COMPOSITIONS AND METHODS FOR REGULATING PRODUCTION OF A PRECURSOR PROTEIN

Description

TECHNICAL FIELD

The present disclosure generally relates to compositions and methods for regulating production of a precursor protein. In particular, the present disclosure relates to compositions and methods for regulating production of a precursor protein that can be post-translationally modified to produce a protein of the toll-like receptor family.

BACKGROUND

The mammalian immune system can differentiate between self and foreign matter. A number of cascades of signaling molecules and immune cells are characterized by their ability to recognize foreign matter and to call upon the production and stimulation of effector cells of the immune system to kill, break down, consume, or sheath the foreign matter in order to protect a host.

One mechanism by which the immune system can differentiate between self and foreign matter relates to a class of pattern recognition receptors that can detect molecular patterns that foreign microbes present. These pattern recognition receptors can be present on the phospholipid bilayer of various cell types and these cells can become activated upon a binding event between the pattern recognition receptors and the foreign molecular patterns. Activation of these cells reflects triggering of the innate immune system and the acquired immune system.

It is known that under various conditions the immune system can become dysregulated. A dysregulated immune system can cause further damage to the host, thereby preventing healing. It may also result in a loss of homeostatic controls and/or a chronically stimulated immune system.

SUMMARY

Some embodiments of the present disclosure relate to compositions and methods that upregulate the production of a precursor protein. The precursor protein may be subjected to one or more post-translational modification processes to produce a protein that is a member of the toll-like receptor (TLR) family of proteins. In some embodiments of the present disclosure, the precursor protein is a precursor of TLR3. When the precursor protein is subjected to one or more post-translational modification processes, the TLR3 protein product is bioavailable and functionally equivalent to a TLR3 protein that is produced within a subject without the benefit of the embodiments of this disclosure.

In some embodiments of the present disclosure, the compositions described herein comprise a vector of plasmid deoxyribonucleic acid (DNA) that includes an insert sequence of nucleic acids. The insert sequence encodes for the production of the precursor protein and the insert sequence may also include a backbone sequence of nucleic acids that facilitate introduction of the insert sequence into one or more of a subject's cells. Within the subject's cells, the insert sequence is expressed and/or replicated. Expression of the insert sequence by one or more cells of the subject results in an increased production of the precursor protein. In some embodiments of the present disclosure, the methods that upregulate the production of precursor protein relate to methods of manufacturing and administering the composition.

Some embodiments of the present disclosure relate to compositions and methods that can be used as a therapy or a treatment for a subject that has a condition whereby the subject's immune system is, or is likely to become, dysregulated.

Some embodiments of the present disclosure relate to a recombinant virus vector (RVV). The RVV comprises a nucleotide sequence encoding production of the precursor protein and an inverted terminal repeat.

Some embodiments of the present disclosure relate to a composition that comprises a nucleotide sequence according to the present disclosure (SEQ ID No. 3) of which at least a portion can be expressed in a target cell.

Some embodiments of the present disclosure relate to an insert for use with an RVV, wherein the insert has a nucleotide sequence according to SEQ ID 1.

Some embodiments of the present disclosure relate to a method of making an agent/target cell complex, the method comprising a step of administering a therapeutically effective amount of the agent to a subject, wherein the agent/target cell complex increases the subject's production of the precursor protein.

Some embodiments of the present disclosure relate to a pharmaceutical agent that comprises an agent, a pharmaceutically acceptable carrier and/or an excipient. Administering the pharmaceutical agent to a subject may increase the subject's production of the precursor protein.

Some embodiments of the present disclosure relate to a method of treating a condition. The method comprises a step of administering to a subject a therapeutically effective amount of an agent that upregulates the subject's production of the precursor protein.

Some embodiments of the present disclosure relate to a use of an agent for treating a condition, wherein the agent upregulates the subject's production of the precursor protein.

Embodiments of the present disclosure relate to at least one approach for inducing endogenous production of the precursor protein. A first approach utilizes one or more gene vectors containing nucleotide sequences for increasing the endogenous production of the precursor protein. The one or more vectors can be administered to a subject to increase the subject's production of the precursor protein.

Without being bound by any particular theory, the one or more vectors may be expressed in cells of the subject that already have the capability to produce, and do or may have produced, the precursor protein. These cells are referred to herein as capable cells. Therefore, the administration of the one or more vectors may increase the production of the precursor protein within those capable cells. The one or more vectors may also be expressed in other cells of the subject that do not produce the precursor protein when the subject is in a homeostatic state, an infection state or a disease state. These cells are not capable of producing the precursor protein without the one or more vectors of the present disclosure being expressed therein and, therefore, these cells may be referred to herein as incapable cells. The administration of the one or more vectors may induce the incapable cells to start producing the precursor protein.

The precursor protein can be subjected to one or more post-translational modification processes, which results in subject cells that are producing the precursor protein to produce a final protein-product that is bioavailable and functional. In some embodiments of the present disclosure, the protein product may be a receptor protein that is capable of participating in a binding event with a ligand. When a binding event occurs, the receptor protein may initiate one or more changes in the internal cell-signaling and metabolism of the subject cells. In some embodiments of the present disclosure, the protein product is a membrane-bound receptor protein. In the case of capable cells, the one or more vectors of the present disclosure may cause the capable cells to be more sensitive to ligands by increasing the number of membrane-bound receptors that can participate in binding events. In the case of incapable cells, the one or more vectors may cause incapable cells to become able to participating in binding events with ligands. In other words, the embodiments of the present disclosure may cause incapable cells to become responsive to a ligand that binds to the membrane-bound receptor product.

In some embodiments of the present disclosure, the membrane-bound receptor protein is a member of the toll-like receptor (TLR) family. Without being bound to any particular theory, the embodiments of the present disclosure may cause capable cells to increase their participation in the innate immune system, the acquired immune system; binding events with other TLR ligands or combinations thereof. Furthermore, incapable cells that produce the precursor protein due to the one or more vectors of the present disclosure, may now be able to participate in binding events with TLR ligands whereas such binding events would not otherwise occur.

Without being bound by any particular theory, TLR3 is a known component of the innate and acquired immune systems. TLR3 participates in activating immune cells upon a binding event with foreign matter due to the ability of TLR3 to recognize patterns that foreign matter present. Furthermore, pharmaceutical agents may also participate in binding events with TLR3 and these pharmaceutical TLR3 agonists may increase the efficacy of other chemotherapies for cancer, such as inhibitors of checkpoint proteins. For example, increased expression and/or functionality of TLR3 may increase the activity of polyIC, a synthetic double stranded RNA. Without being bound by ant particular theory, the embodiments of the present disclosure may ultimately increase the amount of TLR3 expressed and functioning in a subject and that subject may then further benefit from treatment with other oncolytic viruses, as compared to treatment with oncolytic viruses alone.

DETAILED DESCRIPTION

Unless defined otherwise, all technical and scientific terms used herein have the meanings that would be commonly understood by one of skill in the art in the context of the present description. Although any methods and materials similar or equivalent to those described herein can also be used in the practice or testing of the present disclosure, the preferred methods and materials are now described. All publications mentioned herein are incorporated herein by reference to disclose and describe the methods and/or materials in connection with which the publications are cited.

As used herein, the singular forms “a”, “an”, and “the” include plural references unless the context clearly dictates otherwise. For example, reference to “an agent” includes one or more agents and reference to “a subject” or “the subject” includes one or more subjects.

As used herein, the terms “about” or “approximately” refer to within about 25%, preferably within about 20%, preferably within about 15%, preferably within about 10%, preferably within about 5% of a given value or range. It is understood that such a variation is always included in any given value provided herein, whether or not it is specifically referred to.

As used herein, the term “activity” is used interchangeably with the term “functionality” and both terms refer to the physiologic action of biomolecule.

As used herein, the term “agent” refers to a substance that, when administered to a subject, causes one or more chemical reactions and/or one or more physical reactions and/or or one or more physiological reactions and/or one or more immunological reactions in the subject. In some embodiments of the present disclosure, the agent is a plasmid vector.

As used herein, the term “ameliorate” refers to improve and/or to make better and/or to make more satisfactory.

As used herein, the term “biomolecule” refers to a carbohydrate, a protein, an amino acid sequence, a nucleic acid, a lipid, a primary metabolite, a secondary metabolite or another metabolite that is found within a subject. A biomolecule may be endogenous or exogenous to a subject.

As used herein, the term “cell” refers to a single cell as well as a plurality of cells or a population of the same cell type or different cell types. Administering an agent to a cell includes in vivo, in vitro and ex vivo administrations and/or combinations thereof.

As used herein, the term “complex” refers to an association, either direct or indirect, between one or more particles of an agent and one or more target cells. This association results in a change in the metabolism of the target cell. As used herein, the phrase “change in metabolism” refers to an increase or a decrease in the one or more target cells' production of deoxyribonucleic acid (DNA), ribonucleic acid (RNA), one or more proteins, and/or any post-translational modifications of one or more proteins.

As used herein, the terms “dysregulation” and “dysregulated” refer to situations or conditions wherein homeostatic control systems have been disturbed and/or compromised so that one or more metabolic, physiologic and/or biochemical systems within a subject operate partially or entirely without said homeostatic control systems.

As used herein, the term “effector molecule” refers to a molecule within a subject that can directly or indirectly regulate the metabolic activity of a target cell by increasing or decreasing the production of DNA, RNA and/or amino-acid sequences and/or by increasing or decreasing any post-translational modifications of one or more proteins.

As used herein, the term “endogenous” refers to the production and/or modification of a molecule that originates within a cell of a subject.

As used herein, the term “excipient” refers to any substance, not itself an agent, which may be used as a component within a pharmaceutical composition or a medicament for administration of a therapeutically effective amount of the agent to a subject. Additionally, or alternatively, an excipient may, either alone or in combination with further chemical components, improve the handling and/or storage properties and/or permit or facilitate formation of a dose unit of the agent. Excipients include, but are not limited to, one or more of: a binder, a disintegrant, a diluent, a buffer, a taste enhancer, a solvent, a thickening agent, a gelling agent, a penetration enhancer, a solubilizing agent, a wetting agent, an antioxidant, a preservative, a surface active agent, a lubricant, an emollient, a substance that is added to mask or counteract a disagreeable odor, fragrance or taste, a substance added to improve appearance or texture of the composition and/or a substance that is used to form the pharmaceutical compositions or medicaments. Any such excipients can be used in any dosage forms according to the present disclosure. The foregoing classes of excipients are not meant to be exhaustive but are provided merely to be illustrative of what a person of skill in the art would know and would also recognize that additional types and combinations of excipients may be used to achieve delivery of a therapeutically effective amount of the agent to a subject through one or more routes of administration.

As used herein, the term “exogenous” refers to a molecule that is within a subject but that did not originate within the subject.

As used herein, the terms “inhibit”, “inhibiting”, and “inhibition” refer to a decrease in activity, response, or other biological parameter of a biologic process, disease, disorder or symptom thereof. This can include but is not limited to the complete ablation of the activity, response, condition, or disease. This may also include, for example, a 10% reduction in the activity, response, condition, or disease as compared to the native or control level. Thus, the reduction can be a 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, 90%, 100%, or any amount of reduction in between the specifically recited percentages, as compared to native or control levels.

As used herein, the term “medicament” refers to a medicine and/or pharmaceutical composition that comprises the agent and that can promote recovery from a disease, disorder or symptom thereof and/or that can prevent a disease, disorder or symptom thereof and/or that can inhibit the progression of a disease, disorder, or symptom thereof.

As used herein, the term “patient” refers to a subject that is afflicted with a disease or disorder. The term “patient” includes human and veterinary subjects.

As used herein, the term “pharmaceutical composition” means any composition comprising, but not necessarily limited to, an agent to be administered a subject in need of therapy or treatment of a disease, disorder or symptom thereof. Pharmaceutical compositions may include additives such as pharmaceutically acceptable carriers, pharmaceutically accepted salts, excipients and the like. Pharmaceutical compositions may also additionally include one or more further active ingredients such as antimicrobial agents, anti-inflammatory agents, anesthetics, analgesics, and the like.

As used herein, the term “pharmaceutically acceptable carrier” refers to an essentially chemically inert and nontoxic component within a pharmaceutical composition or medicament that does not inhibit the effectiveness and/or safety of the agent. Some examples of pharmaceutically acceptable carriers and their formulations are described in Remington (1995, The Science and Practice of Pharmacy (19th ed.) ed. A. R. Gennaro, Mack Publishing Company, Easton, Pa.), the disclosure of which is incorporated herein by reference. Typically, an appropriate amount of a pharmaceutically acceptable carrier is used in the formulation to render said formulation isotonic. Examples of suitable pharmaceutically acceptable carriers include, but are not limited to: saline solutions, glycerol solutions, ethanol, N-(1(2, 3-dioleyloxy)propyl)-N,N,N-trimethylammonium chloride (DOTMA), dioleolphosphotidylethanolamine (DOPE), and liposomes. Such pharmaceutical compositions contain a therapeutically effective amount of the agent, together with a suitable amount of one or more pharmaceutically acceptable carriers and/or excipients so as to provide a form suitable for proper administration to the subject. The formulation should suit the route of administration. For example, oral administration may require enteric coatings to protect the agent from degrading within portions of the subject's gastrointestinal tract. In another example, injectable routes of administration may be administered in a liposomal formulation to facilitate transport throughout a subject's vascular system and to facilitate delivery across cell membranes of targeted intracellular sites.

As used herein, the phrases “prevention of” and “preventing” refer to avoiding the onset or progression of a disease, disorder, or a symptom thereof.

As used herein, the terms “production”, “producing” and “produce” refer to the synthesis and/or replication of DNA, the transcription of one or more sequences of RNA, the translation of one or more amino acid sequences, the post-translational modifications of an amino-acid sequence, and/or the production of one or more regulatory molecules that can influence the production and/or functionality of an effector molecule or an effector cell. For clarity, “production” is also be used herein to refer to the functionality of a regulatory molecule, unless the context reasonably indicates otherwise.

As used herein, the terms “promote”, “promotion”, and “promoting” refer to an increase in an activity, response, condition, disease process, or other biological parameter. This can include, but is not limited to, the initiation of the activity, response, condition, or disease process. This may also include, for example, a 10% increase in the activity, response, condition, or disease as compared to the native or control level. Thus, the increase in an activity, response, condition, disease, or other biological parameter can be 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, 90%, 100%, or more, including any amount of increase in between the specifically recited percentages, as compared to native or control levels.

As used herein, the term “prophylactic administration” refers to the administration of any composition to a subject, in the absence of any symptom or indication of a disease or disorder, to prevent the occurrence and/or progression of the disease or disorder within the subject.

As used herein, the terms “signal molecule”, “signalling molecule” and “regulatory molecule” can be used interchangeably and refer to a molecule that can directly or indirectly affect the production and/or functionality of an effector molecule or effector cell. Signal molecules can be enzymes or other types of biomolecules that can act as a direct ligand on a target cell or they may influence the levels or functionality of a downstream ligand or a receptor for a ligand.

As used herein, the term “subject” refers to any therapeutic target that receives the agent. The subject can be a vertebrate, for example, a mammal including a human. The term “subject” does not denote a particular age or sex. The term “subject” also refers to one or more cells of an organism, an in vitro culture of one or more tissue types, an in vitro culture of one or more cell types, ex vivo preparations, and/or a sample of biological materials such as tissue and/or biological fluids.

As used herein, the term “target cell” refers to one or more cells and/or cell types that are deleteriously affected, either directly or indirectly, by a dysregulated immune system and/or a disease process. The term “target cell” also refers to cells that are not deleteriously affected but that are cells in which it is desired that the agent interacts.

As used herein, the term “therapeutically effective amount” refers to the amount of the agent used that is of sufficient quantity to ameliorate, treat and/or inhibit one or more of a disease, disorder or a symptom thereof. The “therapeutically effective amount” will vary depending on the agent used, the route of administration of the agent and the severity of the disease, disorder or symptom thereof. The subject's age, weight and genetic make-up may also influence the amount of the agent that will be a therapeutically effective amount.

As used herein, the terms “treat”, “treatment” and “treating” refer to obtaining a desired pharmacologic and/or physiologic effect. The effect may be prophylactic in terms of completely or partially preventing an occurrence of a disease, disorder or symptom thereof and/or the effect may be therapeutic in providing a partial or complete amelioration or inhibition of a disease, disorder, or symptom thereof. Additionally, the term “treatment” refers to any treatment of a disease, disorder, or symptom thereof in a subject and includes: (a) preventing the disease from occurring in a subject which may be predisposed to the disease but has not yet been diagnosed as having it; (b) inhibiting the disease, i.e., arresting its development; and, (c) ameliorating the disease.

As used herein, the terms “unit dosage form” and “unit dose” refer to a physically discrete unit that is suitable as a unitary dose for patients. Each unit contains a predetermined quantity of the agent and optionally, one or more suitable pharmaceutically acceptable carriers, one or more excipients, one or more additional active ingredients, or combinations thereof. The amount of agent within each unit is a therapeutically effective amount.

In embodiments of the present disclosure, the pharmaceutical compositions disclosed herein comprise an agent as described above in a total amount by weight of the composition of about 0.1% to about 95%. For example, the amount of the agent by weight of the pharmaceutical composition may be about 0.1%, about 0.2%, about 0.3%, about 0.4%, about 0.5%, about 0.6%, about 0.7%, about 0.8%, about 0.9%, about 1%, about 1.1%, about 1.2%, about 1.3%, about 1.4%, about 1.5%, about 1.6%, about 1.7%, about 1.8%, about 1.9%, about 2%, about 2.1%, about 2.2%, about 2.3%, about 2.4%, about 2.5%, about 2.6%, about 2.7%, about 2.8%, about 2.9%, about 3%, about 3.1%, about 3.2%, about 3.3%, about 3.4%, about 3.5%, about 3.6%, about 3.7%, about 3.8%, about 3.9%, about 4%, about 4.1%, about 4.2%, about 4.3%, about 4.4%, about 4.5%, about 4.6%, about 4.7%, about 4.8%. about 4.9%, about 5%, about 5.1%, about 5.2%, about 5.3%, about 5.4%, about 5.5%, about 5.6%, about 5.7%, about 5.8%, about 5.9%, about 6%, about 6.1%, about 6.2%, about 6.3%, about 6.4%, about 6.5%, about 6.6%, about 6.7%, about 6.8%, about 6.9%, about 7%, about 7.1%, about 7.2%, about 7.3%, about 7.4%, about 7.5%, about 7.6%, about 7.7%, about 7.8%, about 7.9%, about 8%, about 8.1%, about 8.2%, about 8.3%, about 8.4%, about 8.5%, about 8.6%, about 8.7%, about 8.8%, about 8.9%, about 9%, about 9.1%, about 9.2%, about 9.3%, about 9.4%, about 9.5%, about 9.6%, about 9.7%, about 9.8%, about 9.9%, about 10%, about 11%, about 12%, about 13%, about 14%, about 15%, about 16%, about 17%, about 18%, about 19%, about 20%, about 25%, about 30%, about 35%, about 40%, about 45%, about 50%, about 55%, about 60%, about 65%, about 70%, about 75%, about 80%, about 85%, about 90% or about 95%.

Where a range of values is provided herein, it is understood that each intervening value, to the tenth of the unit of the lower limit unless the context clearly dictates otherwise, between the upper and lower limit of that range and any other stated or intervening value in that stated range, is encompassed within the disclosure. The upper and lower limits of these smaller ranges may independently be included in the smaller ranges, and are also, encompassed within the disclosure, subject to any specifically excluded limit in the stated range. Where the stated range includes one or both of the limits, ranges excluding either or both of those included limits are also included in the disclosure.

In some embodiments of the present disclosure, an agent is a plasmid vector for introducing into a target cell for reproduction or transcription of an insert that comprises one or more nucleotide sequences that are carried within the plasmid vector. In some embodiments of the present disclosure, the plasmid vector is a viral vector. In some embodiments of the present disclosure, the vector is an adeno-associated virus vector.

In some embodiments of the present disclosure, the insert comprises one or more nucleotide sequences that encode for production of a precursor protein. The precursor protein is substantially similar, or substantially the same, as a translational product of a gene whose expression results in increased production of a protein that can participate in the innate immune system and/or the acquired immune system. In some embodiments of the present disclosure, the precursor protein is susceptible to one or more post-translational modification processes to create a protein product that acts as a membrane-bound receptor protein. The protein product can bind with extra-cellular ligands and initiate one or more intracellular signal pathways that change the metabolism of the associated cell.

In some embodiments of the present disclosure, the precursor protein is substantially similar, or substantially the same, as the translational product of the TLR3 gene. Following one or more post-translational modification processes, the precursor protein is converted into a protein product that has substantially similar, or substantially the same, function as the toll-like receptor 3 (TLR3) protein.

In some embodiments of the present disclosure, the precursor protein is a translational product of a nucleotide sequence that is substantially similar or substantially the same as SEQ ID No. 1, provided herein below.

In some embodiments of the present disclosure, the precursor protein has an amino acid sequence that is substantially similar or substantially the same as SEQ ID No. 2, provided herein below.

Without being bound by any particular theory, the precursor protein can be subjected to one or more post-translational modification processes within a subject's cell so that it is converted into a TLR3 protein product that has the same functionality and bioavailability as a TLR3 protein that a subject would produce without the embodiments of the present disclosure.

The present disclosure relates to one or more agents, therapies, treatments, and methods of use of the agents and/or therapies and/or treatments for initiating or upregulating production of the TLR3 precursor protein. Some embodiments of the present disclosure relate to methods for making a complex between at least one particle of an agent and at least one target cell of a subject for initiating or increasing production of the TLR3 precursor protein. The at least one target cell can be a capable cell or an incapable cell. For clarity, a capable cell is a cell that already has the capability to produce, and do or may have produced, the precursor protein. Therefore, the administration of the one or more vectors may increase the production of the precursor protein within those capable cells. The one or more vectors may also be expressed in an incapable cell. For clarity, an incapable cell is a cell of the subject that does not produce the precursor protein when the subject is in a homeostatic state, an infection state or a disease state. Incapable cells are not capable of producing the precursor protein without the one or more vectors of the present disclosure being expressed therein. The administration of the one or more vectors may induce the incapable cells to start producing the precursor protein. The embodiments of the present disclosure may cause at least a portion of a subject's capable cells and a portion of incapable cells to produce, in aggregate, a greater amount of the precursor protein which may then be subjected to one or more post-translational modification processes to produce a functional and bioavailable TLR3 protein product. As such, the embodiments of the present disclosure can be used as a therapy or a treatment for a subject that has a condition whereby the subject's immune system is, or is likely to become, dysregulated. For example, it is known that administering TLR3 agonists in animal models increases the efficacy of certain checkpoint protein inhibitors. Furthermore, it is known that the tumor cells of certain types of cancers may have dysfunctional TLR3 proteins. As such, the embodiments of the present disclosure may enhance the efficacy of therapies that include the administration of one or more checkpoint protein inhibitors, such as therapies that are directed at treating various types of cancer. Furthermore, the embodiments of the present disclosure may also increase the population of functional TLR3 protein products that are present on the surface of the subject's cells, including tumor cells. This may increase the efficacy of chemotherapy agents that acts as ligands for TLR3, such as those chemotherapy agents that may mimic or form segments of double stranded RNA.

In some embodiments of the present disclosure, the agent can be administered to the subject by an intravenous route, an intramuscular route, an intraperitoneal route, an intrathecal route, an intravesical route, a topical route, an intranasal route, a transmucosal route, a pulmonary route, and combinations thereof.

In some embodiments of the present disclosure, the agent can be administered to the subject by pipetting a dose of the agent into an in vitro cell culture, perfusing or immersing an ex vivo cell or tissue preparation with a solution that comprises the agent, mixing a biological fluid sample with a solution or substrate that comprises the agent, or combinations thereof.

Some embodiments of the present disclosure relate to an agent that can be administered to a subject with a condition that could benefit from an increased production of a TLR3 precursor protein that can be modified into a functional TLR3 protein. When a therapeutically effective amount of the agent is administered to the subject, the capable and incapable cells of the subject may increase the translational production of the TLR3 precursor protein, which then may be modified into functional and bioavailable TLR3 membrane-associated receptor protein.

In some embodiments of the present disclosure, administering a therapeutic amount of the agent to a subject upregulates the production, functionality or both of a TLR3 protein product by increasing the translational production of the precursor protein.

In some embodiments of the present disclosure, the agent is a vector used for gene therapy. The gene therapy is useful for increasing the subject's endogenous production of the TLR3 precursor protein. For example, the vector can contain one or more nucleotide sequences that that cause increased production of the precursor protein in both capable cells and incapable cells in which the vector is expressed.

In some embodiments of the present disclosure, the vector used for gene therapy is a virus that can be enveloped or not, replication effective or not, or combinations thereof. In some embodiments of the present disclosure, the vector is a virus that is not enveloped and not replication effective. In some embodiments of the present disclosure, the vector is a virus of the Paroviridae family. In some embodiments of the present disclosure, the vector is a virus of the genus Dependoparvaovirus. In some embodiments of the present disclosure, the vector is an adeno-associated virus (AAV). In some embodiments of the present disclosure, the vector is a recombinant AAV.

The embodiments of the present disclosure also relate to administering a therapeutically effective amount of the agent. In some embodiments of the present disclosure, the therapeutically effective amount of the agent that is administered to a patient is between about 10 and about 1×10¹⁶ TCID₅₀/kg (50% tissue culture infective dose per kilogram of the patient's body weight). In some embodiments of the present disclosure, the therapeutically effective amount of the agent that is administered to the patient is about 1×10¹³ TCID₅₀/kg. In some embodiments of the present disclosure, the therapeutically effective amount of the agent that is administered to a patient is measured in TPC/kg (total particle count of the agent per kilogram of the patient's body weight). In some embodiments the therapeutically effective amount of the agent is between about 10 and about 1×10¹⁶ TCP/kg.

Some embodiments of the present disclosure relate to a method for making a complex within a subject. The method comprises a step of administering a therapeutically effective amount of the agent to the subject. The complex comprises at least one particle of agent and one or more target cells. When the complex is formed, it affects a change in metabolism of the one or more target cells, which results in the target cells upregulating the production of the TLR3 precursor protein. Examples of a target cell include both capable cells and incapable cells, such as but not limited to: an innate immune cell, an acquired immune cell, an adrenal gland cell; a bile duct cell; a chondrocyte; a cochlear cell; a corneal cell; an endocardium cell; an endometrial cell; an endothelial cell; an epithelial cell; a fibroblast; a hair follicle cell; a hepatocyte; a lymph node cell; a mucosal cell; a myocyte; a neuron; a glomeruli cell; an optic nerve cell; an osteoblast; an ovarian tissue cell; a pancreatic islet beta cell; a pericardium cell; a platelet; a red blood cell (RBC); a retinal cell; a scleral cell; a Schwann cell; a T cell; a testicular tissue cell; a thyroid gland cell; a uveal cell; a tumor cell, or combinations thereof.

Some embodiments of the present disclosure relate to a therapy, or method of treating a condition, that can be administered to a subject with the condition. The therapy comprises a step of administering to the subject a therapeutically effective amount of an agent that will upregulate the subject's production of the TLR3 precursor protein. The increased production of the TLR3 precursor protein may result in increased levels of functional and bioavailable TLR3 protein product, which may reduce deleterious effects of the condition upon the subject.

Below are examples of nucleotide sequences of each may be present in the insert. As will be appreciated by those skilled in the art, minor modifications, substitutions or replacements of a select few nucleotides or amino acids in the sequences provided below will not substantially impact the physiologic or biologic effect of such modified sequences, as compared to the sequences provided herein below. Any such modified sequences are also contemplated by the present disclosure.

(nucleotide sequence for transcription of precursor protein)
SEQ ID No. 1

atgcgccaga ccctgccgtg catttatttt tggggcggcc tgctgccgtt tggcatgctg	60
tgcgcgagca gcaccaccaa atgcaccgtg agccatgaag tggcggattg cagccatctg	120
aaactgaccc aggtgccgga tgatctgccg accaacatta ccgtgctgaa cctgacccat	180
aaccagctgc gccgcctgcc ggcggcgaac tttacccgct atagccagct gaccagcctg	240
gatgtgggct ttaacaccat tagcaaactg gaaccggaac tgtgccagaa actgccgatg	300
ctgaaagtgc tgaacctgca gcataacgaa ctgagccagc tgagcgataa aacctttgcg	360
ttttgcacca acctgaccga actgcatctg atgagcaaca gcattcagaa aattaaaaac	420
aacccgtttg tgaaacagaa aaacctgatt accctggatc tgagccataa cggcctgagc	480
agcaccaaac tgggcaccca ggtgcagctg gaaaacctgc aggaactgct gctgagcaac	540
aacaaaattc aggcgctgaa aagcgaagaa ctggatattt ttgcgaacag cagcctgaaa	600
aaactggaac tgagcagcaa ccagattaaa gaatttagcc cgggctgctt tcatgcgatt	660
ggccgcctgt ttggcctgtt tctgaacaac gtgcagctgg gcccgagcct gaccgaaaaa	720
ctgtgcctgg aactggcgaa caccagcatt cgcaacctga gcctgagcaa cagccagctg	780
agcaccacca gcaacaccac ctttctgggc ctgaaatgga ccaacctgac catgctggat	840
ctgagctata acaacctgaa cgtggtgggc aacgatagct ttgcgtggct gccgcagctg	900
gaatattttt ttctggaata taacaacatt cagcatctgt ttagccatag cctgcatggc	960
ctgtttaacg tgcgctatct gaacctgaaa cgcagcttta ccaaacagag cattagcctg	1020
gcgagcctgc cgaaaattga tgattttagc tttcagtggc tgaaatgcct ggaacatctg	1080
aacatggaag ataacgatat tccgggcatt aaaagcaaca tgtttaccgg cctgattaac	1140
ctgaaatatc tgagcctgag caacagcttt accagcctgc gcaccctgac caacgaaacc	1200
tttgtgagcc tggcgcatag cccgctgcat attctgaacc tgaccaaaaa caaaattagc	1260
aaaattgaaa gcgatgcgtt tagctggctg ggccatctgg aagtgctgga tctgggcctg	1320
aacgaaattg gccaggaact gaccggccag gaatggcgcg gcctggaaaa catttttgaa	1380
atttatctga gctataacaa atatctgcag ctgacccgca acagctttgc gctggtgccg	1440
agcctgcagc gcctgatgct gcgccgcgtg gcgctgaaaa acgtggatag cagcccgagc	1500
ccgtttcagc cgctgcgcaa cctgaccatt ctggatctga gcaacaacaa cattgcgaac	1560
attaacgatg atatgctgga aggcctggaa aaactggaaa ttctggatct gcagcataac	1620
aacctggcgc gcctgtggaa acatgcgaac ccgggcggcc cgatttattt tctgaaaggc	1680
ctgagccatc tgcatattct gaacctggaa agcaacggct ttgatgaaat tccggtggaa	1740
gtgtttaaag atctgtttga actgaaaatt attgatctgg gcctgaacaa cctgaacacc	1800
ctgccggcga gcgtgtttaa caaccaggtg agcctgaaaa gcctgaacct gcagaaaaac	1860
ctgattacca gcgtggaaaa aaaagtgttt ggcccggcgt ttcgcaacct gaccgaactg	1920
gatatgcgct ttaacccgtt tgattgcacc tgcgaaagca ttgcgtggtt tgtgaactgg	1980
attaacgaaa cccataccaa cattccggaa ctgagcagcc attatctgtg caacaccccg	2040
ccgcattatc atggctttcc ggtgcgcctg tttgatacca gcagctgcaa agatagcgcg	2100
ccgtttgaac tgttttttat gattaacacc agcattctgc tgatttttat ttttattgtg	2160
ctgctgattc attttgaagg ctggcgcatt agcttttatt ggaacgtgag cgtgcatcgc	2220
gtgctgggct ttaaagaaat tgatcgccag accgaacagt ttgaatatgc ggcgtatatt	2280
attcatgcgt ataaagataa agattgggtg tgggaacatt ttagcagcat ggaaaaagaa	2340
gatcagagcc tgaaattttg cctggaagaa cgcgattttg aagcgggcgt gtttgaactg	2400
gaagcgattg tgaacagcat taaacgcagc cgcaaaatta tttttgtgat tacccatcat	2460
ctgctgaaag atccgctgtg caaacgcttt aaagtgcatc atgcggtgca gcaggcgatt	2520
gaacagaacc tggatagcat tattctggtg tttctggaag aaattccgga ttataaactg	2580
aaccatgcgc tgtgcctgcg ccgcggcatg tttaaaagcc attgcattct gaactggccg	2640
gtgcagaaag aacgcattgg cgcgtttcgc cataaactgc aggtggcgct gggcagcaaa	2700
aacagcgtgc attaa	2715

(amino acid sequence for TRL3 precursor protein)
SEQ ID No. 2
MRQTLPCIYFWGGLLPFGMLCASSTTKCTVSHEVADCSHLKLTQVPDDLPTNITVLNLTH
NQLRRLPAANFTRYSQLTSLDVGFNTISKLEPELCQKLPMLKVLNLQHNELSQLSDKTFA
FCTNLTELHLMSNSIQKIKNNPFVKQKNLITLDLSHNGLSSTKLGTQVQLENLQELLLSN
NKIQALKSEELDIFANSSLKKLELSSNQIKEFSPGCFHAIGRLFGLFLNNVQLGPSLTEK
LCLELANTSIRNLSLSNSQLSTTSNTTFLGLKWTNLTMLDLSYNNLNVVGNDSFAWLPQL
EYFFLEYNNIQHLFSHSLHGLFNVRYLNLKRSFTKQSISLASLPKIDDFSFQWLKCLEHL
NMEDNDIPGIKSNMFTGLINLKYLSLSNSFTSLRTLTNETFVSLAHSPLHILNLTKNKIS
KIESDAFSWLGHLEVLDLGLNEIGQELTGQEWRGLENIFEIYLSYNKYLQLTRNSFALVP
SLQRLMLRRVALKNVDSSPSPFQPLRNLTILDLSNNNIANINDDMLEGLEKLEILDLQHN
NLARLWKHANPGGPIYFLKGLSHLHILNLESNGFDEIPVEVFKDLFELKIIDLGLNNLNT
LPASVFNNQVSLKSLNLQKNLITSVEKKVFGPAFRNLIELDMRFNPFDCTCESIAWFVNW
INETHTNIPELSSHYLCNTPPHYHGFPVRLFDTSSCKDSAPFELFFMINTSILLIFIFIV
LLIHFEGWRISFYWNVSVHRVLGFKEIDRQIhQFEYAAYIIHAYKDKDWVWEHFSSMEKE
DQSLKFCLEERDFEAGVFELEAIVNSIKRSRKIIFVITHHLLKDPLCKRFKVHHAVQQAI
EQNLDSIILVFLEEIPDYKLNHALCLRRGMFKSHCILNWPVQKERIGAFRHKLQVALGSK
NSVH
(nucleotide sequence for plasmid vector)
SEQ ID No. 3

cagcagctgc gcgctcgctc gctcactgag gccgcccggg caaagcccgg gcgtcgggcg	60
acctttggtc gcccggcctc agtgagcgag cgagcgcgca gagagggagt ggccaactcc	120
atcactaggg gttccttgta gttaatgatt aacccgccat gctacttatc tacgtagcca	180
tgctctagga cattgattat tgactagtgg agttccgcgt tacataactt acggtaaatg	240
gcccgcctgg ctgaccgccc aacgaccccc gcccattgac gtcaataatg acgtatgttc	300
ccatagtaac gccaataggg actttccatt gacgtcaatg ggtggagtat ttacggtaaa	360
ctgcccactt ggcagtacat caagtgtatc atatgccaag tacgccccct attgacgtca	420
atgacggtaa atggcccgcc tggcattatg cccagtacat gaccttatgg gactttccta	480
cttggcagta catctacgta ttagtcatcg ctattaccat ggtcgaggtg agccccacgt	540
tctgcttcac tctccccatc tcccccccct ccccaccccc aattttgtat ttatttattt	600
tttaattatt ttgtgcagcg atgggggcgg gggggggggg gggcgcgcgc caggcggggc	660
ggggcggggc gaggggcggg gcggggcgag gcggagaggt gcggcggcag ccaatcagag	720
cggcgcgctc cgaaagtttc cttttatggc gaggcggcgg cggcggcggc cctataaaaa	780
gcgaagcgcg cggcgggcgg gagtcgctgc gcgctgcctt cgccccgtgc cccgctccgc	840
cgccgcctcg cgccgcccgc cccggctctg actgaccgcg ttactaaaac aggtaagtcc	900
ggcctccgcg ccgggttttg gcgcctcccg cgggcgcccc cctcctcacg gcgagcgctg	960
ccacgtcaga cgaagggcgc agcgagcgtc ctgatccttc cgcccggacg ctcaggacag	1020
cggcccgctg ctcataagac tcggccttag aaccccagta tcagcagaag gacattttag	1080
gacgggactt gggtgactct agggcactgg ttttctttcc agagagcgga acaggcgagg	1140
aaaagtagtc ccttctcggc gattctgcgg agggatctcc gtggggcggt gaacgccgat	1200
gatgcctcta ctaaccatgt tcatgttttc tttttttttc tacaggtcct gggtgacgaa	1260
cagggtaccg ccaccatggt gtccaaggga gaggagctgt tcaccggagt ggtgcccatc	1320
ctggtggagc tggacggcga tgtgaatggc cacaagttta gcgtgtccgg agagggagag	1380
ggcgacgcaa cctacggcaa gctgacactg aagttcatct gcaccacagg caagctgccc	1440
gtgccttggc caaccctggt gaccacactg acatacggcg tgcagtgttt ttctcggtat	1500
ccagaccaca tgaagcagca cgatttcttt aagagcgcca tgcccgaggg ctacgtgcag	1560
gagaggacaa tcttctttaa ggacgatggc aactataaga ccagagccga ggtgaagttc	1620
gagggcgaca cactggtgaa ccggatcgag ctgaagggca tcgactttaa ggaggatggc	1680
aatatcctgg gccacaagct ggagtacaac tataattccc acaacgtgta catcatggcc	1740
gataagcaga agaacggcat caaggtgaac ttcaagatcc gccacaatat cgaggacggc	1800
tctgtgcagc tggccgatca ctaccagcag aacaccccta tcggcgacgg acccgtgctg	1860
ctgcctgata atcactatct gtctacacag agcgccctgt ccaaggaccc aaacgagaag	1920
agggatcaca tggtgctgct ggagttcgtg accgcagcag gcatcacact gggcatggat	1980
gagctgtata agcgaaaaag aagatcaggt tcgggtgcgc cagtaaagca gacattaaac	2040
tttgatttgc tgaaacttgc aggtgatgta gagtcaaatc caggtccagg atccatgcgc	2100
cagaccctgc cgtgcattta tttttggggc ggcctgctgc cgtttggcat gctgtgcgcg	2160
agcagcacca ccaaatgcac cgtgagccat gaagtggcgg attgcagcca tctgaaactg	2220
acccaggtgc cggatgatct gccgaccaac attaccgtgc tgaacctgac ccataaccag	2280
ctgcgccgcc tgccggcggc gaactttacc cgctatagcc agctgaccag cctggatgtg	2340
ggctttaaca ccattagcaa actggaaccg gaactgtgcc agaaactgcc gatgctgaaa	2400
gtgctgaacc tgcagcataa cgaactgagc cagctgagcg ataaaacctt tgcgttttgc	2460
accaacctga ccgaactgca tctgatgagc aacagcattc agaaaattaa aaacaacccg	2520
tttgtgaaac agaaaaacct gattaccctg gatctgagcc ataacggcct gagcagcacc	2580
aaactgggca cccaggtgca gctggaaaac ctgcaggaac tgctgctgag caacaacaaa	2640
attcaggcgc tgaaaagcga agaactggat atttttgcga acagcagcct gaaaaaactg	2700
gaactgagca gcaaccagat taaagaattt agcccgggct gctttcatgc gattggccgc	2760
ctgtttggcc tgtttctgaa caacgtgcag ctgggcccga gcctgaccga aaaactgtgc	2820
ctggaactgg cgaacaccag cattcgcaac ctgagcctga gcaacagcca gctgagcacc	2880
accagcaaca ccacctttct gggcctgaaa tggaccaacc tgaccatgct ggatctgagc	2940
tataacaacc tgaacgtggt gggcaacgat agctttgcgt ggctgccgca gctggaatat	3000
ttttttctgg aatataacaa cattcagcat ctgtttagcc atagcctgca tggcctgttt	3060
aacgtgcgct atctgaacct gaaacgcagc tttaccaaac agagcattag cctggcgagc	3120
ctgccgaaaa ttgatgattt tagctttcag tggctgaaat gcctggaaca tctgaacatg	3180
gaagataacg atattccggg cattaaaagc aacatgttta ccggcctgat taacctgaaa	3240
tatctgagcc tgagcaacag ctttaccagc ctgcgcaccc tgaccaacga aacctttgtg	3300
agcctggcgc atagcccgct gcatattctg aacctgacca aaaacaaaat tagcaaaatt	3360
gaaagcgatg cgtttagctg gctgggccat ctggaagtgc tggatctggg cctgaacgaa	3420
attggccagg aactgaccgg ccaggaatgg cgcggcctgg aaaacatttt tgaaatttat	3480
ctgagctata acaaatatct gcagctgacc cgcaacagct ttgcgctggt gccgagcctg	3540
cagcgcctga tgctgcgccg cgtggcgctg aaaaacgtgg atagcagccc gagcccgttt	3600
cagccgctgc gcaacctgac cattctggat ctgagcaaca acaacattgc gaacattaac	3660
gatgatatgc tggaaggcct ggaaaaactg gaaattctgg atctgcagca taacaacctg	3720
gcgcgcctgt ggaaacatgc gaacccgggc ggcccgattt attttctgaa aggcctgagc	3780
catctgcata ttctgaacct ggaaagcaac ggctttgaga aattccggtg gaagtgttta	3840
aagatctgtt tgaactgaaa attattgatc tgggcctgaa caacctgaac accctgccgg	3900
gagcgtgttt aacaaccagg tgagcctgaa aagcctgaac ctgcagaaaa acctgattac	3960
cagcgtggaa aaaaaagtgt ttggcccggc gtttcgcaac ctgaccgaac tggatatgcg	4020
ctttaacccg tttgattgca cctgcgaaag cattgcgtgg tttgtgaact ggattaacga	4080
aacccatacc aacattccgg aactgagcag ccattatctg tgcaacaccc cgccgcatta	4140
tcatggcttt ccggtgcgcc tgtttgatac cagcagctgc aaagatagcg cgccgtttga	4200
actgtttttt atgattaaca ccagcattct gctgattttt atttttattg tgctgctgat	4260
tcattttgaa ggctggcgca ttagctttta ttggaacgtg agcgtgcatc gcgtgctggg	4320
ctttaaagaa attgatcgcc agaccgaaca gtttgaatat gcggcgtata ttattcatgc	4380
gtataaagat aaagattggg tgtgggaaca ttttagcagc atggaaaaag aagatcagag	4440
cctgaaattt tgcctggaag aacgcgattt tgaagcgggc gtgtttgaac tggaagcgat	4500
tgtgaacagc attaaacgca gccgcaaaat tatttttgtg attacccatc atctgctgaa	4560
agatcgctgt gcaaacgctt taaagtgcat catgcggtgc agcaggcgat tgaacagaac	4620
ctggatagca ttattctggt gtttctggaa gaaattccgg attataaact gaaccatgcg	4680
ctgtgcctgc gccgcggcat gtttaaaagc cattgcattc tgaactggcc ggtgcagaaa	4740
gaacgcattg gcgcgtttcg ccataaactg caggtggcgc tgggcagcaa aaacagcgtg	4800
cattaatacc cctatgacgt gcctgattat gcctgactct agaataatca acctctggat	4860
tacaaaattt gtgaaagatt gactggtatt cttaactatg ttgctccttt tacgctatgt	4920
ggatacgctg ctttaatgcc tttgtatcat gctattgctt cccgtatggc tttcattttc	4980
tcctccttgt ataaatcctg gttgctgtct ctttatgagg agttgtggcc cgttgtcagg	5040
caacgtggcg tggtgtgcac tgtgtttgct gacgcaaccc ccactggttg gggcattgcc	5100
accacctgtc agctcctttc cgggactttc gctttccccc tccctattgc cacggcggaa	5160
ctcatcgccg cctgccttgc ccgctgctgg acaggggctc ggctgttggg cactgacaat	5220
tccgtggtgt tgtcggggaa atcatcgtcc tttccttggc tgctcgcctg tgttgccacc	5280
tggattctgc gcgggacgtc cttctgctac gtcccttcgg ccctcaatcc agcggacctt	5340
ccttcccgcg gcctgctgcc ggctctgcgg cctcttccgc gtcttcgcct tcgccctcag	5400
acgagtcgga tctccctttg ggccgcctcc ccgcctaagc ttatcgatac cgtcgagatc	5460
taacttgttt attgcagctt ataatggtta caaataaagc aatagcatca caaatttcac	5520
aaataaagca tttttttcac tgcattctag ttgtggtttg tccaaactca tcaatgtatc	5580
ttatcatgtc tggatctcga cctcgactag agcatggcta cgtagataag tagcatggcg	5640
ggttaatcat taactacaag gaacccctag tgatggagtt ggccactccc tctctgcgcg	5700
ctcgctcgct cactgaggcc gggcgaccaa aggtcgcccg acgcccgggc tttgcccggg	5760
cggcctcagt gagcgagcga gcgcgccagc tggcgtaata gcgaagaggc ccgcaccgat	5820
cgcccttccc aacagttgcg cagcctgaat ggcgaatgga attccagacg attgagcgtc	5880
aaaatgtagg tatttccatg agcgtttttc ctgttgcaat ggctggcggt aatattgttc	5940
tggatattac cagcaaggcc gatagtttga gttcttctac tcaggcaagt gatgttatta	6000
ctaatcaaag aagtattgcg acaacggtta atttgcgtga tggacagact cttttactcg	6060
gtggcctcac tgattataaa aacacttctc aggattctgg cgtaccgttc ctgtctaaaa	6120
tccctttaat cggcctcctg tttagctccc gctctgattc taacgaggaa agcacgttat	6180
acgtgctcgt caaagcaacc atagtacgcg ccctgtagcg gcgcattaag cgcggcgggt	6240
gtggtggtta cgcgcagcgt gaccgctaca cttgccagcg ccctagcgcc cgctcctttc	6300
gctttcttcc cttcctttct cgccacgttc gccggctttc cccgtcaagc tctaaatcgg	6360
gggctccctt tagggttccg atttagtgct ttacggcacc tcgaccccaa aaaacttgat	6420
tagggtgatg gttcacgtag tgggccatcg ccctgataga cggtttttcg ccctttgacg	6480
ttggagtcca cgttctttaa tagtggactc ttgttccaaa ctggaacaac actcaaccct	6540
atctcggtct attcttttga tttataaggg attttgccga tttcggccta ttggttaaaa	6600
aatgagctga tttaacaaaa atttaacgcg aattttaaca aaatattaac gtttacaatt	6660
taaatatttg cttatacaat cttcctgttt ttggggcttt tctgattatc aaccggggta	6720
catatgattg acatgctagt tttacgatta ccgttcatcg attctcttgt ttgctccaga	6780
ctctcaggca atgacctgat agcctttgta gagacctctc aaaaatagct accctctccg	6840
gcatgaattt atcagctaga acggttgaat atcatattga tggtgatttg actgtctccg	6900
gcctttctca cccgtttgaa tctttaccta cacattactc aggcattgca tttaaaatat	6960
atgagggttc taaaaatttt tatccttgcg ttgaaataaa ggcttctccc gcaaaagtat	7020
tacagggtca taatgttttt ggtacaaccg atttagcttt atgctctgag gctttattgc	7080
ttaattttgc taattctttg ccttgcctgt atgatttatt ggatgttgga attcctgatg	7140
cggtattttc tccttacgca tctgtgcggt atttcacacc gcatatggtg cactctcagt	7200
acaatctgct ctgatgccgc atagttaagc cagccccgac acccgccaac acccgctgac	7260
gcgccctgac gggcttgtct gctcccggca tccgcttaca gacaagctgt gaccgtctcc	7320
gggagctgca tgtgtcagag gttttcaccg tcatcaccga aacgcgcgag acgaaagggc	7380
ctcgtgatac gcctattttt ataggttaat gtcatgataa taatggtttc ttagacgtca	7440
ggtggcactt ttcggggaaa tgtgcgcgga acccctattt gtttattttt ctaaatacat	7500
tcaaatatgt atccgctcat gagacaataa ccctgataaa tgcttcaata atattgaaaa	7560
aggaagagta tgagtattca acatttccgt gtcgccctta ttcccttttt tgcggcattt	7620
tgccttcctg tttttgctca cccagaaacg ctggtgaaag taaaagatgc tgaagatcag	7680
ttgggtgcac gagtgggtta catcgaactg gatctcaaca gcggtaagat ccttgagagt	7740
tttcgccccg aagaacgttt tccaatgatg agcactttta aagttctgct atgtggcgcg	7800
gtattatccc gtattgacgc cgggcaagag caactcggtc gccgcataca ctattctcag	7860
aatgacttgg ttgagtactc accagtcaca gaaaagcatc ttacggatgg catgacagta	7920
agagaattat gcagtgctgc cataaccatg agtgataaca ctgcggccaa cttacttctg	7980
acaacgatcg gaggaccgaa ggagctaacc gcttttttgc acaacatggg ggatcatgta	8040
actcgccttg atcgttggga accggagctg aatgaagcca taccaaacga cgagcgtgac	8100
accacgatgc ctgtagcaat ggcaacaacg ttgcgcaaac tattaactgg cgaactactt	8160
actctagctt cccggcaaca attaatagac tggatggagg cggataaagt tgcaggacca	8220
cttctgcgct cggcccttcc ggctggctgg tttattgctg ataaatctgg agccggtgag	8280
cgtgggtctc gcggtatcat tgcagcactg gggccagatg gtaagccctc ccgtatcgta	8340
gttatctaca cgacggggag tcaggcaact atggatgaac gaaatagaca gatcgctgag	8400
ataggtgcct cactgattaa gcattggtaa ctgtcagacc aagtttactc atatatactt	8460
tagattgatt taaaacttca tttttaattt aaaaggatct aggtgaagat cctttttgat	8520
aatctcatga ccaaaatccc ttaacgtgag ttttcgttcc actgagcgtc agaccccgta	8580
gaaaagatca aaggatcttc ttgagatcct ttttttctgc gcgtaatctg ctgcttgcaa	8640
acaaaaaaac caccgctacc agcggtggtt tgtttgccgg atcaagagct accaactctt	8700
tttccgaagg taactggctt cagcagagcg cagataccaa atactgtcct tctagtgtag	8760
ccgtagttag gccaccactt caagaactct gtagcaccgc ctacatacct cgctctgcta	8820
atcctgttac cagtggctgc tgccagtggc gataagtcgt gtcttaccgg gttggactca	8880
agacgatagt taccggataa ggcgcagcgg tcgggctgaa cggggggttc gtgcacacag	8940
cccagcttgg agcgaacgac ctacaccgaa ctgagatacc tacagcgtga gctatgagaa	9000
agcgccacgc ttcccgaagg gagaaaggcg gacaggtatc cggtaagcgg cagggtcgga	9060
acaggagagc gcacgaggga gcttccaggg ggaaacgcct ggtatcttta tagtcctgtc	9120
gggtttcgcc acctctgact tgagcgtcga tttttgtgat gctcgtcagg ggggcggagc	9180
ctatggaaaa acgccagcaa cgcggccttt ttacggttcc tggccttttg ctggcctttt	9240
gctcacatgt tctttcctgc gttatcccct gattctgtgg ataaccgtat taccgccttt	9300
gagtgagctg ataccgctcg ccgcagccga acgaccgagc gcagcgagtc agtgagcgag	9360
gaagcggaag agcgcccaat acgcaaaccg cctctccccg cgcgttggcc gattcattaa	9420
tg	9422

(nucleotide sequence for inverted terminal repeat 1)
SEQ ID 4

ctgcgcgctc gctcgctcac tgaggccgcc cgggcaaagc ccgggcgtcg ggcgaccttt	60
ggtcgcccgg cctcagtgag cgagcgagcg cgcagagagg gagtggccaa ctccatcact	120
aggggttcct	130

(nucleotide sequence for inverted terminal repeat 2)
SEQ ID 5

aggaacccct agtgatggag ttggccactc cctctctgcg cgctcgctcg ctcactgagg	60
ccgggcgacc aaaggtcgcc cgacgcccgg gctttgcccg ggcggcctca gtgagcgagc	120
gagcgcgc	128

(nucleotide sequence for eGFP mouse-human optimized)
SEQ ID 6

cagcagctgc gcgctcgctc gctcactgag gccgcccggg caaagcccgg gcgtcgggcg	60
acctttggtc gcccggcctc agtgagcgag cgagcgcgca gagagggagt ggccaactcc	120
atcactaggg gttccttgta gttaatgatt aacccgccat gctacttatc tacgtagcca	180
tgctctagga cattgattat tgactagtgg agttccgcgt tacataactt acggtaaatg	240
gcccgcctgg ctgaccgccc aacgaccccc gcccattgac gtcaataatg acgtatgttc	300
ccatagtaac gccaataggg actttccatt gacgtcaatg ggtggagtat ttacggtaaa	360
ctgcccactt ggcagtacat caagtgtatc atatgccaag tacgccccct attgacgtca	420
atgacggtaa atggcccgcc tggcattatg cccagtacat gaccttatgg gactttccta	480
cttggcagta catctacgta ttagtcatcg ctattaccat ggtcgaggtg agccccacgt	540
tctgcttcac tctccccatc tcccccccct ccccaccccc aattttgtat ttatttattt	600
tttaattatt ttgtgcagcg atgggggcgg gggggggggg gggcgcgcgc caggcggggc	660
ggggcggggc gaggggcggg gcggggcgag gcggagaggt gcggcggcag ccaatcagag	720
cggcgcgctc cgaaagtttc cttttatggc gaggcggcgg cggcggcggc cctataaaaa	780
gcgaagcgcg cggcgggcgg gagtcgctgc gcgctgcctt cgccccgtgc cccgctccgc	840
cgccgcctcg cgccgcccgc cccggctctg actgaccgcg ttactaaaac aggtaagtcc	900
ggcctccgcg ccgggttttg gcgcctcccg cgggcgcccc cctcctcacg gcgagcgctg	960
ccacgtcaga cgaagggcgc agcgagcgtc ctgatccttc cgcccggacg ctcaggacag	1020
cggcccgctg ctcataagac tcggccttag aaccccagta tcagcagaag gacattttag	1080
gacgggactt gggtgactct agggcactgg ttttctttcc agagagcgga acaggcgagg	1140
aaaagtagtc ccttctcggc gattctgcgg agggatctcc gtggggcggt gaacgccgat	1200
gatgcctcta ctaaccatgt tcatgttttc tttttttttc tacaggtcct gggtgacgaa	1260
cagggtaccg ccaccatggt gtccaaggga gaggagctgt tcaccggagt ggtgcccatc	1320
ctggtggagc tggacggcga tgtgaatggc cacaagttta gcgtgtccgg agagggagag	1380
ggcgacgcaa cctacggcaa gctgacactg aagttcatct gcaccacagg caagctgccc	1440
gtgccttggc caaccctggt gaccacactg acatacggcg tgcagtgttt ttctcggtat	1500
ccagaccaca tgaagcagca cgatttcttt aagagcgcca tgcccgaggg ctacgtgcag	1560
gagaggacaa tcttctttaa ggacgatggc aactataaga ccagagccga ggtgaagttc	1620
gagggcgaca cactggtgaa ccggatcgag ctgaagggca tcgactttaa ggaggatggc	1680
aatatcctgg gccacaagct ggagtacaac tataattccc acaacgtgta catcatggcc	1740
gataagcaga agaacggcat caaggtgaac ttcaagatcc gccacaatat cgaggacggc	1800
tctgtgcagc tggccgatca ctaccagcag aacaccccta tcggcgacgg acccgtgctg	1860
ctgcctgata atcactatct gtctacacag agcgccctgt ccaaggaccc aaacgagaag	1920
agggatcaca tggtgctgct ggagttcgtg accgcagcag gcatcacact gggcatggat	1980
gagctgtata ag	1992

(nucleic acid sequence for HA tag)
SEQ ID 7

tacccctatg acgtgcctga ttatgcc

27

Example 1—Expression Cassette

Expression cassettes for expressing a precursor protein were synthesized by Genscript. Each cassette contained a signal peptide, the precursor protein that may be followed by a self-cleaving 2A peptide sequence, a signal peptide and the human lambda constant domain. The synthesized precursor protein expression cassettes were cloned into the pAVA-00200 plasmid backbone containing the CASI promoter1, multiple cloning site (MCS), Woodchuck Hepatitis Virus post-transcriptional regulatory element (WPRE), Simian virus 40 (SV40) polyadenylation (polyA) sequence all flanked by the AAV2 inverted terminal repeats (ITR). pAVA-00200 was cut with the restriction enzymes KpnI and XbaI in the MCS and separated on a 1% agarose gel. The band of interest was excised and purified using a gel extraction kit. Each precursor protein expression cassette was amplified by PCR using Taq polymerase and the PCR products were gel purified and the bands on interest were also excised and purified using a gel extraction kit. These PCR products contained the precursor protein expression cassettes in addition to 15 base pair 5′ and 3′ overhangs that align with the ends of the linearized pAVA-00200 backbone. Using in-fusion cloning2, the amplified precursor protein or expression cassettes are integrated with the pAVA-00200 backbone via homologous recombination. The resulting plasmid vectors contained the following 5′ ITR, CASI promoter the precursor protein expression cassette, WPRE, SV40 polyA and ITR 3′, per SEQ ID No. 3.

Example 2—Experimental Data

Table 1 below summarizes data obtained from HEK293 cells that were administered an AAV vector of SEQ ID No. 3 and TLR3 protein levels were compared against control HEK293 cells that did not receive the AAV vector of SEQ ID No. 3 (control). Speicifically, about 2.5×10⁶ HEK293 confluent cells were administered about 1×10⁸ AAV vectors of SEQ ID No. 3. About 48 hours later, expression levels of human TLR3 mRNA were determined by qRT-PCR, and converted to expressed TLR3 protein levels.

TABLE 1
TLR3 Protein Levels

Molecule	Control (ag)	AAV recipient (ag)	P-value
TLR3	1	23	0.0076
n.b. ag = attogram 1 × 10−18 grams

As shown in Table 1, cells that received the AAV of SEQ ID No. 3 that include SEQ ID No. 1 that encoded for increased production of a TLR3 precursor protein demonstrated statistically significant higher amounts of TLR3 than the control cells that did not receive the AAV. Without being bound by any particular theory, the cells that were administered the AAV had higher levels of TLR3 than cells that did not receive the AAV.