bƶhmet al., (1996). Journal of Immunological Methods 193 (1): 29-40.). Multicistronic vectors are sometimes constructed to express more than one immunogen, or to express an immunogen and an immunostimulatory protein (Lewis et al., (1999). Advances in Virus Research (Academic Press) 54: 129-88).
Because the plasmid is the āvehicleā from which the immunogen is expressed, optimising vector design for maximal protein expression is essential (Lewis et al., (1999). Advances in Virus Research (Academic Press) 54: 129-88). One way of enhancing protein expression is by optimising the codon usage of pathogenic mRNAs for eukaryotic cells. Another consideration is the choice of promoter. Such promoters may be the SV40 promoter or Rous Sarcoma Virus (RSV).
Plasmids may be introduced into animal tissues by a number of different methods. The two most popular approaches are injection of DNA in saline, using a standard hypodermic needle, and gene gun delivery. A schematic outline of the construction of a DNA vaccine plasmid and its subsequent delivery by these two methods into a host is illustrated at Scientific American (Weiner et al., (1999) Scientific American 281 (1): 34-41). Injection in saline is normally conducted intramuscularly (IM) in skeletal muscle, or intradermally (ID), with DNA being delivered to the extracellular spaces. This can be assisted by electroporation by temporarily damaging muscle fibres with myotoxins such as bupivacaine; or by using hypertonic solutions of saline or sucrose (Alarcon et al., (1999). Adv. Parasitol. Advances in Parasitology 42: 343-410). Immune responses to this method of delivery can be affected by many factors, including needle type, needle alignment, speed of injection, volume of injection, muscle type, and age, sex and physiological condition of the animal being injected(Alarcon et al., (1999). Adv. Parasitol. Advances in Parasitology 42: 343-410).
Gene gun delivery, the other commonly used method of delivery, ballistically accelerates plasmid DNA (pDNA) that has been adsorbed onto gold or tungsten microparticles into the target cells, using compressed helium as an accelerant (Alarcon et al., (1999). Adv. Parasitol. Advances in Parasitology 42: 343-410; Lewis et al., (1999). Advances in Virus Research (Academic Press) 54: 129-88).
Alternative delivery methods may include aerosol instillation of naked DNA on mucosal surfaces, such as the nasal and lung mucosa, (Lewis et al., (1999). Advances in Virus Research (Academic Press) 54: 129-88) and topical administration of pDNA to the eye and vaginal mucosa (Lewis et al., (1999) Advances in Virus Research (Academic Press) 54: 129-88). Mucosal surface delivery has also been achieved using cationic liposome-DNA preparations, biodegradable microspheres, attenuated Shigella or Listeria vectors for oral administration to the intestinal mucosa, and recombinant adenovirus vectors. DNA or RNA may also be delivered to cells following mild mechanical disruption of the cell membrane, temporarily permeabilizing the cells. Such a mild mechanical disruption of the membrane can be accomplished by gently forcing cells through a small aperture (Ex Vivo Cytosolic Delivery of Functional Macromolecules to Immune Cells, Sharei et al, PLOS ONE|DOI:10.1371/journal.pone.0118803 Apr. 13, 2015).
The method of delivery determines the dose of DNA required to raise an effective immune response. Saline injections require variable amounts of DNA, from 10 μg-1 mg, whereas gene gun deliveries require 100 to 1000 times less DNA than intramuscular saline injection to raise an effective immune response. Generally, 0.2 μg-20 μg are required, although quantities as low as 16 ng have been reported. These quantities vary from species to species, with mice, for example, requiring approximately 10 times less DNA than primates. Saline injections require more DNA because the DNA is delivered to the extracellular spaces of the target tissue (normally muscle), where it has to overcome physical barriers (such as the basal lamina and large amounts of connective tissue, to mention a few) before it is taken up by the cells, while gene gun deliveries bombard DNA directly into the cells, resulting in less āwastageā (See e.g., Sedegah et al., (1994). Proceedings of the National Academy of Sciences of the United States of America 91 (21): 9866-9870; Daheshiaet al., (1997). The Journal of Immunology 159 (4): 1945-1952; Chen et al., (1998). The Journal of Immunology 160 (5): 2425-2432; Sizemore (1995) Science 270 (5234): 299-302; Fynan et al., (1993) Proc. Natl. Acad. Sci. U.S.A. 90 (24): 11478-82).
In one embodiment, a neoplasia vaccine or immunogenic composition may include separate DNA plasmids encoding, for example, one or more neoantigenic peptides/polypeptides as identified in according to the invention. As discussed herein, the exact choice of expression vectors can depend upon the peptide/polypeptides to be expressed, and is well within the skill of the ordinary artisan. The expected persistence of the DNA constructs (e.g., in an episomal, non-replicating, non-integrated form in the muscle cells) is expected to provide an increased duration of protection.
One or more neoantigenic peptides of the invention may be encoded and expressed in vivo using a viral based system (e.g., an adenovirus system, an adeno associated virus (AAV) vector, a poxvirus, or a lentivirus). In one embodiment, the neoplasia vaccine or immunogenic composition may include a viral based vector for use in a human patient in need thereof, such as, for example, an adenovirus (see, e.g., Baden et al. First-in-human evaluation of the safety and immunogenicity of a recombinant adenovirus serotype 26 HIV-1 Env vaccine (IPCAVD 001). J Infect Dis. 2013 Jan. 15; 207(2):240-7, hereby incorporated by reference in its entirety). Plasmids that can be used for adeno associated virus, adenovirus, and lentivirus delivery have been described previously (see e.g., U.S. Pat. Nos. 6,955,808 and 6,943,019, and U.S. Patent application No. 20080254008, hereby incorporated by reference).
The peptides and polypeptides of the invention can also be expressed by a vector, e.g., a nucleic acid molecule as herein-discussed, e.g., RNA or a DNA plasmid, a viral vector such as a poxvirus, e.g., orthopox virus, avipox virus, or adenovirus, AAV or lentivirus. This approach involves the use of a vector to express nucleotide sequences that encode the peptide of the invention. Upon introduction into an acutely or chronically infected host or into a noninfected host, the vector expresses the immunogenic peptide, and thereby elicits a host CTL response.
Among vectors that may be used in the practice of the invention, integration in the host genome of a cell is possible with retrovirus gene transfer methods, often resulting in long term expression of the inserted transgene. In a preferred embodiment the retrovirus is a lentivirus. Additionally, high transduction efficiencies have been observed in many different cell types and target tissues. The tropism of a retrovirus can be altered by incorporating foreign envelope proteins, expanding the potential target population of target cells. A retrovirus can also be engineered to allow for conditional expression of the inserted transgene, such that only certain cell types are infected by the lentivirus. Cell type specific promoters can be used to target expression in specific cell types. Lentiviral vectors are retroviral vectors (and hence both lentiviral and retroviral vectors may be used in the practice of the invention). Moreover, lentiviral vectors are preferred as they are able to transduce or infect non-dividing cells and typically produce high viral titers. Selection of a retroviral gene transfer system may therefore depend on the target tissue. Retroviral vectors are comprised of cis-acting long terminal repeats with packaging capacity for up to 6-10 kb of foreign sequence. The minimum cis-acting LTRs are sufficient for replication and packaging of the vectors, which are then used to integrate the desired nucleic acid into the target cell to provide permanent expression. Widely used retroviral vectors that may be used in the practice of the invention include those based upon murine leukemia virus (MuLV), gibbon ape leukemia virus (GaLV), Simian Immuno deficiency virus (SIV), human immuno deficiency virus (HIV), and combinations thereof (see, e.g., Buchscher et al., (1992) J. Virol. 66:2731-2739; Johann et al., (1992) J. Virol. 66:1635-1640; Sommnerfelt et al., (1990) Virol. 176:58-59; Wilson et al., (1998) J. Virol. 63:2374-2378; Miller et al., (1991) J. Virol. 65:2220-2224; PCT/US94/05700).
Also useful in the practice of the invention is a minimal non-primate lentiviral vector, such as a lentiviral vector based on the equine infectious anemia virus (EIAV) (see, e.g., Balagaan, (2006) J Gene Med; 8: 275-285, Published online 21 Nov. 2005 in Wiley InterScience (www.interscience.wiley.com). DOI: 10.1002/jgm.845). The vectors may have cytomegalovirus (CMV) promoter driving expression of the target gene. Accordingly, the invention contemplates amongst vector(s) useful in the practice of the invention: viral vectors, including retroviral vectors and lentiviral vectors.
Lentiviral vectors have been disclosed as in the treatment for Parkinson's Disease, see, e.g., US Patent Publication No. 20120295960 and U.S. Pat. Nos. 7,303,910 and 7,351,585. Lentiviral vectors have also been disclosed for delivery to the Brain, see, e.g., US Patent Publication Nos. US20110293571; US20040013648, US20070025970, US20090111106 and U.S. Pat. No. 7,259,015. In another embodiment lentiviral vectors are used to deliver vectors to the brain of those being treated for a disease.
As to lentivirus vector systems useful in the practice of the invention, mention is made of U.S. Pat. Nos. 6,428,953, 6,165,782, 6,013,516, 5,994,136, 6,312,682, and 7,198,784, and documents cited therein.
In an embodiment herein the delivery is via an lentivirus. Zou et al. administered about 10 μl of a recombinant lentivirus having a titer of 1Ć109 transducing units (TU)/ml by an intrathecal catheter. These sort of dosages can be adapted or extrapolated to use of a retroviral or lentiviral vector in the present invention. For transduction in tissues such as the brain, it is necessary to use very small volumes, so the viral preparation is concentrated by ultracentrifugation. The resulting preparation should have at least 108 TU/ml, preferably from 108 to 109 TU/ml, more preferably at least 109 TU/ml. Other methods of concentration such as ultrafiltration or binding to and elution from a matrix may be used.
In other embodiments the amount of lentivirus administered may be 1.Ć.105 or about 1.Ć.105 plaque forming units (PFU), 5.Ć.105 or about 5.Ć.105 PFU, 1.Ć.106 or about 1.Ć106 PFU, 5.Ć.106 or about 5.Ć.106 PFU, 1.Ć.107 or about 1.Ć.107PFU, 5.Ć.107 or about 5.Ć.107PFU, 1.Ć.108 or about 1.Ć.108 PFU, 5.Ć.108 or about 5.Ć.108 PFU, 1.Ć.109 or about 1.Ć.109PFU, 5.Ć.109 or about 5.Ć.109PFU, 1.Ć.1010 or about 1.Ć.1010 PFU or 5.Ć.1010 or about 5.Ć.1010 PFU as total single dosage for an average human of 75 kg or adjusted for the weight and size and species of the subject. One of skill in the art can determine suitable dosage. Suitable dosages for a virus can be determined empirically.
Also useful in the practice of the invention is an adenovirus vector. One advantage is the ability of recombinant adenoviruses to efficiently transfer and express recombinant genes in a variety of mammalian cells and tissues in vitro and in vivo, resulting in the high expression of the transferred nucleic acids. Further, the ability to productively infect quiescent cells, expands the utility of recombinant adenoviral vectors. In addition, high expression levels ensure that the products of the nucleic acids will be expressed to sufficient levels to generate an immune response (see e.g., U.S. Pat. No. 7,029,848, hereby incorporated by reference).
As to adenovirus vectors useful in the practice of the invention, mention is made of U.S. Pat. No. 6,955,808. The adenovirus vector used can be selected from the group consisting of the Ad5, Ad35, Ad11, C6, and C7 vectors. The sequence of the Adenovirus 5 (āAd5ā) genome has been published. (Chroboczek, J., Bieber, F., and Jacrot, B. (1992) The Sequence of the Genome of Adenovirus Type 5 and Its Comparison with the Genome of Adenovirus Type 2, Virology 186, 280-285; the contents if which is hereby incorporated by reference). Ad35 vectors are described in U.S. Pat. Nos. 6,974,695, 6,913,922, and 6,869,794. Ad11 vectors are described in U.S. Pat. No. 6,913,922. C6 adenovirus vectors are described in U.S. Pat. Nos. 6,780,407; 6,537,594; 6,309,647; 6,265,189; 6,156,567; 6,090,393; 5,942,235 and 5,833,975. C7 vectors are described in U.S. Pat. No. 6,277,558. Adenovirus vectors that are E1-defective or deleted, E3-defective or deleted, and/or E4-defective or deleted may also be used. Certain adenoviruses having mutations in the E1 region have improved safety margin because E1-defective adenovirus mutants are replication-defective in non-permissive cells, or, at the very least, are highly attenuated. Adenoviruses having mutations in the E3 region may have enhanced the immunogenicity by disrupting the mechanism whereby adenovirus down-regulates MHC class I molecules. Adenoviruses having E4 mutations may have reduced immunogenicity of the adenovirus vector because of suppression of late gene expression. Such vectors may be particularly useful when repeated re-vaccination utilizing the same vector is desired. Adenovirus vectors that are deleted or mutated in E1, E3, E4, E1 and E3, and E1 and E4 can be used in accordance with the present invention. Furthermore, āgutlessā adenovirus vectors, in which all viral genes are deleted, can also be used in accordance with the present invention. Such vectors require a helper virus for their replication and require a special human 293 cell line expressing both E1a and Cre, a condition that does not exist in natural environment. Such āgutlessā vectors are non-immunogenic and thus the vectors may be inoculated multiple times for re-vaccination. The āgutlessā adenovirus vectors can be used for insertion of heterologous inserts/genes such as the transgenes of the present invention, and can even be used for co-delivery of a large number of heterologous inserts/genes.
In an embodiment herein the delivery is via an adenovirus, which may be at a single booster dose containing at least 1Ć105 particles (also referred to as particle units, pu) of adenoviral vector. In an embodiment herein, the dose preferably is at least about 1Ć106 particles (for example, about 1Ć106-1Ć1012 particles), more preferably at least about 1Ć107 particles, more preferably at least about 1Ć108 particles (e.g., about 1Ć108-1Ć1011 particles or about 1Ć108-1Ć1012 particles), and most preferably at least about 1Ć109 particles (e.g., about 1Ć109-1Ć1010 particles or about 1Ć109-1Ć1012 particles), or even at least about 1Ć1010 particles (e.g., about 1Ć1010-1Ć1012 particles) of the adenoviral vector. Alternatively, the dose comprises no more than about 1Ć1014 particles, preferably no more than about 1Ć1013 particles, even more preferably no more than about 1Ć1012 particles, even more preferably no more than about 1Ć1011 particles, and most preferably no more than about 1Ć1010 particles (e.g., no more than about 1Ć109 articles). Thus, the dose may contain a single dose of adenoviral vector with, for example, about 1Ć106 particle units (pu), about 2Ć106 pu, about 4Ć106 pu, about 1Ć107 pu, about 2Ć107 pu, about 4Ć107 pu, about 1Ć108 pu, about 2Ć108 pu, about 4Ć108 pu, about 1Ć109 pu, about 2Ć109 pu, about 4Ć109 pu, about 1Ć1010 pu, about 2Ć1010 pu, about 4Ć1010 pu, about 1Ć1011 pu, about 2Ć1011 pu, about 4Ć1011 pu, about 1Ć1012 pu, about 2Ć1012 pu, or about 4Ć1012 pu of adenoviral vector. See, for example, the adenoviral vectors in U.S. Pat. No. 8,454,972 B2 to Nabel, et. al., granted on Jun. 4, 2013; incorporated by reference herein, and the dosages at col 29, lines 36-58 thereof. In an embodiment herein, the adenovirus is delivered via multiple doses.
In terms of in vivo delivery, AAV is advantageous over other viral vectors due to low toxicity and low probability of causing insertional mutagenesis because it doesn't integrate into the host genome. AAV has a packaging limit of 4.5 or 4.75 Kb. Constructs larger than 4.5 or 4.75 Kb result in significantly reduced virus production. There are many promoters that can be used to drive nucleic acid molecule expression. AAV ITR can serve as a promoter and is advantageous for eliminating the need for an additional promoter element. For ubiquitous expression, the following promoters can be used: CMV, CAG, CBh, PGK, SV40, Ferritin heavy or light chains, etc. For brain expression, the following promoters can be used: SynapsinI for all neurons, CaMKIIalpha for excitatory neurons, GAD67 or GAD65 or VGAT for GABAergic neurons, etc. Promoters used to drive RNA synthesis can include: Pol III promoters such as U6 or H1. The use of a Pol II promoter and intronic cassettes can be used to express guide RNA (gRNA).
With regard to AAV vectors useful in the practice of the invention, mention is made of U.S. Pat. Nos. 5,658,785, 7,115,391, 7,172,893, 6,953,690, 6,936,466, 6,924,128, 6,893,865, 6,793,926, 6,537,540, 6,475,769 and 6,258,595, and documents cited therein.
As to AAV, the AAV can be AAV1, AAV2, AAV5 or any combination thereof. One can select the AAV with regard to the cells to be targeted; e.g., one can select AAV serotypes 1, 2, 5 or a hybrid capsid AAV1, AAV2, AAV5 or any combination thereof for targeting brain or neuronal cells; and one can select AAV4 for targeting cardiac tissue. AAV8 is useful for delivery to the liver. The above promoters and vectors are preferred individually.
In an embodiment herein, the delivery is via an AAV. A therapeutically effective dosage for in vivo delivery of the AAV to a human is believed to be in the range of from about 20 to about 50 ml of saline solution containing from about 1Ć1010 to about 1Ć1050 functional AAV/ml solution. The dosage may be adjusted to balance the therapeutic benefit against any side effects. In an embodiment herein, the AAV dose is generally in the range of concentrations of from about 1Ć105 to 1Ć1050 genomes AAV, from about 1Ć108 to 1Ć1020 genomes AAV, from about 1Ć1010 to about 1Ć1016 genomes, or about 1Ć1011 to about 1Ć1016 genomes AAV. A human dosage may be about 1Ć1013 genomes AAV. Such concentrations may be delivered in from about 0.001 ml to about 100 ml, about 0.05 to about 50 ml, or about 10 to about 25 ml of a carrier solution. In a preferred embodiment, AAV is used with a titer of about 2Ć1013 viral genomes/milliliter, and each of the striatal hemispheres of a mouse receives one 500 nanoliter injection. Other effective dosages can be readily established by one of ordinary skill in the art through routine trials establishing dose response curves. See, for example, U.S. Pat. No. 8,404,658 B2 to Hajjar, et al., granted on Mar. 26, 2013, at col. 27, lines 45-60.
In another embodiment effectively activating a cellular immune response for a neoplasia vaccine or immunogenic composition can be achieved by expressing the relevant neoantigens in a vaccine or immunogenic composition in a non-pathogenic microorganism. Well-known examples of such microorganisms are Mycobacterium bovis BCG, Salmonella and Pseudomona (See, U.S. Pat. No. 6,991,797, hereby incorporated by reference in its entirety).
In another embodiment a Poxvirus is used in the neoplasia vaccine or immunogenic composition. These include orthopoxvirus, avipox, vaccinia, MVA, NYVAC, canarypox, ALVAC, fowlpox, TROVAC, etc. (see e.g., Verardiet al., Hum Vaccin Immunother. 2012 July; 8(7):961-70; and Moss, Vaccine. 2013; 31(39): 4220-4222). Poxvirus expression vectors were described in 1982 and quickly became widely used for vaccine development as well as research in numerous fields. Advantages of the vectors include simple construction, ability to accommodate large amounts of foreign DNA and high expression levels.
Information concerning poxviruses that may be used in the practice of the invention, such as Chordopoxvirinae subfamily poxviruses (poxviruses of vertebrates), for instance, orthopoxviruses and avipoxviruses, e.g., vaccinia virus (e.g., Wyeth Strain, WR Strain (e.g., ATCCĀ® VR-1354), Copenhagen Strain, NYVAC, NYVAC.1, NYVAC.2, MVA, MVA-BN), canarypox virus (e.g., Wheatley C93 Strain, ALVAC), fowlpox virus (e.g., FP9 Strain, Webster Strain, TROVAC), dovepox, pigeonpox, quailpox, and raccoon pox, inter alia, synthetic or non-naturally occurring recombinants thereof, uses thereof, and methods for making and using such recombinants may be found in scientific and patent literature, such as:
In another embodiment the vaccinia virus is used in the neoplasia vaccine or immunogenic composition to express a neoantigen. (Rolph et al., Recombinant viruses as vaccines and immunological tools. Curr Opin Immunol 9:517-524, 1997). The recombinant vaccinia virus is able to replicate within the cytoplasm of the infected host cell and the polypeptide of interest can therefore induce an immune response. Moreover, Poxviruses have been widely used as vaccine or immunogenic composition vectors because of their ability to target encoded antigens for processing by the major histocompatibility complex class I pathway by directly infecting immune cells, in particular antigen-presenting cells, but also due to their ability to self-adjuvant.
In another embodiment ALVAC is used as a vector in a neoplasia vaccine or immunogenic composition. ALVAC is a canarypox virus that can be modified to express foreign transgenes and has been used as a method for vaccination against both prokaryotic and eukaryotic antigens (Honig H, Lee D S, Conkright W, et al. Phase I clinical trial of a recombinant canarypoxvirus (ALVAC) vaccine expressing human carcinoembryonic antigen and the B7.1 co-stimulatory molecule. Cancer Immunol Immunother 2000; 49:504-14; von Mehren M, Arlen P, Tsang K Y, et al. Pilot study of a dual gene recombinant avipox vaccine containing both carcinoembryonic antigen (CEA) and B7.1 transgenes in patients with recurrent CEA-expressing adenocarcinomas. Clin Cancer Res 2000; 6:2219-28; Musey L, Ding Y, Elizaga M, et al. HIV-1 vaccination administered intramuscularly can induce both systemic and mucosal T cell immunity in HIV-1-uninfected individuals. J Immunol 2003; 171:1094-101; Paoletti E. Applications of pox virus vectors to vaccination: an update. Proc Natl Acad Sci USA 1996; 93:11349-53; U.S. Pat. No. 7,255,862). In a phase I clinical trial, an ALVAC virus expressing the tumor antigen CEA showed an excellent safety profile and resulted in increased CEA-specific T-cell responses in selected patients; objective clinical responses, however, were not observed (Marshall J L, Hawkins M J, Tsang K Y, et al. Phase I study in cancer patients of a replication-defective avipox recombinant vaccine that expresses human carcinoembryonic antigen. J Clin Oncol 1999; 17:332-7).
In another embodiment a Modified Vaccinia Ankara (MVA) virus may be used as a viral vector for a neoantigen vaccine or immunogenic composition. MVA is a member of the Orthopoxvirus family and has been generated by about 570 serial passages on chicken embryo fibroblasts of the Ankara strain of Vaccinia virus (CVA) (for review see Mayr, A., et al., Infection 3, 6-14, 1975). As a consequence of these passages, the resulting MVA virus contains 31 kilobases less genomic information compared to CVA, and is highly host-cell restricted (Meyer, H. et al., J. Gen. Virol. 72, 1031-1038, 1991). MVA is characterized by its extreme attenuation, namely, by a diminished virulence or infectious ability, but still holds an excellent immunogenicity. When tested in a variety of animal models, MVA was proven to be avirulent, even in immuno-suppressed individuals. Moreover, MVA-BNĀ®-HER2 is a candidate immunotherapy designed for the treatment of HER-2-positive breast cancer and is currently in clinical trials. (Mandl et al., Cancer Immunol Immunother. January 2012; 61(1): 19-29). Methods to make and use recombinant MVA has been described (e.g., see U.S. Pat. Nos. 8,309,098 and 5,185,146 hereby incorporated in its entirety).
In another embodiment the modified Copenhagen strain of vaccinia virus, NYVAC and NYVAC variations are used as a vector (see U.S. Pat. No. 7,255,862; PCT WO 95/30018; U.S. Pat. Nos. 5,364,773 and 5,494,807, hereby incorporated by reference in its entirety).
In one embodiment recombinant viral particles of the vaccine or immunogenic composition are administered to patients in need thereof. Dosages of expressed neoantigen can range from a few to a few hundred micrograms, e.g., 5 to 500. mu.g. The vaccine or immunogenic composition can be administered in any suitable amount to achieve expression at these dosage levels. The viral particles can be administered to a patient in need thereof or transfected into cells in an amount of about at least 103.5 pfu; thus, the viral particles are preferably administered to a patient in need thereof or infected or transfected into cells in at least about 104 pfu to about 106 pfu; however, a patient in need thereof can be administered at least about 108 pfu such that a more preferred amount for administration can be at least about 107 pfu to about 109 pfu. Doses as to NYVAC are applicable as to ALVAC, MVA, MVA-BN, and avipoxes, such as canarypox and fowlpox.
Effective vaccine or immunogenic compositions advantageously include a strong adjuvant to initiate an immune response. As described herein, poly-ICLC, an agonist of TLR3 and the RNA helicase-domains of MDA5 and RIG3, has shown several desirable properties for a vaccine or immunogenic composition adjuvant. These properties include the induction of local and systemic activation of immune cells in vivo, production of stimulatory chemokines and cytokines, and stimulation of antigen-presentation by DCs. Furthermore, poly-ICLC can induce durable CD4+ and CD8+ responses in humans. Importantly, striking similarities in the upregulation of transcriptional and signal transduction pathways were seen in subjects vaccinated with poly-ICLC and in volunteers who had received the highly effective, replication-competent yellow fever vaccine. Furthermore, >90% of ovarian carcinoma patients immunized with poly-ICLC in combination with a NY-ESO-1 peptide vaccine (in addition to Montanide) showed induction of CD4+ and CD8+ T cell, as well as antibody responses to the peptide in a recent phase 1 study. At the same time, poly-ICLC has been extensively tested in more than 25 clinical trials to date and exhibited a relatively benign toxicity profile. In addition to a powerful and specific immunogen the neoantigen peptides may be combined with an adjuvant (e.g., poly-ICLC) or another anti-neoplastic agent. Without being bound by theory, these neoantigens are expected to bypass central thymic tolerance (thus allowing stronger anti-tumor T cell response), while reducing the potential for autoimmunity (e.g., by avoiding targeting of normal self-antigens). An effective immune response advantageously includes a strong adjuvant to activate the immune system (Speiser and Romero, Molecularly defined vaccines for cancer immunotherapy, and protective T cell immunity Seminars in Immunol 22:144 (2010)). For example, Toll-like receptors (TLRs) have emerged as powerful sensors of microbial and viral pathogen ādanger signalsā, effectively inducing the innate immune system, and in turn, the adaptive immune system (Bhardwaj and Gnjatic, TLR AGONISTS: Are They Good Adjuvants? Cancer J. 16:382-391 (2010)). Among the TLR agonists, poly-ICLC (a synthetic double-stranded RNA mimic) is one of the most potent activators of myeloid-derived dendritic cells. In a human volunteer study, poly-ICLC has been shown to be safe and to induce a gene expression profile in peripheral blood cells comparable to that induced by one of the most potent live attenuated viral vaccines, the yellow fever vaccine YF-17D (Caskey et al, Synthetic double-stranded RNA induces innate immune responses similar to a live viral vaccine in humans J Exp Med 208:2357 (2011)). In a preferred embodiment HiltonolĀ®, a GMP preparation of poly-ICLC prepared by Oncovir, Inc, is utilized as the adjuvant. In other embodiments, other adjuvants described herein are envisioned. For instance oil-in-water, water-in-oil or multiphasic W/O/W; see, e.g., U.S. Pat. No. 7,608,279 and Aucouturier et al, Vaccine 19 (2001), 2666-2672, and documents cited therein.
Examples of cancers and cancer conditions that can be treated with the therapy of this document include, but are not limited to a patient in need thereof that has been diagnosed as having cancer, or at risk of developing cancer. The subject may have a solid tumor such as breast, ovarian, prostate, lung, kidney, gastric, colon, testicular, head and neck, pancreas, brain, melanoma, and other tumors of tissue organs and hematological tumors, such as lymphomas and leukemias, including acute myelogenous leukemia, chronic myelogenous leukemia, chronic lymphocytic leukemia, T cell lymphocytic leukemia, and B cell lymphomas, tumors of the brain and central nervous system (e.g., tumors of the meninges, brain, spinal cord, cranial nerves and other parts of the CNS, such as glioblastomas or medulla blastomas); head and/or neck cancer, breast tumors, tumors of the circulatory system (e.g., heart, mediastinum and pleura, and other intrathoracic organs, vascular tumors, and tumor-associated vascular tissue); tumors of the blood and lymphatic system (e.g., Hodgkin's disease, Non-Hodgkin's disease lymphoma, Burkitt's lymphoma, AIDS-related lymphomas, malignant immunoproliferative diseases, multiple myeloma, and malignant plasma cell neoplasms, lymphoid leukemia, myeloid leukemia, acute or chronic lymphocytic leukemia, monocytic leukemia, other leukemias of specific cell type, leukemia of unspecified cell type, unspecified malignant neoplasms of lymphoid, hematopoietic and related tissues, such as diffuse large cell lymphoma, T-cell lymphoma or cutaneous T-cell lymphoma); tumors of the excretory system (e.g., kidney, renal pelvis, ureter, bladder, and other urinary organs); tumors of the gastrointestinal tract (e.g., esophagus, stomach, small intestine, colon, colorectal, rectosigmoid junction, rectum, anus, and anal canal); tumors involving the liver and intrahepatic bile ducts, gall bladder, and other parts of the biliary tract, pancreas, and other digestive organs; tumors of the oral cavity (e.g., lip, tongue, gum, floor of mouth, palate, parotid gland, salivary glands, tonsil, oropharynx, nasopharynx, puriform sinus, hypopharynx, and other sites of the oral cavity); tumors of the reproductive system (e.g., vulva, vagina, Cervix uteri, uterus, ovary, and other sites associated with female genital organs, placenta, penis, prostate, testis, and other sites associated with male genital organs); tumors of the respiratory tract (e.g., nasal cavity, middle ear, accessory sinuses, larynx, trachea, bronchus and lung, such as small cell lung cancer and non-small cell lung cancer); tumors of the skeletal system (e.g., bone and articular cartilage of limbs, bone articular cartilage and other sites); tumors of the skin (e.g., malignant melanoma of the skin, non-melanoma skin cancer, basal cell carcinoma of skin, squamous cell carcinoma of skin, mesothelioma, Kaposi's sarcoma); and tumors involving other tissues including peripheral nerves and autonomic nervous system, connective and soft tissue, retroperitoneoum and peritoneum, eye, thyroid, adrenal gland, and other endocrine glands and related structures, secondary and unspecified malignant neoplasms of lymph nodes, secondary malignant neoplasm of respiratory and digestive systems and secondary malignant neoplasm of other sites. Thus the population of subjects described herein may be suffering from one of the above cancer types. In other embodiments, the population of subjects may be all subjects suffering from solid tumors, or all subjects suffering from liquid tumors.
Of special interest is the treatment of Non-Hodgkin's Lymphoma (NHL), clear cell Renal Cell Carcinoma (ccRCC), metastatic melanoma, sarcoma, leukemia or a cancer of the bladder, colon, brain, breast, head and neck, endometrium, lung, ovary, pancreas or prostate. In certain embodiments, the melanoma is high risk melanoma.
Cancers that can be treated using the therapy described herein may include among others cases which are refractory to treatment with other chemotherapeutics. The term ārefractory, as used herein refers to a cancer (and/or metastases thereof), which shows no or only weak antiproliferative response (e.g., no or only weak inhibition of tumor growth) after treatment with another chemotherapeutic agent. These are cancers that cannot be treated satisfactorily with other chemotherapeutics. Refractory cancers encompass not only (i) cancers where one or more chemotherapeutics have already failed during treatment of a patient, but also (ii) cancers that can be shown to be refractory by other means, e.g., biopsy and culture in the presence of chemotherapeutics.
The therapy described herein is also applicable to the treatment of patients in need thereof who have not been previously treated.
The therapy described herein is also applicable where the subject has no detectable neoplasia but is at high risk for disease recurrence.
Also of special interest is the treatment of patients in need thereof who have undergone Autologous Hematopoietic Stem Cell Transplant (AHSCT), and in particular patients who demonstrate residual disease after undergoing AHSCT. The post-AHSCT setting is characterized by a low volume of residual disease, the infusion of immune cells to a situation of homeostatic expansion, and the absence of any standard relapse-delaying therapy. These features provide a unique opportunity to use the claimed neoplastic vaccine or immunogenic composition compositions to delay disease relapse.
The present invention is also directed to pharmaceutical compositions comprising an effective amount of one or more neoantigenic peptides as described herein (including a pharmaceutically acceptable salt, thereof), optionally in combination with a pharmaceutically acceptable carrier, excipient or additive.
When administered as a combination, the therapeutic agents (i.e. the neoantigenic peptides) can be formulated as separate compositions that are given at the same time or different times, or the therapeutic agents can be given as a single composition.
The compositions may be administered once daily, twice daily, once every two days, once every three days, once every four days, once every five days, once every six days, once every seven days, once every two weeks, once every three weeks, once every four weeks, once every two months, once every six months, or once per year. The dosing interval can be adjusted according to the needs of individual patients. For longer intervals of administration, extended release or depot formulations can be used.
The compositions of the invention can be used to treat diseases and disease conditions that are acute, and may also be used for treatment of chronic conditions. In particular, the compositions of the invention are used in methods to treat or prevent a neoplasia. In certain embodiments, the compounds of the invention are administered for time periods exceeding two weeks, three weeks, one month, two months, three months, four months, five months, six months, one year, two years, three years, four years, or five years, ten years, or fifteen years; or for example, any time period range in days, months or years in which the low end of the range is any time period between 14 days and 15 years and the upper end of the range is between 15 days and 20 years (e.g., 4 weeks and 15 years, 6 months and 20 years). In some cases, it may be advantageous for the compounds of the invention to be administered for the remainder of the patient's life. In preferred embodiments, the patient is monitored to check the progression of the disease or disorder, and the dose is adjusted accordingly. In preferred embodiments, treatment according to the invention is effective for at least two weeks, three weeks, one month, two months, three months, four months, five months, six months, one year, two years, three years, four years, or five years, ten years, fifteen years, twenty years, or for the remainder of the subject's life.
Surgical resection uses surgery to remove abnormal tissue in cancer, such as mediastinal, neurogenic, or germ cell tumors, or thymoma. In certain embodiments, administration of the composition is initiated following tumor resection. In other embodiments, administration of the neoplasia vaccine or immunogenic composition is initiated 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15 or more weeks after tumor resection. Preferably, administration of the neoplasia vaccine or immunogenic composition is initiated 4, 5, 6, 7, 8, 9, 10, 11 or 12 weeks after tumor resection.
Prime/boost regimens refer to the successive administrations of a vaccine or immunogenic or immunological compositions. In certain embodiments, administration of the neoplasia vaccine or immunogenic composition is in a prime/boost dosing regimen, for example administration of the neoplasia vaccine or immunogenic composition at weeks 1, 2, 3 or 4 as a prime and administration of the neoplasia vaccine or immunogenic composition is at months 2, 3 or 4 as a boost. In another embodiment heterologous prime-boost strategies are used to ellicit a greater cytotoxic T-cell response (see Schneider et al., Induction of CD8+ T cells using heterologous prime-boost immunisation strategies, Immunological Reviews Volume 170, Issue 1, pages 29-38, August 1999). In another embodiment DNA encoding neoantigens is used to prime followed by a protein boost. In another embodiment protein is used to prime followed by boosting with a virus encoding the neoantigen. In another embodiment a virus encoding the neoantigen is used to prime and another virus is used to boost. In another embodiment protein is used to prime and DNA is used to boost. In a preferred embodiment a DNA vaccine or immunogenic composition is used to prime a T-cell response and a recombinant viral vaccine or immunogenic composition is used to boost the response. In another preferred embodiment a viral vaccine or immunogenic composition is coadministered with a protein or DNA vaccine or immunogenic composition to act as an adjuvant for the protein or DNA vaccine or immunogenic composition. The patient can then be boosted with either the viral vaccine or immunogenic composition, protein, or DNA vaccine or immunogenic composition (see Hutchings et al., Combination of protein and viral vaccines induces potent cellular and humoral immune responses and enhanced protection from murine malaria challenge. Infect Immun. 2007 December; 75(12):5819-26. Epub 2007 Oct. 1).
The pharmaceutical compositions can be processed in accordance with conventional methods of pharmacy to produce medicinal agents for administration to patients in need thereof, including humans and other mammals.
Modifications of the neoantigenic peptides can affect the solubility, bioavailability and rate of metabolism of the peptides, thus providing control over the delivery of the active species. Solubility can be assessed by preparing the neoantigenic peptide and testing according to known methods well within the routine practitioner's skill in the art.
In certain embodiments of the pharmaceutical composition the pharmaceutically acceptable carrier comprises water. In certain embodiments, the pharmaceutically acceptable carrier further comprises dextrose. In certain embodiments, the pharmaceutically acceptable carrier further comprises dimethylsulfoxide. In certain embodiments, the pharmaceutical composition further comprises an immunomodulator or adjuvant. In certain embodiments, the immunodulator or adjuvant is selected from the group consisting of poly-ICLC, STING agonist, 1018 ISS, aluminum salts, Amplivax, AS15, BCG, CP-870,893, CpG7909, CyaA, dSLIM, GM-CSF, IC30, IC31, Imiquimod, ImuFact IMP321, IS Patch, ISS, ISCOMATRIX, Juvlmmune, LipoVac, MF59, monophosphoryl lipid A, Montanide IMS 1312, Montanide ISA 206, Montanide ISA 50V, Montanide ISA-51, OK-432, OM-174, OM-197-MP-EC, ONTAK, PEPTEL, vector system, PLGA microparticles, resiquimod, SRL172, Virosomes and other Virus-like particles, YF-17D, VEGF trap, R848, beta-glucan, Pam3Cys, and Aquila's QS21 stimulon. In certain embodiments, the immunomodulator or adjuvant comprises poly-ICLC.
Xanthenone derivatives such as, for example, Vadimezan or AsA404 (also known as 5,6-dimethylaxanthenone-4-acetic acid (DMXAA)), may also be used as adjuvants according to embodiments of the invention. Alternatively, such derivatives may also be administered in parallel to the vaccine or immunogenic composition of the invention, for example via systemic or intratumoral delivery, to stimulate immunity at the tumor site. Without being bound by theory, it is believed that such xanthenone derivatives act by stimulating interferon (IFN) production via the stimulator of IFN gene ISTING) receptor (see e.g., Conlon et al. (2013) Mouse, but not Human STING, Binds and Signals in Response to the Vascular Disrupting Agent 5,6-Dimethylxanthenone-4-Acetic Acid, Journal of Immunology, 190:5216-25 and Kim et al. (2013) Anticancer Flavonoids are Mouse-Selective STING Agonists, 8:1396-1401).
The vaccine or immunological composition may also include an adjuvant compound chosen from the acrylic or methacrylic polymers and the copolymers of maleic anhydride and an alkenyl derivative. It is in particular a polymer of acrylic or methacrylic acid cross-linked with a polyalkenyl ether of a sugar or polyalcohol (carbomer), in particular cross-linked with an allyl sucrose or with allylpentaerythritol. It may also be a copolymer of maleic anhydride and ethylene cross-linked, for example, with divinyl ether (see U.S. Pat. No. 6,713,068 hereby incorporated by reference in its entirety).
In certain embodiments, the pH modifier can stabilize the adjuvant or immunomodulator as described herein.
In certain embodiments, a pharmaceutical composition comprises: one to five peptides, dimethylsulfoxide (DMSO), dextrose, water, succinate, poly I: poly C, poly-L-lysine, carboxymethylcellulose, and chloride. In certain embodiments, each of the one to five peptides is present at a concentration of 300 μg/ml. In certain embodiments, the pharmaceutical composition comprises ā¤3% DMSO by volume. In certain embodiments, the pharmaceutical composition comprises 3.6-3.7% dextrose in water. In certain embodiments, the pharmaceutical composition comprises 3.6-3.7 mM succinate (e.g., as sodium succinate) or a salt thereof. In certain embodiments, the pharmaceutical composition comprises 0.5 mg/ml poly I: poly C. In certain embodiments, the pharmaceutical composition comprises 0.375 mg/ml poly-L-Lysine. In certain embodiments, the pharmaceutical composition comprises 1.25 mg/ml sodium carboxymethylcellulose. In certain embodiments, the pharmaceutical composition comprises 0.225% sodium chloride.
Pharmaceutical compositions comprise the herein-described tumor specific neoantigenic peptides in a therapeutically effective amount for treating diseases and conditions (e.g., a neoplasia/tumor), which have been described herein, optionally in combination with a pharmaceutically acceptable additive, carrier and/or excipient. One of ordinary skill in the art from this disclosure and the knowledge in the art will recognize that a therapeutically effective amount of one of more compounds according to the present invention may vary with the condition to be treated, its severity, the treatment regimen to be employed, the pharmacokinetics of the agent used, as well as the patient (animal or human) treated.
To prepare the pharmaceutical compositions according to the present invention, a therapeutically effective amount of one or more of the compounds according to the present invention is preferably intimately admixed with a pharmaceutically acceptable carrier according to conventional pharmaceutical compounding techniques to produce a dose. A carrier may take a wide variety of forms depending on the form of preparation desired for administration, e.g., ocular, oral, topical or parenteral, including gels, creams ointments, lotions and time released implantable preparations, among numerous others. In preparing pharmaceutical compositions in oral dosage form, any of the usual pharmaceutical media may be used. Thus, for liquid oral preparations such as suspensions, elixirs and solutions, suitable carriers and additives including water, glycols, oils, alcohols, flavoring agents, preservatives, coloring agents and the like may be used. For solid oral preparations such as powders, tablets, capsules, and for solid preparations such as suppositories, suitable carriers and additives including starches, sugar carriers, such as dextrose, mannitol, lactose and related carriers, diluents, granulating agents, lubricants, binders, disintegrating agents and the like may be used. If desired, the tablets or capsules may be enteric-coated or sustained release by standard techniques.
The active compound is included in the pharmaceutically acceptable carrier or diluent in an amount sufficient to deliver to a patient a therapeutically effective amount for the desired indication, without causing serious toxic effects in the patient treated.
Oral compositions generally include an inert diluent or an edible carrier. They may be enclosed in gelatin capsules or compressed into tablets. For the purpose of oral therapeutic administration, the active compound or its prodrug derivative can be incorporated with excipients and used in the form of tablets, troches, or capsules. Pharmaceutically compatible binding agents, and/or adjuvant materials can be included as part of the composition.
The tablets, pills, capsules, troches and the like can contain any of the following ingredients, or compounds of a similar nature: a binder such as microcrystalline cellulose, gum tragacanth or gelatin; an excipient such as starch or lactose, a dispersing agent such as alginic acid or corn starch; a lubricant such as magnesium stearate; a glidant such as colloidal silicon dioxide; a sweetening agent such as sucrose or saccharin; or a flavoring agent such as peppermint, methyl salicylate, or orange flavoring. When the dosage unit form is a capsule, it can contain, in addition to material herein discussed, a liquid carrier such as a fatty oil. In addition, dosage unit forms can contain various other materials which modify the physical form of the dosage unit, for example, coatings of sugar, shellac, or enteric agents.
Formulations of the present invention suitable for oral administration may be presented as discrete units such as capsules, cachets or tablets each containing a predetermined amount of the active ingredient; as a powder or granules; as a solution or a suspension in an aqueous liquid or a non-aqueous liquid; or as an oil-in-water liquid emulsion or a water-in-oil emulsion and as a bolus, etc.
A tablet may be made by compression or molding, optionally with one or more accessory ingredients. Compressed tablets may be prepared by compressing in a suitable machine the active ingredient in a free-flowing form such as a powder or granules, optionally mixed with a binder, lubricant, inert diluent, preservative, surface-active or dispersing agent. Molded tablets may be made by molding in a suitable machine a mixture of the powdered compound moistened with an inert liquid diluent. The tablets optionally may be coated or scored and may be formulated so as to provide slow or controlled release of the active ingredient therein.
Methods of formulating such slow or controlled release compositions of pharmaceutically active ingredients, are known in the art and described in several issued US Patents, some of which include, but are not limited to, U.S. Pat. Nos. 3,870,790; 4,226,859; 4,369,172; 4,842,866 and 5,705,190, the disclosures of which are incorporated herein by reference in their entireties. Coatings can be used for delivery of compounds to the intestine (see, e.g., U.S. Pat. Nos. 6,638,534, 5,541,171, 5,217,720, and 6,569,457, and references cited therein).
The active compound or pharmaceutically acceptable salt thereof may also be administered as a component of an elixir, suspension, syrup, wafer, chewing gum or the like. A syrup may contain, in addition to the active compounds, sucrose or fructose as a sweetening agent and certain preservatives, dyes and colorings and flavors.
Solutions or suspensions used for ocular, parenteral, intradermal, subcutaneous, or topical application can include the following components: a sterile diluent such as water for injection, saline solution, fixed oils, polyethylene glycols, glycerine, propylene glycol or other synthetic solvents; antibacterial agents such as benzyl alcohol or methyl parabens; antioxidants such as ascorbic acid or sodium bisulfite; chelating agents such as ethylenediaminetetraacetic acid; buffers such as acetates, citrates or phosphates; and agents for the adjustment of tonicity such as sodium chloride or dextrose.
In certain embodiments, the pharmaceutically acceptable carrier is an aqueous solvent, i.e., a solvent comprising water, optionally with additional co-solvents. Exemplary pharmaceutically acceptable carriers include water, buffer solutions in water (such as phosphate-buffered saline (PBS), and 5% dextrose in water (D5W). In certain embodiments, the aqueous solvent further comprises dimethyl sulfoxide (DMSO), e.g., in an amount of about 1-4%, or 1-3%. In certain embodiments, the pharmaceutically acceptable carrier is isotonic (i.e., has substantially the same osmotic pressure as a body fluid such as plasma).
In one embodiment, the active compounds are prepared with carriers that protect the compound against rapid elimination from the body, such as a controlled release formulation, including implants and microencapsulated delivery systems. Biodegradable, biocompatible polymers can be used, such as ethylene vinyl acetate, polyanhydrides, polyglycolic acid, collagen, polyorthoesters, polylactic acid, and polylactic-co-glycolic acid (PLGA). Methods for preparation of such formulations are within the ambit of the skilled artisan in view of this disclosure and the knowledge in the art.
A skilled artisan from this disclosure and the knowledge in the art recognizes that in addition to tablets, other dosage forms can be formulated to provide slow or controlled release of the active ingredient. Such dosage forms include, but are not limited to, capsules, granulations and gel-caps.
Liposomal suspensions may also be pharmaceutically acceptable carriers. These may be prepared according to methods known to those skilled in the art. For example, liposomal formulations may be prepared by dissolving appropriate lipid(s) in an inorganic solvent that is then evaporated, leaving behind a thin film of dried lipid on the surface of the container. An aqueous solution of the active compound are then introduced into the container. The container is then swirled by hand to free lipid material from the sides of the container and to disperse lipid aggregates, thereby forming the liposomal suspension. Other methods of preparation well known by those of ordinary skill may also be used in this aspect of the present invention.
The formulations may conveniently be presented in unit dosage form and may be prepared by conventional pharmaceutical techniques. Such techniques include the step of bringing into association the active ingredient and the pharmaceutical carrier(s) or excipient(s). In general, the formulations are prepared by uniformly and intimately bringing into association the active ingredient with liquid carriers or finely divided solid carriers or both, and then, if necessary, shaping the product.
Formulations and compositions suitable for topical administration in the mouth include lozenges comprising the ingredients in a flavored basis, usually sucrose and acacia or tragacanth; pastilles comprising the active ingredient in an inert basis such as gelatin and glycerin, or sucrose and acacia; and mouthwashes comprising the ingredient to be administered in a suitable liquid carrier.
Formulations suitable for topical administration to the skin may be presented as ointments, creams, gels and pastes comprising the ingredient to be administered in a pharmaceutical acceptable carrier. A preferred topical delivery system is a transdermal patch containing the ingredient to be administered.
Formulations for rectal administration may be presented as a suppository with a suitable base comprising, for example, cocoa butter or a salicylate.
Formulations suitable for nasal administration, wherein the carrier is a solid, include a coarse powder having a particle size, for example, in the range of 20 to 500 microns which is administered in the manner in which snuff is administered, i.e., by rapid inhalation through the nasal passage from a container of the powder held close up to the nose. Suitable formulations, wherein the carrier is a liquid, for administration, as for example, a nasal spray or as nasal drops, include aqueous or oily solutions of the active ingredient.
Formulations suitable for vaginal administration may be presented as pessaries, tampons, creams, gels, pastes, foams or spray formulations containing in addition to the active ingredient such carriers as are known in the art to be appropriate.
The parenteral preparation can be enclosed in ampoules, disposable syringes or multiple dose vials made of glass or plastic. If administered intravenously, preferred carriers include, for example, physiological saline or phosphate buffered saline (PBS).
For parenteral formulations, the carrier usually comprises sterile water or aqueous sodium chloride solution, though other ingredients including those which aid dispersion may be included. Of course, where sterile water is to be used and maintained as sterile, the compositions and carriers are also sterilized. Injectable suspensions may also be prepared, in which case appropriate liquid carriers, suspending agents and the like may be employed.
Formulations suitable for parenteral administration include aqueous and non-aqueous sterile injection solutions which may contain antioxidants, buffers, bacteriostats and solutes which render the formulation isotonic with the blood of the intended recipient; and aqueous and non-aqueous sterile suspensions which may include suspending agents and thickening agents. The formulations may be presented in unit-dose or multi-dose containers, for example, sealed ampules and vials, and may be stored in a freeze-dried (lyophilized) condition requiring only the addition of the sterile liquid carrier, for example, water for injections, immediately prior to use. Extemporaneous injection solutions and suspensions may be prepared from sterile powders, granules and tablets of the kind previously described.
Administration of the active compound may range from continuous (intravenous drip) to several oral administrations per day (for example, Q.I.D.) and may include oral, topical, eye or ocular, parenteral, intramuscular, intravenous, sub-cutaneous, transdermal (which may include a penetration enhancement agent), buccal and suppository administration, among other routes of administration, including through an eye or ocular route.
The neoplasia vaccine or immunogenic composition, and any additional agents, may be administered by injection, orally, parenterally, by inhalation spray, rectally, vaginally, or topically in dosage unit formulations containing conventional pharmaceutically acceptable carriers, adjuvants, and vehicles. The term parenteral as used herein includes, into a lymph node or nodes, subcutaneous, intravenous, intramuscular, intrasternal, infusion techniques, intraperitoneally, eye or ocular, intravitreal, intrabuccal, transdermal, intranasal, into the brain, including intracranial and intradural, into the joints, including ankles, knees, hips, shoulders, elbows, wrists, directly into tumors, and the like, and in suppository form.
In certain embodiments, the vaccine or immunogenic composition is administered intravenously or subcutaneously. Various techniques can be used for providing the subject compositions at the site of interest, such as injection, use of catheters, trocars, projectiles, pluronic gel, stents, sustained drug release polymers or other device which provides for internal access. Where an organ or tissue is accessible because of removal from the patient, such organ or tissue may be bathed in a medium containing the subject compositions, the subject compositions may be painted onto the organ, or may be applied in any convenient way.
The tumor specific neoantigenic peptides may be administered through a device suitable for the controlled and sustained release of a composition effective in obtaining a desired local or systemic physiological or pharmacological effect. The method includes positioning the sustained released drug delivery system at an area wherein release of the agent is desired and allowing the agent to pass through the device to the desired area of treatment.
The tumor specific neoantigenic peptides may be utilized in combination with at least one known other therapeutic agent, or a pharmaceutically acceptable salt of said agent. Examples of known therapeutic agents which can be used for combination therapy include, but are not limited to, corticosteroids (e.g., cortisone, prednisone, dexamethasone), non-steroidal anti-inflammatory drugs (NSAIDS) (e.g., ibuprofen, celecoxib, aspirin, indomethicin, naproxen), alkylating agents such as busulfan, cis-platin, mitomycin C, and carboplatin; antimitotic agents such as colchicine, vinblastine, paclitaxel, and docetaxel; topo I inhibitors such as camptothecin and topotecan; topo II inhibitors such as doxorubicin and etoposide; and/or RNA/DNA antimetabolites such as 5-azacytidine, 5-fluorouracil and methotrexate; DNA antimetabolites such as 5-fluoro-2ā²-deoxyuridine, ara-C, hydroxyurea and thioguanine; antibodies such as HERCEPTIN and RITUXAN.
It should be understood that in addition to the ingredients particularly mentioned herein, the formulations of the present invention may include other agents conventional in the art having regard to the type of formulation in question, for example, those suitable for oral administration may include flavoring agents.
Pharmaceutically acceptable salt forms may be the preferred chemical form of compounds according to the present invention for inclusion in pharmaceutical compositions according to the present invention.
The present compounds or their derivatives, including prodrug forms of these agents, can be provided in the form of pharmaceutically acceptable salts. As used herein, the term pharmaceutically acceptable salts or complexes refers to appropriate salts or complexes of the active compounds according to the present invention which retain the desired biological activity of the parent compound and exhibit limited toxicological effects to normal cells. Nonlimiting examples of such salts are (a) acid addition salts formed with inorganic acids (for example, hydrochloric acid, hydrobromic acid, sulfuric acid, phosphoric acid, nitric acid, and the like), and salts formed with organic acids such as acetic acid, oxalic acid, tartaric acid, succinic acid, malic acid, ascorbic acid, benzoic acid, tannic acid, pamoic acid, alginic acid, and polyglutamic acid, among others; (b) base addition salts formed with metal cations such as zinc, calcium, sodium, potassium, and the like, among numerous others.
The compounds herein are commercially available or can be synthesized. As can be appreciated by the skilled artisan, further methods of synthesizing the compounds of the formulae herein is evident to those of ordinary skill in the art. Additionally, the various synthetic steps may be performed in an alternate sequence or order to give the desired compounds. Synthetic chemistry transformations and protecting group methodologies (protection and deprotection) useful in synthesizing the compounds described herein are known in the art and include, for example, those such as described in R. Larock, Comprehensive Organic Transformations, 2nd. Ed., Wiley-VCH Publishers (1999); T. W. Greene and P.G.M. Wuts, Protective Groups in Organic Synthesis, 3rd. Ed., John Wiley and Sons (1999); L. Fieser and M. Fieser, Fieser and Fieser's Reagents for Organic Synthesis, John Wiley and Sons (1999); and L. Paquette, ed., Encyclopedia of Reagents for Organic Synthesis, John Wiley and Sons (1995), and subsequent editions thereof.
The additional agents that may be included with the tumor specific neo-antigenic peptides of this invention may contain one or more asymmetric centers and thus occur as racemates and racemic mixtures, single enantiomers, individual diastereomers and diastereomeric mixtures. All such isomeric forms of these compounds are expressly included in the present invention. The compounds of this invention may also be represented in multiple tautomeric forms, in such instances, the invention expressly includes all tautomeric forms of the compounds described herein (e.g., alkylation of a ring system may result in alkylation at multiple sites, the invention expressly includes all such reaction products). All such isomeric forms of such compounds are expressly included in the present invention. All crystal forms of the compounds described herein are expressly included in the present invention.
When the agents described herein are administered as pharmaceuticals to humans or animals, they can be given per se or as a pharmaceutical composition containing active ingredient in combination with a pharmaceutically acceptable carrier, excipient, or diluent.
Actual dosage levels and time course of administration of the active ingredients in the pharmaceutical compositions of the invention can be varied so as to obtain an amount of the active ingredient which is effective to achieve the desired therapeutic response for a particular patient, composition, and mode of administration, without being toxic to the patient. Generally, agents or pharmaceutical compositions of the invention are administered in an amount sufficient to reduce or eliminate symptoms associated with neoplasia, e.g. cancer or tumors.
A preferred dose of an agent is the maximum that a patient can tolerate and not develop serious or unacceptable side effects. Exemplary dose ranges include 0.01 mg to 250 mg per day, 0.01 mg to 100 mg per day, 1 mg to 100 mg per day, 10 mg to 100 mg per day, 1 mg to 10 mg per day, and 0.01 mg to 10 mg per day. A preferred dose of an agent is the maximum that a patient can tolerate and not develop serious or unacceptable side effects. In embodiments, the agent is administered at a concentration of about 10 micrograms to about 100 mg per kilogram of body weight per day, about 0.1 to about 10 mg/kg per day, or about 1.0 mg to about 10 mg/kg of body weight per day.
In embodiments, the pharmaceutical composition comprises an agent in an amount ranging between 1 and 10 mg, such as 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10 mg.
In embodiments, the therapeutically effective dosage produces a serum concentration of an agent of from about 0.1 ng/ml to about 50-100 mg/ml. The pharmaceutical compositions 5 typically should provide a dosage of from about 0.001 mg to about 2000 mg of compound per kilogram of body weight per day. For example, dosages for systemic administration to a human patient can range from 1-10 mg/kg, 20-80 mg/kg, 5-50 mg/kg, 75-150 mg/kg, 100-500 mg/kg, 250-750 mg/kg, 500-1000 mg/kg, 1-10 mg/kg, 5-50 mg/kg, 25-75 mg/kg, 50-100 mg/kg, 100-250 mg/kg, 50-100 mg/kg, 250-500 mg/kg, 500-750 mg/kg, 750-1000 mg/kg, 1000-1500 mg/kg, 10 1500-2000 mg/kg, 5 mg/kg, 20 mg/kg, 50 mg/kg, 100 mg/kg, 500 mg/kg, 1000 mg/kg, 1500 mg/kg, or 2000 mg/kg. Pharmaceutical dosage unit forms are prepared to provide from about 1 mg to about 5000 mg, for example from about 100 to about 2500 mg of the compound or a combination of essential ingredients per dosage unit form.
In embodiments, about 50 nM to about 1 μM of an agent is administered to a subject. In related embodiments, about 50-100 nM, 50-250 nM, 100-500 nM, 250-500 nM, 250-750 nM, 500-750 nM, 500 nM to 1 μM, or 750 nM to 1 μM of an agent is administered to a subject.
Determination of an effective amount is well within the capability of those skilled in the art, especially in light of the detailed disclosure provided herein. Generally, an efficacious or effective amount of an agent is determined by first administering a low dose of the agent(s) and then incrementally increasing the administered dose or dosages until a desired effect (e.g., reduce or eliminate symptoms associated with viral infection or autoimmune disease) is observed in the treated subject, with minimal or acceptable toxic side effects. Applicable methods for determining an appropriate dose and dosing schedule for administration of a pharmaceutical composition of the present invention are described, for example, in Goodman and Gilman's The Pharmacological Basis of Therapeutics, Goodman et al., eds., 11th Edition, McGraw-Hill 2005, and Remington: The Science and Practice of Pharmacy, 20th and 21st Editions, Gennaro and University of the Sciences in Philadelphia, Eds., Lippencott Williams & Wilkins (2003 and 2005), each of which is hereby incorporated by reference.
Preferred unit dosage formulations are those containing a daily dose or unit, daily sub-dose, as herein discussed, or an appropriate fraction thereof, of the administered ingredient.
The dosage regimen for treating a disorder or a disease with the tumor specific neoantigenic peptides of this invention and/or compositions of this invention is based on a variety of factors, including the type of disease, the age, weight, sex, medical condition of the patient, the severity of the condition, the route of administration, and the particular compound employed. Thus, the dosage regimen may vary widely, but can be determined routinely using standard methods.
The amounts and dosage regimens administered to a subject can depend on a number of factors, such as the mode of administration, the nature of the condition being treated, the body weight of the subject being treated and the judgment of the prescribing physician; all such factors being within the ambit of the skilled artisan from this disclosure and the knowledge in the art.
The amount of compound included within therapeutically active formulations according to the present invention is an effective amount for treating the disease or condition. In general, a therapeutically effective amount of the present preferred compound in dosage form usually ranges from slightly less than about 0.025 mg/kg/day to about 2.5 g/kg/day, preferably about 0.1 mg/kg/day to about 100 mg/kg/day of the patient or considerably more, depending upon the compound used, the condition or infection treated and the route of administration, although exceptions to this dosage range may be contemplated by the present invention. In its most preferred form, compounds according to the present invention are administered in amounts ranging from about 1 mg/kg/day to about 100 mg/kg/day. The dosage of the compound can depend on the condition being treated, the particular compound, and other clinical factors such as weight and condition of the patient and the route of administration of the compound. It is to be understood that the present invention has application for both human and veterinary use.
For oral administration to humans, a dosage of between approximately 0.1 to 100 mg/kg/day, preferably between approximately 1 and 100 mg/kg/day, is generally sufficient.
Where drug delivery is systemic rather than topical, this dosage range generally produces effective blood level concentrations of active compound ranging from less than about 0.04 to about 400 micrograms/cc or more of blood in the patient. The compound is conveniently administered in any suitable unit dosage form, including but not limited to one containing 0.001 to 3000 mg, preferably 0.05 to 500 mg of active ingredient per unit dosage form. An oral dosage of 10-250 mg is usually convenient.
According to certain exemplary embodiments, the vaccine or immunogenic composition is administered at a dose of about 10 μg to 1 mg per neoantigenic peptide. According to certain exemplary embodiments, the vaccine or immunogenic composition is administered at an average weekly dose level of about 10 μg to 2000 μg per neoantigenic peptide.
The concentration of active compound in the drug composition will depend on absorption, distribution, inactivation, and excretion rates of the drug as well as other factors known to those of skill in the art. It is to be noted that dosage values will also vary with the severity of the condition to be alleviated. It is to be further understood that for any particular subject, specific dosage regimens should be adjusted over time according to the individual need and the professional judgment of the person administering or supervising the administration of the compositions, and that the concentration ranges set forth herein are exemplary only and are not intended to limit the scope or practice of the claimed composition. The active ingredient may be administered at once, or may be divided into a number of smaller doses to be administered at varying intervals of time.
The invention provides for pharmaceutical compositions containing at least one tumor specific neoantigen described herein. In embodiments, the pharmaceutical compositions contain a pharmaceutically acceptable carrier, excipient, or diluent, which includes any pharmaceutical agent that does not itself induce the production of an immune response harmful to a subject receiving the composition, and which may be administered without undue toxicity. As used herein, the term āpharmaceutically acceptableā means being approved by a regulatory agency of the Federal or a state government or listed in the U.S. Pharmacopia, European Pharmacopia or other generally recognized pharmacopia for use in mammals, and more particularly in humans. These compositions can be useful for treating and/or preventing viral infection and/or autoimmune disease.
A thorough discussion of pharmaceutically acceptable carriers, diluents, and other excipients is presented in Remington's Pharmaceutical Sciences (17th ed., Mack Publishing Company) and Remington: The Science and Practice of Pharmacy (21st ed., Lippincott Williams & Wilkins), which are hereby incorporated by reference. The formulation of the pharmaceutical composition should suit the mode of administration. In embodiments, the pharmaceutical composition is suitable for administration to humans, and can be sterile, non-particulate and/or non-pyrogenic.
Pharmaceutically acceptable carriers, excipients, or diluents include, but are not limited, to saline, buffered saline, dextrose, water, glycerol, ethanol, sterile isotonic aqueous buffer, and combinations thereof.
Wetting agents, emulsifiers and lubricants, such as sodium lauryl sulfate and magnesium stearate, as well as coloring agents, release agents, coating agents, sweetening, flavoring and perfuming agents, preservatives, and antioxidants can also be present in the compositions.
Examples of pharmaceutically-acceptable antioxidants include, but are not limited to: (1) water soluble antioxidants, such as ascorbic acid, cysteine hydrochloride, sodium bisulfate, sodium metabisulfite, sodium sulfite and the like; (2) oil-soluble antioxidants, such as ascorbyl palmitate, butylated hydroxyanisole (BHA), butylated hydroxytoluene (BHT), lecithin, propyl gallate, alpha-tocopherol, and the like; and (3) metal chelating agents, such as citric acid, ethylenediamine tetraacetic acid (EDTA), sorbitol, tartaric acid, phosphoric acid, and the like.
In embodiments, the pharmaceutical composition is provided in a solid form, such as a lyophilized powder suitable for reconstitution, a liquid solution, suspension, emulsion, tablet, pill, capsule, sustained release formulation, or powder.
In embodiments, the pharmaceutical composition is supplied in liquid form, for example, in a sealed container indicating the quantity and concentration of the active ingredient in the pharmaceutical composition. In related embodiments, the liquid form of the pharmaceutical composition is supplied in a hermetically sealed container.
Methods for formulating the pharmaceutical compositions of the present invention are conventional and well known in the art (see Remington and Remington's). One of skill in the art can readily formulate a pharmaceutical composition having the desired characteristics (e.g., route of administration, biosafety, and release profile).
Methods for preparing the pharmaceutical compositions include the step of bringing into association the active ingredient with a pharmaceutically acceptable carrier and, optionally, one or more accessory ingredients. The pharmaceutical compositions can be prepared by uniformly and intimately bringing into association the active ingredient with liquid carriers, or finely divided solid carriers, or both, and then, if necessary, shaping the product. Additional methodology for preparing the pharmaceutical compositions, including the preparation of multilayer dosage forms, are described in Ansel's Pharmaceutical Dosage Forms and Drug Delivery Systems (9th ed., Lippincott Williams & Wilkins), which is hereby incorporated by reference.
Pharmaceutical compositions suitable for oral administration can be in the form of capsules, cachets, pills, tablets, lozenges (using a flavored basis, usually sucrose and acacia or tragacanth), powders, granules, or as a solution or a suspension in an aqueous or non-aqueous liquid, or as an oil-in-water or water-in-oil liquid emulsion, or as an elixir or syrup, or as pastilles (using an inert base, such as gelatin and glycerin, or sucrose and acacia) and/or as mouth washes and the like, each containing a predetermined amount of a compound(s) described herein, a derivative thereof, or a pharmaceutically acceptable salt or prodrug thereof as the active ingredient(s). The active ingredient can also be administered as a bolus, electuary, or paste.
In solid dosage forms for oral administration (e.g., capsules, tablets, pills, dragees, powders, granules and the like), the active ingredient is mixed with one or more pharmaceutically acceptable carriers, excipients, or diluents, such as sodium citrate or dicalcium phosphate, and/or any of the following: (1) fillers or extenders, such as starches, lactose, sucrose, glucose, mannitol, and/or silicic acid; (2) binders, such as, for example, carboxymethylcellulose, alginates, gelatin, polyvinyl pyrrolidone, sucrose and/or acacia; (3) humectants, such as glycerol; (4) disintegrating agents, such as agar-agar, calcium carbonate, potato or tapioca starch, alginic acid, certain silicates, and sodium carbonate; (5) solution retarding agents, such as paraffin; (6) absorption accelerators, such as quaternary ammonium compounds; (7) wetting agents, such as, for example, acetyl alcohol and glycerol monostearate; (8) absorbents, such as kaolin and bentonite clay; (9) lubricants, such a talc, calcium stearate, magnesium stearate, solid polyethylene glycols, sodium lauryl sulfate, and mixtures thereof; and (10) coloring agents. In the case of capsules, tablets, and pills, the pharmaceutical compositions can also comprise buffering agents. Solid compositions of a similar type can also be prepared using fillers in soft and hard-filled gelatin capsules, and excipients such as lactose or milk sugars, as well as high molecular weight polyethylene glycols and the like.
A tablet can be made by compression or molding, optionally with one or more accessory ingredients. Compressed tablets can be prepared using binders (for example, gelatin or hydroxypropylmethyl cellulose), lubricants, inert diluents, preservatives, disintegrants (for example, sodium starch glycolate or cross-linked sodium carboxymethyl cellulose), surface-actives, and/or dispersing agents. Molded tablets can be made by molding in a suitable machine a mixture of the powdered active ingredient moistened with an inert liquid diluent.
The tablets and other solid dosage forms, such as dragees, capsules, pills, and granules, can optionally be scored or prepared with coatings and shells, such as enteric coatings and other coatings well known in the art.
In some embodiments, in order to prolong the effect of an active ingredient, it is desirable to slow the absorption of the compound from subcutaneous or intramuscular injection. This can be accomplished by the use of a liquid suspension of crystalline or amorphous material having poor water solubility. The rate of absorption of the active ingredient then depends upon its rate of dissolution which, in turn, can depend upon crystal size and crystalline form. Alternatively, delayed absorption of a parenterally-administered active ingredient is accomplished by dissolving or suspending the compound in an oil vehicle. In addition, prolonged absorption of the injectable pharmaceutical form can be brought about by the inclusion of agents that delay absorption such as aluminum monostearate and gelatin.
Controlled release parenteral compositions can be in form of aqueous suspensions, microspheres, microcapsules, magnetic microspheres, oil solutions, oil suspensions, emulsions, or the active ingredient can be incorporated in biocompatible carrier(s), liposomes, nanoparticles, implants or infusion devices.
Materials for use in the preparation of microspheres and/or microcapsules include biodegradable/bioerodible polymers such as polyglactin, poly-(isobutyl cyanoacrylate), poly(2-hydroxyethyl-L-glutamine) and poly(lactic acid).
Biocompatible carriers which can be used when formulating a controlled release parenteral formulation include carbohydrates such as dextrans, proteins such as albumin, lipoproteins or antibodies.
Materials for use in implants can be non-biodegradable, e.g., polydimethylsiloxane, or biodegradable such as, e.g., poly(caprolactone), poly(lactic acid), poly(glycolic acid) or poly(ortho esters).
In embodiments, the active ingredient(s) are administered by aerosol. This is accomplished by preparing an aqueous aerosol, liposomal preparation, or solid particles containing the compound. A nonaqueous (e.g., fluorocarbon propellant) suspension can be used. The pharmaceutical composition can also be administered using a sonic nebulizer, which would minimize exposing the agent to shear, which can result in degradation of the compound.
Ordinarily, an aqueous aerosol is made by formulating an aqueous solution or suspension of the active ingredient(s) together with conventional pharmaceutically-acceptable carriers and stabilizers. The carriers and stabilizers vary with the requirements of the particular compound, but typically include nonionic surfactants (Tweens, Pluronics, or polyethylene glycol), innocuous proteins like serum albumin, sorbitan esters, oleic acid, lecithin, amino acids such as glycine, buffers, salts, sugars or sugar alcohols. Aerosols generally are prepared from isotonic solutions.
Dosage forms for topical or transdermal administration of an active ingredient(s) includes powders, sprays, ointments, pastes, creams, lotions, gels, solutions, patches and inhalants. The active ingredient(s) can be mixed under sterile conditions with a pharmaceutically acceptable carrier, and with any preservatives, buffers, or propellants as appropriate.
Transdermal patches suitable for use in the present invention are disclosed in Transdermal Drug Delivery: Developmental Issues and Research Initiatives (Marcel Dekker Inc., 1989) and U.S. Pat. Nos. 4,743,249, 4,906,169, 5,198,223, 4,816,540, 5,422,119, 5,023,084, which are hereby incorporated by reference. The transdermal patch can also be any transdermal patch well known in the art, including transscrotal patches. Pharmaceutical compositions in such transdermal patches can contain one or more absorption enhancers or skin permeation enhancers well known in the art (see, e.g., U.S. Pat. Nos. 4,379,454 and 4,973,468, which are hereby incorporated by reference). Transdermal therapeutic systems for use in the present invention can be based on iontophoresis, diffusion, or a combination of these two effects.
Transdermal patches have the added advantage of providing controlled delivery of active ingredient(s) to the body. Such dosage forms can be made by dissolving or dispersing the active ingredient(s) in a proper medium. Absorption enhancers can also be used to increase the flux of the active ingredient across the skin. The rate of such flux can be controlled by either providing a rate controlling membrane or dispersing the active ingredient(s) in a polymer matrix or gel.
Such pharmaceutical compositions can be in the form of creams, ointments, lotions, liniments, gels, hydrogels, solutions, suspensions, sticks, sprays, pastes, plasters and other kinds of transdermal drug delivery systems. The compositions can also include pharmaceutically acceptable carriers or excipients such as emulsifying agents, antioxidants, buffering agents, preservatives, humectants, penetration enhancers, chelating agents, gel-forming agents, ointment bases, perfumes, and skin protective agents.
Examples of emulsifying agents include, but are not limited to, naturally occurring gums, e.g. gum acacia or gum tragacanth, naturally occurring phosphatides, e.g. soybean lecithin and sorbitan monooleate derivatives.
Examples of antioxidants include, but are not limited to, butylated hydroxy anisole (BHA), ascorbic acid and derivatives thereof, tocopherol and derivatives thereof, and cysteine.
Examples of preservatives include, but are not limited to, parabens, such as methyl or propyl p-hydroxybenzoate and benzalkonium chloride.
Examples of humectants include, but are not limited to, glycerin, propylene glycol, sorbitol and urea.
Examples of penetration enhancers include, but are not limited to, propylene glycol, DMSO, triethanolamine, N,N-dimethylacetamide, N,N-dimethylformamide, 2-pyrrolidone and derivatives thereof, tetrahydrofurfuryl alcohol, propylene glycol, diethylene glycol monoethyl or monomethyl ether with propylene glycol monolaurate or methyl laurate, eucalyptol, lecithin, TRANSCUTOL, and AZONE.
Examples of chelating agents include, but are not limited to, sodium EDTA, citric acid and phosphoric acid.
Examples of gel forming agents include, but are not limited to, Carbopol, cellulose derivatives, bentonite, alginates, gelatin and polyvinylpyrrolidone.
In addition to the active ingredient(s), the ointments, pastes, creams, and gels of the present invention can contain excipients, such as animal and vegetable fats, oils, waxes, paraffins, starch, tragacanth, cellulose derivatives, polyethylene glycols, silicones, bentonites, silicic acid, talc and zinc oxide, or mixtures thereof.
Powders and sprays can contain excipients such as lactose, talc, silicic acid, aluminum hydroxide, calcium silicates and polyamide powder, or mixtures of these substances. Sprays can additionally contain customary propellants, such as chlorofluorohydrocarbons, and volatile unsubstituted hydrocarbons, such as butane and propane.
Injectable depot forms are made by forming microencapsule matrices of compound(s) of the invention in biodegradable polymers such as polylactide-polyglycolide. Depending on the ratio of compound to polymer, and the nature of the particular polymer employed, the rate of compound release can be controlled. Examples of other biodegradable polymers include poly(orthoesters) and poly(anhydrides). Depot injectable formulations are also prepared by entrapping the drug in liposomes or microemulsions which are compatible with body tissue.
Subcutaneous implants are well known in the art and are suitable for use in the present invention. Subcutaneous implantation methods are preferably non-irritating and mechanically resilient. The implants can be of matrix type, of reservoir type, or hybrids thereof. In matrix type devices, the carrier material can be porous or non-porous, solid or semi-solid, and permeable or impermeable to the active compound or compounds. The carrier material can be biodegradable or may slowly erode after administration. In some instances, the matrix is non-degradable but instead relies on the diffusion of the active compound through the matrix for the carrier material to degrade. Alternative subcutaneous implant methods utilize reservoir devices where the active compound or compounds are surrounded by a rate controlling membrane, e.g., a membrane independent of component concentration (possessing zero-order kinetics). Devices consisting of a matrix surrounded by a rate controlling membrane also suitable for use.
Both reservoir and matrix type devices can contain materials such as polydimethylsiloxane, such as SILASTIC, or other silicone rubbers. Matrix materials can be insoluble polypropylene, polyethylene, polyvinyl chloride, ethylvinyl acetate, polystyrene and polymethacrylate, as well as glycerol esters of the glycerol palmitostearate, glycerol stearate, and glycerol behenate type. Materials can be hydrophobic or hydrophilic polymers and optionally contain solubilizing agents.
Subcutaneous implant devices can be slow-release capsules made with any suitable polymer, e.g., as described in U.S. Pat. Nos. 5,035,891 and 4,210,644, which are hereby incorporated by reference.
In general, at least four different approaches are applicable in order to provide rate control over the release and transdermal permeation of a drug compound. These approaches are: membrane-moderated systems, adhesive diffusion-controlled systems, matrix dispersion-type systems and microreservoir systems. It is appreciated that a controlled release percutaneous and/or topical composition can be obtained by using a suitable mixture of these approaches.
In a membrane-moderated system, the active ingredient is present in a reservoir which is totally encapsulated in a shallow compartment molded from a drug-impermeable laminate, such as a metallic plastic laminate, and a rate-controlling polymeric membrane such as a microporous or a non-porous polymeric membrane, e.g., ethylene-vinyl acetate copolymer. The active ingredient is released through the rate controlling polymeric membrane. In the drug reservoir, the active ingredient can either be dispersed in a solid polymer matrix or suspended in an unleachable, viscous liquid medium such as silicone fluid. On the external surface of the polymeric membrane, a thin layer of an adhesive polymer is applied to achieve an intimate contact of the transdermal system with the skin surface. The adhesive polymer is preferably a polymer which is hypoallergenic and compatible with the active drug substance.
In an adhesive diffusion-controlled system, a reservoir of the active ingredient is formed by directly dispersing the active ingredient in an adhesive polymer and then by, e.g., solvent casting, spreading the adhesive containing the active ingredient onto a flat sheet of substantially drug-impermeable metallic plastic backing to form a thin drug reservoir layer.
A matrix dispersion-type system is characterized in that a reservoir of the active ingredient is formed by substantially homogeneously dispersing the active ingredient in a hydrophilic or lipophilic polymer matrix. The drug-containing polymer is then molded into disc with a substantially well-defined surface area and controlled thickness. The adhesive polymer is spread along the circumference to form a strip of adhesive around the disc.
A microreservoir system can be considered as a combination of the reservoir and matrix dispersion type systems. In this case, the reservoir of the active substance is formed by first suspending the drug solids in an aqueous solution of water-soluble polymer and then dispersing the drug suspension in a lipophilic polymer to form a multiplicity of unleachable, microscopic spheres of drug reservoirs.
Any of the herein-described controlled release, extended release, and sustained release compositions can be formulated to release the active ingredient in about 30 minutes to about 1 week, in about 30 minutes to about 72 hours, in about 30 minutes to 24 hours, in about 30 minutes to 12 hours, in about 30 minutes to 6 hours, in about 30 minutes to 4 hours, and in about 3 hours to 10 hours. In embodiments, an effective concentration of the active ingredient(s) is sustained in a subject for 4 hours, 6 hours, 8 hours, 10 hours, 12 hours, 16 hours, 24 hours, 48 hours, 72 hours, or more after administration of the pharmaceutical compositions to the subject.
The present invention is directed in some aspects to pharmaceutical compositions suitable for the prevention or treatment of cancer. In one embodiment, the composition comprises at least an immunogenic composition, e.g., a neoplasia vaccine or immunogenic composition capable of raising a specific T-cell response. The neoplasia vaccine or immunogenic composition comprises neoantigenic peptides and/or neoantigenic polypeptides corresponding to tumor specific neoantigens as described herein.
A suitable neoplasia vaccine or immunogenic composition can preferably contain a plurality of tumor specific neoantigenic peptides. In an embodiment, the vaccine or immunogenic composition can include between 1 and 100 sets of peptides, more preferably between 1 and 50 such peptides, even more preferably between 10 and 30 sets peptides, even more preferably between 15 and 25 peptides. According to another preferred embodiment, the vaccine or immunogenic composition can include at least one peptides, more preferably 2, 3, 4, or 5 peptides, In certain embodiments, the vaccine or immunogenic composition can comprise 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, or 30 different peptides.
The optimum amount of each peptide to be included in the vaccine or immunogenic composition and the optimum dosing regimen can be determined by one skilled in the art without undue experimentation. For example, the peptide or its variant may be prepared for intravenous (i.v.) injection, sub-cutaneous (s.c.) injection, intradermal (i.d.) injection, intraperitoneal (i.p.) injection, intramuscular (i.m.) injection. Preferred methods of peptide injection include s.c, i.d., i.p., i.m., and i.v. Preferred methods of DNA injection include i.d., i.m., s.c, i.p. and i.v. For example, doses of between 1 and 500 mg 50 μg and 1.5 mg, preferably 10 μg to 500 μg of peptide or DNA may be given and can depend from the respective peptide or DNA. Doses of this range were successfully used in previous trials (Brunsvig P F, et al., Cancer Immunol Immunother. 2006; 55(12): 1553-1564; M. Staehler, et al., ASCO meeting 2007; Abstract No 3017). Other methods of administration of the vaccine or immunogenic composition are known to those skilled in the art.
In one embodiment of the present invention the different tumor specific neoantigenic peptides and/or polypeptides are selected for use in the neoplasia vaccine or immunogenic composition so as to maximize the likelihood of generating an immune attack against the neoplasias/tumors in a high proportion of subjects in the population. Without being bound by theory, it is believed that the inclusion of a diversity of tumor specific neoantigenic peptides can generate a broad scale immune attack against a neoplasia/tumor. In one embodiment, the selected tumor specific neoantigenic peptides/polypeptides are encoded by missense mutations. In a second embodiment, the selected tumor specific neoantigenic peptides/polypeptides are encoded by a combination of missense mutations and neoORF mutations. In a third embodiment, the selected tumor specific neoantigenic peptides/polypeptides are encoded by neoORF mutations.
In one embodiment in which the selected tumor specific neoantigenic peptides/polypeptides are encoded by missense mutations, the peptides and/or polypeptides are chosen based on their capability to associate with the MHC molecules of a high proportion of subjects in the population. Peptides/polypeptides derived from neoORF mutations can also be selected on the basis of their capability to associate with the MHC molecules of the patient population.
The vaccine or immunogenic composition is capable of raising a specific cytotoxic T-cells response and/or a specific helper T-cell response.
The vaccine or immunogenic composition can further comprise an adjuvant and/or a carrier. Examples of useful adjuvants and carriers are given herein. The peptides and/or polypeptides in the composition can be associated with a carrier such as, e.g., a protein or an antigen-presenting cell such as e.g. a dendritic cell (DC) capable of presenting the peptide to a T-cell.
Adjuvants are any substance whose admixture into the vaccine or immunogenic composition increases or otherwise modifies the immune response to the mutant peptide. Carriers are scaffold structures, for example a polypeptide or a polysaccharide, to which the neoantigenic peptides, is capable of being associated. Optionally, adjuvants are conjugated covalently or non-covalently to the peptides or polypeptides of the invention.
The ability of an adjuvant to increase the immune response to an antigen is typically manifested by a significant increase in immune-mediated reaction, or reduction in disease symptoms. For example, an increase in humoral immunity is typically manifested by a significant increase in the titer of antibodies raised to the antigen, and an increase in T-cell activity is typically manifested in increased cell proliferation, or cellular cytotoxicity, or cytokine secretion. An adjuvant may also alter an immune response, for example, by changing a primarily humoral or Th2 response into a primarily cellular, or Th1 response.
Suitable adjuvants include, but are not limited to 1018 ISS, aluminum salts, Amplivax, AS15, BCG, CP-870,893, CpG7909, CyaA, dSLIM, GM-CSF, IC30, IC31, Imiquimod, ImuFact IMP321, IS Patch, ISS, ISCOMATRIX, Juvlmmune, LipoVac, MF59, monophosphoryl lipid A, Montanide IMS 1312, Montanide ISA 206, Montanide ISA 50V, Montanide ISA-51, OK-432, OM-174, OM-197-MP-EC, ONTAK, PEPTEL. vector system, PLG microparticles, resiquimod, SRL172, Virosomes and other Virus-like particles, YF-17D, VEGF trap, R848, beta-glucan, Pam3Cys, Aquila's QS21 stimulon (Aquila Biotech, Worcester, Mass., USA) which is derived from saponin, mycobacterial extracts and synthetic bacterial cell wall mimics, and other proprietary adjuvants such as Ribi's Detox. Quil or Superfos. Several immunological adjuvants (e.g., MF59) specific for dendritic cells and their preparation have been described previously (Dupuis M, et al., Cell Immunol. 1998; 186(1): 18-27; Allison A C; Dev Biol Stand. 1998; 92:3-11). Also cytokines may be used. Several cytokines have been directly linked to influencing dendritic cell migration to lymphoid tissues (e.g., TNF-alpha), accelerating the maturation of dendritic cells into efficient antigen-presenting cells for T-lymphocytes (e.g., GM-CSF, IL-1 and IL-4) (U.S. Pat. No. 5,849,589, specifically incorporated herein by reference in its entirety) and acting as immunoadjuvants (e.g., IL-12) (Gabrilovich D I, et al., J Immunother Emphasis Tumor Immunol. 1996 (6):414-418).
Toll like receptors (TLRs) may also be used as adjuvants, and are important members of the family of pattern recognition receptors (PRRs) which recognize conserved motifs shared by many micro-organisms, termed āpathogen-associated molecular patternsā (PAMPS). Recognition of these ādanger signalsā activates multiple elements of the innate and adaptive immune system. TLRs are expressed by cells of the innate and adaptive immune systems such as dendritic cells (DCs), macrophages, T and B cells, mast cells, and granulocytes and are localized in different cellular compartments, such as the plasma membrane, lysosomes, endosomes, and endolysosomes. Different TLRs recognize distinct PAMPS. For example, TLR4 is activated by LPS contained in bacterial cell walls, TLR9 is activated by unmethylated bacterial or viral CpG DNA, and TLR3 is activated by double stranded RNA. TLR ligand binding leads to the activation of one or more intracellular signaling pathways, ultimately resulting in the production of many key molecules associated with inflammation and immunity (particularly the transcription factor NF-ĪŗB and the Type-I interferons). TLR mediated DC activation leads to enhanced DC activation, phagocytosis, upregulation of activation and co-stimulation markers such as CD80, CD83, and CD86, expression of CCR7 allowing migration of DC to draining lymph nodes and facilitating antigen presentation to T cells, as well as increased secretion of cytokines such as type I interferons, IL-12, and IL-6. All of these downstream events are critical for the induction of an adaptive immune response.
Among the most promising cancer vaccine or immunogenic composition adjuvants currently in clinical development are the TLR9 agonist CpG and the synthetic double-stranded RNA (dsRNA) TLR3 ligand poly-ICLC. In preclinical studies poly-ICLC appears to be the most potent TLR adjuvant when compared to LPS and CpG due to its induction of pro-inflammatory cytokines and lack of stimulation of IL-10, as well as maintenance of high levels of co-stimulatory molecules in DCs1. Furthermore, poly-ICLC was recently directly compared to CpG in non-human primates (rhesus macaques) as adjuvant for a protein vaccine or immunogenic composition consisting of human papillomavirus (HPV)16 capsomers (Stahl-Hennig C, Eisenblatter M, Jasny E, et al. Synthetic double-stranded RNAs are adjuvants for the induction of T helper 1 and humoral immune responses to human papillomavirus in rhesus macaques. PLoS pathogens. April 2009; 5(4)).
CpG immuno stimulatory oligonucleotides have also been reported to enhance the effects of adjuvants in a vaccine or immunogenic composition setting. Without being bound by theory, CpG oligonucleotides act by activating the innate (non-adaptive) immune system via Toll-like receptors (TLR), mainly TLR9. CpG triggered TLR9 activation enhances antigen-specific humoral and cellular responses to a wide variety of antigens, including peptide or protein antigens, live or killed viruses, dendritic cell vaccines, autologous cellular vaccines and polysaccharide conjugates in both prophylactic and therapeutic vaccines. More importantly, it enhances dendritic cell maturation and differentiation, resulting in enhanced activation of Th1 cells and strong cytotoxic T-lymphocyte (CTL) generation, even in the absence of CD4 T-cell help. The Th1 bias induced by TLR9 stimulation is maintained even in the presence of vaccine adjuvants such as alum or incomplete Freund's adjuvant (IFA) that normally promote a Th2 bias. CpG oligonucleotides show even greater adjuvant activity when formulated or co-administered with other adjuvants or in formulations such as microparticles, nano particles, lipid emulsions or similar formulations, which are especially necessary for inducing a strong response when the antigen is relatively weak. They also accelerate the immune response and enabled the antigen doses to be reduced by approximately two orders of magnitude, with comparable antibody responses to the full-dose vaccine without CpG in some experiments (Arthur M. Krieg, Nature Reviews, Drug Discovery, 5, June 2006, 471-484). U.S. Pat. No. 6,406,705 B1 describes the combined use of CpG oligonucleotides, non-nucleic acid adjuvants and an antigen to induce an antigen-specific immune response. A commercially available CpG TLR9 antagonist is dSLIM (double Stem Loop Immunomodulator) by Mologen (Berlin, GERMANY), which is a preferred component of the pharmaceutical composition of the present invention. Other TLR binding molecules such as RNA binding TLR 7, TLR 8 and/or TLR 9 may also be used.
Other examples of useful adjuvants include, but are not limited to, chemically modified CpGs (e.g. CpR, Idera), Poly(I:C)(e.g. polyi:CI2U), non-CpG bacterial DNA or RNA as well as immunoactive small molecules and antibodies such as cyclophosphamide, sunitinib, bevacizumab, celebrex, NCX-4016, sildenafil, tadalafil, vardenafil, sorafinib, XL-999, CP-547632, pazopanib, ZD2171, AZD2171, ipilimumab, tremelimumab, and SC58175, which may act therapeutically and/or as an adjuvant. The amounts and concentrations of adjuvants and additives useful in the context of the present invention can readily be determined by the skilled artisan without undue experimentation. Additional adjuvants include colony-stimulating factors, such as Granulocyte Macrophage Colony Stimulating Factor (GM-CSF, sargramostim).
Poly-ICLC is a synthetically prepared double-stranded RNA consisting of polyI and polyC strands of average length of about 5000 nucleotides, which has been stabilized to thermal denaturation and hydrolysis by serum nucleases by the addition of polylysine and carboxymethylcellulose. The compound activates TLR3 and the RNA helicase-domain of MDA5, both members of the PAMP family, leading to DC and natural killer (NK) cell activation and production of a ānatural mixā of type I interferons, cytokines, and chemokines. Furthermore, poly-ICLC exerts a more direct, broad host-targeted anti-infectious and possibly antitumor effect mediated by the two IFN-inducible nuclear enzyme systems, the 2ā²5ā²-OAS and the P1/eIF2a kinase, also known as the PKR (4-6), as well as RIG-I helicase and MDA5.
In rodents and non-human primates, poly-ICLC was shown to enhance T cell responses to viral antigens, cross-priming, and the induction of tumor-, virus-, and autoantigen-specific CD8+ T-cells. In a recent study in non-human primates, poly-ICLC was found to be essential for the generation of antibody responses and T-cell immunity to DC targeted or non-targeted HIV Gag p24 protein, emphasizing its effectiveness as a vaccine adjuvant.
In human subjects, transcriptional analysis of serial whole blood samples revealed similar gene expression profiles among the 8 healthy human volunteers receiving one single s.c. administration of poly-ICLC and differential expression of up to 212 genes between these 8 subjects versus 4 subjects receiving placebo. Remarkably, comparison of the poly-ICLC gene expression data to previous data from volunteers immunized with the highly effective yellow fever vaccine YF17D showed that a large number of transcriptional and signal transduction canonical pathways, including those of the innate immune system, were similarly upregulated at peak time points.
More recently, an immunologic analysis was reported on patients with ovarian, fallopian tube, and primary peritoneal cancer in second or third complete clinical remission who were treated on a phase 1 study of subcutaneous vaccination with synthetic overlapping long peptides (OLP) from the cancer testis antigen NY-ESO-1 alone or with Montanide-ISA-51, or with 1.4 mg poly-ICLC and Montanide. The generation of NY-ESO-1-specific CD4+ and CD8+ T-cell and antibody responses were markedly enhanced with the addition of poly-ICLC and Montanide compared to OLP alone or OLP and Montanide.
A vaccine or immunogenic composition according to the present invention may comprise more than one different adjuvant. Furthermore, the invention encompasses a therapeutic composition comprising any adjuvant substance including any of those herein discussed. It is also contemplated that the peptide or polypeptide, and the adjuvant can be administered separately in any appropriate sequence.
A carrier may be present independently of an adjuvant. The carrier may be covalently linked to the antigen. A carrier can also be added to the antigen by inserting DNA encoding the carrier in frame with DNA encoding the antigen. The function of a carrier can for example be to confer stability, to increase the biological activity, or to increase serum half-life. Extension of the half-life can help to reduce the number of applications and to lower doses, thus are beneficial for therapeutic but also economic reasons. Furthermore, a carrier may aid presenting peptides to T-cells. The carrier may be any suitable carrier known to the person skilled in the art, for example a protein or an antigen presenting cell. A carrier protein could be but is not limited to keyhole limpet hemocyanin, serum proteins such as transferrin, bovine serum albumin, human serum albumin, thyroglobulin or ovalbumin, immunoglobulins, or hormones, such as insulin or palmitic acid. For immunization of humans, the carrier may be a physiologically acceptable carrier acceptable to humans and safe. However, tetanus toxoid and/or diptheria toxoid are suitable carriers in one embodiment of the invention. Alternatively, the carrier may be dextrans for example sepharose.
Cytotoxic T-cells (CTLs) recognize an antigen in the form of a peptide bound to an WIC molecule rather than the intact foreign antigen itself. The MHC molecule itself is located at the cell surface of an antigen presenting cell. Thus, an activation of CTLs is only possible if a trimeric complex of peptide antigen, MHC molecule, and APC is present. Correspondingly, it may enhance the immune response if not only the peptide is used for activation of CTLs, but if additionally APCs with the respective MHC molecule are added. Therefore, in some embodiments the vaccine or immunogenic composition according to the present invention additionally contains at least one antigen presenting cell.
The antigen-presenting cell (or stimulator cell) typically has an WIC class I or II molecule on its surface, and in one embodiment is substantially incapable of itself loading the WIC class I or II molecule with the selected antigen. As is described in more detail herein, the WIC class I or II molecule may readily be loaded with the selected antigen in vitro.
CD8+ cell activity may be augmented through the use of CD4+ cells. The identification of CD4 T+ cell epitopes for tumor antigens has attracted interest because many immune based therapies against cancer may be more effective if both CD8+ and CD4+T lymphocytes are used to target a patient's tumor. CD4+ cells are capable of enhancing CD8 T cell responses. Many studies in animal models have clearly demonstrated better results when both CD4+ and CD8+ T cells participate in anti-tumor responses (see e.g., Nishimura et al. (1999) Distinct role of antigen-specific T helper type 1 (TH1) and Th2 cells in tumor eradication in vivo. J Ex Med 190:617-27). Universal CD4+ T cell epitopes have been identified that are applicable to developing therapies against different types of cancer (see e.g., Kobayashi et al. (2008) Current Opinion in Immunology 20:221-27). For example, an HLA-DR restricted helper peptide from tetanus toxoid was used in melanoma vaccines to activate CD4+ T cells non-specifically (see e.g., Slingluff et al. (2007) Immunologic and Clinical Outcomes of a Randomized Phase II Trial of Two Multipeptide Vaccines for Melanoma in the Adjuvant Setting, Clinical Cancer Research 13(21):6386-95). It is contemplated within the scope of the invention that such CD4+ cells may be applicable at three levels that vary in their tumor specificity: 1) a broad level in which universal CD4+ epitopes (e.g., tetanus toxoid) may be used to augment CD8+ cells; 2) an intermediate level in which native, tumor-associated CD4+ epitopes may be used to augment CD8+ cells; and 3) a patient specific level in which neoantigen CD4+ epitopes may be used to augment CD8+ cells in a patient specific manner. Although current algorithms for predicting CD4 epitopes are limited in accuracy, it is a reasonable expectation that many long peptides containing predicted CD8 neoepitopes will also include CD4 epitopes. CD4 epitopes are longer than CD8 epitopes and typically are 10-12 amino acids in length although some can be longer (Kreiter et al, Mutant MHC Class II epitopes drive therapeutic immune responses to cancer, Nature (2015). Thus the neoantigenic epitopes described herein, either in the form of long peptides (>25 amino acids) or nucleic acids encoding such long peptides, may also boost CD4 responses in a tumor and patient-specific manner (level (3) above).
CD8+ cell immunity may also be generated with neoantigen loaded dendritic cell (DC) vaccine. DCs are potent antigen-presenting cells that initiate T cell immunity and can be used as cancer vaccines when loaded with one or more peptides of interest, for example, by direct peptide injection. For example, patients that were newly diagnosed with metastatic melanoma were shown to be immunized against 3 HLA-A*0201-restricted gp100 melanoma antigen-derived peptides with autologous peptide pulsed CD40L/IFN-g-activated mature DCs via an IL-12p70-producing patient DC vaccine (see e.g., Carreno et al (2013) L-12p70-producing patient DC vaccine elicits Tc1-polarized immunity, Journal of Clinical Investigation, 123(8):3383-94 and Ali et al. (2009) In situ regulation of DC subsets and T cells mediates tumor regression in mice, Cancer Immunotherapy, 1(8):1-10). It is contemplated within the scope of the invention that neoantigen loaded DCs may be prepared using the synthetic TLR 3 agonist Polyinosinic-Polycytidylic Acid-poly-L-lysine Carboxymethylcellulose (Poly-ICLC) to stimulate the DCs. Poly-ICLC is a potent individual maturation stimulus for human DCs as assessed by an upregulation of CD83 and CD86, induction of interleukin-12 (IL-12), tumor necrosis factor (TNF), interferon gamma-induced protein 10 (IP-10), interleukin 1 (IL-1), and type I interferons (IFN), and minimal interleukin 10 (IL-10) production. DCs may be differentiated from frozen peripheral blood mononuclear cells (PBMCs) obtained by leukapheresis, while PBMCs may be isolated by Ficoll gradient centrifugation and frozen in aliquots.
Illustratively, the following 7 day activation protocol may be used. Day 1āPBMCs are thawed and plated onto tissue culture flasks to select for monocytes which adhere to the plastic surface after 1-2 hr incubation at 37° C. in the tissue culture incubator. After incubation, the lymphocytes are washed off and the adherent monocytes are cultured for 5 days in the presence of interleukin-4 (IL-4) and granulocyte macrophage-colony stimulating factor (GM-C SF) to differentiate to immature DCs. On Day 6, immature DCs are pulsed with the keyhole limpet hemocyanin (KLH) protein which serves as a control for the quality of the vaccine and may boost the immunogenicity of the vaccine. The DCs are stimulated to mature, loaded with peptide antigens, and incubated overnight. On Day 7, the cells are washed, and frozen in 1 ml aliquots containing 4-20Ć10(6) cells using a controlled-rate freezer. Lot release testing for the batches of DCs may be performed to meet minimum specifications before the DCs are injected into patients (see e.g., Sabado et al. (2013) Preparation of tumor antigen-loaded mature dendritic cells for immunotherapy, J. Vis Exp. August 1; (78). doi: 10.3791/50085).
A DC vaccine may be incorporated into a scaffold system to facilitate delivery to a patient. Therapeutic treatment of a patients neoplasia with a DC vaccine may utilize a biomaterial system that releases factors that recruit host dendritic cells into the device, differentiates the resident, immature DCs by locally presenting adjuvants (e.g., danger signals) while releasing antigen, and promotes the release of activated, antigen loaded DCs to the lymph nodes (or desired site of action) where the DCs may interact with T cells to generate a potent cytotoxic T lymphocyte response to the cancer neoantigens. Implantable biomaterials may be used to generate a potent cytotoxic T lymphocyte response against a neoplasia in a patient specific manner. The biomaterial-resident dendritic cells may then be activated by exposing them to danger signals mimicking infection, in concert with release of antigen from the biomaterial. The activated dendritic cells then migrate from the biomaterials to lymph nodes to induce a cytotoxic T effector response. This approach has previously been demonstrated to lead to regression of established melanoma in preclinical studies using a lysate prepared from tumor biopsies (see e.g., Ali et al. (2209) In situ regulation of DC subsets and T cells mediates tumor regression in mice, Cancer Immunotherapy 1(8):1-10; Ali et al. (2009) Infection-mimicking materials to program dendritic cells in situ. Nat Mater 8:151-8), and such a vaccine is currently being tested in a Phase I clinical trial recently initiated at the Dana-Farber Cancer Institute. This approach has also been shown to lead to regression of glioblastoma, as well as the induction of a potent memory response to prevent relapse, using the C6 rat glioma model.24 in the current proposal. The ability of such an implantable, biomatrix vaccine delivery scaffold to amplify and sustain tumor specific dendritic cell activation may lead to more robust anti-tumor immunosensitization than can be achieved by traditional subcutaneous or intra-nodal vaccine administrations.
The present invention may include any method for loading a neoantigenic peptide onto a dendritic cell. One such method applicable to the present invention is a microfluidic intracellular delivery system. Such systems cause temporary membrane disruption by rapid mechanical deformation of human and mouse immune cells, thus allowing the intracellular delivery of biomolecules (Sharei et al., 2015, PLOS ONE).
Preferably, the antigen presenting cells are dendritic cells. Suitably, the dendritic cells are autologous dendritic cells that are pulsed with the neoantigenic peptide. The peptide may be any suitable peptide that gives rise to an appropriate T-cell response. T-cell therapy using autologous dendritic cells pulsed with peptides from a tumor associated antigen is disclosed in Murphy et al. (1996) The Prostate 29, 371-380 and Tjua et al. (1997) The Prostate 32, 272-278. In certain embodiments the dendritic cells are targeted using CD141, DEC205, or XCR1 markers. CD141+XCR1+DC's were identified as a subset that may be better suited to the induction of anti-tumor responses (Bachem et al., J. Exp. Med. 207, 1273-1281 (2010); Crozat et al., J. Exp. Med. 207, 1283-1292 (2010); and Gallois & Bhardwaj, Nature Med. 16, 854-856 (2010)).
Thus, in one embodiment of the present invention the vaccine or immunogenic composition containing at least one antigen presenting cell is pulsed or loaded with one or more peptides of the present invention. Alternatively, peripheral blood mononuclear cells (PBMCs) isolated from a patient may be loaded with peptides ex vivo and injected back into the patient. As an alternative the antigen presenting cell comprises an expression construct encoding a peptide of the present invention. The polynucleotide may be any suitable polynucleotide and it is preferred that it is capable of transducing the dendritic cell, thus resulting in the presentation of a peptide and induction of immunity.
The inventive pharmaceutical composition may be compiled so that the selection, number and/or amount of peptides present in the composition covers a high proportion of subjects in the population. The selection may be dependent on the specific type of cancer, the status of the disease, earlier treatment regimens, and, of course, the HLA-haplotypes present in the patient population.
Pharmaceutical compositions comprising the peptide of the invention may be administered to an individual already suffering from cancer. In therapeutic applications, compositions are administered to a patient in an amount sufficient to elicit an effective CTL response to the tumor antigen and to cure or at least partially arrest symptoms and/or complications. An amount adequate to accomplish this is defined as ātherapeutically effective dose.ā Amounts effective for this use can depend on, e.g., the peptide composition, the manner of administration, the stage and severity of the disease being treated, the weight and general state of health of the patient, and the judgment of the prescribing physician, but generally range for the initial immunization (that is for therapeutic or prophylactic administration) from about 1.0 μg to about 50,000 μg of peptide for a 70 kg patient, followed by boosting dosages or from about 1.0 μg to about 10,000 μg of peptide pursuant to a boosting regimen over weeks to months depending upon the patient's response and condition and possibly by measuring specific CTL activity in the patient's blood. It should be kept in mind that the peptide and compositions of the present invention may generally be employed in serious disease states, that is, life-threatening or potentially life threatening situations, especially when the cancer has metastasized. For therapeutic use, administration should begin as soon as possible after the detection or surgical removal of tumors. This is followed by boosting doses until at least symptoms are substantially abated and for a period thereafter.
The pharmaceutical compositions (e.g., vaccine compositions) for therapeutic treatment are intended for parenteral, topical, nasal, oral or local administration. Preferably, the pharmaceutical compositions are administered parenterally, e.g., intravenously, subcutaneously, intradermally, or intramuscularly. The compositions may be administered at the site of surgical excision to induce a local immune response to the tumor. The invention provides compositions for parenteral administration which comprise a solution of the peptides and vaccine or immunogenic compositions are dissolved or suspended in an acceptable carrier, preferably an aqueous carrier. A variety of aqueous carriers may be used, e.g., water, buffered water, 0.9% saline, 0.3% glycine, hyaluronic acid and the like. These compositions may be sterilized by conventional, well known sterilization techniques, or may be sterile filtered. The resulting aqueous solutions may be packaged for use as is, or lyophilized, the lyophilized preparation being combined with a sterile solution prior to administration. The compositions may contain pharmaceutically acceptable auxiliary substances as required to approximate physiological conditions, such as pH adjusting and buffering agents, tonicity adjusting agents, wetting agents and the like, for example, sodium acetate, sodium lactate, sodium chloride, potassium chloride, calcium chloride, sorbitan monolaurate, triethanolamine oleate, etc.
A liposome suspension containing a peptide may be administered intravenously, locally, topically, etc. in a dose which varies according to, inter alia, the manner of administration, the peptide being delivered, and the stage of the disease being treated. For targeting to the immune cells, a ligand, such as, e.g., antibodies or fragments thereof specific for cell surface determinants of the desired immune system cells, can be incorporated into the liposome.
For solid compositions, conventional or nanoparticle nontoxic solid carriers may be used which include, for example, pharmaceutical grades of mannitol, lactose, starch, magnesium stearate, sodium saccharin, talcum, cellulose, glucose, sucrose, magnesium carbonate, and the like. For oral administration, a pharmaceutically acceptable nontoxic composition is formed by incorporating any of the normally employed excipients, such as those carriers previously listed, and generally 10-95% of active ingredient, that is, one or more peptides of the invention, and more preferably at a concentration of 25%-75%.
For aerosol administration, the immunogenic peptides are preferably supplied in finely divided form along with a surfactant and propellant. Typical percentages of peptides are 0.01%-20% by weight, preferably 1%-10%. The surfactant can, of course, be nontoxic, and preferably soluble in the propellant. Representative of such agents are the esters or partial esters of fatty acids containing from 6 to 22 carbon atoms, such as caproic, octanoic, lauric, palmitic, stearic, linoleic, linolenic, olesteric and oleic acids with an aliphatic polyhydric alcohol or its cyclic anhydride. Mixed esters, such as mixed or natural glycerides may be employed. The surfactant may constitute 0.1%-20% by weight of the composition, preferably 0.25-5%. The balance of the composition is ordinarily propellant. A carrier can also be included as desired, as with, e.g., lecithin for intranasal delivery.
The peptides and polypeptides of the invention can be readily synthesized chemically utilizing reagents that are free of contaminating bacterial or animal substances (Merrifield RB: Solid phase peptide synthesis. I. The synthesis of a tetrapeptide. J. Am. Chem. Soc. 85:2149-54, 1963).
The peptides and polypeptides of the invention can also be expressed by a vector, e.g., a nucleic acid molecule as herein-discussed, e.g., RNA or a DNA plasmid, a viral vector such as a poxvirus, e.g., orthopox virus, avipox virus, or adenovirus, AAV or lentivirus. This approach involves the use of a vector to express nucleotide sequences that encode the peptide of the invention. Upon introduction into an acutely or chronically infected host or into a noninfected host, the vector expresses the immunogenic peptide, and thereby elicits a host CTL response.
For therapeutic or immunization purposes, nucleic acids encoding the peptide of the invention and optionally one or more of the peptides described herein can also be administered to the patient. A number of methods are conveniently used to deliver the nucleic acids to the patient. For instance, the nucleic acid can be delivered directly, as ānaked DNAā. This approach is described, for instance, in Wolff et al., Science 247: 1465-1468 (1990) as well as U.S. Pat. Nos. 5,580,859 and 5,589,466. The nucleic acids can also be administered using ballistic delivery as described, for instance, in U.S. Pat. No. 5,204,253. Particles comprised solely of DNA can be administered. Alternatively, DNA can be adhered to particles, such as gold particles. Generally, a plasmid for a vaccine or immunological composition can comprise DNA encoding an antigen (e.g., one or more neoantigens) operatively linked to regulatory sequences which control expression or expression and secretion of the antigen from a host cell, e.g., a mammalian cell; for instance, from upstream to downstream, DNA for a promoter, such as a mammalian virus promoter (e.g., a CMV promoter such as an hCMV or mCMV promoter, e.g., an early-intermediate promoter, or an SV40 promoterāsee documents cited or incorporated herein for useful promoters), DNA for a eukaryotic leader peptide for secretion (e.g., tissue plasminogen activator), DNA for the neoantigen(s), and DNA encoding a terminator (e.g., the 3ā² UTR transcriptional terminator from the gene encoding Bovine Growth Hormone or bGH polyA). A composition can contain more than one plasmid or vector, whereby each vector contains and expresses a different neoantigen. Mention is also made of Wasmoen U.S. Pat. No. 5,849,303, and Dale U.S. Pat. No. 5,811,104, whose text may be useful. DNA or DNA plasmid formulations can be formulated with or inside cationic lipids; and, as to cationic lipids, as well as adjuvants, mention is also made of Loosmore U.S. Patent Application 2003/0104008. Also, teachings in Audonnet U.S. Pat. Nos. 6,228,846 and 6,159,477 may be relied upon for DNA plasmid teachings that can be employed in constructing and using DNA plasmids that contain and express in vivo.
The nucleic acids can also be delivered complexed to cationic compounds, such as cationic lipids. Lipid-mediated gene delivery methods are described, for instance, in W01996/18372; WO 1993/24640; Mannino & Gould-Fogerite, BioTechniques 6(7): 682-691 (1988); U.S. Pat. No. 5,279,833; WO 1991/06309; and Feigner et al., Proc. Natl. Acad. Sci. USA 84: 7413-7414 (1987).
RNA encoding the peptide of interest (e.g., mRNA) can also be used for delivery (see, e.g., Kiken et al, 2011; Su et al, 2011; see also U.S. Pat. No. 8,278,036; Halabi et al. J Clin Oncol (2003) 21:1232-1237; Petsch et al, Nature Biotechnology 2012 Dec. 7; 30(12):1210-6).
Viral vectors as described herein can also be used to deliver the neoantigenic peptides of the invention. Vectors can be administered so as to have in vivo expression and response akin to doses and/or responses elicited by antigen administration.
A preferred means of administering nucleic acids encoding the peptide of the invention uses minigene constructs encoding multiple epitopes. To create a DNA sequence encoding the selected CTL epitopes (minigene) for expression in human cells, the amino acid sequences of the epitopes are reverse translated. A human codon usage table is used to guide the codon choice for each amino acid. These epitope-encoding DNA sequences are directly adjoined, creating a continuous polypeptide sequence. To optimize expression and/or immunogenicity, additional elements can be incorporated into the minigene design. Examples of amino acid sequence that could be reverse translated and included in the minigene sequence include: helper T lymphocyte, epitopes, a leader (signal) sequence, and an endoplasmic reticulum retention signal. In addition, MEW presentation of CTL epitopes may be improved by including synthetic (e.g. poly-alanine) or naturally-occurring flanking sequences adjacent to the CTL epitopes.
The minigene sequence is converted to DNA by assembling oligonucleotides that encode the plus and minus strands of the minigene. Overlapping oligonucleotides (30-100 bases long) are synthesized, phosphorylated, purified and annealed under appropriate conditions using well known techniques. The ends of the oligonucleotides are joined using T4 DNA ligase. This synthetic minigene, encoding the CTL epitope polypeptide, can then cloned into a desired expression vector.
Standard regulatory sequences well known to those of skill in the art are included in the vector to ensure expression in the target cells. Several vector elements are required: a promoter with a down-stream cloning site for minigene insertion; a polyadenylation signal for efficient transcription termination; an E. coli origin of replication; and an E. coli selectable marker (e.g. ampicillin or kanamycin resistance). Numerous promoters can be used for this purpose, e.g., the human cytomegalovirus (hCMV) promoter. See, U.S. Pat. Nos. 5,580,859 and 5,589,466 for other suitable promoter sequences.
Additional vector modifications may be desired to optimize minigene expression and immunogenicity. In some cases, introns are required for efficient gene expression, and one or more synthetic or naturally-occurring introns could be incorporated into the transcribed region of the minigene. The inclusion of mRNA stabilization sequences can also be considered for increasing minigene expression. It has recently been proposed that immuno stimulatory sequences (ISSs or CpGs) play a role in the immunogenicity of DNAā² vaccines. These sequences could be included in the vector, outside the minigene coding sequence, if found to enhance immunogenicity.
In some embodiments, a bicistronic expression vector, to allow production of the minigene-encoded epitopes and a second protein included to enhance or decrease immunogenicity can be used. Examples of proteins or polypeptides that could beneficially enhance the immune response if co-expressed include cytokines (e.g., IL2, IL12, GM-CSF), cytokine-inducing molecules (e.g. LeIF) or costimulatory molecules. Helper (HTL) epitopes could be joined to intracellular targeting signals and expressed separately from the CTL epitopes. This would allow direction of the HTL epitopes to a cell compartment different than the CTL epitopes. If required, this could facilitate more efficient entry of HTL epitopes into the MHC class II pathway, thereby improving CTL induction. In contrast to CTL induction, specifically decreasing the immune response by co-expression of immunosuppressive molecules (e.g. TGF-β) may be beneficial in certain diseases.
Once an expression vector is selected, the minigene is cloned into the polylinker region downstream of the promoter. This plasmid is transformed into an appropriate E. coli strain, and DNA is prepared using standard techniques. The orientation and DNA sequence of the minigene, as well as all other elements included in the vector, are confirmed using restriction mapping and DNA sequence analysis. Bacterial cells harboring the correct plasmid can be stored as a master cell bank and a working cell bank.
Purified plasmid DNA can be prepared for injection using a variety of formulations. The simplest of these is reconstitution of lyophilized DNA in sterile phosphate-buffer saline (PBS). A variety of methods have been described, and new techniques may become available. As noted herein, nucleic acids are conveniently formulated with cationic lipids. In addition, glycolipids, fusogenic liposomes, peptides and compounds referred to collectively as protective, interactive, non-condensing (PINC) could also be complexed to purified plasmid DNA to influence variables such as stability, intramuscular dispersion, or trafficking to specific organs or cell types.
Target cell sensitization can be used as a functional assay for expression and MHC class I presentation of minigene-encoded CTL epitopes. The plasmid DNA is introduced into a mammalian cell line that is suitable as a target for standard CTL chromium release assays. The transfection method used is dependent on the final formulation. Electroporation can be used for ānakedā DNA, whereas cationic lipids allow direct in vitro transfection. A plasmid expressing green fluorescent protein (GFP) can be co-transfected to allow enrichment of transfected cells using fluorescence activated cell sorting (FACS). These cells are then chromium-51 labeled and used as target cells for epitope-specific CTL lines. Cytolysis, detected by 51 Cr release, indicates production of MHC presentation of mini gene-encoded CTL epitopes.
In vivo immunogenicity is a second approach for functional testing of minigene DNA formulations. Transgenic mice expressing appropriate human MHC molecules are immunized with the DNA product. The dose and route of administration are formulation dependent (e.g. IM for DNA in PBS, IP for lipid-complexed DNA). Twenty-one days after immunization, splenocytes are harvested and restimulated for 1 week in the presence of peptides encoding each epitope being tested. These effector cells (CTLs) are assayed for cytolysis of peptide-loaded, chromium-51 labeled target cells using standard techniques. Lysis of target cells sensitized by MHC loading of peptides corresponding to minigene-encoded epitopes demonstrates DNA vaccine function for in vivo induction of CTLs.
Peptides may be used to elicit CTL ex vivo, as well. The resulting CTL, can be used to treat chronic tumors in patients in need thereof that do not respond to other conventional forms of therapy, or does not respond to a peptide vaccine approach of therapy. Ex vivo CTL responses to a particular tumor antigen are induced by incubating in tissue culture the patient's CTL precursor cells (CTLp) together with a source of antigen-presenting cells (APC) and the appropriate peptide. After an appropriate incubation time (typically 1-4 weeks), in which the CTLp are activated and mature and expand into effector CTL, the cells are infused back into the patient, where they destroy their specific target cell (i.e., a tumor cell). In order to optimize the in vitro conditions for the generation of specific cytotoxic T cells, the culture of stimulator cells are maintained in an appropriate serum-free medium.
Prior to incubation of the stimulator cells with the cells to be activated, e.g., precursor CD8+ cells, an amount of antigenic peptide is added to the stimulator cell culture, of sufficient quantity to become loaded onto the human Class I molecules to be expressed on the surface of the stimulator cells. In the present invention, a sufficient amount of peptide is an amount that allows about 200, and preferably 200 or more, human Class I MHC molecules loaded with peptide to be expressed on the surface of each stimulator cell. Preferably, the stimulator cells are incubated with >2 μg/ml peptide. For example, the stimulator cells are incubates with >3, 4, 5, 10, 15, or more μg/ml peptide.
Resting or precursor CD8+ cells are then incubated in culture with the appropriate stimulator cells for a time period sufficient to activate the CD8+ cells. Preferably, the CD8+ cells are activated in an antigen-specific manner. The ratio of resting or precursor CD8+(effector) cells to stimulator cells may vary from individual to individual and may further depend upon variables such as the amenability of an individual's lymphocytes to culturing conditions and the nature and severity of the disease condition or other condition for which the within-described treatment modality is used. Preferably, however, the lymphocyte: stimulator cell ratio is in the range of about 30:1 to 300:1. The effector/stimulator culture may be maintained for as long a time as is necessary to stimulate a therapeutically useable or effective number of CD8+ cells.
The induction of CTL in vitro requires the specific recognition of peptides that are bound to allele specific MHC class I molecules on APC. The number of specific MHC/peptide complexes per APC is crucial for the stimulation of CTL, particularly in primary immune responses. While small amounts of peptide/MHC complexes per cell are sufficient to render a cell susceptible to lysis by CTL, or to stimulate a secondary CTL response, the successful activation of a CTL precursor (pCTL) during primary response requires a significantly higher number of MHC/peptide complexes. Peptide loading of empty major histocompatability complex molecules on cells allows the induction of primary cytotoxic T lymphocyte responses.
Since mutant cell lines do not exist for every human MHC allele, it is advantageous to use a technique to remove endogenous MHC-associated peptides from the surface of APC, followed by loading the resulting empty MHC molecules with the immunogenic peptides of interest. The use of non-transformed (non-tumorigenic), noninfected cells, and preferably, autologous cells of patients as APC is desirable for the design of CTL induction protocols directed towards development of ex vivo CTL therapies. This application discloses methods for stripping the endogenous MHC-associated peptides from the surface of APC followed by the loading of desired peptides.
A stable MHC class I molecule is a trimeric complex formed of the following elements: 1) a peptide usually of 8-10 residues, 2) a transmembrane heavy polymorphic protein chain which bears the peptide-binding site in its a1 and a2 domains, and 3) a non-covalently associated non-polymorphic light chain, p2microglobuiin. Removing the bound peptides and/or dissociating the p2microglobulin from the complex renders the MHC class I molecules nonfunctional and unstable, resulting in rapid degradation. All MHC class I molecules isolated from PBMCs have endogenous peptides bound to them. Therefore, the first step is to remove all endogenous peptides bound to MHC class I molecules on the APC without causing their degradation before exogenous peptides can be added to them.
Two possible ways to free up MHC class I molecules of bound peptides include lowering the culture temperature from 37° C. to 26° C. overnight to destablize p2microglobulin and stripping the endogenous peptides from the cell using a mild acid treatment. The methods release previously bound peptides into the extracellular environment allowing new exogenous peptides to bind to the empty class I molecules. The cold-temperature incubation method enables exogenous peptides to bind efficiently to the MHC complex, but requires an overnight incubation at 26° C. which may slow the cell's metabolic rate. It is also likely that cells not actively synthesizing MHC molecules (e.g., resting PBMC) would not produce high amounts of empty surface MHC molecules by the cold temperature procedure.
Harsh acid stripping involves extraction of the peptides with trifluoroacetic acid, pH 2, or acid denaturation of the immunoaffinity purified class I-peptide complexes. These methods are not feasible for CTL induction, since it is important to remove the endogenous peptides while preserving APC viability and an optimal metabolic state which is critical for antigen presentation. Mild acid solutions of pH 3 such as glycine or citrate-phosphate buffers have been used to identify endogenous peptides and to identify tumor associated T cell epitopes. The treatment is especially effective, in that only the MHC class I molecules are destabilized (and associated peptides released), while other surface antigens remain intact, including MHC class II molecules. Most importantly, treatment of cells with the mild acid solutions do not affect the cell's viability or metabolic state. The mild acid treatment is rapid since the stripping of the endogenous peptides occurs in two minutes at 4° C. and the APC is ready to perform its function after the appropriate peptides are loaded. The technique is utilized herein to make peptide-specific APCs for the generation of primary antigen-specific CTL. The resulting APC are efficient in inducing peptide-specific CD8+ CTL.
Activated CD8+ cells may be effectively separated from the stimulator cells using one of a variety of known methods. For example, monoclonal antibodies specific for the stimulator cells, for the peptides loaded onto the stimulator cells, or for the CD8+ cells (or a segment thereof) may be utilized to bind their appropriate complementary ligand. Antibody-tagged molecules may then be extracted from the stimulator-effector cell admixture via appropriate means, e.g., via well-known immunoprecipitation or immunoassay methods.
Effective, cytotoxic amounts of the activated CD8+ cells can vary between in vitro and in vivo uses, as well as with the amount and type of cells that are the ultimate target of these killer cells. The amount can also vary depending on the condition of the patient and should be determined via consideration of all appropriate factors by the practitioner. Preferably, however, about 1Ć106 to about 1Ć1012, more preferably about 1Ć108 to about 1Ć1011, and even more preferably, about 1Ć109 to about 1Ć1010 activated CD8+ cells are utilized for adult humans, compared to about 5Ć106-5Ć107 cells used in mice.
Preferably, as discussed herein, the activated CD8+ cells are harvested from the cell culture prior to administration of the CD8+ cells to the individual being treated. It is important to note, however, that unlike other present and proposed treatment modalities, the present method uses a cell culture system that is not tumorigenic. Therefore, if complete separation of stimulator cells and activated CD8+ cells are not achieved, there is no inherent danger known to be associated with the administration of a small number of stimulator cells, whereas administration of mammalian tumor-promoting cells may be extremely hazardous.
Methods of re-introducing cellular components are known in the art and include procedures such as those exemplified in U.S. Pat. No. 4,844,893 to Honsik, et al. and U.S. Pat. No. 4,690,915 to Rosenberg. For example, administration of activated CD8+ cells via intravenous infusion is appropriate.
The practice of the present invention employs, unless otherwise indicated, conventional techniques of molecular biology (including recombinant techniques), microbiology, cell biology, biochemistry and immunology, which are well within the purview of the skilled artisan. Such techniques are explained fully in the literature, such as, āMolecular Cloning: A Laboratory Manualā, second edition (Sambrook, 1989); āOligonucleotide Synthesisā (Gait, 1984); āAnimal Cell Cultureā (Freshney, 1987); āMethods in Enzymologyā āHandbook of Experimental Immunologyā (Wei, 1996); āGene Transfer Vectors for Mammalian Cellsā (Miller and Calos, 1987); āCurrent Protocols in Molecular Biologyā (Ausubel, 1987); āPCR: The Polymerase Chain Reactionā, (Mullis, 1994); āCurrent Protocols in Immunologyā (Coligan, 1991). These techniques are applicable to the production of the polynucleotides and polypeptides of the invention, and, as such, may be considered in making and practicing the invention. Particularly useful techniques for particular embodiments are discussed in the sections that follow.
The present invention provides methods of inducing a neoplasia/tumor specific immune response in a subject, vaccinating against a neoplasia/tumor, treating and or alleviating a symptom of cancer in a subject by administering the subject a plurality of neoantigenic peptides or composition of the invention.
According to the invention, the herein-described neoplasia vaccine or immunogenic composition may be used for a patient that has been diagnosed as having cancer, or at risk of developing cancer.
The claimed combination of the invention is administered in an amount sufficient to induce a CTL response.
The tumor specific neoantigen peptides and pharmaceutical compositions described herein can also be administered in a combination therapy with another agent, for example a therapeutic agent. In certain embodiments, the additional agents can be, but are not limited to, chemotherapeutic agents, anti-angiogenesis agents and agents that reduce immune-suppression.
The neoplasia vaccine or immunogenic composition can be administered before, during, or after administration of the additional agent. In embodiments, the neoplasia vaccine or immunogenic composition is administered before the first administration of the additional agent. In other embodiments, the neoplasia vaccine or immunogenic composition is administered after the first administration of the additional therapeutic agent (e.g., 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14 days or more). In embodiments, the neoplasia vaccine or immunogenic composition is administered simultaneously with the first administration of the additional therapeutic agent.
The therapeutic agent is for example, a chemotherapeutic or biotherapeutic agent, radiation, or immunotherapy. Any suitable therapeutic treatment for a particular cancer may be administered. Examples of chemotherapeutic and biotherapeutic agents include, but are not limited to, an angiogenesis inhibitor, such ashydroxy angiostatin K1-3, DL-α-Difluoromethyl-ornithine, endostatin, fumagillin, genistein, minocycline, staurosporine, and thalidomide; a DNA intercaltor/cross-linker, such as Bleomycin, Carboplatin, Carmustine, Chlorambucil, Cyclophosphamide, cis-Diammineplatinum(II) dichloride (Cisplatin), Melphalan, Mitoxantrone, and Oxaliplatin; a DNA synthesis inhibitor, such as (±)-Amethopterin (Methotrexate), 3-Amino-1,2,4-benzotriazine 1,4-dioxide, Aminopterin, Cytosine β-D-arabinofuranoside, 5-Fluoro-5ā²-deoxyuridine, 5-Fluorouracil, Ganciclovir, Hydroxyurea, and Mitomycin C; a DNA-RNA transcription regulator, such as Actinomycin D, Daunorubicin, Doxorubicin, Homoharringtonine, and Idarubicin; an enzyme inhibitor, such as S(+)-Camptothecin, Curcumin, (ā)-Deguelin, 5,6-Dichlorobenzimidazole 1-β-D-ribofuranoside, Etoposide, Formestane, Fostriecin, Hispidin, 2-Imino-1-imidazoli-dineacetic acid (Cyclocreatine), Mevinolin, Trichostatin A, Tyrphostin AG 34, and Tyrphostin AG 879; a gene regulator, such as 5-Aza-2ā²-deoxycytidine, 5-Azacytidine, Cholecalciferol (Vitamin D3), 4-Hydroxytamoxifen, Melatonin, Mifepristone, Raloxifene, all trans-Retinal (Vitamin A aldehyde), Retinoic acid all trans (Vitamin A acid), 9-cis-Retinoic Acid, 13-cis-Retinoic acid, Retinol (Vitamin A), Tamoxifen, and Troglitazone; a microtubule inhibitor, such as Colchicine, docetaxel, Dolastatin 15, Nocodazole, Paclitaxel, Podophyllotoxin, Rhizoxin, Vinblastine, Vincristine, Vindesine, and Vinorelbine (Navelbine); and an unclassified therapeutic agent, such as 17-(Allylamino)-17-demethoxygeldanamycin, 4-Amino-1,8-naphthalimide, Apigenin, Brefeldin A, Cimetidine, Dichloromethylene-diphosphonic acid, Leuprolide (Leuprorelin), Luteinizing Hormone-Releasing Hormone, Pifithrin-α, Rapamycin, Sex hormone-binding globulin, Thapsigargin, and Urinary trypsin inhibitor fragment (Bikunin). The therapeutic agent may be altretamine, amifostine, asparaginase, capecitabine, cladribine, cisapride, cytarabine, dacarbazine (DTIC), dactinomycin, dronabinol, epoetin alpha, filgrastim, fludarabine, gemcitabine, granisetron, ifosfamide, irinotecan, lansoprazole, levamisole, leucovorin, megestrol, mesna, metoclopramide, mitotane, omeprazole, ondansetron, pilocarpine, prochloroperazine, or topotecan hydrochloride. The therapeutic agent may be a monoclonal antibody or small molecule such as rituximab (RituxanĀ®), alemtuzumab (CampathĀ®), Bevacizumab (AvastinĀ®), Cetuximab (ErbituxĀ®), panitumumab (VectibixĀ®), and trastuzumab (HerceptinĀ®), Vemurafenib (ZelborafĀ®) imatinib mesylate (GleevecĀ®), erlotinib (TarcevaĀ®), gefitinib (IressaĀ®), Vismodegib (Erivedgeā¢), 90Y-ibritumomab tiuxetan, 131I-tositumomab, ado-trastuzumab emtansine, lapatinib (TykerbĀ®), pertuzumab (Perjetaā¢), ado-trastuzumab emtansine (Kadcylaā¢) regorafenib (StivargaĀ®), sunitinib (SutentĀ®), Denosumab (XgevaĀ®), sorafenib (NexavarĀ®), pazopanib (VotrientĀ®), axitinib (InlytaĀ®), dasatinib (SprycelĀ®), nilotinib (TasignaĀ®), bosutinib (BosulifĀ®), ofatumumab (ArzerraĀ®), obinutuzumab (Gazyvaā¢), ibrutinib (Imbruvicaā¢) idelalisib (ZydeligĀ®), crizotinib (XalkoriĀ®), erlotinib (TarcevaĀ®), afatinib dimaleate (GilotrifĀ®), ceritinib (LDK378/Zykadia), Tositumomab and 131I-tositumomab (BexxarĀ®), ibritumomab tiuxetan (ZevalinĀ®), brentuximab vedotin (AdcetrisĀ®), bortezomib (VelcadeĀ®), siltuximab (Sylvantā¢), trametinib (MekinistĀ®), dabrafenib (TafinlarĀ®), pembrolizumab (KeytrudaĀ®), carfilzomib (KyprolisĀ®), Ramucirumab (Cyramzaā¢), Cabozantinib (Cometriqā¢), vandetanib (CaprelsaĀ®), Optionally, the therapeutic agent is a neoantigen. The therapeutic agent may be a cytokine such as interferons (INFs), interleukins (ILs), or hematopoietic growth factors. The therapeutic agent may be INF-α, IL-2, Aldesleukin, IL-2, Erythropoietin, Granulocyte-macrophage colony-stimulating factor (GM-CSF) or granulocyte colony-stimulating factor. The therapeutic agent may be a targeted therapy such as toremifene (FarestonĀ®), fulvestrant (FaslodexĀ®), anastrozole (ArimidexĀ®), exemestane (AromasinĀ®), letrozole (FemaraĀ®), ziv-aflibercept (ZaltrapĀ®), Alitretinoin (PanretinĀ®), temsirolimus (ToriselĀ®), Tretinoin (VesanoidĀ®), denileukin diftitox (OntakĀ®), vorinostat (ZolinzaĀ®), romidepsin (IstodaxĀ®), bexarotene (TargretinĀ®), pralatrexate (FolotynĀ®), lenaliomide (RevlimidĀ®), belinostat (Beleodagā¢) lenaliomide (RevlimidĀ®), pomalidomide (PomalystĀ®), Cabazitaxel (JevtanaĀ®), enzalutamide (XtandiĀ®), abiraterone acetate (ZytigaĀ®), radium 223 chloride (XofigoĀ®), or everolimus (AfinitorĀ®). Additionally, the therapeutic agent may be an epigenetic targeted drug such as HDAC inhibitors, kinase inhibitors, DNA methyltransferase inhibitors, histone demethylase inhibitors, or histone methylation inhibitors. The epigenetic drugs may be Azacitidine (Vidaza), Decitabine (Dacogen), Vorinostat (Zolinza), Romidepsin (Istodax), or Ruxolitinib (Jakafi). For prostate cancer treatment, a preferred chemotherapeutic agent with which anti-CTLA-4 can be combined is paclitaxel (TAXOL).
In certain embodiments, the one or more additional agents are one or more anti-glucocorticoid-induced tumor necrosis factor family receptor (GITR) agonistic antibodies. GITR is a costimulatory molecule for T lymphocytes, modulates innate and adaptive immune system and has been found to participate in a variety of immune responses and inflammatory processes. GITR was originally described by Nocentini et al. after being cloned from dexamethasone-treated murine T cell hybridomas (Nocentini et al. Proc Natl Acad Sci USA 94:6216-6221.1997). Unlike CD28 and CTLA-4, GITR has a very low basal expression on naive CD4+ and CD8+ T cells (Ronchetti et al. Eur J Immunol 34:613-622. 2004). The observation that GITR stimulation has immunostimulatory effects in vitro and induced autoimmunity in vivo prompted the investigation of the antitumor potency of triggering this pathway. A review of Modulation Of Ctla 4 And Gitr For Cancer Immunotherapy can be found in Cancer Immunology and Immunotherapy (Avogadri et al. Current Topics in Microbiology and Immunology 344. 2011). Other agents that can contribute to relief of immune suppression include checkpoint inhibitors targeted at another member of the CD28/CTLA4 Ig superfamily such as BTLA, LAG3, ICOS, PDL1 or KIR (Page et a, Annual Review of Medicine 65:27 (2014)). In further additional embodiments, the checkpoint inhibitor is targeted at a member of the TNFR superfamily such as CD40, OX40, CD137, GITR, CD27 or TIM-3. In some cases targeting a checkpoint inhibitor is accomplished with an inhibitory antibody or similar molecule. In other cases, it is accomplished with an agonist for the target; examples of this class include the stimulatory targets OX40 and GITR.
In certain embodiments, the one or more additional agents are synergistic in that they increase immunogenicity after treatment. In one embodiment the additional agent allows for lower toxicity and/or lower discomfort due to lower doses of the additional therapeutic agents or any components of the combination therapy described herein. In another embodiment the additional agent results in longer lifespan due to increased effectiveness of the combination therapy described herein. Chemotherapeutic treatments that enhance the immunological response in a patient have been reviewed (Zitvogel et al., Immunological aspects of cancer chemotherapy. Nat Rev Immunol. 2008 January; 8(1):59-73). Additionally, chemotherapeutic agents can be administered safely with immunotherapy without inhibiting vaccine specific T-cell responses (Perez et al., A new era in anticancer peptide vaccines. Cancer May 2010). In one embodiment the additional agent is administered to increase the efficacy of the therapy described herein. In one embodiment the additional agent is a chemotherapy treatment. In one embodiment low doses of chemotherapy potentiate delayed-type hypersensitivity (DTH) responses. In one embodiment the chemotheray agent targets regulatory T-cells. In one embodiment cyclophosphamide is the therapeutic agent. In one embodiment cyclophosphamide is administered prior to vaccination. In one embodiment cyclophosphamide is administered as a single dose before vaccination (Walter et al., Multipeptide immune response to cancer vaccine IMA901 after single-dose cyclophosphamide associates with longer patient survival. Nature Medicine; 18:8 2012). In another embodiment, cyclophosphamide is administered according to a metronomic program, where a daily dose is administered for one month (Ghiringhelli et al., Metronomic cyclophosphamide regimen selectively depletes CD4+CD25+ regulatory T cells and restores T and NK effector functions in end stage cancer patients. Cancer Immunol Immunother 2007 56:641-648). In another embodiment taxanes are administered before vaccination to enhance T-cell and NK-cell functions (Zitvogel et al., 2008). In another embodiment a low dose of a chemotherapeutic agent is administered with the therapy described herein. In one embodiment the chemotherapeutic agent is estramustine. In one embodiment the cancer is hormone resistant prostate cancer. A ā„50% decrease in serum prostate specific antigen (PSA) was seen in 8.7% of advanced hormone refractory prostate cancer patients by personalized vaccination alone, whereas such a decrease was seen in 54% of patients when the personalized vaccination was combined with a low dose of estramustine (Itoh et al., Personalized peptide vaccines: A new therapeutic modality for cancer. Cancer Sci 2006; 97: 970-976). In another embodiment glucocorticoids are administered with or before the therapy described herein (Zitvogel et al., 2008). In another embodiment glucocorticoids are administered after the therapy described herein. In another embodiment Gemcitabine is administered before, simultaneously, or after the therapy described herein to enhance the frequency of tumor specific CTL precursors (Zitvogel et al., 2008). In another embodiment 5-fluorouracil is administered with the therapy described herein as synergistic effects were seen with a peptide based vaccine (Zitvogel et al., 2008). In another embodiment an inhibitor of Braf, such as Vemurafenib, is used as an additional agent. Braf inhibition has been shown to be associated with an increase in melanoma antigen expression and T-cell infiltrate and a decrease in immunosuppressive cytokines in tumors of treated patients (Frederick et al., BRAF inhibition is associated with enhanced melanoma antigen expression and a more favorable tumor microenvironment in patients with metastatic melanoma. Clin Cancer Res. 2013; 19:1225-1231). In another embodiment an inhibitor of tyrosine kinases is used as an additional agent. In one embodiment the tyrosine kinase inhibitor is used before vaccination with the therapy described herein. In one embodiment the tyrosine kinase inhibitor is used simultaneously with the therapy described herein. In another embodiment the tyrosine kinase inhibitor is used to create a more immune permissive environment. In another embodiment the tyrosine kinase inhibitor is sunitinib or imatinib mesylate. It has previously been shown that favorable outcomes could be achieved with sequential administration of continuous daily dosing of sunitinib and recombinant vaccine (Farsaci et al., Consequence of dose scheduling of sunitinib on host immune response elements and vaccine combination therapy. Int J Cancer; 130: 1948-1959). Sunitinib has also been shown to reverse type-1 immune suppression using a daily dose of 50 mg/day (Finke et al., Sunitinib Reverses Type-1 Immune Suppression and Decreases T-Regulatory Cells in Renal Cell Carcinoma Patients. Clin Cancer Res 2008; 14(20)). In another embodiment targeted therapies are administered in combination with the therapy described herein. Doses of targeted therapies has been described previously (Alvarez, Present and future evolution of advanced breast cancer therapy. Breast Cancer Research 2010, 12(Suppl 2):S1). In another embodiment temozolomide is administered with the therapy described herein. In one embodiment temozolomide is administered at 200 mg/day for 5 days every fourth week of a combination therapy with the therapy described herein. Results of a similar strategy have been shown to have low toxicity (Kyte et al., Telomerase Peptide Vaccination Combined with Temozolomide: A Clinical Trial in Stage IV Melanoma Patients. Clin Cancer Res; 17(13) 2011). In another embodiment the therapy is administered with an additional therapeutic agent that results in lymphopenia. In one embodiment the additional agent is temozolomide. An immune response can still be induced under these conditions (Sampson et al., Greater chemotherapy-induced lymphopenia enhances tumor-specific immune responses that eliminate EGFRvIII-expressing tumor cells in patients with glioblastoma. Neuro-Oncology 13(3):324-333, 2011).
Patients in need thereof may receive a series of priming vaccinations with a mixture of tumor-specific peptides. Additionally, over a 4 week period the priming may be followed by two boosts during a maintenance phase. All vaccinations are subcutaneously delivered. The vaccine or immunogenic composition is evaluated for safety, tolerability, immune response and clinical effect in patients and for feasibility of producing vaccine or immunogenic composition and successfully initiating vaccination within an appropriate time frame. The first cohort can consist of 5 patients, and after safety is adequately demonstrated, an additional cohort of 10 patients may be enrolled. Peripheral blood is extensively monitored for peptide-specific T-cell responses and patients are followed for up to two years to assess disease recurrence.
Administering a Combination Therapy Consistent with Standard of Care
In another aspect, the therapy described herein provides selecting the appropriate point to administer a combination therapy in relation to and within the standard of care for the cancer being treated for a patient in need thereof. The studies described herein show that the combination therapy can be effectively administered even within the standard of care that includes surgery, radiation, or chemotherapy. The standards of care for the most common cancers can be found on the website of National Cancer Institute (www.cancer.gov/cancertopics). The standard of care is the current treatment that is accepted by medical experts as a proper treatment for a certain type of disease and that is widely used by healthcare professionals. Standard or care is also called best practice, standard medical care, and standard therapy. Standards of Care for cancer generally include surgery, lymph node removal, radiation, chemotherapy, targeted therapies, antibodies targeting the tumor, and immunotherapy. Immunotherapy can include checkpoint blockers (CBP), chimeric antigen receptors (CARs), and adoptive T-cell therapy. The combination therapy described herein can be incorporated within the standard of care. The combination therapy described herein may also be administered where the standard of care has changed due to advances in medicine.
Incorporation of the combination therapy described herein may depend on a treatment step in the standard of care that can lead to activation of the immune system. Treatment steps that can activate and function synergistically with the combination therapy have been described herein. The therapy can be advantageously administered simultaneously or after a treatment that activates the immune system.
Incorporation of the combination therapy described herein may depend on a treatment step in the standard of care that causes the immune system to be suppressed. Such treatment steps may include irradiation, high doses of alkylating agents and/or methotrexate, steroids such as glucosteroids, surgery, such as to remove the lymph nodes, imatinib mesylate, high doses of TNF, and taxanes (Zitvogel et al., 2008). The combination therapy may be administered before such steps or may be administered after.
In one embodiment the combination therapy may be administered after bone marrow transplants and peripheral blood stem cell transplantation. Bone marrow transplantation and peripheral blood stem cell transplantation are procedures that restore stem cells that were destroyed by high doses of chemotherapy and/or radiation therapy. After being treated with high-dose anticancer drugs and/or radiation, the patient receives harvested stem cells, which travel to the bone marrow and begin to produce new blood cells. A āmini-transplantā uses lower, less toxic doses of chemotherapy and/or radiation to prepare the patient for transplant. A ātandem transplantā involves two sequential courses of high-dose chemotherapy and stem cell transplant. In autologous transplants, patients receive their own stem cells. In syngeneic transplants, patients receive stem cells from their identical twin. In allogeneic transplants, patients receive stem cells from their brother, sister, or parent. A person who is not related to the patient (an unrelated donor) also may be used. In some types of leukemia, the graft-versus-tumor (GVT) effect that occurs after allogeneic BMT and PBSCT is crucial to the effectiveness of the treatment. GVT occurs when white blood cells from the donor (the graft) identify the cancer cells that remain in the patient's body after the chemotherapy and/or radiation therapy (the tumor) as foreign and attack them. Immunotherapy with the combination therapy described herein can take advantage of this by vaccinating after a transplant. Additionally, the transferred cells may be presented with neoantigens of the combination therapy described herein before transplantation.
In one embodiment the combination therapy is administered to a patient in need thereof with a cancer that requires surgery. In one embodiment the combination therapy described herein is administered to a patient in need thereof in a cancer where the standard of care is primarily surgery followed by treatment to remove possible micro-metastases, such as breast cancer. Breast cancer is commonly treated by various combinations of surgery, radiation therapy, chemotherapy, and hormone therapy based on the stage and grade of the cancer. Adjuvant therapy for breast cancer is any treatment given after primary therapy to increase the chance of long-term survival. Neoadjuvant therapy is treatment given before primary therapy. Adjuvant therapy for breast cancer is any treatment given after primary therapy to increase the chance of long-term disease-free survival. Primary therapy is the main treatment used to reduce or eliminate the cancer. Primary therapy for breast cancer usually includes surgery, a mastectomy (removal of the breast) or a lumpectomy (surgery to remove the tumor and a small amount of normal tissue around it; a type of breast-conserving surgery). During either type of surgery, one or more nearby lymph nodes are also removed to see if cancer cells have spread to the lymphatic system. When a woman has breast-conserving surgery, primary therapy almost always includes radiation therapy. Even in early-stage breast cancer, cells may break away from the primary tumor and spread to other parts of the body (metastasize). Therefore, doctors give adjuvant therapy to kill any cancer cells that may have spread, even if they cannot be detected by imaging or laboratory tests.
In one embodiment the combination therapy is administered consistent with the standard of care for Ductal carcinoma in situ (DCIS). The standard of care for this breast cancer type is:
1. Breast-conserving surgery and radiation therapy with or without tamoxifen.
2. Total mastectomy with or without tamoxifen.
3. Breast-conserving surgery without radiation therapy.
The combination therapy may be administered before breast conserving surgery or total mastectomy to shrink the tumor before surgery. In another embodiment the combination therapy can be administered as an adjuvant therapy to remove any remaining cancer cells. In another embodiment patients diagnosed with stage I, II, IIIA, and Operable IIIC breast cancer are treated with the combination therapy as described herein. The standard of care for this breast cancer type is:
1. Local-regional treatment:
2. Adjuvant radiation therapy postmastectomy in axillary node-positive tumors:
3. Adjuvant systemic therapy
In one embodiment the combination therapy is administered as a neoadjuvant therapy to shrink the tumor. In another embodiment the combination is administered as an adjuvant systemic therapy.
In another embodiment patients diagnosed with inoperable stage IIIB or IIIC or inflammatory breast cancer are treated with the combination therapy as described herein. The standard of care for this breast cancer type is:
1. Multimodality therapy delivered with curative intent is the standard of care for patients with clinical stage IIIB disease.
2. Initial surgery is generally limited to biopsy to permit the determination of histology, estrogen-receptor (ER) and progesterone-receptor (PR) levels, and human epidermal growth factor receptor 2 (HER2/neu) overexpression. Initial treatment with anthracycline-based chemotherapy and/or taxane-based therapy is standard. For patients who respond to neoadjuvant chemotherapy, local therapy may consist of total mastectomy with axillary lymph node dissection followed by postoperative radiation therapy to the chest wall and regional lymphatics. Breast-conserving therapy can be considered in patients with a good partial or complete response to neoadjuvant chemotherapy. Subsequent systemic therapy may consist of further chemotherapy. Hormone therapy should be administered to patients whose tumors are ER-positive or unknown. All patients should be considered candidates for clinical trials to evaluate the most appropriate fashion in which to administer the various components of multimodality regimens.
In one embodiment the combination therapy is administered as part of the various components of multimodality regimens. In another embodiment the combination therapy is administered before, simultaneously with, or after the multimodality regimens. In another embodiment the combination therapy is administered based on synergism between the modalities. In another embodiment the combination therapy is administered after treatment with anthracycline-based chemotherapy and/or taxane-based therapy (Zitvogel et al., 2008). Treatment after administering the combination therapy may negatively affect dividing effector T-cells. The combination therapy may also be administered after radiation.
In another embodiment the combination therapy described herein is used in the treatment in a cancer where the standard of care is primarily not surgery and is primarily based on systemic treatments, such as Chronic Lymphocytic Leukemia (CLL).
In another embodiment patients diagnosed with stage I, II, III, and IV Chronic Lymphocytic Leukemia are treated with the combination therapy as described herein. The standard of care for this cancer type is:
1. Observation in asymptomatic or minimally affected patients
2. Rituximab
3. Ofatumomab
4. Oral alkylating agents with or without corticosteroids
5. Fludarabine, 2-chlorodeoxyadenosine, or pentostatin
6. Bendamustine
7. Lenalidomide
8. Combination chemotherapy.
9. Involved-field radiation therapy.
10. Alemtuzumab
11. Bone marrow and peripheral stem cell transplantations are under clinical evaluation.
12. Ibrutinib
In one embodiment the combination therapy is administered before, simultaneously with or after treatment with Rituximab or Ofatumomab. As these are monoclonal antibodies that target B-cells, treatment with the combination therapy may be synergistic. In another embodiment the combination therapy is administered after treatment with oral alkylating agents with or without corticosteroids, and Fludarabine, 2-chlorodeoxyadenosine, or pentostatin, as these treatments may negatively affect the immune system if administered before. In one embodiment bendamustine is administered with the combination therapy in low doses based on the results for prostate cancer described herein. In one embodiment the combination therapy is administered after treatment with bendamustine.
In another embodiment, therapies targeted to specific recurrent mutations in genes that include extracellular domains are used in the treatment of a patient in need thereof suffering from cancer. The genes may advantageously be well-expressed genes. Well expressed may be expressed in ātranscripts per millionā (TPM). A TPM greater than 100 is considered well expressed. Well expressed genes may be FGFR3, ERBB3, EGFR, MUC4, PDGFRA, MMP12, TMEM52, and PODXL. The therapies may be a ligand capable of binding to an extracellular neoantigen epitope. Such ligands are well known in the art and may include therapeutic antibodies or fragments thereof, antibody-drug conjugates, engineered T cells, or aptamers. Engineered T cells may be chimeric antigen receptors (CARs). Antibodies may be fully humanized, humanized, or chimeric. The antibody fragments may be a nanobody, Fab, Fabā², (Fabā²)2, Fv, ScFv, diabody, triabody, tetrabody, Bis-scFv, minibody, Fab2, or Fab3 fragment. Antibodies may be developed against tumor-specific neoepitopes using known methods in the art.
Aspects of the invention involve the adoptive transfer of immune system cells, such as T cells, specific for selected antigens, such as tumor associated antigens (see Maus et al., 2014, Adoptive Immunotherapy for Cancer or Viruses, Annual Review of Immunology, Vol. 32: 189-225; Rosenberg and Restifo, 2015, Adoptive cell transfer as personalized immunotherapy for human cancer, Science Vol. 348 no. 6230 pp. 62-68; Restifo et al., 2015, Adoptive immunotherapy for cancer: harnessing the T cell response. Nat. Rev. Immunol. 12(4): 269-281; and Jenson and Riddell, 2014, Design and implementation of adoptive therapy with chimeric antigen receptor-modified T cells. Immunol Rev. 257(1): 127-144). Various strategies may for example be employed to genetically modify T cells by altering the specificity of the T cell receptor (TCR) for example by introducing new TCR α and β chains with selected peptide specificity (see U.S. Pat. No. 8,697,854; PCT Patent Publications: WO2003020763, WO2004033685, WO2004044004, WO2005114215, WO2006000830, WO2008038002, WO2008039818, WO2004074322, WO2005113595, WO2006125962, WO2013166321, WO2013039889, WO2014018863, WO2014083173; U.S. Pat. No. 8,088,379).
As an alternative to, or addition to, TCR modifications, chimeric antigen receptors (CARs) may be used in order to generate immunoresponsive cells, such as T cells, specific for selected targets, such as malignant cells, with a wide variety of receptor chimera constructs having been described (see U.S. Pat. Nos. 5,843,728; 5,851,828; 5,912,170; 6,004,811; 6,284,240; 6,392,013; 6,410,014; 6,753,162; 8,211,422; and, PCT Publication WO9215322). Alternative CAR constructs may be characterized as belonging to successive generations. First-generation CARs typically consist of a single-chain variable fragment of an antibody specific for an antigen, for example comprising a VL linked to a VH of a specific antibody, linked by a flexible linker, for example by a CD8α hinge domain and a CD8α transmembrane domain, to the transmembrane and intracellular signaling domains of either CD3ζ or FcRγ (scFv-CD3ζ or scFv-FcRγ; see U.S. Pat. Nos. 7,741,465; 5,912,172; 5,906,936). Second-generation CARs incorporate the intracellular domains of one or more costimulatory molecules, such as CD28, OX40 (CD134), or 4-1BB (CD137) within the endodomain (for example scFv-CD28/OX40/4-1BB-CD3ζ; see U.S. Pat. Nos. 8,911,993; 8,916,381; 8,975,071; 9,101,584; 9,102,760; 9,102,761). Third-generation CARs include a combination of costimulatory endodomains, such a CD3ζ-chain, CD97, GDI 1a-CD18, CD2, ICOS, CD27, CD154, CDS, OX40, 4-1BB, or CD28 signaling domains (for example scFv-CD28-4-1BB-CD3ζ t or scFv-CD28-OX40-CD3ζ; see U.S. Pat. Nos. 8,906,682; 8,399,645; 5,686,281; PCT Publication No. WO2014134165; PCT Publication No. WO2012079000). Alternatively, costimulation may be orchestrated by expressing CARs in antigen-specific T cells, chosen so as to be activated and expanded following engagement of their native αβTCR, for example by antigen on professional antigen-presenting cells, with attendant costimulation. In addition, additional engineered receptors may be provided on the immunoresponsive cells, for example to improve targeting of a T-cell attack and/or minimize side effects.
Alternative techniques may be used to transform target immunoresponsive cells, such as protoplast fusion, lipofection, transfection or electroporation. A wide variety of vectors may be used, such as retroviral vectors, lentiviral vectors, adenoviral vectors, adeno-associated viral vectors, plasmids or transposons, such as a Sleeping Beauty transposon (see U.S. Pat. Nos. 6,489,458; 7,148,203; 7,160,682; 7,985,739; 8,227,432), may be used to introduce CARs, for example using 2nd generation antigen-specific CARs signaling through CD3ζ and either CD28 or CD137. Viral vectors may for example include vectors based on HIV, SV40, EBV, HSV or BPV.
Cells that are targeted for transformation may for example include T cells, Natural Killer (NK) cells, cytotoxic T lymphocytes (CTL), regulatory T cells, human embryonic stem cells, tumor-infiltrating lymphocytes (TIL) or a pluripotent stem cell from which lymphoid cells may be differentiated. T cells expressing a desired CAR may for example be selected through co-culture with γ-irradiated activating and propagating cells (AaPC), which co-express the cancer antigen and co-stimulatory molecules. The engineered CAR T-cells may be expanded, for example by co-culture on AaPC in presence of soluble factors, such as IL-2 and IL-21. This expansion may for example be carried out so as to provide memory CAR+ T cells (which may for example be assayed by non-enzymatic digital array and/or multi-panel flow cytometry). In this way, CAR T cells may be provided that have specific cytotoxic activity against antigen-bearing tumors (optionally in conjunction with production of desired chemokines such as interferon-γ). CART cells of this kind may for example be used in animal models, for example to treat tumor xenografts.
Approaches such as the foregoing may be adapted to provide methods of treating and/or increasing survival of a subject having a disease, such as a neoplasia, for example by administering an effective amount of an immunoresponsive cell comprising an antigen recognizing receptor that binds a selected antigen, wherein the binding activates the immunoreponsive cell, thereby treating or preventing the disease (such as a neoplasia, a pathogen infection, an autoimmune disorder, or an allogeneic transplant reaction).
In one embodiment, the treatment can be administrated into patients undergoing an immunosuppressive treatment. The cells or population of cells, may be made resistant to at least one immunosuppressive agent due to the inactivation of a gene encoding a receptor for such immunosuppressive agent. Not being bound by a theory, the immunosuppressive treatment should help the selection and expansion of the immunoresponsive or T cells according to the invention within the patient.
The administration of the cells or population of cells according to the present invention may be carried out in any convenient manner, including by aerosol inhalation, injection, ingestion, transfusion, implantation or transplantation. The cells or population of cells may be administered to a patient subcutaneously, intradermally, intratumorally, intranodally, intramedullary, intramuscularly, by intravenous or intralymphatic injection, or intraperitoneally. In one embodiment, the cell compositions of the present invention are preferably administered by intravenous injection.
The administration of the cells or population of cells can consist of the administration of 104-109 cells per kg body weight, preferably 105 to 106 cells/kg body weight including all integer values of cell numbers within those ranges. Dosing in CAR T cell therapies may for example involve administration of from 106 to 109 cells/kg, with or without a course of lymphodepletion, for example with cyclophosphamide. The cells or population of cells can be administrated in one or more doses. In another embodiment, the effective amount of cells are administrated as a single dose. In another embodiment, the effective amount of cells are administrated as more than one dose over a period time. Timing of administration is within the judgment of managing physician and depends on the clinical condition of the patient. The cells or population of cells may be obtained from any source, such as a blood bank or a donor. While individual needs vary, determination of optimal ranges of effective amounts of a given cell type for a particular disease or conditions are within the skill of one in the art. An effective amount means an amount which provides a therapeutic or prophylactic benefit. The dosage administrated will be dependent upon the age, health and weight of the recipient, kind of concurrent treatment, if any, frequency of treatment and the nature of the effect desired.
In another embodiment, the effective amount of cells or composition comprising those cells are administrated parenterally. The administration can be an intravenous administration. The administration can be directly done by injection within a tumor.
To guard against possible adverse reactions, engineered immunoresponsive cells may be equipped with a transgenic safety switch, in the form of a transgene that renders the cells vulnerable to exposure to a specific signal. For example, the herpes simplex viral thymidine kinase (TK) gene may be used in this way, for example by introduction into allogeneic T lymphocytes used as donor lymphocyte infusions following stem cell transplantation (Greco, et al., Improving the safety of cell therapy with the TK-suicide gene. Front. Pharmacol. 2015; 6: 95). In such cells, administration of a nucleoside prodrug such as ganciclovir or acyclovir causes cell death. Alternative safety switch constructs include inducible caspase 9, for example triggered by administration of a small-molecule dimerizer that brings together two nonfunctional icasp9 molecules to form the active enzyme. A wide variety of alternative approaches to implementing cellular proliferation controls have been described (see U.S. Patent Publication No. 20130071414; PCT Patent Publication WO2011146862; PCT Patent Publication WO2014011987; PCT Patent Publication WO2013040371; Zhou et al. BLOOD, 2014, 123/25:3895-3905; Di Stasi et al., The New England Journal of Medicine 2011; 365:1673-1683; Sadelain M, The New England Journal of Medicine 2011; 365:1735-173; Ramos et al., Stem Cells 28(6):1107-15 (2010)).
In a further refinement of adoptive therapies, genome editing may be used to tailor immunoresponsive cells to alternative implementations, for example providing edited CAR T cells (see Poirot et al., 2015, Multiplex genome edited T-cell manufacturing platform for āoff-the-shelfā adoptive T-cell immunotherapies, Cancer Res 75 (18): 3853). Cells may be edited using any DNA targeting protein, including, but not limited to a CRISPR system, Zinc Finger binding protein, TALE or TALEN as known in the art. DNA targeting proteins may be delivered to an immune cell by any method known in the art. In preferred embodiments, cells are edited ex vivo and transferred to a subject in need thereof. Immunoresponsive cells, CAR T cells or any cells used for adoptive cell transfer may be edited. Editing may be performed to eliminate potential alloreactive T-cell receptors (TCR), disrupt the target of a chemotherapeutic agent, block an immune checkpoint, activate a T cell, and/or increase the differentiation and/or proliferation of functionally exhausted or dysfunctional CD8+ T-cells (see PCT Patent Publications: WO2013176915, WO2014059173, WO2014172606, WO2014184744, and WO2014191128). Editing may result in inactivation of a gene.
By inactivating a gene it is intended that the gene of interest is not expressed in a functional protein form. In a particular embodiment, the CRISPR system specifically catalyzes cleavage in one targeted gene thereby inactivating said targeted gene. The nucleic acid strand breaks caused are commonly repaired through the distinct mechanisms of homologous recombination or non-homologous end joining (NHEJ). However, NHEJ is an imperfect repair process that often results in changes to the DNA sequence at the site of the cleavage. Repair via non-homologous end joining (NHEJ) often results in small insertions or deletions (Indel) and can be used for the creation of specific gene knockouts. Cells in which a cleavage induced mutagenesis event has occurred can be identified and/or selected by well-known methods in the art.
T cell receptors (TCR) are cell surface receptors that participate in the activation of T cells in response to the presentation of antigen. The TCR is generally made from two chains, α and β, which assemble to form a heterodimer and associates with the CD3-transducing subunits to form the T cell receptor complex present on the cell surface. Each α and β chain of the TCR consists of an immunoglobulin-like N-terminal variable (V) and constant (C) region, a hydrophobic transmembrane domain, and a short cytoplasmic region. As for immunoglobulin molecules, the variable region of the α and β chains are generated by V(D)J recombination, creating a large diversity of antigen specificities within the population of T cells. However, in contrast to immunoglobulins that recognize intact antigen, T cells are activated by processed peptide fragments in association with an MHC molecule, introducing an extra dimension to antigen recognition by T cells, known as MHC restriction. Recognition of MHC disparities between the donor and recipient through the T cell receptor leads to T cell proliferation and the potential development of graft versus host disease (GVHD). The inactivation of TCRα or TCRβ can result in the elimination of the TCR from the surface of T cells preventing recognition of alloantigen and thus GVHD. However, TCR disruption generally results in the elimination of the CD3 signaling component and alters the means of further T cell expansion.
Allogeneic cells are rapidly rejected by the host immune system. It has been demonstrated that, allogeneic leukocytes present in non-irradiated blood products will persist for no more than 5 to 6 days (Boni, Muranski et al. 2008 Blood 1; 112(12):4746-54). Thus, to prevent rejection of allogeneic cells, the host's immune system usually has to be suppressed to some extent. However, in the case of adoptive cell transfer the use of immunosuppressive drugs also have a detrimental effect on the introduced therapeutic T cells. Therefore, to effectively use an adoptive immunotherapy approach in these conditions, the introduced cells would need to be resistant to the immunosuppressive treatment. Thus, in a particular embodiment, the present invention further comprises a step of modifying T cells to make them resistant to an immunosuppressive agent, preferably by inactivating at least one gene encoding a target for an immunosuppressive agent. An immunosuppressive agent is an agent that suppresses immune function by one of several mechanisms of action. An immunosuppressive agent can be, but is not limited to a calcineurin inhibitor, a target of rapamycin, an interleukin-2 receptor α-chain blocker, an inhibitor of inosine monophosphate dehydrogenase, an inhibitor of dihydrofolic acid reductase, a corticosteroid or an immunosuppressive antimetabolite. The present invention allows conferring immunosuppressive resistance to T cells for immunotherapy by inactivating the target of the immunosuppressive agent in T cells. As non-limiting examples, targets for an immunosuppressive agent can be a receptor for an immunosuppressive agent such as: CD52, glucocorticoid receptor (GR), a FKBP family gene member and a cyclophilin family gene member.
Immune checkpoints are inhibitory pathways that slow down or stop immune reactions and prevent excessive tissue damage from uncontrolled activity of immune cells. In certain embodiments, the immune checkpoint targeted is the programmed death-1 (PD-1 or CD279) gene (PDCD1). In other embodiments, the immune checkpoint targeted is cytotoxic T-lymphocyte-associated antigen (CTLA-4). In additional embodiments, the immune checkpoint targeted is another member of the CD28 and CTLA4 Ig superfamily such as BTLA, LAG3, ICOS, PDL1 or KIR. In further additional embodiments, the immune checkpoint targeted is a member of the TNFR superfamily such as CD40, OX40, CD137, GITR, CD27 or TIM-3.
Additional immune checkpoints include Src homology 2 domain-containing protein tyrosine phosphatase 1 (SHP-1) (Watson H A, et al., SHP-1: the next checkpoint target for cancer immunotherapy? Biochem Soc Trans. 2016 Apr. 15; 44(2):356-62). SHP-1 is a widely expressed inhibitory protein tyrosine phosphatase (PTP). In T-cells, it is a negative regulator of antigen-dependent activation and proliferation. It is a cytosolic protein, and therefore not amenable to antibody-mediated therapies, but its role in activation and proliferation makes it an attractive target for genetic manipulation in adoptive transfer strategies, such as chimeric antigen receptor (CAR) T cells. Immune checkpoints may also include T cell immunoreceptor with Ig and ITIM domains (TIGIT/Vstm3/WUCAM/VSIG9) and VISTA (Le Mercier I, et al., (2015) Beyond CTLA-4 and PD-1, the generation Z of negative checkpoint regulators. Front. Immunol. 6:418).
WO2014172606 relates to the use of MT1 and/or MT1 inhibitors to increase proliferation and/or activity of exhausted CD8+ T-cells and to decrease CD8+ T-cell exhaustion (e.g., decrease functionally exhausted or unresponsive CD8+ immune cells). In certain embodiments, metallothioneins are targeted by gene editing in adoptively transferred T cells.
In certain embodiments, targets of gene editing may be at least one targeted locus involved in the expression of an immune checkpoint protein. Such targets may include, but are not limited to CTLA4, PPP2CA, PPP2CB, PTPN6, PTPN22, PDCD1, ICOS (CD278), PDL1, KIR, LAG3, HAVCR2, BTLA, CD160, TIGIT, CD96, CRTAM, LAIR1, SIGLEC7, SIGLEC9, CD244 (2B4), TNFRSF10B, TNFRSF10A, CASP8, CASP10, CASP3, CASP6, CASP7, FADD, FAS, TGFBRII, TGFRBRI, SMAD2, SMAD3, SMAD4, SMAD10, SKI, SKIL, TGIF1, IL10RA, IL10RB, HMOX2, IL6R, IL6ST, EIF2AK4, CSK, PAG1, SIT1, FOXP3, PRDM1, BATF, VISTA, GUCY1A2, GUCY1A3, GUCY1B2, GUCY1B3, MT1, MT2, CD40, OX40, CD137, GITR, CD27, SHP-1 or TIM-3. In preferred embodiments, the gene locus involved in the expression of PD-1 or CTLA-4 genes is targeted. In other preferred embodiments, combinations of genes are targeted, such as but not limited to PD-1 and TIGIT.
In other embodiments, at least two genes are edited. Pairs of genes may include, but are not limited to PD1 and TCRα, PD1 and TCRβ, CTLA-4 and TCRα, CTLA-4 and TCRβ, LAG3 and TCRα, LAG3 and TCRβ, Tim3 and TCRα, Tim3 and TCRβ, BTLA and TCRα, BTLA and TCRβ, BY55 and TCRα, BY55 and TCRβ, TIGIT and TCRα, TIGIT and TCRβ, B7H5 and TCRα, B7H5 and TCRβ, LAIR1 and TCRα, LAIR1 and TCRβ, SIGLEC10 and TCRα, SIGLEC10 and TCRβ, 2B4 and TCRα, 2B4 and TCRβ.
Whether prior to or after genetic modification of the T cells, the T cells can be activated and expanded generally using methods as described, for example, in U.S. Pat. Nos. 6,352,694; 6,534,055; 6,905,680; 5,858,358; 6,887,466; 6,905,681; 7,144,575; 7,232,566; 7,175,843; 5,883,223; 6,905,874; 6,797,514; 6,867,041; and 7,572,631. T cells can be expanded in vitro or in vivo.
Selecting the Patient Population Most Likely to Benefit from the Therapy
In another aspect, the invention provides selecting for the patients in need thereof most likely to benefit from the therapy of the present invention. Although the compositions and methods of the present invention are typically applicable in a high proportion of subjects suffering from cancer, the method may still comprise one or more steps of selecting patients from the patient population who are likely to benefit. For instance, the method may comprise selecting subjects whose tumors contain one or more of the mutations represented in the neoantigenic peptides in the composition. In another embodiment, the method may comprise selecting subjects having at least one HLA allele which binds to one or more neoepitopes represented in the neoantigenic peptides in the composition.
In an aspect, the invention provides kits containing any one or more of the elements discussed herein to allow administration of the therapy. Elements may be provided individually or in combinations, and may be provided in any suitable container, such as a vial, a bottle, or a tube. In some embodiments, the kit includes instructions in one or more languages, for example in more than one language. In some embodiments, a kit comprises one or more reagents for use in a process utilizing one or more of the elements described herein. Reagents may be provided in any suitable container. For example, a kit may provide one or more delivery or storage buffers. Reagents may be provided in a form that is usable in a particular process, or in a form that requires addition of one or more other components before use (e.g. in concentrate or lyophilized form). A buffer can be any buffer, including but not limited to a sodium carbonate buffer, a sodium bicarbonate buffer, a borate buffer, a Tris buffer, a MOPS buffer, a HEPES buffer, and combinations thereof. In some embodiments, the buffer is alkaline. In some embodiments, the buffer has a pH from about 7 to about 10. In some embodiments, the kit comprises one or more of the vectors, proteins and/or one or more of the polynucleotides described herein. The kit may advantageously allow the provision of all elements of the systems of the invention. Kits can involve vector(s) and/or particle(s) and/or nanoparticle(s) containing or encoding RNA(s) for 1-50 or more neoantigen mutations to be administered to an animal, mammal, primate, rodent, etc., with such a kit including instructions for administering to such a eukaryote; and such a kit can optionally include any of the anti-cancer agents described herein. The kit may include any of the components above (e.g. vector(s) and/or particle(s) and/or nanoparticle(s) containing or encoding RNA(s) for 1-50 or more neoantigen mutations, neoantigen proteins or peptides) as well as instructions for use with any of the methods of the present invention.
In one embodiment the kit contains at least one vial with an immunogenic composition or vaccine. In one embodiment the kit contains at least one vial with an immunogenic composition or vaccine and at least one vial with an anticancer agent. In one embodiment kits may comprise ready to use components that are mixed and ready to administer. In one aspect a kit contains a ready to use immunogenic or vaccine composition and a ready to use anti-cancer agent. The ready to use immunogenic or vaccine composition may comprise separate vials containing different pools of immunogenic compositions. The immunogenic compositions may comprise one vial containing a viral vector or DNA plasmid and the other vial may comprise immunogenic protein. The ready to use anticancer agent may comprise a cocktail of anticancer agents or a single anticancer agent. Separate vials may contain different anti-cancer agents. In another embodiment a kit may contain a ready to use anti-cancer agent and an immunogenic composition or vaccine in a ready to be reconstituted form. The immunogenic or vaccine composition may be freeze dried or lyophilized. The kit may comprise a separate vial with a reconstitution buffer that can be added to the lyophilized composition so that it is ready to administer. The buffer may advantageously comprise an adjuvant or emulsion according to the present invention. In another embodiment the kit may comprise a ready to reconstitute anti-cancer agent and a ready to reconstitute immunogenic composition or vaccine. In this aspect both may be lyophilized. In this aspect separate reconstitution buffers for each may be included in the kit. The buffer may advantageously comprise an adjuvant or emulsion according to the present invention. In another embodiment the kit may comprise single vials containing a dose of immunogenic composition and anti-cancer agent that are administered together. In another aspect multiple vials are included so that one vial is administered according to a treatment timeline. One vial may only contain the anti-cancer agent for one dose of treatment, another may contain both the anti-cancer agent and immunogenic composition for another dose of treatment, and one vial may only contain the immunogenic composition for yet another dose. In a further aspect the vials are labeled for their proper administration to a patient in need thereof. The immunogen or anti-cancer agents of any embodiment may be in a lyophilized form, a dried form or in aqueous solution as described herein. The immunogen may be a live attenuated virus, protein, or nucleic acid as described herein.
In one embodiment the anticancer agent is one that enhances the immune system to enhance the effectiveness of the immunogenic composition or vaccine. In a preferred embodiment the anti-cancer agent is a checkpoint inhibitor. In another embodiment the kit contains multiple vials of immunogenic compositions and anti-cancer agents to be administered at different time intervals along a treatment plan. In another embodiment the kit may comprise separate vials for an immunogenic composition for use in priming an immune response and another immunogenic composition to be used for boosting. In one aspect the priming immunogenic composition could be DNA or a viral vector and the boosting immunogenic composition may be protein. Either composition may be lyophilized or ready for administering. In another embodiment different cocktails of anti-cancer agents containing at least one anti-cancer agent are included in different vials for administration in a treatment plan.
Although the present invention and its advantages have been described in detail, it should be understood that various changes, substitutions and alterations can be made herein without departing from the spirit and scope of the invention as defined in the appended claims.
The present invention will be further illustrated in the following Examples which are given for illustration purposes only and are not intended to limit the invention in any way.
sPDL1 Generates Immunogenic Epitopes Across a Variety of HLA Alleles.
PDL1 (CD274) is a trans-membrane protein which interacts with PD1 (CD279; PDCD1) on T cells and may be involved in multiple forms of natural immune suppression (such as during gestation). Expression of PDL1 is also utilized by tumor cells as a way to evade host immune response. sPDL1 is an alternate spliced form of the PDL1 gene. This alternate spliced form is caused by a lack of splicing at the end of Exon 4, reading into the 4th intron. The transcript terminates within intron 4. The translation product is in frame for 18 amino acids before a stop codon is encountered.
The translated product lacks the transmembrane domain typically found in PDL1 and thus is secreted. It also contains a cysteine within the neoORF translated from the intron and appears to dimerize in the media. The secreted form appears to block binding between PDL1 and PD1.
Applicants analyzed the predicted binding possibilities for 9 and 10mer peptides containing the neoORF region encoded by the intron. The analysis is shown for predicted 9mer peptides Table 1. The values highlighted in yellow are alleles that are present at a frequency >5% in the indicated population. Notably, the common HLA allele A0210 in the Caucasian population is predicted to have a reasonably tight binding peptide. A similar analysis shows that 10mer peptides are also predicted to be potentially immunogenic, including for the A0201 allele (85 nM). Tumor cells expressing the alternate form of the PDL1 message would be thus rendered as targets of the immune system.
These peptides could be utilized across multiple patients (either HLA-restricted or more broadly if the patient is expected to have some probability to contain a relevant HLA allele) as a āShared Neoantigenā. Note that given the relatively short size of the neoORF region of sPDL1, two or three long overlapping peptides could be used as a mixture, allowing targeting of any HLA allele, even rare alleles, and reducing the need to prepare a different product for each patient based on their HLA type.
This neoORF may also contain a CD4 epitope although prediction algorithms for CD4 epitopes are not highly accurate. The presence of a CD4 epitope could be assessed in vitro with naive T cells or in patient samples.
| TABLEā1 |
| (SEQāIDāNOSā1-23,ārespectively,āināorderāofāappearance) |
| peptide | affinity | Cauca- | |||||
| HLA | 9mers | (nM) | sian | Black | Asian | Hispanic | ENHTAELVIPGNILNVSIKICLTLSPST |
| A0201 | VIPGNILNV | 182 | 28.3% | 11.4% | ā9.7% | 19.7% | |
| B4001 | AELVIPGNI | 144 | ā4.0% | ā1.0% | 12.0% | ā1.3% | |
| A3201 | NILNVSIKI | 491 | ā3.2% | ā1.6% | ā0.3% | ā2.6% | |
| A3201 | VSIKICLTL | 224 | ā3.2% | ā1.6% | ā0.3% | ā2.6% | |
| A2301 | VSIKICLTL | 468 | ā2.3% | 11.6% | ā0.2% | ā3.5% | |
| B4002 | AELVIPGNI | ā53 | ā1.6% | ā0.3% | ā7.6% | ā5.0% | |
| B4901 | AELVIPGNI | 108 | ā1.4% | ā3.1% | ā0.0% | ā2.3% | |
| B4102 | AELVIPGNI | 192 | ā1.0% | ā0.6% | ā0.0% | ā0.5% | |
| A0205 | VIPGNILNV | 170 | ā0.8% | ā2.3% | ā0.1% | ā1.4% | |
| B5801 | VSIKICLTL | 373 | ā0.8% | ā4.3% | ā4.5% | ā1.3% | |
| A6802 | HTAELVIPG | 170 | ā0.7% | ā6.4% | ā0.0% | ā2.4% | |
| B4405 | AELVIPGNI | 219 | ā0.6% | ā0.0% | ā0.0% | ā0.2% | |
| B4101 | AELVIPGNI | ā92 | ā0.5% | ā0.6% | ā0.0% | ā1.1% | |
| B4501 | AELVIPGNI | 302 | ā0.4% | ā5.3% | ā0.0% | ā1.5% | |
| B1517 | VSIKICLTL | ā23 | ā0.3% | ā0.5% | ā0.1% | ā0.6% | |
| A0206 | VIPGNILNV | ā85 | ā0.2% | ā0.0% | ā4.7% | ā4.1% | |
| A0202 | VIPGNILNV | ā90 | ā0.1% | ā4.4% | ā0.0% | ā0.7% | |
| A6901 | HTAELVIPG | 283 | ā0.1% | ā0.1% | ā0.0% | ā0.5% | |
| A6901 | NILNVSIKI | 162 | ā0.1% | ā0.1% | ā0.0% | ā0.5% | |
| B1503 | IKICLTLSP | 408 | ā0.1% | ā6.5% | ā0.1% | ā1.5% | |
| B1503 | VSIKICLTL | 138 | ā0.1% | ā6.5% | ā0.1% | ā1.5% | |
| A0203 | VIPGNILNV | ā98 | ā0.0% | ā0.0% | ā5.2% | ā0.0% | |
Androgen Receptor Generates Immunogenic Epitopes Across a Variety of HLA Alleles.
The androgen receptor was identified as another alternate spliced form of a message that results in a neoORF which may be specifically expressed in tumor cells. Alternate splicing results in at least two isoforms that bring in cryptic exons that are.neoORFs.
Of these alternate transcripts, AR-V1 and AR-V7 were consistently seen in hormone resistant prostate cancer samples.
The immunogenic potential of these neoORFs was unknown and thus Applicants conducted predicted binding analysis across a number of common HLA alleles. These are shown for HLA A alleles (Table 2).
| TABLEā2ā |
| (SEQāIDāNOSā24,ā27,ā28,ā30,ā25,ā29,ā31,ā26,ā32,ā33,ā41,ā43,ā45,ā34,ā42,ā44,ā46, |
| 35,ā47,ā36,ā48,ā37,ā49āandā38-40,ārespectively,āināorderāofāappearance) |
| A0201 | A0301 | A1101 | A3001 | ||||
| Caucasian | 28.30% | 13.70% | ā6.00% | 1.60% | |||||||||||
| Asian | ā9.70% | ā0.90% | 22.40% | 1.40% | |||||||||||
| Hispanic | 19.65% | ā7.59% | ā4.88% | 2.20% | |||||||||||
| Black | 11.40% | ā7.10% | ā1.00% | 6.50% | |||||||||||
| RVFGVS | SEQ2 | 233 | RVGNC | SEQ1 | 122 | RVGN | SEQ1 | ā33 | SEQ1 | ā30 | |||||
| EWL | KHLK | CKHL | |||||||||||||
| K | |||||||||||||||
| GMTLG | SEQ2 | 282 | VVVS | SEQ2 | 359 | KFRV | SEQ1 | 103 | |||||||
| AVVV | ERILR | GNC | |||||||||||||
| KH | |||||||||||||||
| MTLGE | SEQ1 | 400 | KFRV | SEQ1 | 190 | ||||||||||
| KFRV | GNCK | ||||||||||||||
| HL | |||||||||||||||
| A3101 | A3201 | A3301 | A6801 | A | B | ||
| 2.40% | 3.20% | 0.70% | 3.40% | 30.30% | ā6.80% | Caucasian | |||||||||
| 3.40% | 0.30% | 0.60% | 0.30% | 28.70% | 19.70% | Asian | |||||||||
| 4.72% | 2.62% | 1.97% | 4.46% | 26.46% | ā7.86% | Hispanic | |||||||||
| 1.00% | 1.60% | 1.70% | 3.20% | 20.40% | ā2.10% | Black | |||||||||
| SEQ1 | ā70 | RVFGVS | SEQ2 | ā41 | NCK | SEQ1 | 385 | VVVS | SEQ2 | ā47 | |||||
| EWL | HLK | ERIL | |||||||||||||
| MTR | R | ||||||||||||||
| TLGAVV | SEQ2 | 121 | ILRVFG | SEQ2 | 255 | TLG | SEQ2 | 417 | TLGA | SEQ2 | ā84 | ||||
| VSER | VSEW | AVV | VVVS | ||||||||||||
| VSE | ER | ||||||||||||||
| R | |||||||||||||||
| VVVSERI | SEQ2 | 127 | EAGM | SEQ1 | 230 | ||||||||||
| LR | TLGE | ||||||||||||||
| K | |||||||||||||||
| GMTLGE | SEQ1 | 199 | LGAV | SEQ2 | 268 | ||||||||||
| KFR | VVSE | ||||||||||||||
| R | |||||||||||||||
| AVVVSE | SEQ2 | 230 | AVVV | SEQ2 | 339 | ||||||||||
| RILR | SERIL | ||||||||||||||
| R | |||||||||||||||
| AGMTLG | SEQ1 | 284 | |||||||||||||
| EKFR | |||||||||||||||
| GNCKHL | SEQ1 | 466 | |||||||||||||
| KMTR | |||||||||||||||
| LGAVVV | SEQ2 | 488 | |||||||||||||
| SER | |||||||||||||||
Again, as for sPDL1, a number of peptides are predicted to be immunogenic binders and these can be applied across a large subset of patients. These immunogenic peptides can be used across multiple patients.
Drug Resistant Mutations.
Treatment with various chemotherapeutic agents, particularly with targeted therapies such as tyrosine kinase inhibitors, frequently leads to new mutations in the target molecules that resist the activity of the therapeutic. Multiple strategies to overcome this resistance are being evaluated, including development of second generation therapies that are not affected by these mutations and treatment with multiple agents including those that act downstream of the resistance mutation.
Applicants have evaluated the immunogenic potential of the mutated peptides created by these resistance mutations and have found that for some, predicted immunogenic peptides are created that can bind to a range of HLA alleles. Two specific examples are provided below as well as data for a range of resistance variants.
A very common mutation to ibrutinib, a molecule targeting Bruton's Tyrosine Kinase (BTK) and used for CLL and certain lymphomas, is a Cysteine to Serine change at position 481. This change produces a number of binding peptides which bind to a range of HLA molecules.
Shown are results of binding predictions for 9mer peptides. Similar binding peptides can be found for 10mer peptides (Table 3). Only peptides with mutant predicted affinity below 150 nM are included. Expanding the range of peptides up to 500 nM would also significantly increase the number of HLA range.
| TABLEā3ā |
| (SEQāIDāNOSā50-72,ārespectively,āināorderāofāappearance) |
| affinity | affinity | ||||||
| HLA | peptide | (nM)āMUT | (nM)āNAT | Caucasian | Black | Asian | Hispanic |
| A0201 | SLLNYLREM | 97 | 278 | 28.3% | 11.4% | 9.7% | 19.7% |
| A2402 | EYMANGSLL | 95 | 120 | 9.3% | 2.0% | 23.1% | 12.4% |
| B1801 | TEYMANGSL | 80 | 252 | 6.1% | 3.5% | 0.4% | 4.1% |
| B1501 | MANGSLLNY | 91 | 158 | 5.8% | 0.8% | 12.1% | 2.6% |
| B3501 | MANGSLLNY | 17 | 17 | 5.6% | 6.1% | 2.4% | 6.0% |
| B4001 | TEYMANGSL | 10 | 24 | 4.0% | 1.0% | 12.0% | 1.3% |
| A3101 | LLNYLREMR | 43 | 206 | 2.4% | 1.0% | 3.4% | 4.7% |
| A2301 | EYMANGSLL | 122 | 133 | 2.3% | 11.6% | 0.2% | 3.5% |
| A2902 | MANGSLLNY | 17 | 10 | 2.0% | 4.4% | 0.0% | 4.1% |
| B4002 | TEYMANGSL | 45 | 110 | 1.6% | 0.3% | 7.6% | 5.0% |
| B4102 | TEYMANGSL | 133 | 341 | 1.0% | 0.6% | 0.0% | 0.5% |
| B5801 | MANGSLLNY | 40 | 35 | 0.8% | 4.3% | 4.5% | 1.3% |
| A3301 | LLNYLREMR | 91 | 188 | 0.7% | 1.7% | 0.6% | 2.0% |
| A3002 | MANGSLLNY | 16 | 15 | 0.5% | 6.6% | 0.0% | 2.8% |
| A6804 | EYMANGSLL | 47 | 448 | 0.0% | 0.0% | 0.0% | 0.0% |
| B1801 | TEYMANGSL | 44 | 252 | 6.1% | 3.5% | 0.4% | 4.1% |
| B1501 | MANGSLLNY | 42 | 158 | 5.8% | 0.8% | 12.1% | 2.6% |
| B3501 | MANGSLLNY | 40 | 17 | 5.6% | 6.1% | 2.4% | 6.0% |
| B4001 | TEYMANGSL | 38 | 24 | 4.0% | 1.0% | 12.0% | 1.3% |
| A3101 | LLNYLREMR | 36 | 206 | 2.4% | 1.0% | 3.4% | 4.7% |
| A2301 | EYMANGSLL | 34 | 133 | 2.3% | 11.6% | 0.2% | 3.5% |
| A2902 | MANGSLLNY | 32 | 10 | 2.0% | 4.4% | 0.0% | 4.1% |
| B4002 | TEYMANGSL | 30 | 110 | 1.6% | 0.3% | 7.6% | 5.0% |
Such peptide immunogens are preferably utilized prophylactically (prior to detection of resistant disease) to induce an immunogenic response capable of killing any pre-existing or newly mutated cells or could also be used at the time of detection of disease recurrence following or during therapy. These peptides could be utilized across multiple patients (either HLA-restricted or more broadly if the patient is expected with some probability to contain a relevant HLA allele).
Erlotinib, which targets the tyrosine kinase domain of the Epidermal Growth Factor Receptor (EGFR), is commonly used in the treatment of lung cancer and resistant tumors invariably develop following therapy. A common mutation found in resistant clones is a Threonine to methionine mutation at position 790. This change produces a number of binding peptides which bind to a range of HLA molecules (Table 4).
| TABLEā4ā |
| (SEQāIDāNOSā73,ā74,ā74-76,ā73,ā73,ā78,ā78,ā78,ā78,ā78,ā79,ā80, |
| 78,ā77āandā77,ārespectively,āināorderāofāappearance) |
| SUM | |||||||||||||
| Caucasian | 2.3% | 3.9% | 4.0% | 3.2% | 3.2% | 17% | |||||||
| Black | 11.6% | 0.3% | 1.5% | 1.6% | 1.6% | 17% | |||||||
| Asian | 0.2% | 0.0% | 3.9% | 0.3% | 0.3% | ā5% | |||||||
| Hisāanic | 3.5% | 0.9% | 2.8% | 2.6% | 2.6% | 12% | |||||||
| A2301 | A2501 | A2601 | A3201 | A3201 |
| VQLIMQLMPF | 366 | STVQLIMQLM | 125 | STVQLIMQLM | ā67 | QLIMQLMPF | 155 | QLIMQLMPF | 155 | ||||
| VQLIMQLMPF | 426 | VQLIMQLMPF | 426 | ||||||||||
| Caucasian | 4.2% | 5.8% | 2.9% | 1.4% | 0.4% | 1.6% | 16% | ||||||
| Black | 1.2% | 0.8% | 0.1% | 0.3% | 0.1% | 0.3% | ā3% | ||||||
| Asian | 1.2% | 12.1% | 0.2% | 2.4% | 0.0% | 7.6% | 24% | ||||||
| Hispanic | 1.2% | 2.6% | 1.8% | 1.0% | 2.2% | 5.0% | 14% | ||||||
| B1302 | B1501 | B3801 | B3901 | B3906 | B4002 |
| MQLMPFGCLL | 125 | MQLMPFGCLL | 488 | MQLMPFGCLL | 400 | MQLMPFGCLL | 213 | MQLMPFGCLL | 400 | MQLMPFGCL | 221 | ||
| QUMQLMPF | ā23 | MQLMPFGCLL | 103 | ||||||||||
| VQLIMQLMPF | ā73 | VQLIMQLMPF | 365 | ||||||||||
As stated herein, such peptide immunogens are ideally utilized prophylactically (prior to detection of resistant disease) to induce an immunogenic response capable of killing any pre-existing or newly mutated cells or are also used at the time of detection of disease recurrence following or during therapy. These peptides could be utilized across multiple patients (either HLA-restricted or more broadly if the patient is expected with some probability to contain a relevant HLA allele).
Note that as an immunogen, only a single long peptide containing the mutated amino acid and at least 10 amino acids on either side of the mutated amino acid would be sufficient to contain all the epitopes listed. Thus, all the HLA alleles shown, as well as any additional alleles that have not been shown in this analysis would be covered. For the Caucasian population, the HLA A alleles shown represent 17% of the population distribution of alleles and the HLA B alleles represent 16% of the population distribution of alleles. As each individual has two HLA A alleles and two HLA B alleles, approximately 50% of Caucasian patients will be expected to have at least one of the alleles shown and thus benefit from immune therapy with a vaccine targeting this molecule. This rationale also applies to any other single amino acid mutation discussed herein.
In addition to the specific resistance cases discussed herein, there are many other observed resistance mutations to targeted therapy. Each of these are also used to define immunogenic epitopes that could be utilized as vaccine for immunotherapy targeting those cells containing the resistance mutations (Table 5).
| TABLE 5 | ||||
| Drug | Gene | Resistance rr | Sensitive | Refs |
| Imatinib | BCR-Abl | T315I | http://www.mycancergenome.org/content/disease/chronic-myeloid-leukemia/ | |
| Imatinib | BCR-Abl | Y253H | http.//www.mycancergenome.org/content/disease/chronic-myeloid-leukemia/ | |
| Imatinib | BCR-Abl | E255K | http.//www.mycancergenome.org/content/disease/chronic-myeloid-leukemia/ | |
| Imatinib | BCR-Abl | E255V | http://www.mycancergenome.org/content/disease/chronic-myeloid-leukemia/ | |
| Imatinib | c-kit | T670I | http://www.mycancergenome.org/content/disease/gist/kit/50/ | |
| Erlotinib/gefitinib | PIK3CA | E545K | PMC1570180; PMC3132801 | |
| Erlotinib/gefitinib | HER2 | G776(YVMA) | PMID 16843263; 15753357 | |
| Erlotinib/gefitinib | EML4-ALK | G1269A | http://www.ncbi.nlm.nih.gov/pubmed/22235099?dopt=Abstract | |
| Crizotinib | KRAS | G12V/D | http://www.ncbi.nlm.nih.gov/pubmed/22235099?dopt=Abstract | |
| Crizotinib | ALK | L1196M | http://stm.sciencemag.org/content/4/120/120ra17 | |
| Crizotinib | ALK | G1202R | http://stm.sciencemag.org/content/4/120/120ra17 | |
| Crizotinib | ALK | S1206Y | http://stm.sciencemag.org/content/4/120/120ra17 | |
| Crizotinib | ALK | 1151T(ins) | http://stm.sciencemag.org/content/4/120/120ra17 | |
| Crizotinib | ALK | F1174C | http://cancerdiscovery.aacrjournals.org/content/4/6/662 | |
| Crizotinib | ROS1 | G2032R | http.//www.nejm.org/doi/full/10.1056/NEJMoa1215530 | |
| Crizotinib | PIK3CA | E542K | http://www.mycancergenome.org/content/disease/breast-cancer/ | |
| Trastuzumab | Her2 | E545K | http://www.mycancergenome.org/content/disease/breast-cancer/ | |
| Trastuzumab | Hwe2 | H1047R | http://www.mycancergenome.org/content/disease/breast-cancer/ | |
| Trastuzumab | AKT1 | E17K | http://www.ncbi.nlm.nih.gov/pmc/articles/PMC2834432/ | |
| Trastuzumab | BRAF | V600E | ||
| Vemurafenib | MEK1 | Q56P | http://www.ncbi.nlm.nih.gov/pubmed/23569304 | |
| Vemurafenib | MEK1 | E203K | http://www.ncbi.nlm.nih.gov/pubmed/23569304 | |
| Vemurafenib | MEK1 | C121S | http://cancerdiscovery.aacrjournals.org/content/4/1/94.1ong | |
| Vemurafenib | NRAS | Q61K/L | http://www.ncbi.nlm.nih.gov/pubmed/23569304 | |
| Vemurafenib | NRAS | Q61R | http://cancerdiscovery.aacrjournals.org/content/4/1/94.1ong | |
| Vemurafenib | NRAS | T58I | http://cancerdiscovery.aacrjournals.org/content/4/1/94.1ong | |
| Vemurafenib | MEK2 | C125S | http://cancerdiscovery.aacrjournals.org/content/4/1/94.1ong | |
| Vemurafenib | MEK1 | V60E | http://cancerdiscovery.aacrjournals.org/content/4/1/94.1ong | |
| RAF/MEK | MEK1 | G128V | http://cancerdiscovery.aacrjournals.org/content/4/1/94.1ong | |
| RAF/MEK | MEK1 | V154I | http://cancerdiscovery.aacrjournals.org/content/4/1/94.1ong | |
| RAF/MEK | MEK1 | P124S | http://cancerdiscovery.aacrjournals.org/content/4/1/94.1ong | |
| RAF/MEK | MEK1 | P124L | http://cancerdiscovery.aacrjournals.org/content/4/1/94.1ong | |
| RAF/MEK | RAC1 | P29S | http://cancerdiscovery.aacrjournals.org/content/4/1/94.1ong | |
| RAF/MEK | ESR1 | S463P | http://www.mycancergenome.org/content/disease/breast-cancer/er/314/ | |
| Antiestrogen therapy | AR | V534E | http://www.mycancergenome.org/content/disease/breast-cancer/er/314/ | |
| Antiestrogen therapy | AR | P535H | http.//www.mycancergenome.org/content/disease/breast-cancer/er/314/ | |
| Antiestrogen therapy | AR | L536Q | http.//www.mycancergenome.org/content/disease/breast-cancer/er/314/ | |
| Antiestrogen therapy | AR | L536R | http://www.mycancergenome.org/content/disease/breast-cancer/er/314/ | |
| Antiestrogen therapy | AR | Y537C | http://www.mycancergenome.org/content/disease/breast-cancer/er/314/ | |
| Antiestrogen therapy | AR | Y537S | http://www.mycancergenome.org/content/disease/breast-cancer/er/314/ | |
| Antiestrogen therapy | AR | Y537N | http://www.mycancergenome.org/content/disease/breast-cancer/er/314/ | |
| Antiestrogen therapy | AR | D538G | http://www.mycancergenome.org/content/disease/breast-cancer/er/314/ | |
| Antiestrogen therapy | AR | F876L | http://cancerdiscovery.aacrjournals.org/content/early/2013/06/18/2159-8290.CD-13-0226 | |
A number of these examples have been used to predict immunogenic epitopes. These results are summarized in Table 6, in which for each resistance mutation, the number of potential binding peptides (with predicted affinity <500 nM) for each mutation are shown for multiple Human HLA alleles.
| TABLE 6 | |||||||||||
| ABL1:p.T315I | ALK:p.F1174C | ALK:p.F1174L | ALK:p.G1202R | ALK:p.G1269A | ALK:p.L1196M | ALK:p.S1206Y | AR:p.F876L | ||||
| RES 500 | Caucasian | Black | Asian | 80 | 80 | 80 | 80 | 80 | 80 | 80 | 80 |
| hla_a_01_01 | 0.143 | 0.047 | 0.012 | 1 | |||||||
| hla_a_02_01 | 0.283 | 0.114 | 0.097 | 1 | 2 | ||||||
| hla_a_02_03 | 0 | 0 | 0.052 | 1 | 2 | 2 | |||||
| hla_a_02_07 | 0 | 0 | 0.08 | 1 | |||||||
| hla_a_03_01 | 0.137 | 0.071 | 0.009 | 1 | 1 | ||||||
| hla_a_11_01 | 0.06 | 0.01 | 0.224 | 1 | 1 | 2 | |||||
| hla_a_23_01 | 0.023 | 0.116 | 0.002 | 2 | |||||||
| hla_a_24_02 | 0.093 | 0.02 | 0.231 | 1 | |||||||
| hla_a_30_01 | 0.016 | 0.065 | 0.014 | 1 | 1 | 2 | 1 | 1 | 1 | ||
| hla_a_30_02 | 0.005 | 0.066 | 0 | 2 | 2 | ||||||
| hla_a_33_03 | 0.004 | 0.041 | 0.072 | 3 | 1 | 3 | |||||
| hla_a_68_02 | 0.007 | 0.064 | 0 | ||||||||
| hla_a_74_01 | 0 | 0.051 | 0.001 | 1 | 1 | 1 | |||||
| hla_b_07_02 | 0.118 | 0.062 | 0.015 | 2 | 1 | ||||||
| hla_b_08_01 | 0.098 | 0.039 | 0.002 | 1 | |||||||
| hla_b_15_01 | 0.058 | 0.008 | 0.121 | 1 | 1 | 3 | 1 | ||||
| hla_b_15_02 | 0 | 0 | 0.066 | 1 | 2 | 3 | 1 | ||||
| hla_b_15_03 | 0.001 | 0.065 | 0.001 | 5 | 3 | 3 | 2 | 4 | 4 | 4 | |
| hla_b_18_01 | 0.061 | 0.035 | 0.004 | 2 | 1 | 1 | 1 | ||||
| hla_b_35_01 | 0.056 | 0.061 | 0.024 | 3 | 1 | 1 | 2 | 2 | |||
| hla_b_40_01 | 0.04 | 0.01 | 0.12 | 3 | 1 | 1 | 1 | 1 | |||
| hla_b_40_02 | 0.016 | 0.003 | 0.076 | 3 | 1 | 1 | 1 | 1 | 1 | 2 | |
| hla_b_42_01 | 0 | 0.057 | 0 | 2 | |||||||
| hla_b_44_02 | 0.071 | 0.014 | 0.002 | 1 | 1 | ||||||
| hla_b_45_01 | 0.004 | 0.053 | 0 | 1 | 1 | ||||||
| hla_b_46_01 | 0 | 0 | 0.082 | 1 | |||||||
| hla_b_51_01 | 0.051 | 0.021 | 0.04 | 2 | |||||||
| hla_b_53_01 | 0.003 | 0.11 | 0 | 1 | 1 | ||||||
| BTK:p.C481S | EGFR:p.T790M | KRAS:p.G12D | MAP2K1:p.C121S | MAP2K1:p.E203K | MAP2K1:p.G128V | MAP2K1:p.P124L | MAP2K1:p.P124S | ||||
| RES 500 | Caucasian | Black | Asian | 80 | 80 | 80 | 80 | 80 | 80 | 80 | 80 |
| hla_a_01_01 | 0.143 | 0.047 | 0.012 | 2 | 1 | 1 | 2 | ||||
| hla_a_02_01 | 0.283 | 0.114 | 0.097 | 1 | 2 | 1 | 1 | 3 | 2 | 1 | |
| hla_a_02_03 | 0 | 0 | 0.052 | 2 | 1 | 2 | 1 | 3 | 2 | 1 | |
| hla_a_02_07 | 0 | 0 | 0.08 | ||||||||
| hla_a_03_01 | 0.137 | 0.071 | 0.009 | 1 | 1 | ||||||
| hla_a_11_01 | 0.06 | 0.01 | 0.224 | 2 | 2 | 1 | |||||
| hla_a_23_01 | 0.023 | 0.116 | 0.002 | 1 | 2 | 1 | 1 | 2 | |||
| hla_a_24_02 | 0.093 | 0.02 | 0.231 | 1 | 1 | 1 | 1 | ||||
| hla_a_30_01 | 0.016 | 0.065 | 0.014 | 1 | 1 | ||||||
| hla_a_30_02 | 0.005 | 0.066 | 0 | 2 | 3 | 2 | 3 | 4 | 5 | ||
| hla_a_33_03 | 0.004 | 0.041 | 0.072 | 2 | 1 | ||||||
| hla_a_68_02 | 0.007 | 0.064 | 0 | 1 | 2 | 1 | 1 | 1 | |||
| hla_a_74_01 | 0 | 0.051 | 0.001 | 1 | |||||||
| hla_b_07_02 | 0.118 | 0.062 | 0.015 | 2 | |||||||
| hla_b_08_01 | 0.098 | 0.039 | 0.002 | ||||||||
| hla_b_15_01 | 0.058 | 0.008 | 0.121 | 3 | 2 | 2 | 1 | 3 | 1 | 2 | |
| hla_b_15_02 | 0 | 0 | 0.066 | 3 | 2 | 2 | 1 | 3 | 3 | 3 | |
| hla_b_15_03 | 0.001 | 0.065 | 0.001 | 8 | 7 | 7 | 2 | 6 | 8 | 8 | |
| hla_b_18_01 | 0.061 | 0.035 | 0.004 | 2 | 1 | 1 | 1 | ||||
| hla_b_35_01 | 0.056 | 0.061 | 0.024 | 3 | 1 | 2 | 1 | 3 | 3 | ||
| hla_b_40_01 | 0.04 | 0.01 | 0.12 | 2 | 1 | 2 | 1 | 1 | 1 | ||
| hla_b_40_02 | 0.016 | 0.003 | 0.076 | 2 | 3 | 3 | 1 | 1 | 1 | ||
| hla_b_42_01 | 0 | 0.057 | 0 | ||||||||
| hla_b_44_02 | 0.071 | 0.014 | 0.002 | ||||||||
| hla_b_45_01 | 0.004 | 0.053 | 0 | 2 | 1 | 1 | 1 | ||||
| hla_b_46_01 | 0 | 0 | 0.082 | 3 | 1 | 1 | 1 | 1 | |||
| hla_b_51_01 | 0.051 | 0.021 | 0.04 | 1 | 1 | ||||||
| hla_b_53_01 | 0.003 | 0.11 | 0 | 2 | 2 | ||||||
| MAP2K1:p.056P | MAP2K1:p.V154I | MAP2K1:p.V60E | MAP2K2:p.C125S | MAP2K2:p.L46F | MAP2K2:p.N126D | MAP2K2:p.V35M | NRAS:p.Q61R | ||||
| RES 500 | Caucasian | Black | Asian | 80 | 80 | 80 | 80 | 80 | 80 | 80 | 80 |
| hla_a_01_01 | 0.143 | 0.047 | 0.012 | 1 | |||||||
| hla_a_02_01 | 0.283 | 0.114 | 0.097 | 1 | 1 | 1 | 1 | ||||
| hla_a_02_03 | 0 | 0 | 0.052 | 1 | 1 | 1 | 1 | ||||
| hla_a_02_07 | 0 | 0 | 0.08 | ||||||||
| hla_a_03_01 | 0 137 | 0.071 | 0.009 | 1 | |||||||
| hla_a_11_01 | 0.06 | 0.01 | 0.224 | 1 | 1 | ||||||
| hla_a_23_01 | 0.023 | 0.116 | 0.002 | ||||||||
| hla_a_24_02 | 0.093 | 0.02 | 0.231 | ||||||||
| hla_a_30_01 | 0.016 | 0.065 | 0.014 | 2 | 1 | 1 | |||||
| hla_a_30_02 | 0.005 | 0.066 | 0 | 3 | 4 | 1 | |||||
| hla_a_33_03 | 0.004 | 0.041 | 0.072 | 1 | |||||||
| hla_a_68_02 | 0.007 | 0.064 | 0 | 1 | 1 | ||||||
| hla_a_74_01 | 0 | 0.051 | 0.001 | ||||||||
| hla_b_07_02 | 0.118 | 0.062 | 0.015 | 1 | |||||||
| hla_b_08_01 | 0.098 | 0.039 | 0.002 | 1 | 2 | 1 | 1 | ||||
| hla_b_15_01 | 0.058 | 0.008 | 0.121 | 2 | 2 | ||||||
| hla_b_15_02 | 0 | 0 | 0.066 | 7 | 2 | 5 | 1 | 3 | |||
| hla_b_15_03 | 0.001 | 0.065 | 0.001 | 1 | 1 | ||||||
| hla_b_18_01 | 0.061 | 0.035 | 0.004 | 2 | 2 | ||||||
| hla_b_35_01 | 0.056 | 0.061 | 0.024 | 2 | 1 | 1 | |||||
| hla_b_40_01 | 0.04 | 0.01 | 0.12 | 3 | 1 | 1 | |||||
| hla_b_40_02 | 0.016 | 0.003 | 0.076 | ||||||||
| hla_b_42_01 | 0 | 0.057 | 0 | ||||||||
| hla_b_44_02 | 0.071 | 0.014 | 0.002 | 2 | 1 | ||||||
| hla_b_45_01 | 0.034 | 0.053 | 0 | 1 | |||||||
| hla_b_46_01 | 0 | 0 | 0.082 | ||||||||
| hla_b_51_01 | 0.051 | 0.021 | 0.04 | ||||||||
| hla_b_53_01 | 0.033 | 0.11 | 0 | ||||||||
| NRAS:p.T58I | PIK3CA:p.E545K | PLCG2:p.R665W | ROS1:p.G2032A | ||||
| RES 500 | Caucasian | Black | Asian | 80 | 80 | 80 | 80 |
| hla_a_01_01 | 0.143 | 0.047 | 0.012 | 1 | 1 | ||
| hla_a_02_01 | 0.283 | 0.114 | 0.097 | 1 | 2 | 3 | |
| hla_a_02_03 | 0 | 0 | 0.052 | 1 | 3 | 3 | |
| hla_a_02_07 | 0 | 0 | 0.08 | ||||
| hla_a_03_01 | 0.137 | 0.071 | 0.009 | ||||
| hla_a_11_01 | 0.06 | 0.01 | 0.224 | 2 | |||
| hla_a_23_01 | 0.023 | 0.116 | 0.002 | ||||
| hla_a_24_02 | 0.093 | 0.02 | 0.231 | ||||
| hla_a_30_01 | 0.016 | 0.065 | 0.014 | 1 | |||
| hla_a_30_02 | 0.005 | 0.066 | 0 | 1 | 1 | 2 | |
| hla_a_33_03 | 0.004 | 0.041 | 0.072 | 1 | |||
| hla_a_68_02 | 0.007 | 0.064 | 0 | 1 | 2 | ||
| hla_a_74_01 | 0 | 0.051 | 0.001 | ||||
| hla_b_07_02 | 0.118 | 0.062 | 0.015 | ||||
| hla_b_08_01 | 0.098 | 0.039 | 0.002 | ||||
| hla_b_15_01 | 0.058 | 0.008 | 0.121 | 1 | 2 | ||
| hla_b_15_02 | 0 | 0 | 0.066 | 1 | 2 | ||
| hla_b_15_03 | 0.001 | 0.065 | 0.001 | 3 | 2 | 4 | 5 |
| hla_b_18_01 | 0.061 | 0.035 | 0.004 | 1 | 2 | ||
| hla_b_35_01 | 0.056 | 0.061 | 0.024 | 1 | 1 | ||
| hla_b_40_01 | 0.04 | 0.01 | 0.12 | 3 | |||
| hla_b_40_02 | 0.016 | 0.003 | 0.076 | 1 | 3 | ||
| hla_b_42_01 | 0 | 0.057 | 0 | ||||
| hla_b_44_02 | 0.071 | 0.014 | 0.002 | 1 | 2 | 2 | |
| hla_b_45_01 | 0.004 | 0.053 | 0 | ||||
| hla_b_46_01 | 0 | 0.082 | 1 | ||||
| hla_b_51_01 | 0.051 | 0.021 | 0.04 | 1 | |||
| hla_b_53_01 | 0.003 | 0.11 | 0 | 1 | |||
In all of the above examples, predictions are only shown for a subset of HLA alleles. These are often but not exclusively the most abundant alleles in each ethnic population. Additional alleles are readily predicted.
Moreover, for a given immunization designed to attack resistant variants for a given resistance mutation, multiple peptides, each targeting a separate possible resistance variant that may arise, are utilized to benefit the broadest set of patients.
Cancer Subtype Specific Immunogenic Compositions.
Table 7 shows a data summary for the number of mutations found within a population of samples specific to a cancer subtype. Each mutation found within the data set for each disease leads to at least one predicted binder to any one of 33 HLA alleles selected based on being found in at least 5% of any one of the three ethnic populations (Caucasian, Black, Asian). A combination of neoantigenic peptides derived from polypeptides resulting from these mutations can be used in an immunogenic composition. Based on the number of peptides from the mutations selected, a larger percentage of patients may receive a benefit from the vaccine. Table 7 shows the number of mutations that are recurrent in each cancer specific data set. Also shown are the percentage of subjects in each data set that will have at least a single mutation when selecting recurrent mutations. For example, an immunogenic composition for SKCM that includes neoantigenic peptides derived from 64 recurrent mutations described herein covers 90.91% of patients in this population, whereby each subject will contain at least one of the neoantigenic mutations.
| TABLE 7 | |||||
| recurrence | # samples | ||||
| (muts that | # | that have | |||
| occur in | unique | at least one | |||
| Exemplary | ā„ given | muts in | mutation in | total # | |
| disease | # samples | the set | the set | samples | percentage |
| SKCM | 5 | 64 | 230 | 253 | 90.91 |
| SKCM | 4 | 200 | 241 | 253 | 95.26 |
| SKCM | 3 | 707 | 247 | 253 | 97.63 |
| SKCM | 2 | 4437 | 250 | 253 | 98.81 |
| SKCM | 1 | 103732 | 253 | 253 | 100 |
| ACC | 5 | 161 | 90 | 90 | 100 |
| ACC | 4 | 219 | 90 | 90 | 100 |
| ACC | 3 | 299 | 90 | 90 | 100 |
| ACC | 2 | 546 | 90 | 90 | 100 |
| ACC | 1 | 10310 | 90 | 90 | 100 |
| BLCA | 5 | 6 | 35 | 130 | 26.92 |
| BLCA | 4 | 9 | 47 | 130 | 36.15 |
| BLCA | 3 | 26 | 77 | 130 | 59.23 |
| BLCA | 2 | 181 | 121 | 130 | 93.08 |
| BLCA | 1 | 25605 | 130 | 130 | 100 |
| BRCA | 5 | 18 | 320 | 888 | 36.04 |
| BRCA | 4 | 25 | 337 | 888 | 37.95 |
| BRCA | 3 | 35 | 357 | 888 | 40.2 |
| BRCA | 2 | 148 | 475 | 888 | 53.49 |
| BRCA | 1 | 31457 | 886 | 888 | 99.77 |
| CESC | 5 | 4 | 46 | 194 | 23.71 |
| CESC | 4 | 7 | 55 | 194 | 28.35 |
| CESC | 3 | 12 | 65 | 194 | 33.51 |
| CESC | 2 | 145 | 133 | 194 | 68.56 |
| CESC | 1 | 25585 | 194 | 194 | 100 |
| CRC | 5 | 15 | 132 | 233 | 56.65 |
| CRC | 4 | 22 | 142 | 233 | 60.94 |
| CRC | 3 | 53 | 160 | 233 | 68.67 |
| CRC | 2 | 711 | 209 | 233 | 89.7 |
| CRC | 1 | 55287 | 233 | 233 | 100 |
| DLBCL | 5 | 0 | 0 | 58 | 0 |
| DLBCL | 4 | 2 | 8 | 58 | 13.79 |
| DLBCL | 3 | 4 | 13 | 58 | 22.41 |
| DLBCL | 2 | 30 | 38 | 58 | 65.52 |
| DLBCL | 1 | 7435 | 57 | 58 | 98.28 |
| HNSC | 5 | 10 | 83 | 384 | 21.61 |
| HNSC | 4 | 15 | 97 | 384 | 25.26 |
| HNSC | 3 | 27 | 123 | 384 | 32.03 |
| HNSC | 2 | 154 | 227 | 384 | 59.11 |
| HNSC | 1 | 43143 | 384 | 384 | 100 |
| KICH | 5 | 0 | 0 | 66 | 0 |
| KICH | 4 | 0 | 0 | 66 | 0 |
| KICH | 3 | 0 | 0 | 66 | 0 |
| KICH | 2 | 24 | 33 | 66 | 50 |
| KICH | 1 | 2576 | 66 | 66 | 100 |
| KIRP | 5 | 9 | 68 | 161 | 42.24 |
| KIRP | 4 | 18 | 86 | 161 | 53.42 |
| KIRP | 3 | 35 | 104 | 161 | 64.6 |
| KIRP | 2 | 117 | 139 | 161 | 86.34 |
| KIRP | 1 | 10482 | 161 | 161 | 100 |
| LIHC | 5 | 2 | 13 | 198 | 6.57 |
| LIHC | 4 | 5 | 25 | 198 | 12.63 |
| LIHC | 3 | 10 | 38 | 198 | 19.19 |
| LIHC | 2 | 33 | 73 | 198 | 36.87 |
| LIHC | 1 | 18574 | 198 | 198 | 100 |
| LUAD | 5 | 11 | 134 | 401 | 33.42 |
| LUAD | 4 | 17 | 152 | 401 | 37.91 |
| LUAD | 3 | 35 | 185 | 401 | 46.13 |
| LUAD | 2 | 611 | 330 | 401 | 82.29 |
| LUAD | 1 | 101222 | 399 | 401 | 99.5 |
| MM | 5 | 6 | 49 | 205 | 23.9 |
| MM | 4 | 8 | 55 | 205 | 26.83 |
| MM | 3 | 16 | 71 | 205 | 34.63 |
| MM | 2 | 51 | 101 | 205 | 49.27 |
| MM | 1 | 7116 | 204 | 205 | 99.51 |
| PRAD | 5 | 24 | 104 | 261 | 39.85 |
| PRAD | 4 | 38 | 133 | 261 | 50.96 |
| PRAD | 3 | 83 | 174 | 261 | 66.67 |
| PRAD | 2 | 205 | 213 | 261 | 81.61 |
| PRAD | 1 | 10174 | 261 | 261 | 100 |
| STAD | 5 | 150 | 141 | 289 | 48.79 |
| STAD | 4 | 245 | 156 | 289 | 53.98 |
| STAD | 3 | 613 | 201 | 289 | 69.55 |
| STAD | 2 | 2729 | 269 | 289 | 93.08 |
| STAD | 1 | 97578 | 289 | 289 | 100 |
| TGCT | 5 | 14 | 80 | 155 | 51.61 |
| TGCT | 4 | 25 | 99 | 155 | 63.87 |
| TGCT | 3 | 64 | 124 | 155 | 80 |
| TGCT | 2 | 338 | 149 | 155 | 96.13 |
| TGCT | 1 | 7632 | 155 | 155 | 100 |
| THCA | 5 | 5 | 283 | 405 | 69.88 |
| THCA | 4 | 5 | 283 | 405 | 69.88 |
| THCA | 3 | 7 | 287 | 405 | 70.86 |
| THCA | 2 | 31 | 300 | 405 | 74.07 |
| THCA | 1 | 4439 | 405 | 405 | 100 |
| UCS | 5 | 2 | 9 | 56 | 16.07 |
| UCS | 4 | 10 | 31 | 56 | 55.36 |
| UCS | 3 | 19 | 41 | 56 | 73.21 |
| UCS | 2 | 55 | 53 | 56 | 94.64 |
| UCS | 1 | 3805 | 56 | 56 | 100 |
| CLL | 5 | 6 | 46 | 263 | 17.49 |
| CLL | 4 | 19 | 74 | 263 | 28.14 |
| CLL | 3 | 38 | 100 | 263 | 38.02 |
| CLL | 2 | 157 | 167 | 263 | 63.5 |
| CLL | 1 | 7870 | 263 | 263 | 100 |
| GBM | 5 | 14 | 100 | 291 | 34.36 |
| GBM | 4 | 24 | 125 | 291 | 42.96 |
| GBM | 3 | 45 | 153 | 291 | 52.58 |
| GBM | 2 | 221 | 252 | 291 | 86.6 |
| GBM | 1 | 14142 | 291 | 291 | 100 |
| KIRC | 5 | 4 | 25 | 417 | 6 |
| KIRC | 4 | 8 | 41 | 417 | 9.83 |
| KIRC | 3 | 23 | 78 | 417 | 18.71 |
| KIRC | 2 | 291 | 292 | 417 | 70.02 |
| KIRC | 1 | 17725 | 417 | 417 | 100 |
| LAML | 5 | 11 | 93 | 196 | 47.45 |
| LAML | 4 | 12 | 95 | 196 | 48.47 |
| LAML | 3 | 16 | 101 | 196 | 51.53 |
| LAML | 2 | 27 | 114 | 196 | 58.16 |
| LAML | 1 | 1458 | 195 | 196 | 99.49 |
| LUSC | 5 | 2 | 14 | 178 | 7.87 |
| LUSC | 4 | 4 | 22 | 178 | 12.36 |
| LUSC | 3 | 15 | 50 | 178 | 28.09 |
| LUSC | 2 | 130 | 138 | 178 | 77.53 |
| LUSC | 1 | 42062 | 178 | 178 | 100 |
| OV | 5 | 10 | 72 | 316 | 22.78 |
| OV | 4 | 12 | 80 | 316 | 25.32 |
| OV | 3 | 14 | 86 | 316 | 27.22 |
| OV | 2 | 56 | 151 | 316 | 47.78 |
| OV | 1 | 12840 | 316 | 316 | 100 |
| PAAD | 5 | 53 | 146 | 146 | 100 |
| PAAD | 4 | 69 | 146 | 146 | 100 |
| PAAD | 3 | 123 | 146 | 146 | 100 |
| PAAD | 2 | 398 | 146 | 146 | 100 |
| PAAD | 1 | 23715 | 146 | 146 | 100 |
| UCEC | 5 | 30 | 168 | 248 | 67.74 |
| UCEC | 4 | 81 | 196 | 248 | 79.03 |
| UCEC | 3 | 302 | 217 | 248 | 87.5 |
| UCEC | 2 | 2797 | 237 | 248 | 95.56 |
| UCEC | 1 | 112636 | 248 | 248 | 100 |
| COAD | 5 | 3 | 19 | 70 | 27.14% |
| COAD | 4 | 7 | 20 | 70 | 28.57% |
| COAD | 3 | 11 | 25 | 70 | 35.71% |
| COAD | 2 | 84 | 44 | 70 | 62.86% |
| COAD | 1 | 16670 | 70 | 70 | 100.00% |
| READ | 5 | 0 | 0 | 39 | 0.00% |
| READ | 4 | 2 | 8 | 39 | 20.51% |
| READ | 3 | 5 | 16 | 39 | 41.03% |
| READ | 2 | 33 | 29 | 39 | 74.36% |
| READ | 1 | 12132 | 39 | 39 | 100.00% |
Table 8 shows the specific recurrent mutations for each cancer subtype, as well as the peptides that each mutation generates and the flanking peptide that includes the peptides (āACCā, āBLCAā, āBRCAā, āCESCā, āCOADā, āCLLā, āCRCā, āDLBCLā, āGBMā, āHNSCā, āKICHā, āKIRCā, āKIRPā, āLAMLā, āLIHCā, āLUADā, āLUSCā, āMMā, āOVā, āPAADā, āPRADā, āREADā, āSKCMā, āSTADā, āTGCTā, āTHCAā, āUCECā, and āUCSā). Frameshift muations are denoted with a āfsā. āDelā and āInsā indicate deletions and inserts. The number of peptides that are generated from each mutation that binds to a specific HLA allele are shown. The recurrent mutations include frameshift mutations and create HLA binders across many alleles.
| Lengthy table referenced here |
| US20200368337A1-20201126-T00001 |
| Please refer to the end of the specification for access instructions. |
Recurrent Mutations for Cancer Subtype Specific Immunogenic Compositions.
The Cancer Genome Atlas (TCGA) contains comprehensive large-scale genome sequencing data from tumor samples to catalogue genetic mutations responsible for cancer. Tumor-specific neoantigenic peptides for use in an immunogenic composition can be selected based on a number of criteria. The first criteria is based on gene expression. The fraction of patients (per tumor type) who express the gene at >10 transcripts per million was determined. Estimates assume a random assortment of HLA type vs. mutation status of each gene vs. gene expression (per tumor type). National yearly incidence was used to quantify the population that could be treated with each peptide. Peptides were ranked by expected population. The results of the analysis is shown in Table 9.
| TABLEā9 | ||||
| MutantāSequence | ||||
| (SEQāIDāNOSā | ||||
| 33503-33732,ā | RelevantāTumor | Presenting | ||
| respectively, | Estimated | Types | HLAs | |
| ināorderāof | Yearly | (>500āpatients | (predicted | |
| Mutation | appearance) | Population | perāyear) | <500ānM) |
| RBM14āp.AAAAAAA286del | VTAASTSYY | 19282 | PancreaticāCancer | HLA.A01.01 |
| (uc009yrj.2) | HLA.A03.01 | |||
| HLA.A11.01 | ||||
| HLA.A26.01 | ||||
| HLA.A26.02 | ||||
| HLA.A26.03 | ||||
| HLA.A29.02 | ||||
| HLA.A68.01 | ||||
| HLA.A80.01 | ||||
| HLA.B15.01 | ||||
| HLA.B15.03 | ||||
| HLA.B15.17 | ||||
| HLA.B58.01 | ||||
| HRASāp.G12Dā(uc001lpv.2) | KLVVVGADGV | 16466 | ColorectalāCancer | HLA.A02.01 |
| KRASāp.G12Dā(uc001rgp.1) | PancreaticāCancer | HLA.A02.03 | ||
| NRASāp.G12Dā(uc009wgu.2) | UterineāCorpus | HLA.A02.06 | ||
| Endometrial | ||||
| Carcinoma | ||||
| NRASāp.G12Vā(uc009wgu.2) | KLVVVGAVGV | 13995 | ColorectalāCancer | HLA.A02.01 |
| KRASāp.G12Vā(uc001rgp.1) | Lung | HLA.A02.03 | ||
| Adenocarcinoma | HLA.A02.06 | |||
| PancreaticāCancer | ||||
| UterineāCorpus | ||||
| Endonnetrial | ||||
| Carcinoma | ||||
| NRASāp.G12Vā(uc009wgu.2) | VVGAVGVGK | 11278 | ColorectalāCancer | HLA.A03.01 |
| KRASāp.G12Vā(uc001rgp.1) | Lung | HLA.A11.01 | ||
| Adenocarcinoma | ||||
| PancreaticāCancer | ||||
| UterineāCorpus | ||||
| Endonnetrial | ||||
| Carcinoma | ||||
| KRASāp.G12Cā(uc001rgp.1) | KLVVVGACGV | 7538 | ColorectalāCancer | HLA.A02.01 |
| NRASāp.G12Cā(uc009wgu.2) | Lung | HLA.A02.03 | ||
| HRASāp.G12Cā(uc001Ipv.2) | Adenocarcinoma | HLA.A02.06 | ||
| KRASāp.G12Cā(uc001rgp.1) | VVGACGVGK | 5751 | ColorectalāCancer | HLA.A03.01 |
| NRASāp.G12Cā(uc009wgu.2) | Lung | HLA.A11.01 | ||
| HRASāp.G12Cā(uc001lpv.2) | Adenocarcinoma | |||
| NRASāp.G12Vā(uc009wgu.2) | VVVGAVGVGK | 5535 | ColorectalāCancer | HLA.A11.01 |
| KRASāp.G12Vā(uc001rgp.1) | Lung | HLA.A68.01 | ||
| Adenocarcinoma | ||||
| PancreaticāCancer | ||||
| TP53āp.R248Wā(uc002ginn.2) | GMNWRPILTI | 5006 | BreastāCancer | HLA.A02.01 |
| ColorectalāCancer | HLA.A02.03 | |||
| PancreaticāCancer | ||||
| PIK3CAāp.E542Kā(uc003fjk.2) | AISTRDPLSK | 4852 | BladderāCancer | HLA.A03.01 |
| BreastāCancer | HLA.A11.01 | |||
| FRG1Bāp.110Tā(uc010ztl.1) | KLSDSRTAL | 4782 | ProstateāCancer | HLA.A02.01 |
| HLA.A02.02 | ||||
| HLA.A02.03 | ||||
| HLA.B07.02 | ||||
| HLA.B15.03 | ||||
| GATA3āp.H435fsā(uc001ijz.2) | KIMFATLQR | 4535 | BreastāCancer | HLA.A03.01 |
| HLA.A11.01 | ||||
| HLA.A30.01 | ||||
| HLA.A31.01 | ||||
| HLA.A68.01 | ||||
| HRASāp.G12Dā(uc001lpv.2) | VVGADGVGK | 4530 | ColorectalāCancer | |
| KRASāp.G12Dā(uc001rgp.1) | PancreaticāCancer | HLA.A11.01 | ||
| NRASāp.G12Dā(uc009wgu.2) | ||||
| NRASāp.Q61Rā(uc009wgu.2) | ILDTAGREEY | 4433 | Melanoma | HLA.A01.01 |
| KRASāp.Q61Rā(uc001rgp.1) | ThyroidāCancer | |||
| HRASāp.Q61Rā(uc001lpv.2) | ||||
| NRASāp.Q61Kā(uc009wgu.2) | ILDTAGKEEY | 4203 | ColorectalāCancer | HLA.A01.01 |
| HRASāp.Q61Kā(uc001lpv.2) | Melanoma | |||
| KRASāp.Q61Kā(uc001rgp.1) | ||||
| GATA3āp.H435fsā(uc001ijz.2) | MLTGPPARV | 4113 | BreastāCancer | HLA.A02.01 |
| HLA.A02.02 | ||||
| HLA.A02.03 | ||||
| HLA.A02.06 | ||||
| HLA.A68.02 | ||||
| HLA.A69.01 | ||||
| RBM47āp.495_502AAAAAAAA>A | AAAAVIPTV | 4035 | PancreaticāCancer | HLA.A02.01 |
| (uc003gvc.2) | HLA.A02.02 | |||
| HLA.A02.03 | ||||
| HLA.A02.06 | ||||
| HLA.A68.02 | ||||
| HLA.A69.01 | ||||
| HLA.B15.17 | ||||
| RBM47āp.495_502AAAAAAAA>A | AAAAAVIPTV | 3864 | PancreaticāCancer | HLA.A02.01 |
| (uc003gvc.2) | HLA.A02.03 | |||
| HLA.A02.06 | ||||
| HLA.A68.02 | ||||
| GATA3āp.H435fsā(uc001ijz.2) | YMFLKAESK | 3832 | BreastāCancer | HLA.A03.01 |
| HLA.A11.01 | ||||
| HLA.A68.01 | ||||
| GATA3āp.H435fsā(uc001ijz.2) | SMLTGPPARV | 3718 | BreastāCancer | HLA.A02.01 |
| HLA.A02.03 | ||||
| HLA.A02.06 | ||||
| GATA3āp.H435fsā(uc001ijz.2) | YMFLKAESKI | 3718 | BreastāCancer | HLA.A02.01 |
| HLA.A02.03 | ||||
| HLA.A02.06 | ||||
| GATA3āp.H435fsā(uc001ijz.2) | TLQRSSLWCL | 3621 | BreastāCancer | HLA.A02.01 |
| HLA.A02.03 | ||||
| AP3S1āp.K41fsā(uc003krl.2) | LVSEMKMFV | 3603 | PancreaticāCancer | HLA.A02.01 |
| HLA.A02.02 | ||||
| HLA.A02.03 | ||||
| HLA.A02.06 | ||||
| HLA.A68.02 | ||||
| HLA.A69.01 | ||||
| PIK3CAāp.H1047Rā(uc003fjk.2) | FMKQMNDAR | 3582 | BreastāCancer | HLA.A31.01 |
| HLA.A33.01 | ||||
| HLA.A68.01 | ||||
| KRASāp.Q61Lā(uc001rgp.1) | LLDILDTAGL | 3563 | ColorectalāCancer | HLA.A02.01 |
| NRASāp.Q61Lā(uc009wgu.2) | Lung | HLA.A02.03 | ||
| HRASāp.Q61Lā(uc001lpv.2) | Adenocarcinoma | HLA.A02.06 | ||
| Melanoma | ||||
| GATA3āp.H435fsā(uc001ijz.2) | FATLQRSSL | 3551 | BreastāCancer | HLA.B07.02 |
| HLA.B08.01 | ||||
| HLA.B39.01 | ||||
| AP3S1āp.K41fsā(uc003krl.2) | HLVSEMKMFV | 3524 | PancreaticāCancer | HLA.A02.01 |
| HLA.A02.03 | ||||
| HLA.A02.06 | ||||
| HLA.A68.02 | ||||
| FRG1Bāp.L525ā(uc010ztl.1) | ALSASNSCFI | 3502 | ProstateāCancer | HLA.A02.01 |
| HLA.A02.03 | ||||
| HLA.A02.06 | ||||
| FRG1Bāp.L525ā(uc010ztl.1) | FQNGKMALSA | 3502 | ProstateāCancer | HLA.A02.01 |
| HLA.A02.03 | ||||
| HLA.A02.06 | ||||
| RBM14āp.AAAAAAA286del | AVTAASTSY | 3477 | PancreaticāCancer | HLA.A26.02 |
| (uc009yrj.2) | HLA.A29.02 | |||
| HLA.B15.01 | ||||
| HLA.B15.03 | ||||
| HLA.B15.17 | ||||
| KRASāp.G12Rā(uc001rgp.1) | VVGARGVGK | 3176 | PancreaticāCancer | HLA.A03.01 |
| NRASāp.G12Rā(uc009wgu.2) | HLA.A11.01 | |||
| PIK3CAāp.E545Kā(uc003fjk.2) | SEITKQEKDF | 3090 | BreastāCancer | HLA.B44.02 |
| FRG1Bāp.A53Tā(uc010ztl.1) | LLTSNSCFI | 3016 | ProstateāCancer | HLA.A02.01 |
| HLA.A02.02 | ||||
| HLA.A02.03 | ||||
| HLA.A02.06 | ||||
| FRG1Bāp.A53Tā(uc010ztl.1) | ALLTSNSCFI | 2959 | ProstateāCancer | HLA.A02.01 |
| HLA.A02.03 | ||||
| HLA.A02.06 | ||||
| FRG1Bāp.110Tā(uc010ztl.1) | RTALKSGYGK | 2787 | ProstateāCancer | HLA.A03.01 |
| HLA.A11.01 | ||||
| HLA.A68.01 | ||||
| FRG1Bāp.A5OPā(uc010ztl.1) | FQNGKMPLL | 2781 | ProstateāCancer | HLA.A02.01 |
| Melanoma | HLA.A02.02 | |||
| HLA.A02.03 | ||||
| HLA.A02.06 | ||||
| HLA.B15.03 | ||||
| HLA.B39.01 | ||||
| PIK3CAāp.H1047Lā(uc003fjk.2) | FMKQMNDAL | 2610 | BreastāCancer | HLA.A02.01 |
| HLA.A02.02 | ||||
| HLA.A02.03 | ||||
| HLA.A02.06 | ||||
| HLA.B08.01 | ||||
| HLA.B15.01 | ||||
| HLA.B15.03 | ||||
| KRASāp.Q61Lā(uc001rgp.1) | ILDTAGLEEY | 2555 | ColorectalāCancer | HLA.A01.01 |
| NRASāp.Q61Lā(uc009wgu.2) | Lung | |||
| HRASāp.Q61Lā(uc001lpv.2) | Adenocarcinoma | |||
| Melanoma | ||||
| FRG1Bāp.A11Tā(uc010ztl.1) | ITLKSGYGK | 2523 | ProstateāCancer | HLA.A03.01 |
| Melanoma | HLA.A11.01 | |||
| HLA.A30.01 | ||||
| HLA.A31.01 | ||||
| HLA.A68.01 | ||||
| ANAPC1āp.T537Aā(uc002thi.2) | VSAPKPLSK | 2521 | PancreaticāCancer | HLA.A03.01 |
| ProstateāCancer | HLA.A11.01 | |||
| HLA.A30.01 | ||||
| GATA3āp.H435fsā(uc001ijz.2) | FLKAESKIM | 2496 | BreastāCancer | HLA.A02.03 |
| HLA.B08.01 | ||||
| HLA.B15.01 | ||||
| HLA.B15.03 | ||||
| FRG1Bāp.A5OPā(uc010ztl.1) | FQNGKMPLLA | 2486 | ProstateāCancer | HLA.A02.01 |
| Melanoma | HLA.A02.03 | |||
| HLA.A02.06 | ||||
| PIK3CAāp.H1047Rā(uc003fjk.2) | YFMKQMNDAR | 2478 | BreastāCancer | HLA.A33.01 |
| HLA.A68.01 | ||||
| GATA3āp.5408fsā(uc001ijz.2) | AIQPVLWTT | 2371 | BreastāCancer | HLA.A02.01 |
| HLA.A02.02 | ||||
| HLA.A02.06 | ||||
| RBM14āp.AAAAAAA286del | AVTAASTSYY | 2363 | PancreaticāCancer | HLA.A11.01 |
| (uc009yrj.2) | ||||
| FRG1Bāp.l10Tā(uc010ztl.1) | KLSDSRTALK | 2356 | ProstateāCancer | HLA.A03.01 |
| HLA.A11.01 | ||||
| FRG1Bāp.A11Tā(uc010ztl.1) | KLSDSRITL | 2328 | ProstateāCancer | HLA.A02.01 |
| Melanoma | HLA.A02.02 | |||
| HLA.A02.03 | ||||
| HLA.A02.06 | ||||
| HLA.B15.03 | ||||
| ANAPC1āp.T537Aā(uc002thi.2) | GVSAPKPLSK | 2260 | PancreaticāCancer | HLA.A03.01 |
| ProstateāCancer | HLA.A11.01 | |||
| TP53āp.Y220Cā(uc002ginn.2) | VVVPCEPPEV | 2200 | BreastāCancer | HLA.A02.01 |
| HLA.A02.06 | ||||
| TP53āp.R248Wā(uc002ginn.2) | SSCMGGMNWR | 2135 | ColorectalāCancer | HLA.A11.01 |
| HLA.A68.01 | ||||
| KRASāp.G12Rā(uc001rgp.1) | GARGVGKSAL | 2075 | PancreaticāCancer | HLA.B07.02 |
| NRASāp.G12Rā(uc009wgu.2) | ||||
| RAC1āp.P295ā(uc0035px.2) | TTNAFSGEY | 2042 | Melanoma | HLA.A01.01 |
| HLA.A11.01 | ||||
| HLA.A25.01 | ||||
| HLA.A26.01 | ||||
| HLA.A26.02 | ||||
| HLA.A26.03 | ||||
| HLA.A29.02 | ||||
| HLA.A68.01 | ||||
| HLA.A80.01 | ||||
| HLA.B15.01 | ||||
| HLA.B15.03 | ||||
| HLA.B15.17 | ||||
| GATA3āp.H435fsā(uc001ijz.2) | GPPARVPAV | 2039 | BreastāCancer | HLA.B07.02 |
| GATA3āp.H435fsā(uc001ijz.2) | KPKRDGYMF | 2039 | BreastāCancer | HLA.B07.02 |
| GATA3āp.H435fsā(uc001ijz.2) | KPKRDGYMFL | 2039 | BreastāCancer | HLA.B07.02 |
| KRASāp.G12Aā(uc001rgp.1) | ColorectalāCancer | HLA.A02.01 | ||
| HRASāp.G12Aā(uc001lpv.2) | KLVVVGAAGV | 2034 | Lung | HLA.A02.03 |
| NRASāp.G12Aā(uc009wgu.2) | Adenocarcinoma | HLA.A02.06 | ||
| SPOPāp.F133Lā(uc002ipg.2) | FVQGKDWGL | 2002 | ProstateāCancer | HLA.A02.01 |
| HLA.A02.02 | ||||
| HLA.A02.03 | ||||
| HLA.A02.06 | ||||
| HLA.A68.02 | ||||
| HLA.A69.01 | ||||
| GATA3āp.H435fsā(uc001ijz.2) | CSMLTGPPAR | 1995 | BreastāCancer | HLA.A11.01 |
| HLA.A33.01 | ||||
| HLA.A68.01 | ||||
| WASH3Pāp.G1755ā(uc002cdi.2) | SIRQAGGISK | 1978 | ProstateāCancer | HLA.A03.01 |
| WASH2Pāp.G1755ā(uc002tkh.2) | Melanoma | HLA.A11.01 | ||
| ARFGAP3āp.N299fsā(uc003bdd.2) | EIAEVLFHI | 1959 | ProstateāCancer | HLA.A02.01 |
| HLA.A02.02 | ||||
| HLA.A02.03 | ||||
| HLA.A02.06 | ||||
| HLA.A26.02 | ||||
| HLA.A26.03 | ||||
| HLA.A68.02 | ||||
| HLA.A69.01 | ||||
| GATA3āp.5408fsā(uc001ijz.2) | ALQPLQPHA | 1906 | BreastāCancer | HLA.A02.01 |
| HLA.A02.02 | ||||
| HLA.A02.03 | ||||
| ARFGAP3āp.N299fsā(uc003bdd.2) | SAWDLEIAEV | 1892 | ProstateāCancer | HLA.A02.01 |
| HLA.A02.06 | ||||
| HLA.A68.02 | ||||
| FRG1Bāp.I59Vā(uc010ztl.1) | LLASNSCFV | 1824 | ProstateāCancer | HLA.A02.01 |
| FRG1āp.I157Vā(uc003iz5.2) | Melanoma | HLA.A02.02 | ||
| HLA.A02.03 | ||||
| HLA.A02.06 | ||||
| HLA.A68.02 | ||||
| HLA.A69.01 | ||||
| ARFGAP3āp.N299fsā(uc003bdd.2) | KMLTQTDSA | 1818 | ProstateāCancer | HLA.A02.01 |
| HLA.A02.02 | ||||
| HLA.A02.03 | ||||
| HLA.A02.06 | ||||
| PTH2āp.L22delā(uc002pnn.1) | LLLLLLLLV | 1807 | ProstateāCancer | HLA.A02.01 |
| CTSAāp.L37delā(uc002xqh.2) | HLA.A02.02 | |||
| AGPAT2āp.17_18insLā(uc004cii.1) | HLA.A02.03 | |||
| HLA.A02.06 | ||||
| TP53āp.R248Qā(uc002ginn.2) | SSCMGGMNQR | 1795 | BladderāCancer | HLA.A11.01 |
| HLA.A68.01 | ||||
| KRASāp.G12Cā(uc001rgp.1) | VVVGACGVGK | 1785 | ColorectalāCancer | HLA.A11.01 |
| NRASāp.G12Cā(uc009wgu.2) | Lung | |||
| HRASāp.G12Cā(uc0011pv.2) | Adenocarcinoma | |||
| PIK3CAāp.N345Kā(uc003fjk.2) | KILCATYVK | 1776 | BreastāCancer | HLA.A03.01 |
| HLA.A11.01 | ||||
| HLA.A30.01 | ||||
| HLA.A31.01 | ||||
| FRG1Bāp.A11Tā(uc010ztl.1) | KLSDSRITLK | 1749 | ProstateāCancer | HLA.A03.01 |
| HLA.A11.01 | ||||
| FRG1Bāp.A11Tā(uc010ztl.1) | RITLKSGYGK | 1749 | ProstateāCancer | HLA.A03.01 |
| HLA.A11.01 | ||||
| GATA3āp.H435fsā(uc001ijz.2) | AVPFDLHFCR | 1749 | BreastāCancer | HLA.A11.01 |
| HLA.A68.01 | ||||
| PIK3CAāp.E542Kā(uc003fjk.2) | ISTRDPLSK | 1746 | BreastāCancer | HLA.A11.01 |
| TP53āp.G2455ā(uc002ginn.2) | SSCMGSMNR | 1732 | ColorectalāCancer | HLA.A11.01 |
| HLA.A31.01 | ||||
| HLA.A68.01 | ||||
| GATA3āp.H435fsā(uc001ijz.2) | AESKIMFATL | 1731 | BreastāCancer | HLA.B40.01 |
| HLA.B44.02 | ||||
| AKT1āp.E17Kā(uc001ypk.2) | WLHKRGKYIK | 1717 | BreastāCancer | HLA.A03.01 |
| AKT2āp.E17Kā(uc002onf.2) | ||||
| PIK3CAāp.N345Kā(uc003fjk.2) | ILCATYVKV | 1715 | BreastāCancer | HLA.A02.01 |
| HLA.A02.02 | ||||
| HLA.A02.03 | ||||
| HLA.A02.06 | ||||
| FRG1Bāp.I59Vā(uc010ztl.1) | ALLASNSCFV | 1698 | ProstateāCancer | HLA.A02.01 |
| FRG1āp.I157Vā(uc003iz5.2) | Melanoma | HLA.A02.03 | ||
| HLA.A02.06 | ||||
| FRG1Bāp.L525ā(uc010ztl.1) | SASNSCFIR | 1685 | ProstateāCancer | HLA.A11.01 |
| HLA.A31.01 | ||||
| HLA.A33.01 | ||||
| HLA.A68.01 | ||||
| PIK3CAāp.N345Kā(uc003fjk.2) | KILCATYVKV | 1679 | BreastāCancer | HLA.A02.01 |
| HLA.A02.03 | ||||
| HLA.A02.06 | ||||
| AP3S1āp.K41fsā(uc003krl.2) | ETFHLVSEM | 1635 | PancreaticāCancer | HLA.A25.01 |
| HLA.A26.01 | ||||
| HLA.A26.02 | ||||
| HLA.A26.03 | ||||
| HLA.A68.01 | ||||
| HLA.A68.02 | ||||
| HLA.A69.01 | ||||
| HLA.B15.17 | ||||
| PIK3CAāp.N345Kā(uc003fjk.2) | KVNIRDIDK | 1620 | BreastāCancer | HLA.A03.01 |
| HLA.A11.01 | ||||
| HLA.A30.01 | ||||
| KRASāp.G12Aā(uc001rgp.1) | VVGAAGVGK | 1613 | ColorectalāCancer | HLA.A03.01 |
| HRASāp.G12Aā(uc001lpv.2) | Lung | HLA.A11.01 | ||
| NRASāp.G12Aā(uc009wgu.2) | Adenocarcinoma | |||
| CDC27āp.D555Eā(uc002ile.3) | TLWHLQKEV | 1577 | ColorectalāCancer | HLA.A02.01 |
| HLA.A02.02 | ||||
| HLA.A02.03 | ||||
| HLA.A02.06 | ||||
| GATA3āp.H435fsā(uc001ijz.2) | ESKIMāFATL | 1573 | BreastāCancer | HLA.A68.02 |
| HLA.B08.01 | ||||
| TP53āp.P75fsā(uc002ginn.2) | KPTRAATVSV | 1536 | ColorectalāCancer | HLA.B07.02 |
| CTNNB1āp.T41Aā(uc010hia.1) | ATAPSLSGK | 1536 | ProstateāCancer | HLA.A03.01 |
| HLA.A11.01 | ||||
| HLA.A30.01 | ||||
| HLA.A31.01 | ||||
| HLA.A68.01 | ||||
| CDC27āp.D555Eā(uc002ile.3) | HLQKEVALSV | 1530 | ColorectalāCancer | HLA.A02.01 |
| HLA.A02.03 | ||||
| HLA.A02.06 | ||||
| PIK3CAāp.H1047Lā(uc003fjk.2) | ALHGGWTTK | 1513 | BreastāCancer | HLA.A03.01 |
| HLA.A11.01 | ||||
| HLA.A30.01 | ||||
| UBCāp.R73Lā(uc002gyy.3) | RLRGGMQIFV | 1474 | ProstateāCancer | HLA.A02.01 |
| HLA.A02.03 | ||||
| HLA.A02.06 | ||||
| PEX1āp.1370fsā(uc003uly.2) | KMRRPVCYK | 1456 | ProstateāCancer | HLA.A03.01 |
| HLA.A11.01 | ||||
| HLA.A30.01 | ||||
| HLA.A31.01 | ||||
| TP53āp.C238Yā(uc002ginn.2) | TTIHYNYMY | 1454 | ColorectalāCancer | HLA.A01.01 |
| HLA.A11.01 | ||||
| HLA.A25.01 | ||||
| HLA.A26.01 | ||||
| HLA.A26.02 | ||||
| HLA.A26.03 | ||||
| HLA.A29.02 | ||||
| HLA.A68.01 | ||||
| HLA.A80.01 | ||||
| HLA.B15.17 | ||||
| ANAPC1āp.T537Aā(uc002thi.2) | APKPLSKLL | 1449 | PancreaticāCancer | HLA.B07.02 |
| FRGā1Bāp.A53Tā(uc010ztl.1) | LTSNSCFIR | 1447 | ProstateāCancer | HLA.A11.01 |
| HLA.A31.01 | ||||
| HLA.A33.01 | ||||
| HLA.A68.01 | ||||
| RNF43āp.G659fsā(uc002iwf.2) | TQLARFFPI | 1442 | ColorectalāCancer | HLA.A02.01 |
| ProstateāCancer | HLA.A02.02 | |||
| HLA.A02.03 | ||||
| HLA.A02.06 | ||||
| HLA.A23.01 | ||||
| HLA.A30.01 | ||||
| HLA.A31.01 | ||||
| HLA.A69.01 | ||||
| HLA.B08.01 | ||||
| HLA.B08.03 | ||||
| HLA.B15.03 | ||||
| HLA.B38.01 | ||||
| HLA.B39.01 | ||||
| HLA.B40.01 | ||||
| HLA.B40.02 | ||||
| AP3S1āp.K41fsā(uc003krl.2) | ETFHLVSEMK | 1440 | PancreaticāCancer | HLA.A11.01 |
| HLA.A68.01 | ||||
| PIK3CAāp.H1047Rā(uc003fjk.2) | ARHGGWTTK | 1426 | BreastāCancer | HLA.B27.05 |
| PIK3CAāp.H1047Rā(uc003fjk.2) | ARHGGWTTKM | 1426 | BreastāCancer | HLA.B27.05 |
| GATA3āp.5408fsā(uc001ijz.2) | QPVLWTTPPL | 1421 | BreastāCancer | HLA.B07.02 |
| FRGā1Bāp.A5OPā(uc010ztl.1) | MPLLASNSCF | 1374 | ProstateāCancer | HLA.B07.02 |
| WASH3Pāp.G1755ā(uc002cdi.2) | ISKAKLRSM | 1337 | ProstateāCancer | HLA.A30.01 |
| WASH2Pāp.G1755ā(uc002tkh.2) | Melanoma | HLA.B08.01 | ||
| HLA.B15.17 | ||||
| HRASāp.G13Rā(uc001lpv.2) | VVGAGRVGK | 1324 | ColorectalāCancer | HLA.A03.01 |
| NRASāp.G13Rā(uc009wgu.2) | HLA.A11.01 | |||
| HLA.A30.01 | ||||
| ACADSāp.R330Hā(uc001tza.3) | RLLTWHAAM | 1321 | ProstateāCancer | HLA.A02.01 |
| HLA.A02.02 | ||||
| HLA.A02.03 | ||||
| HLA.A02.06 | ||||
| HLA.B08.01 | ||||
| HLA.B15.01 | ||||
| HLA.B15.03 | ||||
| HLA.B15.17 | ||||
| HRASāp.G12Dā(uc001lpv.2) | LVVVGADGV | 1284 | PancreaticāCancer | HLA.A02.06 |
| KRASāp.G12Dā(uc001rgp.1) | HLA.A68.02 | |||
| NRASāp.G12Dā(uc009wgu.2) | HLA.A69.01 | |||
| KRASāp.G12Sā(uc001rgp.1) | KLVVVGASGV | 1278 | ColorectalāCancer | HLA.A02.01 |
| HRASāp.G125ā(uc001lpv.2) | HLA.A02.03 | |||
| NRASāp.G125ā(uc009wgu.2) | HLA.A02.06 | |||
| TP53āp.A159Vā(uc002ginn.2) | RVRVMAIYK | 1271 | BladderāCancer | HLA.A03.01 |
| HLA.A11.01 | ||||
| HLA.A30.01 | ||||
| HLA.A31.01 | ||||
| HLA-Aāp.Q78Rā(uc003nol.2) | IEREGPEYW | 1271 | ProstateāCancer | HLA.B44.02 |
| HLA.B44.03 | ||||
| GATA3āp.H435fsā(uc001ijz.2) | LQRSSLWCL | 1248 | BreastāCancer | HLA.A02.06 |
| HLA.B15.01 | ||||
| HLA.B15.03 | ||||
| ZMIZ2 | ALQEKQSQEL | 1226 | PancreaticāCancer | HLA.A02.01 |
| p.VAAAAATATATATAT153del | HLA.A02.03 | |||
| (uc003tlr.2) | ||||
| GIGYF2āp.Q1005delā(uc002vtj.3) | KLSGWGNVSK | 1204 | PancreaticāCancer | HLA.A03.01 |
| HLA.A11.01 | ||||
| FRG1Bāp.L525ā(uc010ztl.1) | LSASNSCFIR | 1190 | ProstateāCancer | HLA.A11.01 |
| HLA.A68.01 | ||||
| AKT1āp.E17Kā(uc001ypk.2) | WLHKRGKYI | 1172 | BreastāCancer | HLA.A02.03 |
| AKT2āp.E17Kā(uc002onf.2) | HLA.B08.01 | |||
| PEX1āp.1370fsā(uc003uly.2) | KLGQIIMKK | 1165 | ProstateāCancer | HLA.A03.01 |
| HLA.A11.01 | ||||
| RAC1āp.P295ā(uc0035px.2) | FSGEYIPTV | 1152 | Melanoma | HLA.A02.01 |
| HLA.A02.02 | ||||
| HLA.A02.03 | ||||
| HLA.A02.06 | ||||
| HLA.A68.02 | ||||
| HLA.A69.01 | ||||
| GATA3āp.H435fsā(uc001ijz.2) | IMKPKRDGY | 1151 | BreastāCancer | HLA.B15.01 |
| HLA.B15.03 | ||||
| AEBP1āp.K1133delā(uc003tkb.2) | EEEIATGQAF | 1143 | PancreaticāCancer | HLA.B44.02 |
| FBXW7āp.R465Hā(uc003inn5.2) | TVHCMHLHEK | 1142 | ColorectalāCancer | HLA.A03.01 |
| HLA.A11.01 | ||||
| HLA.A68.01 | ||||
| TSPAN4āp.L92Vā(uc001lsd.1) | LTFFLLLLV | 1140 | ProstateāCancer | HLA.A02.01 |
| HLA.A02.02 | ||||
| HLA.A02.03 | ||||
| HLA.A02.06 | ||||
| HLA.A68.02 | ||||
| HLA.A69.01 | ||||
| HLA.B15.17 | ||||
| TP53āp.R158Lā(uc002ginn.2) | RVLAMAIYK | 1136 | LungāSquamous | HLA.A03.01 |
| CellāCarcinoma | HLA.A11.01 | |||
| HLA.A30.01 | ||||
| HLA.A31.01 | ||||
| HLA.A68.01 | ||||
| NRASāp.G12Vā(uc009wgu.2) | LVVVGAVGV | 1130 | PancreaticāCancer | HLA.A02.03 |
| KRASāp.G12Vā(uc001rgp.1) | HLA.A02.06 | |||
| HLA.A68.02 | ||||
| HLA.A69.01 | ||||
| GATA3āp.5408fsā(uc001ijz.2) | HMSSLSHISA | 1127 | BreastāCancer | HLA.A02.01 |
| HLA.A02.03 | ||||
| HLA.A02.06 | ||||
| CTNNB1āp.537Fā(uc010hia.1) | YLDSGIHFG | 1121 | UterineāCorpus | HLA.A02.01 |
| Endometrial | HLA.A02.02 | |||
| Carcinoma | HLA.A02.06 | |||
| CTNNB1āp.537Fā(uc010hia.1) | YLDSGIHFGA | 1120 | UterineāCorpus | HLA.A02.01 |
| Endometrial | HLA.A02.03 | |||
| Carcinoma | HLA.A02.06 | |||
| CTNNB1āp.537Cā(uc010hia.1) | YLDSGIHCGA | 1111 | UterineāCorpus | HLA.A02.01 |
| Endometrial | HLA.A02.03 | |||
| Carcinoma | HLA.A02.06 | |||
| SF3B1āp.K700Eā(uc002uue.2) | GLVDEQQEV | 1099 | BreastāCancer | HLA.A02.01 |
| HLA.A02.02 | ||||
| HLA.A02.03 | ||||
| HLA.A02.06 | ||||
| KRASāp.G12Rā(uc001rgp.1) | VVVGARGVGK | 1082 | PancreaticāCancer | HLA.A11.01 |
| NRASāp.G12Rā(uc009wgu.2) | ||||
| EGFRāp.L858Rā(uc003tqk.2) | KITDFGRAK | 1054 | Lung | HLA.A03.01 |
| Adenocarcinoma | HLA.A11.01 | |||
| HLA.A30.01 | ||||
| TP53āp.E271Kā(uc002ginn.2) | NLLGRNSFK | 1046 | BladderāCancer | HLA.A03.01 |
| HLA.A11.01 | ||||
| HLA.A68.01 | ||||
| TSPAN4āp.L92Vā(uc001lsd.1) | FLLLLVVFL | 1044 | ProstateāCancer | HLA.A02.01 |
| HLA.A02.02 | ||||
| HLA.A02.03 | ||||
| HLA.A02.06 | ||||
| TSPAN4āp.L92Vā(uc001lsd.1) | LLVVFLLEA | 1044 | ProstateāCancer | HLA.A02.01 |
| HLA.A02.02 | ||||
| HLA.A02.03 | ||||
| HLA.A02.06 | ||||
| TSPAN4āp.L92Vā(uc001lsd.1) | LLLLVVFLL | 1030 | ProstateāCancer | HLA.A02.01 |
| HLA.A02.02 | ||||
| HLA.A02.06 | ||||
| TSPAN4āp.L92Vā(uc001lsd.1) | FLLLLVVFLL | 1027 | ProstateāCancer | HLA.A02.01 |
| HLA.A02.03 | ||||
| HLA.A02.06 | ||||
| TSPAN4āp.L92Vā(uc001lsd.1) | LLLVVFLLEA | 1027 | ProstateāCancer | HLA.A02.01 |
| HLA.A02.03 | ||||
| HLA.A02.06 | ||||
| TSPAN4āp.L92Vā(uc001lsd.1) | LLTFFLLLLV | 1027 | ProstateāCancer | HLA.A02.01 |
| HLA.A02.03 | ||||
| HLA.A02.06 | ||||
| ARFGAP3āp.N299fsā(uc003bdd.2) | LEIAEVLFHI | 1024 | ProstateāCancer | HLA.B40.01 |
| HLA.B44.02 | ||||
| FRGā1Bāp.110Tā(uc010ztl.1) | TALKSGYGK | 1020 | ProstateāCancer | HLA.A11.01 |
| HLA.A68.01 | ||||
| RBM14āp.AAAAAAA286del | ATAAAVTAA | 1020 | PancreaticāCancer | HLA.A02.02 |
| (uc009yrj.2) | HLA.A02.03 | |||
| HLA.A02.06 | ||||
| HLA.A68.02 | ||||
| HLA.A69.01 | ||||
| KRASāp.G12Sā(uc001rgp.1) | VVGASGVGK | 1019 | ColorectalāCancer | HLA.A03.01 |
| HRASāp.G125ā(uc001lpv.2) | HLA.A11.01 | |||
| NRASāp.G12Sā(uc009wgu.2) | ||||
| UBCāp.L149Rā(uc002gyy.3) | STLHLVLRR | 1014 | ProstateāCancer | HLA.A11.01 |
| HLA.A31.01 | ||||
| HLA.A33.01 | ||||
| HLA.A68.01 | ||||
| PIK3CAāp.N345Kā(uc003fjk.2) | ATYVKVNIR | 1007 | BreastāCancer | HLA.A11.01 |
| HLA.A31.01 | ||||
| HLA.A33.01 | ||||
| HLA.A68.01 | ||||
| ERBB3āp.V104Mā(uc001sjh.2) | RMVRGTQVY | 990 | ColorectalāCancer | HLA.A03.01 |
| HLA.A29.02 | ||||
| HLA.A80.01 | ||||
| HLA.B15.01 | ||||
| HLA.B15.03 | ||||
| HLA.B15.17 | ||||
| GATA3āp.H435fsā(uc001ijz.2) | AESKIMFAT | 984 | BreastāCancer | HLA.B40.01 |
| HLA.B40.02 | ||||
| HLA.B45.01 | ||||
| FRGā1Bāp.L525ā(uc010ztl.1) | ALSASNSCF | 982 | ProstateāCancer | HLA.B15.01 |
| HLA.B15.03 | ||||
| TP53āp.E271Kā(uc002ginn.2) | LLGRNSFKV | 978 | BladderāCancer | HLA.A02.01 |
| HLA.A02.02 | ||||
| HLA.A02.03 | ||||
| HLA.A02.06 | ||||
| TP53āp.E271Kā(uc002ginn.2) | NLLGRNSFKV | 969 | BladderāCancer | HLA.A02.01 |
| HLA.A02.03 | ||||
| HLA.A02.06 | ||||
| FRG1Bāp.A11Tā(uc010ztl.1) | TLKSGYGKY | 969 | ProstateāCancer | HLA.A26.02 |
| HLA.A29.02 | ||||
| HLA.B15.01 | ||||
| HLA.B15.03 | ||||
| NFE2L2āp.E79Qā(uc002ulh.3) | QLDEQTGEFL | 966 | LungāSquamous | HLA.A02.01 |
| CellāCarcinoma | HLA.A02.06 | |||
| TP53āp.K132Nā(uc002ginn.2) | ALNNMFCQL | 955 | BladderāCancer | HLA.A02.01 |
| HLA.A02.02 | ||||
| HLA.A02.03 | ||||
| HLA.A02.06 | ||||
| HLA.B15.01 | ||||
| HLA.B15.03 | ||||
| MAP2K1āp.P1245ā(uc010bhq.2) | NSSYIVGFY | 943 | Melanoma | HLA.A01.01 |
| HLA.A26.01 | ||||
| HLA.A26.02 | ||||
| HLA.A29.02 | ||||
| HLA.A68.01 | ||||
| HLA.A80.01 | ||||
| HLA.B15.03 | ||||
| HLA.B15.17 | ||||
| TSPAN9āp.550Lā(uc001qlp.2) | ATFSPSFPL | 937 | Melanoma | HLA.A02.01 |
| HLA.A02.02 | ||||
| HLA.A02.03 | ||||
| HLA.A02.06 | ||||
| HLA.A11.01 | ||||
| HLA.A30.01 | ||||
| HLA.A31.01 | ||||
| HLA.A68.02 | ||||
| HLA.A69.01 | ||||
| HLA.B15.03 | ||||
| HLA.B15.17 | ||||
| HLA.B58.01 | ||||
| SF3B1āp.K700Eā(uc002uue.2) | QEVRTISAL | 936 | BreastāCancer | HLA.B15.03 |
| HLA.B39.01 | ||||
| HLA.B40.01 | ||||
| HLA.B40.02 | ||||
| HLA.B44.02 | ||||
| HLA.B44.03 | ||||
| ZNF91āp.R333Hā(uc002nre.2) | FSHSSTLAK | 907 | ProstateāCancer | HLA.A03.01 |
| HLA.A11.01 | ||||
| HLA.A30.01 | ||||
| HLA.A68.01 | ||||
| FNBP4āp.TT58delā(uc009ylv.2) | APSAATTTA | 905 | ProstateāCancer | HLA.B07.02 |
| FNBP4āp.TT58delā(uc009ylv.2) | APSAATTTAV | 905 | ProstateāCancer | HLA.B07.02 |
| RAC1āp.P29Sā(uc0035px.2) | YTTNAFSGEY | 901 | Melanoma | HLA.A01.01 |
| HLA.A68.01 | ||||
| ACADSāp.R330Hā(uc001tza.3) | LTWHAAMLK | 896 | ProstateāCancer | HLA.A03.01 |
| HLA.A11.01 | ||||
| HLA.A30.01 | ||||
| HLA.A31.01 | ||||
| HLA.A68.01 | ||||
| TP53āp.C242Fā(uc002ginn.2) | SSFMGGMNR | 889 | LungāSquamous | HLA.A03.01 |
| CellāCarcinoma | HLA.A11.01 | |||
| HLA.A31.01 | ||||
| HLA.A33.01 | ||||
| HLA.A68.01 | ||||
| CNPY3āp.17_18LL>Lā(uc0030ta.3) | LLLLPAPEL | 878 | ProstateāCancer | HLA.A02.01 |
| HLA.A02.02 | ||||
| HLA.A02.06 | ||||
| CNPY3āp.17_18LL>Lā(uc0030ta.3) | LLLLLLLLPA | 876 | ProstateāCancer | HLA.A02.01 |
| HLA.A02.03 | ||||
| HLA.A02.06 | ||||
| CNPY3āp.17_18LL>Lā(uc0030ta.3) | LLLLLLLPA | 876 | ProstateāCancer | HLA.A02.01 |
| HLA.A02.03 | ||||
| HLA.A02.06 | ||||
| CNPY3āp.17_18LL>Lā(uc0030ta.3) | LLLLLPAPEL | 876 | ProstateāCancer | HLA.A02.01 |
| HLA.A02.03 | ||||
| HLA.A02.06 | ||||
| ZMIZ2 | AAAAAVAAL | 855 | PancreaticāCancer | HLA.A02.02 |
| p.VAAAAATATATATAT153del | HLA.A02.03 | |||
| (uc003tlr.2) | HLA.A02.06 | |||
| HLA.A68.02 | ||||
| HLA.B07.02 | ||||
| HLA.B15.03 | ||||
| HLA.B15.17 | ||||
| PODXLāp.28_30PSP>P | SPSPSQNAT | 852 | ProstateāCancer | HLA.B07.02 |
| (uc003vqw.3) | ||||
| PODXLāp.28_30PSP>P | SPSQNATQTT | 852 | ProstateāCancer | HLA.B07.02 |
| (uc003vqw.3) | ||||
| AP3S1āp.K41fsā(uc003krl.2) | HLVSEMKMF | 849 | PancreaticāCancer | HLA.A26.02 |
| HLA.B15.01 | ||||
| HLA.B15.03 | ||||
| STK19āp.D89Nā(uc003nyv.2) | NPIFRFSSL | 849 | Melanoma | HLA.A26.02 |
| HLA.B07.02 | ||||
| HLA.B08.01 | ||||
| HLA.B39.01 | ||||
| NUF2āp.5340Lā(uc001gcq.1) | NLFKRLMIV | 845 | ColorectalāCancer | HLA.A02.01 |
| HLA.A02.02 | ||||
| HLA.A02.03 | ||||
| HLA.A02.06 | ||||
| HLA.B08.01 | ||||
| FRG1Bāp.A53Tā(uc010ztl.1) | ALLTSNSCF | 833 | ProstateāCancer | HLA.B15.01 |
| HLA.B15.03 | ||||
| UBCāp.L149Rā(uc002gyy.3) | LVLRRRGGM | 829 | ProstateāCancer | HLA.B08.01 |
| TP53āp.A159Pā(uc002ginn.2) | RVRPMAIYK | 820 | Lung | HLA.A03.01 |
| Adenocarcinoma | HLA.A11.01 | |||
| HLA.A30.01 | ||||
| HLA.A31.01 | ||||
| HLA.A68.01 | ||||
| FRG1Bāp.K13Nā(uc010ztl.1) | IALNSGYGK | 791 | ProstateāCancer | HLA.A03.01 |
| HLA.A11.01 | ||||
| HLA.A30.01 | ||||
| HLA.A31.01 | ||||
| HLA.A68.01 | ||||
| GATA3āp.H435fsā(uc001ijz.2) | VPFDLHFCR | 791 | BreastāCancer | HLA.A33.01 |
| HLA.A68.01 | ||||
| UBCāp.L149Rā(uc002gyy.3) | STLHLVLRRR | 789 | ProstateāCancer | HLA.A11.01 |
| HLA.A33.01 | ||||
| HLA.A68.01 | ||||
| ACADSāp.R330Hā(uc001tza.3) | LLTWHAAML | 789 | ProstateāCancer | HLA.A02.01 |
| HLA.A02.02 | ||||
| HLA.A02.03 | ||||
| HLA.A02.06 | ||||
| GATA3āp.H435fsā(uc001ijz.2) | ATLQRSSLW | 782 | BreastāCancer | HLA.B15.17 |
| HLA.B57.01 | ||||
| HLA.B58.01 | ||||
| MAP2K1āp.P1245ā(uc010bhq.2) | VLHECNSSYI | 779 | Melanoma | HLA.A02.01 |
| HLA.A02.03 | ||||
| HLA.A02.06 | ||||
| ACADSāp.R330Hā(uc001tza.3) | RLLTWHAAML | 773 | ProstateāCancer | HLA.A02.01 |
| HLA.A02.03 | ||||
| HLA.A02.06 | ||||
| RXRAāp.S427Fā(uc004cfb.2) | RLPALRFIGL | 771 | BladderāCancer | HLA.A02.01 |
| RXRGāp.5428Fā(uc001gda.2) | HLA.A02.03 | |||
| HLA.A02.06 | ||||
| ERBB3āp.V104Mā(uc001sjh.2) | LPLPNLRMV | 765 | ColorectalāCancer | HLA.B07.02 |
| TSPAN9āp.550Lā(uc001qlp.2) | LLSAANLVI | 759 | Melanoma | HLA.A02.01 |
| HLA.A02.02 | ||||
| HLA.A02.03 | ||||
| HLA.B15.01 | ||||
| HLA.B15.03 | ||||
| HLA.B15.17 | ||||
| CTNNB1āp.533Fā(uc010hia.1) | YLDFGIHSGA | 755 | UterineāCorpus | HLA.A02.01 |
| Endometrial | HLA.A02.03 | |||
| Carcinoma | HLA.A02.06 | |||
| CTNNB1āp.533Fā(uc010hia.1) | YLDFGIHSG | 754 | UterineāCorpus | HLA.A02.01 |
| Endometrial | HLA.A02.02 | |||
| Carcinoma | HLA.A02.06 | |||
| PTENāp.R130Gā(uc001kfb.2) | GTGVMāICAY | 751 | UterineāCorpus | HLA.A29.02 |
| Endometrial | HLA.B15.01 | |||
| Carcinoma | HLA.B15.17 | |||
| RXRAāp.5427Fā(uc004cfb.2) | LPALRFIGL | 748 | BladderāCancer | HLA.B07.02 |
| RXRGāp.5428Fā(uc001gda.2) | HLA.B08.01 | |||
| NOTCH2āp.P6fsā(uc001eik.2) | MPALRRSAV | 747 | BladderāCancer | HLA.B07.02 |
| HLA.B08.01 | ||||
| JMYāp.PPPPPPPPPPPP811del | LPPTPPPLPV | 733 | PancreaticāCancer | HLA.B07.02 |
| (uc003kfx.3) | ||||
| JMYāp.PPPPPPPPPPPP811del | SPLPPTPPPL | 733 | PancreaticāCancer | HLA.B07.02 |
| (uc003kfx.3) | ||||
| ACADSāp.R330Hā(uc001tza.3) | LLTWHAAMLK | 729 | ProstateāCancer | HLA.A03.01 |
| HLA.A11.01 | ||||
| HLA.A68.01 | ||||
| GATA3āp.H435fsā(uc001ijz.2) | RSSIMKPKR | 703 | BreastāCancer | HLA.A30.01 |
| HLA.A31.01 | ||||
| OGFOD1āp.G477fsā(uc002ejb.2) | FLLLTLPKV | 702 | PancreaticāCancer | HLA.A02.01 |
| HLA.A02.02 | ||||
| HLA.A02.03 | ||||
| HLA.A02.06 | ||||
| HERC2P3āp.A803Vā(uc001ytg.2) | RVRDMKCLM | 699 | PancreaticāCancer | HLA.A30.01 |
| HLA.B07.02 | ||||
| HLA.B15.17 | ||||
| C1QB | ESGDYKATQK | 697 | PancreaticāCancer | HLA.A68.01 |
| p.GPKGPMGPKGGPGAPGAP90del | ||||
| (uc001bgd.2) | ||||
| SLC38A10āp.1071_107211>1 | GLNPLPDVQV | 689 | PancreaticāCancer | HLA.A02.01 |
| (uc002jzz.1) | HLA.A02.03 | |||
| UBBāp.I188fsā(uc002gpx.2) | IPPTSRGSSL | 686 | ProstateāCancer | HLA.B07.02 |
| UBCāp.I191Tā(uc002gyy.3) | ||||
| UBBāp.I188fsā(uc002gpx.2) | PPTSRGSSL | 686 | ProstateāCancer | HLA.B07.02 |
| UBCāp.I191Tā(uc002gyy.3) | ||||
| CTNNB1āp.D32Nā(uc010hia.1) | YLNSGIHSGA | 672 | UterineāCorpus | HLA.A02.01 |
| Endometrial | HLA.A02.03 | |||
| Carcinoma | HLA.A02.06 | |||
| FRG1Bāp.K13Nā(uc010ztl.1) | ALNSGYGKYL | 670 | ProstateāCancer | HLA.A02.01 |
| HLA.A02.03 | ||||
| NBPF14āp.R25Cā(uc001eqf.2) | KLCPQLAENK | 667 | PancreaticāCancer | HLA.A03.01 |
| HLA.A11.01 | ||||
| IARS2āp.R832Cā(uc001hnnc.2) | VIVCSFAPI | 662 | Melanoma | HLA.A02.01 |
| HLA.A02.02 | ||||
| HLA.A02.03 | ||||
| HLA.A02.06 | ||||
| HLA.A68.02 | ||||
| HLA.A69.01 | ||||
| HLA.B15.03 | ||||
| PIK3CAāp.H1047Rā(uc003fjk.2) | KQMNDARHG | 661 | BreastāCancer | HLA.B15.03 |
| CTNNB1āp.D32Nā(uc010hia.1) | YLNSGIHSG | 658 | UterineāCorpus | HLA.A02.01 |
| Endometrial | HLA.A02.02 | |||
| Carcinoma | HLA.A02.03 | |||
| 51K3āp.950_951QQ>Q | QEYQELFRHM | 653 | PancreaticāCancer | HLA.B40.01 |
| (uc001ppy.2) | HLA.B44.02 | |||
| IARS2āp.R832Cā(uc001hnnc.2) | ILDVIVCSFA | 651 | Melanoma | HLA.A02.01 |
| HLA.A02.03 | ||||
| HLA.A02.06 | ||||
| AP3S1āp.K41fsā(uc003krl.2) | RETFHLVSEM | 650 | PancreaticāCancer | HLA.B40.01 |
| PPP2R1Aāp.P179Rā(uc002pyp.2) | RMVRRAAASK | 649 | UterineāCorpus | HLA.A03.01 |
| Endometrial | HLA.A11.01 | |||
| Carcinoma | ||||
| ZMIZ2 | AAAAAAVAAL | 641 | PancreaticāCancer | HLA.B07.02 |
| p.VAAAAATATATATAT153del | ||||
| (uc003tlr.2) | ||||
| HSD17B7P2āp.N1755ā(uc010qex.1) | SARKSNFSL | 637 | ProstateāCancer | HLA.A30.01 |
| HLA.B07.02 | ||||
| HLA.B08.01 | ||||
| HLA.B15.17 | ||||
| ARL16āp.G6Rā(uc002kbf.2) | RVAGRRALSR | 632 | Melanoma | HLA.A03.01 |
| HLA.A11.01 | ||||
| HLA.A33.01 | ||||
| HLA.A68.01 | ||||
| GATA3āp.5408fsā(uc001ijz.2) | TTPPLQHGHR | 623 | BreastāCancer | HLA.A33.01 |
| HLA.A68.01 | ||||
| AP3S1āp.K41fsā(uc003krl.2) | FHLVSEMKM | 619 | PancreaticāCancer | HLA.B38.01 |
| HLA.B39.01 | ||||
| PLEKHA6āp.V328fsā(uc001hau.2) | SIMMSWMPPL | 613 | ColorectalāCancer | HLA.A02.01 |
| HLA.A02.03 | ||||
| HLA.A02.06 | ||||
| HLA.A68.02 | ||||
| HLA.B07.02 | ||||
| LZTS1 | KLEGLELEV | 609 | PancreaticāCancer | HLA.A02.01 |
| p.RTQDLEGALRTKGLEL432del | HLA.A02.02 | |||
| (uc003wzr.2) | HLA.A02.03 | |||
| HLA.A02.06 | ||||
| HSD17B7P2āp.N1755ā(uc010qex.1) | WTSSRSARK | 607 | ProstateāCancer | HLA.A03.01 |
| HLA.A11.01 | ||||
| HLA.A30.01 | ||||
| HLA.A68.01 | ||||
| RBM14āp.AAAAAAA286del | GAAATAAAV | 606 | PancreaticāCancer | HLA.A02.03 |
| (uc009yrj.2) | HLA.A68.02 | |||
| TP53āp.R249Mā(uc002ginn.2) | MPILTIITL | 606 | Lung | HLA.A69.01 |
| Adenocarcinoma | HLA.B07.02 | |||
| HLA.B08.01 | ||||
| HLA.B15.03 | ||||
| HLA.B39.01 | ||||
| HLA.B53.01 | ||||
| IRF2BPLāp.114_115QQ>Q | QLNHVDGSSK | 605 | ProstateāCancer | HLA.A03.01 |
| (uc001xsy.2) | HLA.A11.01 | |||
| POLIāp.D17delā(uc002lfj.3) | EEDAEAWAM | 599 | ProstateāCancer | HLA.B40.01 |
| HLA.B44.02 | ||||
| HLA.B44.03 | ||||
| ZNF780Aāp.Q600Hā(uc010xvh.1) | HMHLIRHQK | 594 | ProstateāCancer | HLA.A03.01 |
| HLA.A11.01 | ||||
| HLA.A30.01 | ||||
| HLA.A31.01 | ||||
| HLA.A33.01 | ||||
| HLA.A68.01 | ||||
| FRG1Bāp.110Tā(ucO1Oztl.1) | LSDSRTALK | 589 | ProstateāCancer | HLA.A11.01 |
| PARGāp.A584Tā(uc001jih.2) | EETEAQHLY | 585 | ProstateāCancer | HLA.B44.02 |
| HLA.B44.03 | ||||
| GATA3āp.5408fsā(uc001ijz.2) | SSLSHISAL | 573 | BreastāCancer | HLA.A02.06 |
| HLA.B08.01 | ||||
| HLA.B15.03 | ||||
| HLA.B15.17 | ||||
| HLA.B39.01 | ||||
| EGFRāp.L858Rā(uc003tqk.2) | FGRAKLLGA | 564 | Lung | HLA.B08.01 |
| Adenocarcinoma | ||||
| TP53āp.R249Mā(uc002ginn.2) | RMPILTIITL | 563 | Lung | HLA.A02.01 |
| Adenocarcinoma | HLA.A02.03 | |||
| HLA.A02.06 | ||||
| PARGāp.A584Tā(uc001jih.2) | TEAQHLYQSI | 557 | ProstateāCancer | HLA.B40.01 |
| HLA.B44.02 | ||||
| CDC27āp.D555Eā(uc002ile.3) | EVALSVLSK | 557 | ColorectalāCancer | HLA.A11.01 |
| HLA.A68.01 | ||||
| GATA3āp.H435fsā(uc001ijz.2) | MFLKAESKI | 554 | BreastāCancer | HLA.A23.01 |
| FRGā1Bāp.K13Nā(uc010ztl.1) | RIALNSGYGK | 546 | ProstateāCancer | HLA.A03.01 |
| HLA.A11.01 | ||||
| CTNNB1āp.G34Rā(uc010hia.1) | YLDSRIHSGA | 530 | UterineāCorpus | HLA.A02.01 |
| Endometrial | HLA.A02.03 | |||
| Carcinoma | HLA.A02.06 | |||
| FRG1Bāp.L525ā(uc010ztl.1) | LSASNSCFI | 528 | ProstateāCancer | HLA.A68.02 |
| HLA.B15.17 | ||||
| HLA.B58.01 | ||||
| AXIN2āp.W663fsā(uc002jfi.2) | TPAPPPVPT | 520 | ColorectalāCancer | HLA.B07.02 |
| AXIN2āp.W663fsā(uc002jfi.2) | VPTCSPRTL | 520 | ColorectalāCancer | HLA.B07.02 |
| FCGBPāp.A2493Vā(uc0020nnp.3) | RPGLHRFVV | 504 | PancreaticāCancer | HLA.B07.02 |
| HLA.B08.01 | ||||
Therapeutic Targeting of Recurrent Mutations Expressed in Genes Containing Extracellular Domains.
Tumor-specific mutations present in greater than 1% of a population of cancer patients may be targeted with a drug or therapy that recognizes the tumor-specific neoepitope resulting from the mutation. The mutation is preferably within an extracellular domain. The drug or therapy is an antibody, antibody fragment, antibody drug conjugate, aptamer, CAR, or T cell receptor. The antibody or fragment thereof may be humanized, fully humanized, or chimeric. The antibody fragment may be a nanobody, Fab, Fabā², (Fabā²)2, Fv, ScFv, diabody, triabody, tetrabody, Bis-scFv, minibody, Fab2, or Fab3 fragment.
A recurrent mutation that may be targeted is FGFR3:p.S249C. Fibroblast growth factor receptor 3 (FGFR3) is a protein that in humans is encoded by the FGFR3 gene. FGFR3 has also been designated as CD333 (cluster of differentiation 333). The full-length protein includes an extracellular region, composed of three immunoglobulin-like domains, a single hydrophobic membrane-spanning segment and a cytoplasmic tyrosine kinase domain. The mutation occurs in the extracellular domain of the protein. The mutation is present in 6.92% of bladder cancer (BLCA) patients analyzed and 1.12% of lung squamous cell carcinoma (LUSC) patients analyzed.
Another recurrent mutation that may be targeted is ERBB3:p.V104M. Receptor tyrosine-protein kinase erbB-3, also known as HER3 (human epidermal growth factor receptor 3), is a membrane bound protein that in humans is encoded by the ERBB3 gene. ErbB3 is a member of the epidermal growth factor receptor (EGFR/ERBB) family of receptor tyrosine kinases. The mutation is present in 1.72% of colorectal cancer (CRC), 2.86% of colon adenocarcinoma (COAD), 2.42% of stomach adenocarcinoma (STAD), and 2.06% of cervical squamous cell carcinoma and endocervical adenocarcinoma (CESC) patients analyzed.
Another recurrent mutation that may be targeted is EGFR:p.L858R. The epidermal growth factor receptor (EGFR; ErbB-1; HER1 in humans) is the cell-surface receptor for members of the epidermal growth factor family (EGF-family) of extracellular protein ligands. The mutation is present in 3.24% of lung adenocarcinoma (LUAD) patients analyzed.
Another recurrent mutation that may be targeted is MUC4:p.H4205Q. Mucin 4 (MUC 4) is a mucin protein that in humans is encoded by the MUC4 gene. This gene encodes an integral membrane glycoprotein found on the cell surface, although secreted isoforms may exist. The mutation is present in 2.3% of prostate adenocarcinoma (PRAD), 2.31% of bladder urothelial carcinoma (BLCA), and 7.14% of uterine carcinosarcoma (UCS) patients analyzed.
Another recurrent mutation that may be targeted is PDGFRA:p.R483fs. Platelet-derived growth factor receptor, alpha polypeptide is a protein that in humans is encoded by the PDGFRA gene. This gene encodes a cell surface tyrosine kinase receptor for members of the platelet-derived growth factor family. The mutation is present in 1.92% of prostate adenocarcinoma (PRAD) patients analyzed.
Another recurrent mutation that may be targeted is TMEM52 23_26LLPL>L. Transmembrane protein 52 is encoded by the TMEM52 gene. The mutation is present in 1.53% of prostate adenocarcinoma (PRAD) patients analyzed.
Another recurrent mutation that may be targeted is PODXL 28_30PSP>P. Podocalyxin-like protein 1 is a protein that in humans is encoded by the PODXL gene. The mutation is present in 1.53% of prostate adenocarcinoma (PRAD), 15.56% of adrenocortical carcinoma (ACC), and 3.57% of uterine carcinosarcoma (UCS) patients analyzed.
Having thus described in detail preferred embodiments of the present invention, it is to be understood that the invention defined by the above paragraphs is not to be limited to particular details set forth in the above description as many apparent variations thereof are possible without departing from the spirit or scope of the present invention.
| LENGTHY TABLES |
| The patent application contains a lengthy table section. A copy of the table is available in electronic form from the USPTO web site (<![CDATA[https://seqdata.uspto.gov/?pageRequest=docDetail&DocID=US20200368337A1]]>). An electronic copy of the table will also be available from the USPTO upon request and payment of the fee set forth in 37 CFR 1.19(b)(3). |
1.-93. (canceled)
94. A pharmaceutical composition comprising
(i) a polypeptide comprising at least one amino acid sequence comprising at least 8 amino contiguous acids of:
| (SEQāIDāNO:ā1297) |
| FSHSSHMLTTPTPMHPPSSLSFGPHPPLQHGHRHGLEPCSMLTGPPARVP |
| AVPFDLHFCRSSIMKPKRDGYMFLKAESKIMFATLQRSSLWCLCSNH, |
(ii) a nucleic acid encoding the polypeptide,
(iii) antigen presenting cells (APCs) comprising (i) or (ii), or
(iv) T cells stimulated with APCs comprising (i) or (ii); and
a pharmaceutically acceptable carrier.
95. The pharmaceutical composition of claim 94, wherein the at least one amino acid sequence binds to a protein encoded by an HLA allele.
96. The pharmaceutical composition of claim 95, wherein the at least one amino acid sequence binds to a protein encoded by an HLA-A, HLA-B or HLA-C allele with a KD of less than 500 nM.
97. The pharmaceutical composition of claim 95, wherein the at least one amino acid sequence binds to a protein encoded by a class II HLA allele with a binding affinity of less than 1000 nM.
98. The pharmaceutical composition of claim 94, wherein the polypeptide is from 8 to 50 amino acids in length.
99. The pharmaceutical composition of claim 94, wherein the at least one amino acid sequence comprises at least 8 amino contiguous acids of:
| (residuesā26-97āofāSEQāIDāNO:ā1297) |
| PPLQHGHRHGLEPCSMLTGPPARVPAVPFDLHFCRSSIMKPKRDGYMFLK |
| AESKIMFATLQRSSLWCLCSNH. |
100. The pharmaceutical composition of claim 94, wherein the polypeptide comprises an amino acid sequence ESKIMFATL (SEQ ID NOs: 13457, 13526, 13595, 13661, 13717, 13772, 33585).
101. The pharmaceutical composition of claim 94, wherein the polypeptide comprises an amino acid sequence FATLQRSSL (SEQ ID NOs: 13454, 13523, 13592, 13658, 13714, 13769, 33527).
102. The pharmaceutical composition of claim 94, wherein the polypeptide comprises an amino acid sequence FLKAESKIM (SEQ ID NOs: 13438, 13507, 13576, 13643, 13700, 13754, 33542).
103. The pharmaceutical composition of claim 94, wherein the polypeptide comprises an amino acid sequence FLKAESKIMF (SEQ ID NOs: 13488, 13559, 13628, 13687, 13741, 13796).
104. The pharmaceutical composition of claim 94, wherein the polypeptide comprises an amino acid sequence GPPARVPAV (SEQ ID NOs: 13452, 13521, 13590, 13656, 13712, 13767, 33554).
105. The pharmaceutical composition of claim 94, wherein the polypeptide comprises an amino acid sequence IMKPKRDGYM (SEQ ID NOs: 13477, 13548, 13617, 13679, 13734, 13789).
106. The pharmaceutical composition of claim 94, wherein the polypeptide comprises an amino acid sequence KIMFATLQR (SEQ ID NOs: 13441, 13510, 13579, 13646, 13703, 13757, 33513).
107. The pharmaceutical composition of claim 94, wherein the polypeptide comprises an amino acid sequence KPKRDGYMF (SEQ ID NOs: 13453, 13522, 13591, 13657, 13713, 13768, 33555).
108. The pharmaceutical composition of claim 94, wherein the polypeptide comprises an amino acid sequence KPKRDGYMFL (SEQ ID NOs: 13485, 13556, 13625, 13684, 13738, 13793, 33556).
109. The pharmaceutical composition of claim 94, wherein the polypeptide comprises an amino acid sequence LHFCRSSIM (SEQ ID NOs: 13456, 13525, 13594, 13660, 13716, 13771).
110. The pharmaceutical composition of claim 94, wherein the polypeptide comprises an amino acid sequence MFATLQRSSL (SEQ ID NOs: 13487, 13558, 13627, 13686, 13740, 13795).
111. The pharmaceutical composition of claim 94, wherein the polypeptide comprises an amino acid sequence MFLKAESKI (SEQ ID NOs: 13444, 13513, 13582, 13649, 13706, 13760, 33726).
112. The pharmaceutical composition of claim 94, wherein the polypeptide comprises an amino acid sequence MLTGPPARV (SEQ ID NOs: 13437, 13506, 13575, 13642, 13699, 13753, 33517).
113. The pharmaceutical composition of claim 94, wherein the polypeptide comprises an amino acid sequence QPVLWTTPPL (SEQ ID NOs: 13484, 13555, 13624, 33599).
114. The pharmaceutical composition of claim 94, wherein the polypeptide comprises an amino acid sequence SMLTGPPARV (SEQ ID NOs: 13471, 13541, 13610, 13672, 13728, 13783, 33521).
115. The pharmaceutical composition of claim 94, wherein the polypeptide comprises an amino acid sequence TLQRSSLWCL (SEQ ID NOs: 13473, 13543, 13612, 13674, 13730, 13785, 33523).
116. The pharmaceutical composition of claim 94, wherein the polypeptide comprises an amino acid sequence VLPEPHLAL (SEQ ID NOs: 13434).
117. The pharmaceutical composition of claim 94, wherein the polypeptide comprises an amino acid sequence: YMFLKAESK (SEQ ID NOs: 13440, 13509, 13578, 13645, 13702, 13756, 33520).
118. The pharmaceutical composition of claim 94, wherein the polypeptide comprises an amino acid sequence YMFLKAESKI (SEQ ID NOs: 13472, 13542, 13611, 13673, 13729, 13784, 33522).
119. The pharmaceutical composition of claim 94, wherein the pharmaceutical composition comprises (iv).
120. The pharmaceutical composition of claim 94, wherein the pharmaceutical composition comprises (i) or (ii).
121. The pharmaceutical composition of claim 94, further comprising an adjuvant or an immunomodulator.
122. The pharmaceutical composition of claim 121, wherein the immunomodulator or adjuvant is poly(I:C).
123. The pharmaceutical composition of claim 94, wherein the pharmaceutical composition is an immunogenic composition or a vaccine composition.