US20220184109A1
2022-06-16
17/547,008
2021-12-09
The present subject matter provides compositions, formulations, and methods for inhibiting, treating, or preventing aberrant angiogenesis in a subject.
Get notified when new applications in this technology area are published.
C12Q2600/158 » CPC further
Oligonucleotides characterized by their use Expression markers
A61K31/7088 » CPC main
Medicinal preparations containing organic active ingredients; Carbohydrates; Sugars; Derivatives thereof Compounds having three or more nucleosides or nucleotides
A61P27/02 » CPC further
Drugs for disorders of the senses Ophthalmic agents
A61P35/04 » CPC further
Antineoplastic agents specific for metastasis
A61K31/5513 » CPC further
Medicinal preparations containing organic active ingredients; Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins having seven-membered rings, e.g. azelastine, pentylenetetrazole having two nitrogen atoms, e.g. dilazep 1,4-Benzodiazepines, e.g. diazepam or clozapine
C12Q1/6886 » CPC further
Measuring or testing processes involving enzymes, nucleic acids or microorganisms ; Compositions therefor; Processes of preparing such compositions involving nucleic acids; Nucleic acid products used in the analysis of nucleic acids, e.g. primers or probes for diseases caused by alterations of genetic material for cancer
This application is a continuation of U.S. patent application Ser. No. 16/348,860, filed May 9, 2019, which is the U.S. national stage application, filed under 35 U.S.C. 371, of PCT International Patent Application No. PCT/US17/61620, filed Nov. 14, 2017, which claims the benefit of priority to U.S. Provisional Application No. 62/476,610, filed Mar. 24, 2017 and U.S. Provisional Application No. 62/422,523, filed Nov. 15, 2016, the entire contents of each of which are incorporated herein by reference.
This invention was made with government support under R01EY005318, R00EY021624, K12EY16335, UH2NS100121-01, R21EY027061, and P30EY003790 awarded by the National Institutes of Health. The government has certain rights in the invention.
The present invention relates to aberrant angiogenesis.
The entire content of the text file named SEQLISTING.txt, which was created on Dec. 9, 2021, and is 195,667 bytes in size, is hereby incorporated by reference.
Neovascularization is a pathological feature of proliferative diabetic retinopathy (PDR), age-related macular degeneration (AMD), retinopathy of prematurity (ROP), cancer, and other conditions [Chung A S & Ferrara N (2011) Annu Rev Cell Dev Biol 27:563-584]. Abnormal vessel growth is thought to develop when there is an imbalance between pro- and anti-angiogenic signals, a process known as the angiogenic switch [Bergers G & Benjamin L E (2003) Nat Rev Cancer 3(6):401-410]. The resulting new vessels can be located in physiologically avascular regions such as the surface of the retina or within the vitreous of the eye. The new vessels generally display irregular branching patterns and increased permeability, leaving them prone to hemorrhage [Daxer A (1993) Curr Eye Res 12(12):1103-1109; Antonetti et al. (1999) J Biol Chem 274(33):23463-23467]. Anti-angiogenic therapies typically target vascular endothelial growth factor (VEGF) and are effective treatments for a number of neovascular ocular diseases and some solid tumors [Yadav et al. J Clin Diagn Res 9(6):XE01-XE05; Kim L A & D'Amore P A (2012) Am J Pathol 181(2):376-379].
Despite the success of anti-VEGF therapies, there is a need for new therapeutic approaches to treat aberrant angiogenesis, as current therapies are not universally effective and prolonged inhibition of VEGF may lead to tissue atrophy and other side effects [Saint-Geniez M, et al. (2008) PLoS One 3(11):e3554; Sang D N & D'Amore P A (2008) Diabetologia 51(9):1570-1573]. For example, anti-VEGF therapies are sometimes avoided in the treatment of PDR because they may precipitate the angio-fibrotic switch, enhancing the conversion of neovascular membranes into fibrovascular membranes (FVMs), which may contract and cause hemorrhages and tractional retinal detachments in patients with PDR while extended therapy may lead to tissue atropy, ischemia, and reperfusion injury [Arevalo J F, et al. (2008) Br J Ophthalmol 92(2):213-216; Hsu et al. (2014) Era. Journal of ophthalmology 2014.917375; Kuiper E J, et al. (2008) PLoS One 3(7):e2675]. Complex surgical procedures are required to remove intraocular hemorrhage, excise FVMs, and relieve associated traction in order to restore vision. The molecular mechanisms underlying the transition from a proliferative to a fibrotic state in PDR are largely unknown, though some reports implicate the balance between VEGF and connective tissue growth factor (CTGF) as critical to this process [Kuiper E J, et al. (2008) PLoS One 3(7):e2675; Van Geest R J, et al. (2012) Br J Ophthalmol 96(4):587-590; Sohn E H, et al. (2012) Arch Ophthalmol 130(9):1127-1134].
ROP, diabetic retinopathy (DR), and AMD, are leading causes of blindness in infants, working-age adults, and the elderly, respectively. ROP is believed to account for 6-18% of childhood blindness in developed countries [Hakeem et al., Middle East Afr J Ophthalmol. 2012 July-September: 19(3): 289-294]; the number of Americans with DR is expected to nearly double between 2010-2050, from 7.7 million to 14.6 million (nei.nih.gov/eyedata/diabetic); and AMD accounts for 8-7% of all blindness worldwide and is the most common cause of blindness in developed countries (www.who.int/blindness/causes/priority/en/).
Currently, there are no medical treatments for PDR, which is the most severe manifestation of DR. Current standard of care for PDR includes panretinal photocoagulation, or vitreo-retinal surgery to surgically remove fibrovascular membranes. Compositions and methods for the treatment of aberrant angiogenesis in diseases such as PDR are needed.
Provided herein are, inter alia, solutions to the clinical needs and problems described above. The present subject matter provides compositions, formulations, and methods for inhibiting, treating, or preventing aberrant angiogenesis, e.g., aberrant angiogenesis in the eye such as ocular neovascularization, in a subject. Aspects of the present subject matter provide a method for inhibiting, treating, or preventing aberrant angiogenesis in a subject, comprising administering to the subject an effective amount of a Runt-Related Transcription Factor 1 (RUNX1) or PIM3 Proto-Oncogene, Serine/Threonine Kinase (PIM3) inhibitor or modulator.
In some embodiments, the PIM3 inhibitor is co-administered with an ubiquitin-specific protease-7 (USP7) inhibitor.
In various embodiments, the aberrant angiogenesis comprises aberrant ocular angiogenesis (aberrant angiogenesis in the eye). In some embodiments, the subject comprises proliferative diabetic retinopathy (PDR), macular edema, non-proliferative diabetic retinopathy, age-related macular degeneration (AMfD), or ocular neovascularization. In certain embodiments, the AMD comprises dry AMD. In various embodiments, the AMD comprises wet AMD.
In some embodiments, the subject comprises a cancer. In certain embodiments, the cancer is other than leukemia. In various embodiments, the cancer comprises melanoma. In some embodiments, the cancer comprises a solid tumor. For example, the aberrant angiogenesis may include blood vessel growth toward, into, and/or within the solid tumor. In certain embodiments, the solid tumor comprises a dimension that is greater than at least about 1, 2, 3, 4, 5, 6, 7, 8, 9, 10 mm or more and/or a volume of at least about 1, 1.5, 2, 3, 4, 5, 6, 7, 8, 9, 10 mm3 or more.
In various embodiments, the RUNX1 inhibitor or the PIM3 inhibitor is administered as part of a treatment regimen that does not comprise an additional antiangiogenic inhibitor. In a non-limiting example, the treatment regimen does not comprise a vascular endothelial growth factor (VEGF) pathway inhibitor. In some embodiments, the RUNX1 or PIM3 inhibitor is administered as a monotherapy. In various embodiments, a PIM3 inhibitor is co-administered with an USP7 inhibitor.
In certain embodiments, the subject is an animal other than a pregnant animal, an infant, a fetus, or an embryo.
In some embodiments, the subject comprises diabetes. For example, the diabetes may be type 1 diabetes or type 2 diabetes.
In various embodiments, the subject comprises retinopathy of prematurity (ROP), diabetic retinopathy (DR), age-related macular degeneration (AMD), a retinal vein occlusion, a vascular malformation, a cerebral cavernous malformation, macular edema, non-proliferative diabetic retinopathy, ocular ischemic syndrome, neovascular glaucoma, a hemangioma, a retinal hemangioma, Coats' Disease, Norrie Disease, or Von Hippel-Lindau disease, or any condition that includes pathological angiogenesis as part of its pathobiology.
In certain embodiments, the subject is at least about 10, 20, 30, 40, 50, 60, 70, 80, or 90 years old.
In various embodiments, the RUNX1 inhibitor is a gamma-secretase inhibitor or modulator. In some embodiments, the gamma-secretase inhibitor reduces the expression of RUNX1. In certain embodiments, the gamma-secretase inhibitor is Compound E.
In some embodiments, the RUNX1 inhibitor or the PIM3 inhibitor comprises an aptamer, an oligonucleotide, a peptide, an antibody or a fragment thereof, or a small molecule. In a non-limiting example, the RUNX1 inhibitor binds to RUNX1 and/or CBFβ. In various embodiments, the RUNX1 inhibitor binds to RUNX1. In some embodiments the PIM3 inhibitor binds to PIM3. In certain embodiments, the RUNX1 inhibitor comprises Ro5-3335. In some ebodiments, the RUXI inhibitor comprises Ro24-7429. In various embodiments, the RUNX1 inhibitor or the PIM3 inhibitor comprises an oligonucleotide. For example, the oligonucleotide may comprise at least about 10, 15, 20, 25, 30, or more nucleotides in a sequence that is complementary to a nucleotide sequence within a gene or mRNA molecule that encodes RUNX1 or PIM3.
Aspects of the present subject matter also provide a composition comprising an effective amount of a RUNX1 inhibitor or a PIM3 inhibitor and an ophthalmically acceptable vehicle.
Aspects of the present subject matter relate to targeting RUNX1 or PIM3 for the treatment of a wide variety of retinal neovascular disorders including but not limited to: retinal vein occlusions, ocular ischemic syndrome, neovascular glaucoma, retinal hemangiomas, Coats' Disease, Norrie Disease, and retinopathy of prematurity, as well as other conditions that include aberrant angiogenesis.
The present subject matter also provides a method for inhibiting, treating, or preventing aberrant angiogenesis in a subject, comprising altering a RUNX1 or PIM3 gene in said subject. In various embodiments, altering a gene comprises altering a promoter, enhancer or other regulatory element of the gene, or an exon, an intron, or an intron-exon splice site of the gene. In some embodiments, altering the RUNX1 or PIM3 gene comprises the administration of (i) a Cas protein, a zinc finger nuclease (ZFN), or a transcription activator-like effector-based nuclease (TALEN), or (ii) an expression vector encoding a Cas protein, a ZFN, or a TALEN, to said subject. For example, in certain embodiments the gene is altered with via a CRISPR-Cas9 system.
The present subject matter further includes a method for inhibiting, treating, or preventing aberrant angiogenesis in a subject, comprising administering to said subject a NOTCH inhibitor in an amount that is effective to reduce RUNX1 expression or activity.
Included herein are compositions, formulations, and methods for inhibiting, treating, or preventing small vessel diseases (SVDs). Aspects of the present subject matter relate to the use of RUNX1 or PIM3 inhibitors or modulators for the treatment of a wide variety of SVDs including but not limited to cerebral small vessel disease, cerebral autosomal recessive arteriopathy with subcortical infarcts and leukoencephalopathy (CARASIL), age-related macular degeneration (AMD), cerebral autosomal-dominant arteriopathy with subcortical infarcts and leukoencephalopathy (CADASIL), NOTCH3 loss-of-function-associated SVD (e.g., a SVD associated with a mutation that reduces the expression and/or activity of NOTCH3), nephropathy, microangiopathy, heart failure, Alagille syndrome, familial tetralogy of Fallot, patent ductus arteriosus, cerebral cavernous malformation, diabetic retinopathy, and familial exudative vitreoretinopathy (FEVR). In various embodiments, during development there is less development of vessels in the retinal periphery but blindness occurs when subjects (e.g., child subjects such as subjects less than 18, 17, 16, 15, 14, 13, 12, 11, 10, 9, 8, 7, 6, 5, 4, 3, or 2 years of age) grow and have compensatory aberrant ocular angiogenesis. In some embodiments, RUNX1 or PIM3 inhibition is useful to treating such aberrant ocular angiogenesis.
In various embodiments, an SVD comprises aberrant angiogenesis such as aberrant ocular angiogenesis.
Aspects of the present subject matter provide a method for inhibiting, treating, or preventing aberrant angiogenesis or an SVD in a subject, comprising administering to the subject an effective amount of insulin growth factor binding protein 3 (IGFBP3) (e.g., recombinant IGFBP3 such as recombinantly produced human IGFBP3). Alternatively or in addition, aberrant angiogenesis or an SVD may be treated by, e.g., increasing the expression of IGFBP3. In some embodiments, the expression of IGFBP3 is increased by a method comprising genetically modifying a subject's IGFBP3 gene to increase the expression thereof (e.g., by altering or replacing the promoter or another regulatory sequence of the IGFBP3 gene, or by inserting an additional copy of the IGFBP3 gene into a subject, or by targeting enhancers of transcription to the promoter using CRISPR or TALEN). In certain embodiments, increasing the expression of IGFBP3 comprises administering a vector that encodes IGFBP3 to the subject. In various embodiments, the vector comprises a viral vector or a plasmid.
In various embodiments, a subject who is treated by any method disclosed herein has been identified as at risk of aberrant angiogenesis, or as having aberrant angiogenesis, by a diagnostic or prognostic method provided herein, or with a battery of testing comprising a diagnostic or prognostic method provided herein.
Various implementations relate to a method for detecting or diagnosing aberrant angiogenesis in a subject comprising (a) providing a test sample from the subject; (b) assaying the level of RUNX1, PIM3, or IGFBP3 protein or mRNA in the test sample; and (c) diagnosing the subject as having aberrant angiogenesis if the level of RUNX1 or PIM3 protein or mRNA is elevated in the test sample compared to a normal control, or diagnosing the subject as having aberrant angiogenesis if the level of 1GFBP3 protein or mRNA is lower in the test sample compared to a normal control. In some embodiments, the subject is diagnosed with the aberrant angiogenesis if the level of RUNX1 or PTM3 protein or mRNA is at least about 5%, 10%, 15%, 20%, 25%, 30%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 90%, 5-50%, 50-75%, 1-fold, 2-fold, 3-fold, 4-fold, or 5-fold higher in said test sample compared to a normal control. In certain embodiments, the subject is diagnosed with the aberrant angiogenesis if the level of IGFBP3 protein or mRNA in said test sample is less than about 5%, 10%, 15%, 20%, 25%, 30%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, or 90% of the level than a normal control. In some embodiments, the level of RUNX1 protein is the level of phosphorylated RUNX1 protein (pRUNX1). In certain embodiments, the level of pRUNX1 comprises pRUNX1 that is prosphorylated at S249.
In various embodiments, IGFBP3 is a biomarker for RUNX1 activity, and a decrease in IGFBP3 protein or mRNA indicates an increase in RUNX1 activity. In some embodiments, lower level of IGFBP3 protein or mRNA in a sample compared to a normal control sample (e.g., a level that is less than about 5%, 10%, 15%, 20%, 25%, 30%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, or 90% of the level than a normal control) indicates an abnormally high level of RUNX1 activity, such as a level of RUNX1 activity that is indicative of aberrant angiogenesis. In some embodiments, the level of RUNX1 protein is the level of pRUNX1. In certain embodiments, the level of pRUNX1 comprises pRUNX1 that is prosphorylated at S249. In certain embodiments, the level of IGFBP3 is measured in affected tissue, the vitreous, or blood (e.g., whole blood, plasma, or serum).
Aspects of the present subject matter provide a method for identifying whether a subject is at risk of developing a disease comprising aberrant angiogenesis comprising (a) providing a test sample from said subject; (b) assaying the level of RUNX1, PIM3, or IGFBP3 protein or mRNA in the test sample; and (c) identifying the subject as at risk of developing the disease if the level of RUNX1 or PIM3 protein or mRNA is elevated in the test sample compared to a normal control, or identifying the subject as at risk of developing the disease if the level of IGFBP3 protein or mRNA is lower in the test sample compared to a normal control. In some embodiments, the subject is identified as at risk of developing the disease if the level of RUNX1 or PIM3 protein or mRNA is at least about 5%, 10%, 15%, 20%, 25%, 30%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 90%, 5-50%, 50-75%, 1-fold, 2-fold, 3-fold, 4-fold, or 5-fold higher in said test sample compared to a normal control. In certain embodiments, the subject is identified as at risk of developing the disease if the level of TGFBP3 protein or mRNA in said test sample is less than about 5%, 10%, 15%, 20%, 25%, 30%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, or 90% of the level than a normal control. In some embodiments, the level of RUNX1 protein is the level of pRUNX1. In certain embodiments, the level of pRUNX1 comprises pRUNX1 that is prosphorylated at S249.
In some embodiments, the method further comprises directing the subject to obtain (i) additional screening or an additional diagnostic test for the disease if the subject is identified as at risk of developing the disease; or (ii) treatment to reduce, delay, or prevent the onset or progression of the disease.
The present subject matter also includes a method for monitoring whether a disease that comprises aberrant angiogenesis is progressing in a subject who has been diagnosed with the disease, comprising periodically determining the level of RUNX1, PIM3, or IGFBP3 protein or mRNA in the subject, and (1) identifying the disease as worsening if the level of RUNX1 or PIM3 protein or mRNA increases over time, or if the level of IGFBP3 protein or mRNA decreases over time; (2) identifying the disease as improving if the level of RUNX1 or PIM3 protein or mRNA decreases over time, or if the level of IGFBP3 protein or mRNA increases over time; or (3) identifying the disease as neither worsening nor improving if the level of RUNX1, PIM3, or IGFBP3 protein or mRNA remains the same or about the same over time, wherein determining the level of RUNX1, PIM3, or IGFBP3 protein or mRNA comprises (a) providing a test sample from the subject; and (b) assaying the level of RUNX1, PIM3, or IGFBP3 protein or mRNA in the test sample. In some embodiments, the level of RUNX1, PIM3, or IGFBP3 protein or mRNA is determined at least about 1, 2, 3, 4, 5, 6, 7, 8, 9, 10 or more times and/or at least once every 1, 2, 3, or 4 weeks; at least once every 1, 2, 3, 4, 5, or 6 weeks; or at least once every 1, 2, 3, 4, or 5 years. In some embodiments, the level of RUNX1 protein is the level of pRUNX1. In certain embodiments, the level of pRUNX1 comprises pRUNX1 that is prosphorylated at S249.
Aspects of the present subject matter also provide a method of prophylaxis for a disease comprising aberrant angiogenesis, comprising identifying whether a subject is at risk of suffering from the disease, and administering to the subject a treatment for the disease if the subject is identified as at risk of suffering from the disease.
Also included is a method for adjusting the dose of a compound that is administered to a subject during a treatment regimen for a disease that comprises aberrant angiogenesis, comprising periodically determining the level of RUNX1, PIM3, or IGFBP3 protein or mRNA in the subject, and (1) increasing the dose of the compound if the level of RUNX1 or PIM3 protein or mRNA increases over time, or if the level of IGFBP3 protein or mRNA decreases over time; (2) maintaining or decreasing the dose of the compound if the level of RUNX1 or PIM3 protein or mRNA decreases over time, or if the level of IGFBP3 protein or mRNA increases over time; or (3) maintaining or increasing the dose of the compound if the level of RUNX1, PIM3, or IGFBP3 protein or mRNA remains the same or about the same over time, wherein determining the level of RUNX1, PIM3, or IGFBP3 protein or mRNA comprises (a) providing a test sample from the subject; and (b) assaying the level of RUNX1, PIM3, or IGFBP3 protein or mRNA in the test sample. In some embodiments, the level of RUNX1 protein is the level of pRUNX1. In certain embodiments, the level of pRUNX1 comprises pRUNX1 that is prosphorylated at S249.
The present subject matter further includes a method for identifying whether a therapy has reduced or ameliorated a disease that comprises aberrant angiogenesis in a subject comprising (a) providing a pre-therapy test sample from the subject; (b) assaying the pre-therapy level of RUNX1, PIM3, or IGFBP3 protein or mRNA in the pre-therapy test sample; (c) administering the therapy to the subject; (d) providing a post-therapy test sample from the subject; (e) assaying the post-therapy level of RUNX1, PIM3, or IGFBP3 protein or mRNA in the post-therapy test sample; and (f) identifying the therapy as having reduced or ameliorated said disease if the level of RUNX1 or PIM3 protein or mRNA in the post-therapy test sample is lower than the level of RUNX1 or PIM3 protein or mRNA in the pre-therapy test sample, or if the level of IGFBP3 protein or mRNA in the post-therapy test sample is higher than the level of IGFBP3 protein or mRNA in the pre-therapy test sample. In some embodiments, the level of RUNX1 protein is the level of pRUNX1. In certain embodiments, the level of pRUNX1 comprises pRUNX1 that is prosphorylated at S249.
Various implementations relate to a method for detecting or diagnosing aberrant angiogenesis in a subject comprising (a) providing a test sample from the subject; (b) assaying the level of PPIF or CD44 protein or mRNA in the test sample; and (c) diagnosing the subject as having aberrant angiogenesis if the level of PPIF (Peptidylprolyl Isomerase F) or CD44 protein or mRNA is elevated in the test sample compared to a normal control. In some embodiments, the subject is diagnosed with the aberrant angiogenesis if the level of PPIF or CD44 protein or mRNA is at least about 5%, 10%, 15%, 20%, 25%, 30%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 90%, 5-50%, 50-75%, 1-fold, 2-fold, 3-fold, 4-fold, or 5-fold higher in said test sample compared to a normal control.
Aspects of the present subject matter provide a method for identifying whether a subject is at risk of developing a disease comprising aberrant angiogenesis comprising (a) providing a test sample from said subject; (b) assaying the level of PPIF or CD44 protein or mRNA in the test sample; and (c) identifying the subject as at risk of developing the disease if the level of PPIF or CD44 protein or mRNA is elevated in the test sample compared to a normal control. In some embodiments, the subject is identified as at risk of developing the disease if the level of PPIF or CD44 protein or mRNA is at least about 5%, 10%, 15%, 20%, 25%, 30%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 90%, 5-50%, 50-75%, 1-fold, 2-fold, 3-fold, 4-fold, or 5-fold higher in said test sample compared to a normal control.
In some embodiments, the method further comprises directing the subject to obtain (i) additional screening or an additional diagnostic test for the disease if the subject is identified as at risk of developing the disease; or (ii) treatment to reduce, delay, or prevent the onset or progression of the disease.
The present subject matter also includes a method for monitoring whether a disease that comprises aberrant angiogenesis is progressing in a subject who has been diagnosed with the disease, comprising periodically determining the level of PPIF or CD44 protein or mRNA in the subject, and (1) identifying the disease as worsening if the level of PPIF or CD44 protein or mRNA increases over time; (2) identifying the disease as improving if the level of PPIF or CD44 protein or mRNA decreases over time; or (3) identifying the disease as neither worsening nor improving if the level of PPIF or CD44 protein or mRNA remains the same or about the same over time, wherein determining the level of PPIF or CD44 protein or mRNA comprises (a) providing a test sample from the subject; and (b) assaying the level of PPIF or CD44 protein or mRNA in the test sample. In some embodiments, the level of PPIF or CD44 protein or mRNA is determined at least about 1, 2, 3, 4, 5, 6, 7, 8, 9, 10 or more times and/or at least once every 1, 2, 3, or 4 weeks; at least once every 1, 2, 3, 4, 5, or 6 weeks; or at least once every 1, 2, 3, 4, or 5 years.
Aspects of the present subject matter also provide a method of prophylaxis for a disease comprising aberrant angiogenesis, comprising identifying whether a subject is at risk of suffering from the disease, and administering to the subject a treatment for the disease if the subject is identified as at risk of suffering from the disease.
Also included is a method for adjusting the dose of a compound that is administered to a subject during a treatment regimen for a disease that comprises aberrant angiogenesis, comprising periodically determining the level of PPIF or CD44 protein or mRNA in the subject, and (1) increasing the dose of the compound if the level of PPIF or CD44 protein or mRNA increases over time; (2) maintaining or decreasing the dose of the compound if the level of PPIF or CD44 protein or mRNA decreases over time; or (3) maintaining or increasing the dose of the compound if the level of PPIF or CD44 protein or mRNA remains the same or about the same over time, wherein determining the level of PPIF or CD44 protein or mRNA comprises (a) providing a test sample from the subject; and (b) assaying the level of PPIF or CD44 protein or mRNA in the test sample.
The present subject matter further includes a method for identifying whether a therapy has reduced or ameliorated a disease that comprises aberrant angiogenesis in a subject comprising (a) providing a pre-therapy test sample from the subject; (b) assaying the pre-therapy level of PPIF or CD44 protein or mRNA in the pre-therapy test sample; (c) administering the therapy to the subject; (d) providing a post-therapy test sample from the subject; (e) assaying the post-therapy level of PPIF or CD44 protein or mRNA in the post-therapy test sample; and (f) identifying the therapy as having reduced or ameliorated said disease if the level of PPIF or CD44 protein or mRNA in the post-therapy test sample is lower than the level of PPIF or CD44 protein or mRNA in the pre-therapy test sample.
In various embodiments, PPIF and CD44 are downstream targets of RUNX1. In embodiments, the CD44 is present on the plasma membrane of a cell.
In some embodiments, the test sample comprises a bodily fluid from said subject. Non-limiting examples of bodily fluids include whole blood, a component of whole blood, plasma, or serum. Alternatively or in addition, the test sample comprises a tissue biopsy.
In various embodiments, assaying the level of RUNX1, PIM3, IGFBP3, RUNX1, PIM3, IGFBP3, PPIF, or CD44 (e.g., RUNX1, PIM3, or IGFBP3) protein or mRNA comprises contacting the RUNX1, PIM3, or IGFBP3 protein or mRNA with a specific binding agent. In some embodiments, the binding agent comprises oligonucleotide probe or primer, an antibody or a fragment thereof, or a polypeptide or a fragment thereof. In certain embodiments, the binding agent is attached to a solid support.
In some embodiments, assaying comprises an enzyme immunoassay (ETA) or a reverse transcriptase polymerase chain reaction (RT-PCR). In certain embodiments, assaying comprises an enzyme-linked immunosorbent assay (ELISA), a Western blot, a mass spectrometry assay, a radioimmunoassay, or a fluoroimmunoassay.
Biomarker changes that may be detected also include the redistribution of biomarkers between different compartments of a body, such as between a vessel and blood or between cerebrospinal fluid (CSF) and blood. Therefore, assaying of one or more of the biomarkers provided herein may be performed using a specific binding agent that may be detected with via imaging. Non-limiting examples of imaging technologies include positron emission tomography (PET) and single-photon emission computed tomography (SPECT).
Embodiments of the present subject matter relate to kits that detect two or more of the biomarkers disclosed herein (e.g., at the same time) and/or protein-protein interactions between them. In some embodiments, the biomarkers include 1, 2, 3, or 4 of any combination of RUNX1, PIM3, IGFBP3, PPIF, and CD44, or all 5 of RUNX1, PIM3, IGFBP3, PPIF, and CD44. Aspects of the present subject matter provide a kit comprising (a) (i) an agent for detecting the level of RUNX1; (ii) an agent for detecting the level of PIM3; or (iii) an agent for detecting the level of IGFBP3, and (b) instructions for using the agent for diagnosing or detecting aberrant angiogenesis, for identifying whether a subject is at risk of developing a disease that comprises aberrant angiogenesis, for determining the progression of the disease, for assessing the efficacy of a treatment for the disease, and/or for adjusting the dose of a compound during the treatment of disease. Also provided is a kit comprising (a) (i) an agent for detecting the level of PPIF; (ii) an agent for detecting the level of CD44; and/or (iii) an agent for detecting the level of RUNX1, PIM3, and/or IGFBP3, and (b) instructions for using the agent for diagnosing or detecting aberrant angiogenesis, for identifying whether a subject is at risk of developing a disease that comprises aberrant angiogenesis, for determining the progression of the disease, for assessing the efficacy of a treatment for the disease, and/or for adjusting the dose of a compound during the treatment of disease. In some embodiments, the agent for detecting the level of RUNX1 detects the level of pRUNX1. In certain embodiments, the level of pRUNX1 comprises pRUNX1 that is prosphorylated at S249.
The present subject matter also provides a diagnostic system comprising (a) an assortment, collection, or compilation of test results data representing the level of RUNX1, PIM3, and/or IGFBP3 in a plurality of test samples; (b) a means for computing an index value using said level, wherein the index value comprises a diagnostic, prognostic, progression, or treatment score; and (c) a means for reporting the index value. Also included is a diagnostic system comprising (a) an assortment, collection, or compilation of test results data representing the level of RUNX1, PIM3, IGFBP3, PPIF, and/or CD44 in a plurality of test samples; (b) a means for computing an index value using said level, wherein the index value comprises a diagnostic, prognostic, progression, or treatment score; and (c) a means for reporting the index value. In some embodiments, the agent for detecting the level of RUNX1 detects the level of pRUNX1. In certain embodiments, the level of pRUNX1 comprises pRUNX1 that is prosphorylated at S249.
In some embodiments, the level of RUNX1, PIM3, IGFBP3, PPIF, and/or CD44 (e.g., RUNX1, PIM3, and/or IGFBP3) is measured in one or more biological fluids as part of a diagnostic or prognostic test for aberrant angiogenesis. Measurements of RUNX1, PIM3, IGFBP3, PPIF, and/or CD44 (e.g., RUNX1, PIM3, and/or IGFBP3) in biological fluids or tissue samples can be used as diagnostic or prognostic readouts for diseases comprising aberrant angiogenesis. In certain embodiments, a method disclosed herein is part of a battery of testing for a disease comprising aberrant angiogenesis. For example, a subject may be screened/tested and/or directed to receive additional screening/testing for a disease based on the level of RUNX1, PIM3, IGFBP3, PPIF, and/or CD44 (e.g., RUNX1, PIM3, and/or IGFBP3) in one or more bodily fluids or tissue samples.
In various embodiments, the level of RUNX1, PIM3, IGFBP3, PPIF, and/or CD44 (e.g., RUNX1, PIM3, and/or IGFBP3) is measured in one or more biological fluids or tissue samples as part of a method for evaluating the effectiveness of a treatment or the progression of a disease. Measures of RUNX1, PIM3, IGFBP3, PPIF, and/or CD44 (e.g., RUNX1, PIM3, and/or IGFBP3) in biological samples can be used as biomarkers to determine the efficacy of a treatment in an animal model or human. For example, a subject may be administered and/or directed to receive a different treatment, an increased dose of a therapeutic compound, or a decreased dose of a therapeutic compound based on the level of RUNX1, PIM3, IGFBP3, PPIF, and/or CD44 (e.g., RUNX1, PIM3, and/or IGFBP3) in one or more samples. In some embodiments, the therapeutic compound is a test compound being evaluated in a clinical trial. In certain embodiments, the therapeutic compound is a compound that has been approved for use in humans by a regulatory body such as the United States Food and Drug Administration. In some embodiments, the level of RUNX1 protein is the level of pRUNX1. In certain embodiments, the level of pRUNX1 comprises pRUNX1 that is prosphorylated at S249.
In instances where a disease cannot be specifically treated, the diagnostic and prognostic methods of the present subject matter provide valuable information to subjects that will allow them to make relevant lifestyle decisions and plan for the onset of likely symptoms. Thus, the present subject matter provides valuable tools, resources, and information to subjects with incurable diseases.
Methods described herein represent a non-invasive (or minimally invasive) test assay. For example, the test sample such as blood is obtained (e.g., by venipuncture), and the sample comprises a bodily fluid such as blood, serum, or plasma. In another example, the test sample comprises saliva, tears, vitreous, urine, or sweat.
In various implementations, the methods described herein may also include computing a level of RUNX1, PIM3, IGFBP3, PPIF, and/or CD44 (e.g., RUNX1, PIM3, and/or IGFBP3) in a process that includes the use of a binding agent. An exemplary example of a binding agent includes an antibody (or a fragment thereof) or a detectable protein (or a fragment thereof). The antibody may be labeled with a detectable moiety, e.g., a fluorescent compound or a radioactive agent (e.g., technetium-99m, iodine-123, iodine-125, iodine-131, indium-111, carbon-11, nitrogen-13, oxygen-15, fluorine-18, gallium-68, zirconium-89, or rubidium-82). When the fluorescently labeled antibody is exposed to light of the proper wavelength, its presence can then be detected due to fluorescence. Non-limiting examples of fluorescent labeling compounds include fluorescein isothiocyanate, rhodamine, phycoerythrin, phycocyanin, allophycocyanin, p-phthaldehyde, and fluorescamine. The antibody can also be detectably labeled using fluorescence emitting metals such as europium-152, or others of the lanthanide series. These metals can be attached to the antibody using such metal chelating groups as diethylenetriaminepentacetic acid (DTPA) or ethylenediaminetetraacetic acid (EDTA). The antibody also can be detectably labeled by coupling it to a chemiluminescent compound. The presence of the chemiluminescent-tagged antibody is then determined by detecting the presence of luminescence that arises during the course of chemical reaction. Non-limiting examples of particularly useful chemiluminescent labeling compounds include luminol, isoluminol, theromatic acridinium ester, imidazole, acridinium salt, and oxalate ester.
As used herein, a “specific binding agent” describes an agent having a greater than 10-fold, preferably greater than 100-fold, and most preferably, greater than 1000-fold affinity for a target molecule as compared to another molecule. As the skilled artisan will appreciate, the term “specific” is used to indicate that other biomolecules present in the sample do not significantly bind to the binding agent specific for the target molecule. In various embodiments, the level of binding to a biomolecule other than the target molecule results in a binding affinity which is at most only 10% or less, only 5% or less only 2% or less or only 1% or less of the affinity to the target molecule, respectively. A preferred specific binding agent will fulfill both the above minimum criteria for affinity as well as for specificity. For example, an antibody has a binding affinity in the low micromolar (10−6), nanomolar (10−7-10−9), with high affinity antibodies in the low nanomolar (10−9) or pico molar (10−12) range for its specific target ligand.
The present subject matter describes a composition utilizing a binding agent, wherein the binding agent is attached to a solid support, (e.g., a strip, a polymer, a bead, or a nanoparticle). Well-known supports or carriers include glass, polystyrene, polypropylene, polyethylene, dextran, nylon, amylases, natural and modified celluloses, polyacrylamides, gabbros, and magnetite. The nature of the carrier can be either soluble to some extent or insoluble for the purposes of the present subject matter. The support material may have virtually any possible structural configuration so long as the target molecule (e.g., a RUNX1, PIM3, or IGFBP3 protein) is capable of binding to a binding agent (e.g., an antibody). Thus, the support configuration may be spherical, as in a bead, or cylindrical, as in the inside surface of a test tube, or the external surface of a rod. Alternatively, the surface may be flat such as a sheet, or test strip, etc. In some embodiments, the support includes polystyrene beads. Those skilled in the art will know many other suitable carriers and supports, or will be able to ascertain the same by use of routine experimentation.
In some aspects, the solid support comprises a polymer, to which an agent is chemically bound, immobilized, dispersed, or associated. A polymer support may be a network of polymers, and may be prepared in bead form (e.g., by suspension polymerization). The location of active sites introduced into a polymer support depends on the type of polymer support. For example, in a swollen-gel-bead polymer support the active sites are distributed uniformly throughout the beads, whereas in a macroporous-bead polymer support they are predominantly on the internal surfaces of the macropores. In various embodiments, the solid support contains a RUNX1 binding agent alone or together with a binding agent for PTM3 and/or IGFBP3. In some embodiments, the solid support contains a PIM3 binding agent alone. In certain embodiments, the solid support contains an IGFBP3 binding agent alone. In various embodiments, the solid support contains a binding agent for any of, or any combination of 2, 3, or 4 of, or all of RUNX1, PIM3, IGFBP3, PPIF, and CD44.
In various embodiments, a test (e.g., assay) is carried out on a bodily fluid such as blood, serum, or plasma. The level of a protein may be measured using any applicable method known in the art, such as an immunoassay such as an enzyme-linked immunosorbent assay (ELISA), Western blot, radioimmunoassay (RIA), fluoroimmunoassay, or mass spectrometry. Non-limiting examples of mass spectrometry techniques include electrospray ionization (ESI), matrix assisted laser desorption (MALDI), MALDI-TOF (Time of flight), Fourier transform ion cyclotron resonance (FTIC), and surface-enhanced laser desorption (SELDI). Non-limiting examples of live imaging techniques for detecting the level and/or location (e.g., expression or localization changes) of a biomarker in the body of a subject include PET and SPECT.
As used herein, the term “assay” is intended to exclude the mere reading of a report or database entry. An assay is an investigative (analytic) procedure for qualitatively assessing or quantitatively measuring presence or amount or the functional activity of a target entity (e.g., the amount or level of RUNX1, PIM3, or IGFBP3 protein or mRNA in a test sample).
The term “sample” as used herein refers to a biological sample obtained for the purpose of evaluation in vitro. With regard to the methods disclosed herein, the sample or patient sample preferably may comprise any body fluid. In some embodiments, the body fluid includes, but is not limited to, whole blood, plasma, serum, lymph, breast milk, saliva, mucous, semen, cellular extracts, inflammatory fluids, cerebrospinal fluid, vitreous humor, tears, vitreous, aqueous humor, or urine obtained from the subject. In some aspects, the sample is a composite panel of two or more body fluids. In exemplary aspects, the sample comprises blood or a fraction thereof (e.g., plasma, serum, fraction obtained via leukopheresis).
Various methods disclosed herein comprise repeating providing, contacting, detecting, assaying, identifying, and/or computing steps overtime.
Additionally, a progressive increase over time in the level of RUNX1, PIM3, or IGFBP3 indicates a progressive worsening of the severity of a disease. A progressive decrease overtime in the level of RUNX1, PTM3, or IGFBP3 indicates an amelioration of a disease associated with aberrant angiogenesis. In some embodiments, a method may include the step of treatment following risk stratification as described herein. For example, a method further comprises identifying a subject with a high risk of a particular symptom or disease and administering to that subject a therapeutic regimen to inhibit, treat, or prevent the symptom or disease.
Also disclosed herein is a kit comprising RUNX1, PIM3, and/or IGFBP3 binding agent(s) and instructions for using the agent(s) for diagnosing a subject, evaluating a subject's prognosis, or determining the efficacy of a therapeutic regimen. In some embodiments, the agent is attached to a solid support such a test strip. The kit optionally contains buffers, enzymes, salts, stabilizing agents, preservatives, and a container for receiving a test sample of bodily fluid or cell. In some cases, such a container contains an anti-coagulant or a cell separation agent (e.g., to separate white cells from red blood cells). In various embodiments, the agent is attached to a solid support (e.g., a test strip). Various embodiments of the invention relate to a kit comprising agents for measuring a group of markers, wherein the group of markers are defined as described in any of the paragraphs, or panels containing figures, or other descriptions of preferred sets or panels of markers found herein. In some variations, such agents are packaged together. In some variations, the kit further includes an analysis tool for evaluating risk of an individual developing a disease or a symptom thereof from measurements of the group of markers from at least one biological sample from the subject.
The diagnostic or prognostic assay is optionally formulated in a two-antibody binding format in which one RUNX1, PIM3, or IGFBP3 protein-specific antibody captures RUNX1, PIM3, or IGFBP3 protein, e.g., in a patient sample and another anti-RUNX1, anti-PIM3, or anti-IGFBP3 antibody is used to detect captured protein. For example, the capture antibody is immobilized on a solid phase, e.g., an assay plate, an assay well, a nitrocellulose membrane, a bead, a dipstick, or a component of an elution column. The second antibody, i.e., the detection antibody, is typically tagged with a detectable label such as a colorimetric agent or radioisotope.
The present subject matter also describes diagnostic test system that obtains test results data representing levels of a marker in at least one biological sample. In various embodiments, the results are collected and tracked by the system. In some embodiments, the system comprises a means for computing an index value from said marker, wherein the index value comprises a disease risk score or a disease symptom risk score. The system may also include a means of reporting the index value.
Aspects of the present subject matter relate to a diagnostic test system comprising a means for obtaining test results data representing levels of a marker (e.g., the level of RUNX1, PIM3, or IGFBP3 protein or mRNA) in at least one biological sample; a means for collecting and tracking test results data for one or more individual biological samples; a means for computing an index value from marker measurement data, wherein said biomarker measurement data is representative of measured levels of markers, wherein said measured levels of markers comprise the levels of a set or panel of markers; and a means for reporting said index value. In some variations of the diagnostic test system, the index value is a disease risk score or a symptom risk score. In certain variations, the risk score is computed according to the methods described herein for computing such scores. In some variations, the means for collecting and tracking test results data representing information and/or index values for one or more individuals comprises a data structure or database. In various embodiments, the means for computing a risk score comprises a computer or microprocessor, comprising a visible display, an audio output, a link to a data structure or database, or a printer.
Methods, compositions, kits, and systems disclosed herein may be used to indicate that the method according to the present invention will, alone or together with other variables, establish or confirm the absence or presence of a disease, or aid a physician in the prognosis, and or the monitoring of treatment. The skilled artisan will appreciate that any such evaluation or assessment is made using an in vitro assay. The patient sample is solely used for the in vitro diagnostic method of the invention and the material of the patient sample is not transferred back into the patient's body. Typically, the sample is a liquid sample, e.g., whole blood, serum or plasma, or a biopsy sample.
Each embodiment disclosed herein is contemplated as being applicable to each of the other disclosed embodiments. Thus, all combinations of the various elements described herein are within the scope of the invention.
Other features and advantages of the invention will be apparent from the following description of the preferred embodiments thereof, and from the claims. Unless otherwise defined, all technical and scientific terms used herein have the same meaning as commonly understood by one of ordinary skill in the art to which this invention belongs. Although methods and materials similar or equivalent to those described herein can be used in the practice or testing of the present invention, suitable methods and materials are described below.
FIG. 1A is a set of graphs showing a Principle Component Analysis of transcriptomes. Two-dimensional representations of the three most significant Principle Components (PC) are provided. PC1, PC2, and PC3 account for 45.37% of the observed sample variance. The wide distribution of transcriptomes from FVM-derived CD31+ cells contrasts the congruity of transcriptomes of cells from normal retinal samples, indicating significant variance in FVM gene expression levels. FIG. 1B is a graph showing the top twenty-five pathways presented in order of descending significance with the number of genes from the candidate gene list enriching the pathway.
FIG. 2 is a graph showing a Database for Annotation, Visualization and Integrated Discovery (DAVID) Gene Ontology analysis of candidate genes. Pathways are presented in order of descending significance.
FIGS. 3A and B are graphs showing the effect of elevated glucose on human retinal microvascular endothelial cells (HRMEC) gene expression. FIG. 3A: Gene expression of Chemokine (C—X—C Motif) Ligand 10 (CXCL10) (negative control gene), PIM3 Proto-Oncogene, Serine/Threonine Kinase (PIM3), Peptidylprolyl Isomerase F (PPIF), RUNX1, and CD44 was measured by qRT-PCR (NG: normal (5 mM) D-glucose, HG: high (30 mM) D-glucose). Each candidate gene had a marked increase in response to D-glucose but no statistically significant changes in response to osmotic controls (L-glucose or mannitol). CXCL10 is not glucose responsive, consistent with RNA-sequencing (n=3; the experiment was performed in triplicate). FIG. 3B: Results of FVM ribonucleic acid (RNA)-sequencing (reads per kilobase of transcript per million mapped reads, RPKM) show increased expression of PIM3, PPIF, RUNX1, and CD44 in ECs from patients with PDR compared to non-diabetic patients. CXCL10 did not exhibit increased expression in FVMs (ncontrols=4; nPDR-FVM=8). ns: not significant, *p<0.05, **p<0.01, ***p<0.001.
FIGS. 4A and B are images and graphs showing the effect of elevated glucose on expression of RUNX1 protein. FIG. 4A: Increasing D-glucose led to a dose-dependent increase of RUNX1 protein expression in IRMEC (top) and IHUVECs (bottom) as determined by western blot (n=3; experiment performed in triplicate). FIG. 4B: The increase in RUNX1 protein induced by 30 mM D-glucose was independent of osmotic forces (n=3; experiment performed in triplicate). *p<0.05, **p<0.01, ***p<0.001.
FIGS. 5A-E are images showing the immunohistochemical localization of RUNX1 in FVMs. FIG. 5A: Normal retinal vessels showed no staining (RPE=retinal pigment epithelium, L=vessel lumen). FIG. 5B: A subset of vessels in FVM stained positively for RUNX1 (arrows). Asterisk denotes non-staining vessels (scale bar=100 μm). (FIG. 5C) Higher magnification view of normal retinal vessel negative for RUNX1 staining and (FIG. 5D) positively stained vessels in FVM (arrows) (scale bar=50 μm). FIG. 5E shows a larger version of FIGS. 5A and 5D.
FIG. 6A is a set of are images showing the retina of P17 C57BL/6J mice with oxygen-induced retinopathy (OIR) co-stained for RUNX1 and vessels (IB4 or CD31) showing positive RUNX1 staining conforming to neovascular tufts and not to normal underlying vasculature (scale bar=50 μm). FIG. 6A (upper left panel): Merged image of isolectin B4 and Runx1 staining of OIR retina showing distribution of RUNX1 in neovascular tufts. FIG. 6A (upper middle panel): Isolectin B4 staining (green) visualizes both normal vascular networks and pathologic neovascular tufts in retina from pups with OIR. FIG. 6A (right panel): Positive RUNX1 immunostaining (red) conforms to the shape of neovascular tufts only (scale bar=50 μm). FIG. 6B: Section of human melanoma inoculated subdermally in nude mice showing no staining for RUNX1 in normal capillary of the hypodermis. FIGS. 6B-D: Positive RUNX1 immunostaining (red) in melanoma sections conforming to vessel walls, particularly in capillaries (scale bar=50 μm). FIG. 6E is a set of images and graphs showing the effectiveness of treatment using a RUNX1 inhibitor in a model of aberrant retinal angiogenesis. Retinal flat mounts of P17 C57BL/6J mice following OIR induction and intravitreal injection of 75 μM Ro5-3335 or vehicle at P13 and P15 (red overlay identifies the avascular area and neovascularization respectively. Scale bar=1 mm). There was a non-significant downward trend in avascular area but a significant reduction in neovascularization in the treated group compared to vehicle treated (nvehicle=7; nRo5-3335=9. Experiment performed in triplicate). ns: not significant, **p<0.01.
FIGS. 7A and B are a set of images and a graph, respectively, showing the role of RUNX1 in HRMEC migration. FIG. 7A: Scratch-wound assay using HRMEC cells at 0 h (left column), 6 h (mid column) and 12 h (right column) with control (top row), scramble siRNA (mid row) or RUNX1 siRNA (bottom row) treatment. Dark grey regions denote wound areas (scale bar=400 μm). FIG. 7B: Quantification of wound closure rates shows that knockdown of RUNX1 effectively inhibits wound closure. There was no significant difference between transfection reagent alone (control) and scramble siRNA treatment. *p<0.05.
FIGS. 8A and B are a set of images and a graph, respectively, showing the role of RUNX1 in HRMEC proliferation. FIG. 8A: Ki67 staining 48 h post transfection demonstrates significant reduction in cell number and proliferative capacity of RUNX1 siRNA treated cells compared to cells treated with transfection reagent alone or scramble siRNA (scale bar=200 μm). FIG. 8B: Quantification of percentage of 4′,6-diamidino-2-phenylindole (DAPI) positive nuclei colocalized with Ki67 stain (n=6, experiment performed in duplicate). FIG. 8C: HRMEC treated with Ro-3335 RUNX1 inhibitor overnight exhibited reduced tube forming capacity compared to vehicle treated cells at 6 h after plating. There was statistically significant reduction in tube length, meshes, and nodes. (scale bar=500 μm. n=4, experiment performed in duplicate). *p<0.05, **p<0.01, ***p<0.001 ***p<0.001.
FIGS. 9A-C is a set of images showing the isolation and culture of endothelial cells from surgical specimens of FVM. FIG. 9A: Representative pre-surgical fundus photograph of a right eye exhibiting a FVM encroaching on the optic nerve (dashed line) causing tractional retinal detachment with blot hemorrhages throughout the retina (arrowheads). FIG. 9B: Magnetic beads (arrows) allow for separation and culturing of enriched cell populations from surgical specimens (Scale bar=100 μm). FIG. 9C: Cultures of isolated cells stained positively for CD31 representing a successfully isolated enriched population (Scale bar=40 μm).
FIG. 10A is a set of graphs, FIG. 10B is a graph and an image, and FIG. 10C is a set of images and graphs that collectively show efficient siRNA knockdown of RUNX1 expression and function demonstrated by qRT-PCR, Western Blot, and scratch assay. FIG. 10A (left graph): RUNX1 siRNA induced a 60% reduction of RUNX1 expression measured by qRT-PCR 48 hours post-transfection whereas expression of RUNX2 and RUNX3, the two other mammalian RUNX orthologues, showed no significant changes, indicating specificity of the siRNA. FIG. 10A (right graph): Functional inhibition of RUNX1 signaling was demonstrated by a 330% increase in the mRNA expression of a canonical target named TGFBP3, a known target of RUNX1 inhibition. Western blot demonstrated similar reduction in protein levels (FIG. 10B). FIG. 10C: siRNA-2's effect on RUNX1 was validated by qRT-PCR and western blot, demonstrating a similar reduction in both RNA and protein. Scratch assay demonstrates functional inhibition of RUNX1 by siRNA-2. ns: not significant, *p<0.05, ***p<0.001.
FIG. 11 is a graph showing PIM3 knockdown with siRNA. PIM3 siRNA knockdown leads to the downregulation of RUNX1. Transfection of human retinal microvascular endothelial cells with siRNA targeting PIM3 significantly reduced PIM3 and RUNX1 mRNA expression. Human primary cultured vascular endothelial cells were transfected with siRNA specific for PIM3 (HSC.RNAI.N001001852.12—TriFECTA RNAi Kit: PIM3 from Integrated DNA Technologies) using Dharmafect 1 and harvested 48 hours later. RNA was extracted prior to cDNA synthesis and qPCR with primers specific for beta-2-microglobulin as calibrator, PIM3, and RUNX1. siScramble is control. siPIM3PPP corresponds to the condition in which three oligos from the siRNA kit specific for PIM3 knockdown were mixed at equimolar amounts to obtain 100 nM dose. siPIM P1 corresponds to condition in which 50 nM or 100 nM of one oligo from the siRNA kit specific for PIM3 was used for knockdown. ***p<0.001
FIG. 12 is an image showing glucose-dependent PIM3 protein expression. Human microvascular retinal endothelial cells exhibited increased PIM3 protein expression in response to glucose in a dose dependent fashion. The same response was observed for RUNX1. Human microvascular retinal endothelial cells were cultured in EGM-2 supplemented with different concentrations of D-glucose for 96 hrs. After harvest, proteins were extracted using RIPA buffer and analyzed by western blot. The following commercially available antibodies were used for detection of specific proteins: RUNX1 antibody from Santacruz (sc-365644), PIM3 antibody from Abcam (ab71321). GAPDH protein was detected as loading control.
FIG. 13 is an image showing that a commercially available small molecule PIM3 inhibitor (PIM3 kinase inhibitor VII from EMD Millipore) reduced total RUNX1 protein levels in primary culture retinal endothelial cells in normal and high glucose conditions. Human microvascular retinal endothelial cells were cultured in EGM-2 supplemented with different concentrations of D-glucose for 72 hours in the presence of PIM3 inhibitor (PIM3 kinase inhibitor VII from EMD Millipore, Cat No. 526526, 0.05 μM) or vehicle (DMSO). After harvest, proteins were extracted using RIPA buffer and analyzed by western blot. RUNX1 was detected using antibodies from Santacruz (sc-365644). β-actin was used as a loading control.
FIG. 14 is a graph showing PIM3 gene expression. PIM3 expression was 88% downregulated in the treated cells with siPIM3 compared with the control (Untreated Cells). qRT-RNA took place 48 hours after transfection. RNA was extracted using Rneasy Mini Kits (Qiagen). The primers were purchased from Integrated DNA technologies. cDNA was obtained using iScript cDNA synthesis kit (Bio-Rad Laboratories) and probed using FastStart Universal SYBR Green Master (Hoffmann-La Roche). B2M was used as a calibrator gene control.
FIG. 15A is a graph and FIG. 15B is a series of images showing a 35% reduction in cell migration in Human Retinal Microvascular Endothelial Cells (HRMECs) transfected with PIM3 SiRNA compared with Scramble SiRNA. Migration was assessed with the wound scratch assay. This experiment was executed 24 hours after transfection. One scratch was done per well. The cells were imaged on an EVOS® system every three hours for 12 h. Tscratch Matlab Modules were used for image analysis.
FIG. 16A is a graph and FIG. 16B is a series of fluorescent images showing a 43% reduction in cell migration in HRMECs treated with the PIM kinases inhibitor AZD1208 (from Selleckchem catalogue #S7104) inhibitor compared with the DMSO control. AZD1208 is a pan-PIM inhibitor that inhibits PIM1, PIM2, and PIM3. The AZD1208 was used as a PIM3 kinase inhibitor and Dimethyl Sulfoxide (DMSO) as a control. HRMECs were treated for DMSO and PIM3 inhibitor for 48 hours before proliferation assay. The antibody Ki67 was used as a proliferation marker. The cells were imaged on an EVOS® system. Image J were used for image analysis.
FIG. 17A is a graph and FIG. 17B is a series of images showing a 39% reduction in cell migration in HRMECs treated with the AZD1208 inhibitor at 1.9 nM compared with DMSO vehicle control. Migration was assessed with the wound scratch assay. The AZD1208 was used as a PIM3 kinase inhibitor (Selleck Chemicals). A concentration of 1.9 nM (IC50) was tested. HRMECs were treated for DMSO and PIM3 inhibitor for 16 hours before wound assay. One scratch was done per well. The cells were imaged on an EVOS® system every three hours for 12 h. Iscratch Matlab Module were used for image analysis.
FIG. 18 is a graph showing that gamma-secretase inhibition using Compound E small molecule (100 nM) reduced the expression of TES1, a canonical downstream target for Notch activity and RUNX1 in primary culture human microvascular endothelial cells. Reduction of HES1 and RUNX1 expression was effective under normal glucose (5 mM D-glucose and high glucose 30 mM D-glucose). Cells were incubated with Compound E or DMSO vehicle control in different glucose concentrations for 72 hours before harvest followed by qRT-PCR for each gene. HPRT1 expression was used as control.
FIG. 19 is set of images showing that gamma-secretase inhibition using Compound E small molecule (100 nM) reduces the expression of RUNX1 in primary culture human microvascular endothelial cells. Reduction of RUNX1 expression was effective under normal glucose (5 mM D-glucose and high glucose (30 mM D-glucose). Cells were incubated with Compound E in different glucose concentrations for 72 hours before harvest followed by western blot with RUNX1 and GAPDH specific antibodies.
FIG. 20 is a set of fluorescent images showing that choroidal explant and laser-induced CNV demonstrates RUNX1 expression. Choroidal endothelial cells are endomucin+(green). Angiogenic choroidal sprouts/vessels are RUNX1+(red). Merged image reveals co-staining of endomucin and RUNX1 within the choroidal sprouts (top panels), and within new choroidal vessels (white arrows) in laser-induced choroidal neovascularization (CNV) (bottom panels).
FIG. 21 is a graph showing RUNX1 overexpression and effect on IGFBP3 expression. Nucleofection of RUNX1 leads to a ˜2.8 fold increase in RUNX 1 expression and ˜2 fold decrease in IGFBP3 expression.
FIG. 22 is a set of images showing that immunohistology of control retina and FVM identifies specific staining of phosphorylated RUNX1 (pRUNX1) within blood vessels in FVM but not in control retina. Scale bar=50 μm. S249 phosphorylated RUNX1 staining was largely absent from vessels in control retina but prominent in vessels from FVM (Santa Cruz Biotechnology, sc-293146).
Aspects of the present subject matter relate to the surprising discovery that RUNX1 inhibition reduces aberrant angiogenesis. Blood vessel growth may occur via the process of angiogenesis and/or vasculogenesis. The processes are distinct, and the involvement of a protein or pathway in vasculogenesis (e.g., during embryonic development) does not necessarily indicate that the protein or pathway is relevant to angiogenesis, much less aberrant angiogenesis. Moreover, the involvement of a protein or pathway in embryonic angiogenesis does not indicate that targeting the protein or pathway would be capable of reducing the aberrant angiogenesis, much less sufficient for inhibiting aberrant angiogenesis or safe for targeting in an infant, child, or adult.
As used herein, “angiogenesis” means the physiological process through which new blood vessels form from pre-existing vessels. Angiogenesis is particularly relevant to aberrant vessel growth in infants, children, adults, such as during tumor growth and in PDR. “Vasculogenesis” means the process of blood vessel formation occurring by a de novo production of endothelial cells. Vasculogenesis is particularly relevant to embryonic blood vessel formation. Vasculogenesis and angiogenesis are distinct from each other in that angiogenesis relates to the development of new blood vessels from (e.g., sprouting or extending from) pre-existing blood vessels, whereas vasculogenesis relates to the formation of new blood vessels that have not extended/sprouted from pre-existing blood vessels (e.g., where there are no pre-existing vessels). For example, if a monolayer of endothelial cells begins sprouting to form capillaries, angiogenesis is occurring. Vasculogenesis, in contrast, is when endothelial precursor cells (angioblasts) migrate and differentiate in response to local cues (such as growth factors and extracellular matrices) to form new blood vessels. These new blood vessels formed by vasculogenesis are then pruned and extended through angiogenesis.
RUNX1 has been implicated in other biological processes including endothelial-cell derived blood vessel formation during embryonic development and normal angiogenesis. However, a role for RUNX1 in pathogenic angiogenesis has not previously been described.
In various embodiments, RUNX1 is used as a therapeutic target for diabetic retinopathy (a common complication of diabetes) and other conditions characterized by aberrant angiogenesis. As shown in FIG. 6E, treatment using a RUNX1 inhibitor was effective at reducing neovascularization in an animal model of aberrant retinal angiogenesis. In some embodiments, the diabetic retinopathy comprises PDR. There are currently no non-surgical methods for the management of PDR. RUNX1 pathway represents an alternative target for PDR. Current management of fibrovascular membranes includes the use of laser photocoagulation (which is a destructive method that ablates the peripheral retina) or potentially risky and invasive surgical methods for removing fibrovascular membranes directly from the eye.
Targeting RUNX1 allows for targeted medical management of fibrovascular membranes, and causes their regression and/or impedes the growth of such membranes, which avoids the need for surgery. Other conditions including cancer that are characterized and/or made worse by aberrant angiogenesis may be inhibited, treated, or prevented using RUNX1 regulation. In addition to PDR, RUNX1 regulation is used as a target for the treatment of a wide variety of retinal neovascular disorders including but not limited to: retinal vein occlusions, ocular ischemic syndrome, neovascular glaucoma, retinal hemangiomas, and retinopathy of prematurity in addition to other ocular neovascular disorders such as corneal graft rejection and other pathologic neovascularization in the anterior segment of the eye, as well as other conditions characterized by aberrant angiogenesis, such as cancer.
Also provided herein, inter alia, are methods and compositions for reducing aberrant angiogenesis by inhibiting PIM3. The characterization of transcriptomes from endothelial cells obtained from human fibrovascular membranes derived from fresh surgical specimens identified PIM3—a serine/threonine kinase—as a candidate gene in PDR (the PIM3 gene is overexpressed). Consistent with this finding, upregulation of PIM3 in human retinal microvascular endothelial cells (HRMEC) exposed to high glucose in vitro. PIM kinases have pleiotropic pro-survival and anti-apoptotic effects.
RUNX1 is phosphorylated in the vessels of individuals with proliferative diabetic retinopathy. A different PIM kinase can phosphorylate and stabilize a different RUNX protein. See, e.g., Kim et al. (2008). J Cell Biochem 105(4):1048-58. In some embodiments, one way to inhibit RUNX1 is to inhibit its phosphorylation by inhibiting PIM3. In certain embodiments, PIM kinase inhibition impacts RUNX1 function via diminished phosphorylation.
Surprisingly, and without being limited by any scientific theory, in various embodiments there is a direct functional link between PIM3 and RUNX1. In some embodiments, PIM3 inhibition results in RUNX1 inhibition (e.g., downregulation). In certain embodiments, a RUNX1 inhibitor and/or a PIM3 inhibitor is administered in a formulation such as an eyedrop formulation (e.g., topically). In various embodiments, PIM3 inhibition using a small molecule inhibitor that binds to PIM3 leads to significant RUNX1 downregulation. In some embodiments, PIM3 knockdown or inhibition via small molecules leads to downregulation of RUNX1. In certain embodiments, an existing PIM3 inhibitor (e.g., a commercially available inhibitor such as a non-limiting example disclosed herein) is administered to treat aberrant angiogenesis in a disease or disorder such as diabetic retinopathy, age-related macular degeneration, retinal vein occlusions, neovascular glaucoma, corneal neovascularization, retinal hemangioma, or cancer. Other non-limiting examples of diseases and disorders are disclosed herein. Alternatively or in addition, compounds are screened and developed to inhibit PIM3 for treating aberrant angiogenesis. In some embodiments, PIM3 inhibition is used as means to inhibit RUNX1 expression or activity.
Preferably, (i) a PIM3 inhibitor binds to a PIM3 protein or a polynucleotide (such as mRNA) that encodes a PIM3 protein; and (ii) a RUNX1 inhibitor binds to a RUNX1 protein or a polynucleotide (such as mRNA) that encodes a RUNX1 protein.
It is surprising that PIM3 inhibition would regulate RUNX1 expression or regulate pathological angiogenesis. It is also surprising that PIM3 is upregulated in PDR. In some embodiments, PIM3 inhibition is used to treat aberrant angiogenesis. In various embodiments, PIM3 inhibition is used as means to inhibit RUNX1 to treat aberrant angiogenesis.
In certain embodiments, PIM3 inhibition is used in combination with RUNX1 inhibition and/or other compounds to treat aberrant angiogenesis. In various embodiments, the level of activity of PIM3 is used as a biomarker for aberrant angiogenesis. In certain embodiments, a disease that impacts the anterior segment of the eye is treated or prevented. In various embodiments, a disease that impacts the posterior segment of the eye is treated or prevented. In some embodiments, PIM3 inhibition reduces oxygen-induced retinopathy. In certain embodiments, PIM3 inhibition reduces corneal neovascularization. Non-limiting examples of diseases involving aberrant angiogenesis that may be treated with PIM3 inhibitors are disclosed herein, and include retinopathy of prematurity, wet-age related macular degeneration, proliferative diabetic retinopathy, retinal vein occlusion, cancer and other conditions.
In some embodiments, a PIM3 inhibitor is used to treat PDR. As noted above, PIM3 expression is increased in vascular endothelial cells from proliferative diabetic retinopathy fibrovascular membranes. PDR, a condition characterized by aberrant angiogenesis in the eye, is a common cause of blindness in working adults in the United States. In severe cases, the angiogenic sprouts develop into fibrovascular membranes (FVM), which may contract, triggering tractional retinal detachment and blindness.
Anti-VEGF therapy is infrequently used in PDR because it may trigger hemorrhage and retinal detachment by precipitating the angio-fibrotic switch. Additionally, anti-VEGF therapy often requires intravitreal injection. Non-VEGF-related pathways in PDR that could be targeted with drugs are needed. As disclosed herein, RUNX1 and PIM3 inhibition and or IGFBP3 activation is useful for treating PDR that has important advantages compared to anti-VEGF therapy. For example, in some embodiments the RUNX1 or PIM3 inhibitor is a small molecule inhibitor. In certain embodiments, the inhibitor is administered by a method other than intravitreal injection. For example, in some embodiments the IGFBP3 activator is a small molecular activator. In certain embodiments, the activator is administered by a method other than intravitreal injection.
In some embodiments, IGFBP3, PIM3, and/or RUNX1 is expressed in a blood cell. In certain embodiments, the level of IGFBP3, PIM3, and/or RUNX1 expression is measured in a blood cell. In various embodiments, the level of IGFBP3, PIM3, and/or RUNX1 expression is measured in a cell from an affected tissue. In some embodiments, the affected tissue is a fibrovascular membrane. In certain embodiments, cells are obtained from specific ocular fluids (e.g. vitreous fluid), and the level of IGFBP3, PIM3, and/or RUNX1 mRNA and/or protein is measured in the cells. In various embodiments, the level of PIM3 and/or RUNX1 expression (e.g., as measured by the level of mRNA and/or protein) will be higher compared to a control (such as the level in a corresponding fluid, tissue, or cell from a healthy subject) by at least about 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, 90%, or 100%. In some embodiments, the level of IGFBP3 is assessed in a bodily fluid such as blood, plasma, or serum. In certain embodiments, the level of IGFBP3 expression (e.g., as measured by the level of mRNA and/or protein) will be lower compared to a control (such as the level in a corresponding fluid, tissue, or cell from a healthy subject) by at least about 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, 90%, or 100%.
Aberrant angiogenesis is observed in numerous diseases, such as proliferative diabetic retinopathy, ROP, DR, AMD, retinal vein occlusions, ocular ischemic syndrome, neovascular glaucoma, retinal hemangiomas, and cancer (especially in solid tumors). It is also observed in genetic diseases such as Coats disease, Norrie's Disease, FEVR and Von Hippel Lindau. Aberrant angiogenesis includes any angiogenesis that is not a normal (nonpathological) part of an organism's development, growth, or healing. Ocular neovascularization includes retinal neovascularization as well as neovascularization in the anterior segment of the eye.
In some instances, aberrant angiogenesis may manifest itself as anterior ocular neovascularization, e.g., aberrant angiogenesis that occurs as a part of corneal graft rejection. Corneal angiogenesis is involved in corneal graft rejection. Thus, inhibition of RUNX expression or activity, (e.g., anti-RUNX1 treatment) is also useful to prevent or reduce corneal graft rejection.
Diabetic Retinopathy
Diabetic retinopathy is a condition that occurs in people who have diabetes. It causes progressive damage to the retina, which is the light-sensitive lining at the back of the eye. Diabetic retinopathy is a serious sight-threatening complication of diabetes. See, e.g., American Optometric Association, Diabetic Retinopathy, available from www.aoa.org/patients-and-public/eye-and-vision-problems/glossary-of-eye-and-vision-conditions/diabetic-retinopathy?sso=y, the entire contents of which are incorporated herein by reference.
Diabetes interferes with the body's ability to use and store sugar (glucose). The disease is characterized by too much sugar in the blood, which can cause damage throughout the body, including the eyes. Over time, diabetes damages the blood vessels in the retina. Diabetic retinopathy occurs when these tiny blood vessels leak blood and other fluids. This causes the retinal tissue to swell, resulting in cloudy or blurred vision. The condition usually affects both eyes. The longer a person has diabetes, the more likely they will develop diabetic retinopathy. If left untreated, diabetic retinopathy can cause blindness.
Symptoms of diabetic retinopathy include (i) seeing spots or floaters; (ii) blurred vision; (iii) having a dark or empty spot in the center of vision; and (iv) difficulty seeing well at night.
Often the early stages of diabetic retinopathy have no visual symptoms. Early detection and treatment can limit the potential for significant vision loss from diabetic retinopathy. In some embodiments, a subject with diabetes or early stage diabetic retinopathy is administered a RUNX1 inhibitor to halt, prevent, inhibit, or treat the progression of diabetic retinopathy. In certain embodiments, visual symptoms are delayed or prevented.
PDR is a more advanced form of the disease. At this stage, new fragile blood vessels can begin to grow in the retina and into the vitreous (the gel-like fluid that fills the back of the eye). The new blood vessels may leak blood into the vitreous, clouding vision.
Without wishing to be bound by any scientific theory, diabetic retinopathy results from the damage diabetes causes to the small blood vessels located in the retina. These damaged blood vessels can cause vision loss. For example, fluid can leak into the macula, the area of the retina responsible for clear central vision. Although small, the macula is the part of the retina that allows us to see colors and fine detail. The fluid causes the macula to swell, resulting in blurred vision. In an attempt to improve blood circulation in the retina, new blood vessels may form on its surface. These fragile, abnormal blood vessels can leak blood into the back of the eye and block vision.
Diabetic retinopathy is classified into two types:
Both NPDR and PDR may also result in macular edema. Embodiments of the present subject matter relate to the reduction of macular edema in subjects with diabetic retinopathy.
Other complications of PDR include detachment of the retina due to scar tissue formation and the development of neovascular glaucoma. Glaucoma is an eye disease in which there is progressive damage to the optic nerve. In PDR, new blood vessels grow into the area of the eye that drains fluid from the eye. This greatly raises the eye pressure, which damages the optic nerve. If left untreated, PDR can cause severe vision loss and even blindness.
In some embodiments, a subject who is at risk of developing diabetic retinopathy is administered a RUNX1 inhibitor to delay, prevent, or ameliorate the onset of the disease (e.g., NPDR and/or PDR and/or macular edema). Risk factors for diabetic retinopathy include:
Non-limiting examples of methods for diagnosing diabetic retinopathy include dilated eye examination, visual acuity tests, slit-lamp examination, fluorescein angiography, optical coherence tomography (OCT), and ultrasound. See, e.g., Kierstan Boyd (2013) “Diabetic Retinopathy Diagnosis” American Academy of Ophthamology (available at www.aao.org/eye-health/diseases/diabetic-retinopathy-diagnosis); and Mayo Clinic (2015) “Diabetic retinopathy, Tests and diagnosis” (available at www.mayoclinic.org/diseases-conditions/diabetic-retinopathy/basics/tests-diagnosis/con-20023311) the entire content of each of which is hereby incorporated by reference.
Any symptom, type, or stage of diabetic retinopathy may be inhibited, treated, or prevented using methods and compositions disclosed herein.
Retinopathy of Prematurity
Retinopathy of prematurity (ROP) is a potentially blinding eye disorder that primarily affects premature infants weighing about 2¾ pounds (1250 grams) or less that are born before 31 weeks of gestation (a full-term pregnancy has a gestation of 38-42 weeks). The smaller a baby is at birth, the more likely that baby is to develop ROP. This disorder, which usually develops in both eyes, is one of the most common causes of visual loss in childhood and can lead to lifelong vision impairment and blindness. See, e.g., National Eye Institute, Facts About Retinopathy of Prematurity (ROP), available from nei.nih.gov/health/rop/rop, the entire contents of which are incorporated herein by reference.
Today, with advances in neonatal care, smaller and more premature infants are being saved. These infants are at a much higher risk for ROP. Not all babies who are premature develop ROP. There are approximately 3.9 million infants born in the U.S. each year; of those, about 28,000 weigh 2% pounds or less. About 14,000-16,000 of these infants are affected by some degree of ROP. The disease improves and leaves no permanent damage in milder cases of ROP. About 90 percent of all infants with ROP are in the milder category and do not need treatment. However, infants with more severe disease can develop impaired vision or even blindness. About 1,100-1,500 infants annually develop ROP that is severe enough to require medical treatment. About 400-600 infants each year in the US become legally blind from ROP.
ROP is classified in five stages, ranging from mild (stage I) to severe (stage V):
Stage I—Mildly abnormal blood vessel growth. Many children who develop stage I improve with no treatment and eventually develop normal vision. The disease resolves on its own without further progression.
Stage II—Moderately abnormal blood vessel growth. Many children who develop stage II improve with no treatment and eventually develop normal vision. The disease resolves on its own without further progression.
Stage III—Severely abnormal blood vessel growth. The abnormal blood vessels grow toward the center of the eye instead of following their normal growth pattern along the surface of the retina. Some infants who develop stage III improve with no treatment and eventually develop normal vision. However, when infants have a certain degree of Stage III and “plus disease” develops, treatment is considered. “Plus disease” means that the blood vessels of the retina have become enlarged and twisted, indicating a worsening of the disease. Treatment at this point has a good chance of preventing retinal detachment.
Stage IV—Partially detached retina. Traction from the scar produced by bleeding, abnormal vessels pulls the retina away from the wall of the eye.
Stage V— Completely detached retina and the end stage of the disease. If the eye is left alone at this stage, the baby can have severe visual impairment and even blindness.
Most babies who develop ROP have stages I or III. However, in a small number of babies, ROP worsens, sometimes very rapidly. Untreated ROP threatens to destroy vision.
ROP occurs when abnormal blood vessels grow and spread throughout the retina, the tissue that lines the back of the eye. These abnormal blood vessels are fragile and can leak, scarring the retina and pulling it out of position. This causes a retinal detachment. Retinal detachment is the main cause of visual impairment and blindness in ROP
Without wishing to be bound by any scientific theory, several complex factors may be responsible for the development of ROP. The eye starts to develop at about 16 weeks of pregnancy, when the blood vessels of the retina begin to form at the optic nerve in the back of the eye. The blood vessels grow gradually toward the edges of the developing retina, supplying oxygen and nutrients. During the last 12 weeks of a pregnancy, the eye develops rapidly. When a baby is born full-term, the retinal blood vessel growth is mostly complete (the retina usually finishes growing a few weeks to a month after birth). But if a baby is born prematurely, before these blood vessels have reached the edges of the retina, normal vessel growth may stop. The edges of the retina (the periphery) may not get enough oxygen and nutrients. The periphery of the retina may then send out signals to other areas of the retina for nourishment. As a result, new abnormal vessels begin to grow. These new blood vessels are fragile and weak and can bleed, leading to retinal scarring. When these scars shrink, they pull on the retina, causing it to detach from the back of the eye.
A non-limiting example of a method for diagnosing ROP includes dilated eye examination. See, e.g., American Association for Pediatric Ophthalmology and Strabismus (2016) Retinopathy of Prematurity (available at aapos.org/terms/conditions/94), the entire content of which is incorporated herein by reference.
Aspects of the present invention relate to inhibiting, preventing, or treating the onset of or the progression of a ROP in a premature infant. Any symptom or stage of ROP may be inhibited, treated, or prevented using methods and compositions disclosed herein.
Age-Related Macular Degeneration
Age-related macular degeneration (AMD) is an eye disease that is a leading cause of vision loss in older people in developed countries. The vision loss usually becomes noticeable in a person's sixties or seventies and tends to worsen over time. See, e.g., the U.S. National Library of Medicine Genetics Home Reference, Age-Related Macular Degeneration, available at ghr.nlm.nih.gov/condition/age-related-macular-degeneration, the entire contents of which are incorporated herein by reference.
Age-related macular degeneration mainly affects central vision, which is needed for detailed tasks such as reading, driving, and recognizing faces. The vision loss in this condition results from a gradual deterioration of light-sensing cells in the tissue at the back of the eye that detects light and color (the retina). Specifically, age-related macular degeneration affects a small area near the center of the retina, called the macula, which is responsible for central vision. Side (peripheral) vision and night vision are generally not affected.
Researchers have described two major types of age-related macular degeneration, known as the dry form and the wet form. The dry form is much more common, accounting for 85 to 90 percent of all cases of AMD. It is characterized by a buildup of yellowish deposits called drusen beneath the retina and slowly progressive vision loss. The condition typically affects vision in both eyes, although vision loss often occurs in one eye before the other.
The wet form of age-related macular degeneration is associated with severe vision loss that can worsen rapidly. This form of the condition is characterized by the growth of abnormal, fragile blood vessels underneath the macula. These vessels leak blood and fluid, which damages the macula and makes central vision appear blurry and distorted.
In some embodiments, a subject who is at risk of developing AMD is administered a RUNX1 inhibitor to delay, prevent, or ameliorate the onset of AMD. AMD results from a combination of genetic and environmental factors. Many of these factors have been identified, but some remain unknown.
Researchers have considered changes in many genes as possible risk factors for AMD. The best-studied of these genes are involved in a part of the body's immune response known as the complement system. This system is a group of proteins that work together to destroy foreign invaders (such as bacteria and viruses), trigger inflammation, and remove debris from cells and tissues. Genetic changes in and around several complement system genes, including the complement factor H (CFH) gene, contribute to a person's risk of developing AMD. It is unclear how these genetic changes are related to the retinal damage and vision loss characteristic of this condition.
Changes on the long (q) arm of chromosome 10 in a region known as 10q26 are also associated with an increased risk of AMD. The 10q26 region contains two genes of interest, age-related maculopathy susceptibility 2 (ARMS2) and HtrA Serine Peptidase 1 (HTRA1). Changes in both genes have been studied as possible risk factors for the disease. However, because the two genes are so close together, it is difficult to tell which gene is associated with AMD risk, or whether increased risk results from variations in both genes. An estimated 15 to 20 percent of people with AMD have at least one first-degree relative (such as a sibling) with the condition.
Other genes that are associated with AMD include genes involved in transporting and processing high-density lipoprotein (HDL) and genes that have been associated with other forms of macular disease.
Nongenetic factors also contribute to the risk of age-related macular degeneration. Age appears to be the most important risk factor; the chance of developing the condition increases significantly as a person gets older. Smoking is another established risk factor for AMD.
Aspects of the present subject matter relate to administering a RUNX1 inhibitor or a PIM3 inhibitor to a subject who is diagnosed with or determined to be at risk of developing AMD. Subjects at risk of developing AMD include subjects with high blood pressure, heart disease, a high-fat diet or a diet that is low in certain nutrients (such as antioxidants and zinc), obesity, repeated and/or prolonged exposure to ultraviolet (UV) rays from sunlight, and/or who smoke or have smoked for at least about 1, 5, 10, or more years, and/or who are at least about 50, 55, 60, 65, 70, 75, 80, 85, or 90 years old. Subjects at risk of developing AMD and/or a symptom or complication thereof also include subjects with at least 1 or 2 grandparents, parents, or siblings who suffer from AMD, and/or the symptom or complication thereof. In various embodiments, a subject who carries a mutation in a CFH, ARMS2, HTRA1 gene, or a gene involved in transporting or processing HDL.
Non-limiting examples of methods for diagnosing AMD include examination of the back of the eye (e.g., with an ophthalmoscope), tests for defects in the center of a subject's vision, fluorescein angiography, indocyanine green angiography, and optical coherence tomography. See, e.g., Mayo Clinic (2015) “Dry Macular Degeneration” (available at www.mayoclinic.org/diseases-conditions/dry-macular-degeneration/diagnosis-treatment/diagnosis/dxc-20165013); Mayo Clinic (2015) “Wet macular degeneration” (available at www.mayoclinic.org/diseases-conditions/wet-macular-degeneration/diagnosis-treatment/diagnosis/dxc-20164284), the entire contents of each of which are incorporated herein by reference.
Any symptom, type, or stage of AMD may be inhibited, treated, or prevented using methods and compositions disclosed herein.
Retinal Vein Occlusion
Retinal vein occlusion (RVO) is a blockage of the small veins that carry blood away from the retina. Retinal vein occlusion is most often caused by hardening of the arteries (atherosclerosis) and the formation of a blood clot. Blockage of smaller veins (branch veins or BRVO) in the retina often occurs in places where retinal arteries that have been thickened or hardened by atherosclerosis cross over and place pressure on a retinal vein. See, e.g., U.S. National Library of Medicine, Retinal vein occlusion, available at www.nlm.nih.gov/medlineplus/ency/article/007330.htm, the entire contents of which are incorporated herein by reference.
Risk factors for retinal vein occlusion include: (i) atherosclerosis; (ii) diabetes; (iii) high blood pressure (hypertension: e.g., a systolic pressure of at least 140 mmHg or a diastolic pressure of at least 90 mmHg); and (iv) other eye conditions, such as glaucoma, macular edema, or vitreous hemorrhage. The risk of these disorders increases with age, therefore retinal vein occlusion most often affects older people.
Blockage of retinal veins may cause other eye problems, including: (i) glaucoma (high pressure in the eye), caused by new, abnormal blood vessels growing in the front part of the eye; (ii) neovascularization (RVO can cause the retina to develop new, abnormal blood vessels, a condition called neovascularization. These new vessels may leak blood or fluid into the vitreous, the jelly-like substance that fills the inside of the eye. Small spots or clouds, called floaters, may appear in the field of vision. With severe neovascularization, the retina may detach from the back of the eye.); (iii) macular edema, caused by the leakage of fluid in the retina; and (iv) neovascular glaucoma (New blood vessels in certain parts of the eye can cause pain and a dangerous increase in pressure inside the eye.).
Non-limiting examples of methods for diagnosing RVO include optical coherence tomography, ophthalmoscopy, and fluorescein angiography. See, e.g., Cleveland Clinic (2015) “Retinal Vein Occlusion” (available at my.clevelandclinic.org/services/cole-eye/diseases-conditions/hic-retinal-vein-occlusion), the entire content of which is incorporated herein by reference.
Any symptom, type, or stage of retinal vein occlusion may be inhibited, treated, or prevented using methods and compositions disclosed herein.
Ocular Ischemic Syndrome
Ocular ischemic syndrome (OIS) encompasses the ocular signs and symptoms that result from chronic vascular insufficiency. Common anterior segment findings include advanced cataract, anterior segment inflammation, and iris neovascularization. Posterior segment signs include narrowed retinal arteries, dilated but nontortuous retinal veins, midperipheral dot-and-blot retinal hemorrhages, cotton-wool spots, and optic nerve/retinal neovascularization. The presenting symptoms include ocular pain and abrupt or gradual visual loss. See, e.g., Medscape, Ocular Ischemic Syndrome, available at emedicine.medscape.com/article/1201678-overview#a6.
Without wishing to be bound by any scientific theory, the most common etiology of OIS is severe unilateral or bilateral atherosclerotic disease of the internal carotid artery or marked stenosis at the bifurcation of the common carotid artery. OIS may also be caused by giant cell arteritis. The decreased vascular perfusion results in tissue hypoxia and increased ocular ischemia, leading to neovascularization.
Non-limiting examples of methods for diagnosing OIS include imaging studies of the carotid arteries (such as fluorescein angiography) and ultrasound. See, e.g., Terelak-Borys et al., Med Sci Monit. 2012; 18(8): RA138-RA144, the entire content of which is incorporated herein by reference.
Any symptom, type, or stage of ocular ischemic syndrome may be inhibited, treated, or prevented using methods and compositions disclosed herein.
Neovascular Glaucoma
Neovascular glaucoma (NVG) is classified as a secondary glaucoma. First documented in 1871, historically, it has been referred to as hemorrhagic glaucoma, thrombotic glaucoma, congestive glaucoma, rubeotic glaucoma, and diabetic hemorrhagic glaucoma. Numerous secondary ocular and systemic diseases that share one common element, retinal ischemia/hypoxia and subsequent release of an angiogenesis factor, cause NVG. This angiogenesis factor causes new blood vessel growth from preexisting vascular structure. Depending on the progression ofNVG, it can cause glaucoma either through secondary open-angle or secondary closed-angle mechanisms. This is accomplished through the growth of a fibrovascular membrane over the trabecular meshwork in the anterior chamber angle, resulting in obstruction of the meshwork and/or associated peripheral anterior synechiae. See, e.g., Medscape, Neovascular Glaucoma, available at emedicine.medscape.com/article/1205736-overview#a6, the entire contents of which are hereby incorporated herein by reference.
NVG is a potentially devastating glaucoma, where delayed diagnosis or poor management can result in complete loss of vision or, quite possibly, loss of the globe itself. Early diagnosis of the disease, followed by immediate and aggressive treatment, is imperative. In managing NVG, it is essential to treat both the elevated intraocular pressure (IOP) and the underlying cause of the disease.
Retinal ischemia is the most common and important mechanism in most, if not all, cases that result in the anterior segment changes causing NVG. Various predisposing conditions cause retinal hypoxia and, consequently, production of an angiogenesis factor.
Without wishing to be bound by any scientific theory, several angiogenesis factors have been identified as potential agents causing ocular neovascularization. Recent studies suggest that VEGF might play a central role in angiogenesis. Once released, the angiogenic factor(s) diffuses into the aqueous and the anterior segment and interacts with vascular structures in areas where the greatest aqueous-tissue contact occurs. The resultant growth of new vessels at the pupillary border and iris surface [neovascularization of the iris (NVI)] and over the iris angle [neovascularization of the angle (NVA)] ultimately leads to formation of fibrovascular membranes. The fibrovascular membranes, which may be invisible on gonioscopy, accompany NVA and progressively obstruct the trabecular meshwork. This causes secondary open-angle glaucoma.
As the disease process continues, the fibrovascular membranes along the NVA tend to mature and contract, thereby tenting the iris toward the trabecular meshwork and resulting in peripheral anterior synechiae and progressive synechial angle closure. Elevated IOP is a direct result of this secondary angle-closure glaucoma.
Non-limiting methods for diagnosing neovascular glaucoma may include, e.g., examination of the iris and aqueous humor outflow and measuring intraocular pressure. See, e.g., Shazly and Latina, (2009) “Neovascular Glaucoma: Etiology, Diagnosis and Prognosis” Seminars in Ophthalmology, Volume 24, Issue 2, pages 113-121, the entire content of which is incorporated herein by reference.
Any symptom, type, or stage of neovascular glaucoma may be inhibited, treated, or prevented using methods and compositions disclosed herein.
Retinal Hemangiomas
Retinal hemangiomas, also known as retinal capillary hemangiomas (RCHs) and retinal hemangioblastomas, occur most frequently in conjunction with von lippel-Lindau (V-HL) syndrome. These lesions are characterized by plump, but otherwise normal, retinal capillary endothelial cells with normal pericytes and basement membrane. Astrocytes with lipid vacuoles are found in the tumor interstitia. Isolated RCH outside of VHL do occur, although they are more likely to be single, unilateral, and present later. See, e.g., American Academy of Ophthamology, Retinal Capillary Angioma, available at www.aao.org/munnerlyn-laser-surgery-center/retinal-capillary-angioma, the entire content of which is incorporated herein by reference.
Von Hippel-Lindau syndrome has an autosomal dominant inheritance pattern, with an incidence of 1 in 36,000 live births. These lesions can occur either singly, or more often, multiply and bilaterally, with a greater than 80% predilection for peripheral location. Vision loss can occur from exudation, strabismus, hemorrhage, and retinal detachment, as well secondary causes such as macular edema, lipid maculopathy, and epiretinal membrane. Early lesions often present as indistinct areas of redness in the retina, which appear to be retinal hemorrhages. Patients may be relatively asymptomatic until the lesions achieve larger size, and it is imperative to perform life-long surveillance of even asymptomatic individuals with VHL because smaller lesions are more easily eradicated than larger lesions. In VHL patients, RCH is diagnosed at a mean of 25 years.
In VHL syndrome, the stromal cells have a mutation on chromosome 3p25-26, which leads to dysfunctional VHL protein. These cells cannot degrade hypoxia-inducible factor 1a (HIF-1a), so this factor accumulates and causes production of VEGF, platelet-derived growth factor (PDGF), erythropoietin, and transforming growth factor-alpha, all of which lead to proliferation and vascularization of the tumor. There are three types of mutation in the VHL gene: type 1, with deletion or nonsense mutation and manifesting mainly hemangioblastomas only; type 2, with missense mutation at risk for hemangioblastomas and pheochromocytomas (type 2A), additional renal cell carcinoma (type 2B), or only pheochromocytoma (type 2C); and type 3, with risk for polycythemia.
Non-limiting examples of methods or diagnosing retinal hemangiomas include ophthalmoscopic examination. See, e.g., Turell and Singh (2010) “Vascular Tumors of the Retina and Choroid: Diagnosis and Treatment” Middle East Afr J Ophthalmol. 17(3): 191-200, the entire content of which is incorporated herein by reference.
Any symptom, type, or stage of retinal hemangioma may be inhibited, treated, or prevented using methods and compositions disclosed herein. In some embodiments, a subject at risk of developing a retinal hemangioma, such as a subject with VIHL, is treated to delay or prevent the onset of a retinal hemangioma
Hemangiomas
A hemangioma is an abnormal buildup of blood vessels in the skin or internal tissue/organs. Symptoms of a hemangioma include a red to reddish-purple, raised sore (lesion) on the skin; a massive, raised, tumor with blood vessels; bleeding; problems with breathing or eating; psychological distress from skin appearance; secondary infections and sores; visible changes in the skin; and vision problems. Hemangiomas can grow, e.g., in/on the skin, the liver, the lungs, the colon, or the brain. However, many hemangiomas are on the face and neck.
In some instances, a hemangioma may be associated with a pathologic processes, such as the consumptive coagulopathy of Kasabach-Merritt syndrome and tumor-induced osteomalacia. Gorham disease is a process of massive osteolysis, which is believed to be within the spectrum of hemangiomatous disease. Hemangiomas occurring in the setting of multiple enchondromatosis are part of the spectrum of Maffucci syndrome.
Cavernous hemangiomas that involve the eyelid and block vision can be treated with lasers or steroid injections to shrink them. This allows vision to develop normally. Large cavernous hemangiomas or mixed hemangiomas may be treated with steroids, taken by mouth or injected into the hemangioma. Taking beta-blocker medicines may also help reduce the size of a hemangioma.
Any symptom, type, or stage of hemangioma may be inhibited, treated, or prevented using methods and compositions disclosed herein. In some embodiments, a subject at risk of developing a hemangioma is treated to delay or prevent the onset of the hemangioma.
Cerebral Cavernous Malformations
Cerebral cavernous malformations (CCMs) are vascular lesions comprising clusters of tightly packed, abnormally thin-walled small blood vessels (capillaries) that displace normal neurological tissue in the brain or spinal cord. The vessels are often filled with slow-moving or stagnant blood that is usually clotted or in a state of decomposition. Cavernous malformations can occur in the brain, spinal cord, and other body regions. In the brain and spinal cord these cavernous lesions are quite fragile and are prone to bleeding, causing hemorrhagic strokes (bleeding into the brain), seizures, and neurological deficits. CCMs can range in size from a few fractions of an inch to several inches in diameter, depending on the number of blood vessels involved. Some people develop multiple lesions while others never experience related medical problems. Hereditary forms of CCM are caused by mutations in one of three CCM disease genes: cerebral cavernous malformation protein 1 (CCM1), cerebral cavernous malformation protein 2 (CCM2), and cerebral cavernous malformation protein 3 (CCM3). A large population with hereditary CCM disease is found in New Mexico and the Southwestern United States, in which the disease is caused by mutations in the gene CCM1.
Any symptom, type, or stage of a CCM may be inhibited, treated, or prevented using methods and compositions disclosed herein. In some embodiments, a subject at risk of developing a CCM is treated to delay or prevent the onset of the CCM.
Tumor Angiogenesis
As tumors grow in size, they require blood vessels to provide oxygen and nutrients to cancer cells, as well as to clear waste from the tumor. Disrupting the growth of vessels may reduce the growth and size of a tumor.
Cancer cells are cells that have lost their ability to divide in a controlled fashion. A malignant tumor consists of a population of rapidly dividing and growing cancer cells that progressively accrues mutations. However, tumors need a blood supply to provide the oxygen and other essential nutrients they require in order to grow beyond a certain size (generally 1-2 mm3).
Without wishing to be bound by any scientific theory, tumors may induce blood vessel growth (angiogenesis) by secreting various growth factors (e.g. VEGF). Growth factors such as basic fibroblast growth factor (bFGF) and VEGF can induce capillary growth into the tumor, which may supply required nutrients, allowing for tumor expansion. Unlike normal blood vessels, tumor blood vessels are dilated with an irregular shape. Angiogenesis may also serve as a waste pathway, taking away the biological end products secreted by rapidly dividing cancer cells. In either case, angiogenesis is a necessary and required step for transition from a small harmless cluster of cells, often said to be about the size of the metal ball at the end of a ball-point pen, to a large tumor. Angiogenesis is also required for the spread of a tumor, or metastasis. Single cancer cells can break away from an established solid tumor, enter a blood vessel, and be carried to a distant site, where they can implant and begin the growth of a secondary tumor. Evidence now suggests the blood vessel in a given solid tumor may, in fact, be mosaic vessels, composed of endothelial cells and tumor cells. This mosaicity allows for substantial shedding of tumor cells into the vasculature, possibly contributing to the appearance of circulating tumor cells in the peripheral blood of patients with malignancies. The subsequent growth of such metastases will also require a supply of nutrients and oxygen and a waste disposal pathway.
Aspects of the present subject matter relate to the use of RUNX1 inhibitors to inhibit, treat, or prevent angiogenesis by cancer cells and tumors, and/or to inhibit, treat, or prevent tumor metastasis. RUNX1 inhibition may also lead to vessel stabilization, which can improve access of the chemotherapeutic agents to tumor.
Coats' Disease
Coats' disease, (also known as exudative retinitis or retinal telangiectasis, sometimes spelled Coates' disease), is a rare congenital, nonhereditary eye disorder, causing full or partial blindness, characterized by abnormal development of blood vessels behind the retina. Coats' usually affects only one eye (unilateral) and occurs predominantly in young males 1/100,000, with the onset of symptoms generally appearing in the first decade of life. Peak age of onset is between 6-8 years of age, but onset can range from 5 months to 71 years.
Coats' disease results in a gradual loss of vision. Blood leaks from the abnormal vessels into the back of the eye, leaving behind cholesterol deposits and damaging the retina. Coats' disease normally progresses slowly. At advanced stages, retinal detachment is likely to occur. Glaucoma, atrophy, and cataracts can also develop secondary to Coats' disease. In some cases, removal of the eye may be necessary (enucleation).
The most common sign at presentation is leukocoria (abnormal white reflection of the retina). Symptoms typically begin as blurred vision, usually pronounced when one eye is closed (due to the unilateral nature of the disease). Often the unaffected eye will compensate for the loss of vision in the other eye; however, this results in some loss of depth perception and parallax. Deterioration of sight may begin in either the central or peripheral vision. Deterioration is likely to begin in the upper part of the vision field as this corresponds with the bottom of the eye where blood usually pools. Flashes of light, known as photopsia, and floaters are common symptoms. Persistent color patterns may also be perceived in the affected eye. Initially, these may be mistaken for psychological hallucinations, but are actually the result of both retinal detachment and foreign fluids mechanically interacting with the photoreceptors located on the retina.
One early warning sign of Coats' disease is yellow-eye in flash photography Just as the red-eye effect is caused by a reflection of blood vessels in the back of a normal eye, an eye affected by Coats' will glow yellow in photographs as light reflects off cholesterol deposits. Children with yellow-eye in photographs are typically advised to immediately seek evaluation from an optometrist or ophthalmologist, who will assess and diagnose the condition and refer to a vitreo-retinal specialist.
Coats' disease itself is painless. Pain may occur if fluid is unable to drain from the eye properly, causing the internal pressure to swell, resulting in painful glaucoma.
Coats' disease is thought to result from breakdown of the blood-retinal barrier in the endothelial cell, resulting in leakage of blood products containing cholesterol crystals and lipid-laden macrophages into the retina and subretinal space. Over time, the accumulation of this proteinaceous exudate thickens the retina, leading to massive, exudative retinal detachment.
On funduscopic eye examination, the retinal vessels in early Coats' disease appear tortuous and dilated, mainly confined to the peripheral and temporal portions of retina. In moderate to severe Coats' disease, massive retinal detachment and hemorrhage from the abnormal vessels may be seen.
Imaging studies such as ultrasonography (US), Computerized Tomography (CT) and Magnetic Resonance Imaging (MRI) can aid diagnosis. On ultrasound, Coats' disease appears as a hyperechoic mass in the posterior vitreous without posterior acoustic shadowing; vitreous and subretinal hemorrhage may often be observed. On CT, the globe appears hyperdense compared to normal vitreous due to the proteinaceous exudate, which may obliterate the vitreous space in advanced disease. The anterior margin of the subretinal exudate enhances with contrast. Since the retina is fixed posteriorly at the optic disc, this enhancement has a V-shaped configuration. On MRI, the subretinal exudate shows high signal intensity on both T1- and T2-weighted images. The exudate may appear heterogeneous if hemorrhage or fibrosis is present. The subretinal space does not enhance with gadolinium contrast. Mild to moderate linear enhancement may be seen between the exudate and the remaining vitreous. The exudate shows a large peak at 1-1.6 ppm on proton MR spectroscopy.
Any symptom, type, or stage of Coats' disease may be inhibited, treated, or prevented using methods and compositions disclosed herein. In some embodiments, a subject at risk of developing Coats' disease is treated to delay or prevent the onset of Coats' disease.
Norrie Disease
Norrie disease is an inherited eye disorder that leads to blindness in male infants at birth or soon after birth. It causes abnormal development of the retina, the layer of sensory cells that detect light and color, with masses of immature retinal cells accumulating at the back of the eye. As a result, the pupils appear white when light is shone on them, a sign called leukocoria. The irises (colored portions of the eyes) or the entire eyeballs may shrink and deteriorate during the first months of life, and cataracts (cloudiness in the lens of the eye) may eventually develop.
About one third of individuals with Norrie disease develop progressive hearing loss, and more than half experience developmental delays in motor skills such as sitting up and walking. Other problems may include mild to moderate intellectual disability, often with psychosis, and abnormalities that can affect circulation, breathing, digestion, excretion, or reproduction.
Mutations in the norrin cystine knot growth factor (NDP) gene cause Norrie disease. The NDP gene provides instructions for making a protein called norrin. Norrin participates in the Wnt cascade, a sequence of steps that affect the way cells and tissues develop. In particular, norrin seems to play a critical role in the specialization of retinal cells for their unique sensory capabilities. It is also involved in the establishment of a blood supply to tissues of the retina and the inner ear, and the development of other body systems. In order to initiate the Wnt cascade, norrin must bind (attach) to another protein called frizzled-4. Mutations in the norrin protein interfere with its ability to bind to frizzled-4, resulting in the signs and symptoms of Norrie disease. This condition is inherited in an X-linked recessive pattern. A condition is considered X-linked if the mutated gene that causes the disorder is located on the X chromosome, one of the two sex chromosomes. In males (who have only one X chromosome), one altered copy of the gene in each cell is sufficient to cause the condition. In females (who have two X chromosomes), a mutation must be present in both copies of the gene to cause the disorder. Males are affected by X-linked recessive disorders much more frequently than females. A characteristic of X-linked inheritance is that fathers cannot pass X-linked traits to their sons. In X-linked recessive inheritance, a female with one altered copy of the gene in each cell is called a carrier. She can pass on the gene, but generally does not experience signs and symptoms of the disorder. In rare cases, however, carrier females have shown some retinal abnormalities or mild hearing loss associated with Norrie disease.
Norrie disease is diagnosed if an individual has the symptoms suggesting this disorder (primarily congenital blindness). Most often the Norrie gene mutation can be identified by DNA analysis in the affected individual. Mutations in the Norrie gene are often unique to a family and have been described throughout the extent of the Norrie gene. About 15-20% of mutations are a gene deletion involving at least some part of the Norrie gene and sometimes extending out beyond the Norrie gene to affect other adjacent genes.
Clinical genetic lab testing is available to help make the diagnosis, assess genetic risk in family members and for prenatal testing. Although Norrie disease itself does not seem to shorten lifespan, individuals with blindness, deafness and/or mental disability may have a reduced lifespan as a result of these conditions. Norrie disease affects each individual differently, even within the same family, as there is a spectrum of symptoms and severity.
Patients who have not completely lost their vision may be treated with surgery or laser therapy in infancy. Hearing loss can be treated with hearing aids and cochlear implants. Behavioral abnormalities and mental disability can be treated through counseling, medications, and care by special education professionals. Men with Norrie disease may need varying degrees of assistance from family, friends and caretakers, but lead full and rewarding lives.
Any symptom, type, or stage of Norrie disease may be inhibited, treated, or prevented using methods and compositions disclosed herein.
Von Hippel-Lindau Disease
Von Hippel-Lindau disease is an inherited disorder characterized by the formation of tumors and fluid-filled sacs (cysts) in many different parts of the body. Tumors may be either noncancerous or cancerous and most frequently appear during young adulthood; however, the signs and symptoms of von Hippel-Lindau disease can occur throughout life.
Tumors called hemangioblastomas are characteristic of von Hippel-Lindau disease. These growths are made of newly formed blood vessels. Although they are typically noncancerous, they can cause serious or life-threatening complications. Hemangioblastomas that develop in the brain and spinal cord can cause headaches, vomiting, weakness, and a loss of muscle coordination (ataxia). Hemangioblastomas can also occur in the light-sensitive tissue that lines the back of the eye (the retina). These tumors, which are also called retinal angiomas, may cause vision loss.
People with von Hippel-Lindau disease commonly develop cysts in the kidneys, pancreas, and genital tract. They are also at an increased risk of developing a type of kidney cancer called clear cell renal cell carcinoma and a type of pancreatic cancer called a pancreatic neuroendocrine tumor.
Von Hippel-Lindau disease is associated with a type of tumor called a pheochromocytoma, which most commonly occurs in the adrenal glands (small hormone-producing glands located on top of each kidney). Pheochromocytomas are usually noncancerous. They may cause no symptoms, but in some cases they are associated with headaches, panic attacks, excess sweating, or dangerously high blood pressure that may not respond to medication. Pheochromocytomas are particularly dangerous if they develop during pregnancy.
About 10 percent of people with von Hippel-Lindau disease develop endolymphatic sac tumors, which are noncancerous tumors in the inner ear. These growths can cause hearing loss in one or both ears, as well as ringing in the ears (tinnitus) and problems with balance. Without treatment, these tumors can cause sudden profound deafness.
Mutations in the von Hippel-Lindau tumor suppressor (VHL) gene cause von Hippel-Lindau disease. The VHL gene is a tumor suppressor gene, which means it keeps cells from growing and dividing too rapidly or in an uncontrolled way. Mutations in this gene prevent production of the VHL protein or lead to the production of an abnormal version of the protein. An altered or missing VHL protein cannot effectively regulate cell survival and division. As a result, cells grow and divide uncontrollably to form the tumors and cysts that are characteristic of von Hippel-Lindau disease.
Mutations in the VHL gene are inherited in an autosomal dominant pattern, which means that one copy of the altered gene in each cell is sufficient to increase the risk of developing tumors and cysts. Most people with von Hippel-Lindau disease inherit an altered copy of the gene from an affected parent. In about 20 percent of cases, however, the altered gene is the result of a new mutation that occurred during the formation of reproductive cells (eggs or sperm) or very early in development.
Unlike most autosomal dominant conditions, in which one altered copy of a gene in each cell is sufficient to cause the disorder, two copies of the VHL gene must be altered to trigger tumor and cyst formation in von Hippel-Lindau disease. A mutation in the second copy of the VHL gene occurs during a person's lifetime in certain cells within organs such as the brain, retina, and kidneys. Cells with two altered copies of this gene make no functional VHL protein, which allows tumors and cysts to develop. Almost everyone who inherits one VHL mutation will eventually acquire a mutation in the second copy of the gene in some cells, leading to the features of von Hippel-Lindau disease.
The detection of tumors specific to VHL disease is important in the disease's diagnosis. In individuals with a family history of VHL disease, one hemangioblastoma, pheochromocytoma or renal cell carcinoma may be sufficient to make a diagnosis. As all the tumors associated with VHL disease can be found sporadically, at least two tumors must be identified to diagnose VHL disease in a person without a family history.
Genetic diagnosis is also useful in VHL disease diagnosis. In hereditary VHL, disease techniques such as southern blotting and gene sequencing can be used to analyze DNA and identify mutations. These tests can be used to screen family members of those afflicted with VHL disease; de novo cases that produce genetic mosaicism are more difficult to detect because mutations are not found in the white blood cells that are used for genetic analysis. Any symptom, type, or stage of Von Hippel-Lindau disease may be inhibited, treated, or prevented using methods and compositions disclosed herein. In some embodiments, a subject at risk of developing Von Hippel-Lindau disease is treated to delay or prevent the onset of Von Hippel-Lindau disease.
Familial exudative vitreoretinopathy (FEVR) is a rare hereditary ocular disorder characterized by a failure of peripheral retinal vascularization which may be abnormal or incomplete. FEVR is a condition with fundus changes similar to those in retinopathy of prematurity, but appearing in children who had been born full-term with normal birthweight. With respect to genetics, about 50% of cases can be linked to 4 causative genes (NDP, LRP5, FZD4, and TSPAN12), all of which form part of the Wnt signaling pathway, which is vital for normal retinal vascular development.
Any symptom, type, or stage of FEVR may be inhibited, treated, or prevented using methods and compositions disclosed herein. In some embodiments, a subject at risk of developing FEVR is treated to delay or prevent the onset or progression of FEVR. In some embodiments, a subject at risk of developing FEVR is treated to delay or prevent the onset or progression of aberrant angiogenesis due to FEVR.
Runt-related transcription factor 1 (RUNX1), also known as acute myeloid leukemia 1 protein (AML1) or core-binding factor subunit alpha-2 (CBFA2), is a protein that in humans is encoded by the RUNX1 gene.
RUNX1 is a transcription factor that regulates the differentiation of hematopoietic stem cells into mature blood cells. RUNX1 also plays a role in the development of the neurons that transmit pain. It belongs to the Runt-related transcription factor (RUNX) family of genes which are also called core binding factor-α (CBF(α).
RUNX1 may form part of a complex called Core Binding Factor (CBF), corresponding to a group of heterodimeric transcription factors. Core Binding Factors are comprised of (i) a non DNA-binding CBFβ chain (encoded by the CBFB gene); and (ii) a DNA-binding CBFα chain (such as RUNX1, RUNX2, or RUNX3). CBFB is a gene. RUNX1 is another gene. RUNX2 is another gene. RUNX3 is another gene. Due to alternative splicing RUNX1 has many true isoforms. CBFB and RUNX1 proteins can form a complex in which the CBFB protein is the beta subunit and RUNX1 is the alpha subunit RUNX proteins form a heterodimeric complex with core binding factor β (CBFβ) which confers increased deoxyribonucleic acid (DNA) binding and stability to the complex.
In humans, the RUNX1 gene is 260 kilobases (kb) in length, and is located on chromosome 21 (21q22.12). The gene can be transcribed from 2 alternative promoters, promoter 1 (distal) or promoter 2 (proximal). As a result, various isoforms of RUNX1 can be synthesized, facilitated by alternative splicing. The full-length RUNX1 protein is encoded by 12 exons. Among the exons are two defined domains, namely the runt homology domain (RHD) or the runt domain (exons 2, 3 and 4), and the transactivation domain (TAD) (exon 6). These domains are necessary for RUNX1 to mediate DNA binding and protein-protein interactions respectively. The transcription of RUNX1 is regulated by 2 enhancers (regulatory element 1 and regulatory element 2), and these tissue specific enhancers enable the binding of lymphoid or erythroid regulatory proteins, therefore the gene activity of RUNX1 is highly active in the hematopoietic system.
An exemplary isoform of RUNX1 (Q01196-1) has 453 amino acids. As a transcription factor (TF), its DNA binding ability is encoded by the runt domain (residues 50-177), which is homologous to the p53 family. Without wishing to be bound by any scientific theory, the runt domain of RUNX1 is believed to bind to the core consensus sequence TGTGGNNN (where NNN can represent either TTT or TCA). DNA recognition is achieved by loops of the 12-stranded β-barrel and the C-terminus “tail” (residues 170-177), which clamp around the sugar phosphate backbone and fits into the major and minor grooves of DNA. Specificity is achieved by making direct or water-mediated contacts with the bases. RUNX1 can bind DNA as a monomer, but its DNA binding affinity is enhanced by 10 fold if it heterodimerizes with the CBFβ, also via the runt domain. The RUNX family is often referred to as α-subunits, together with binding of a common β-subunit CBFβ, RUNX can behave as heterodimeric transcription factors collectively called the core binding factors (CBFs).
An amino acid sequence for human RUNX1b is publically available in the UniProt database under accession number Q01196-1 (SEQ ID NO: 1) and is as follows:
| MRIPVDASTSRRFTPPSTALSPGKMSEALPLGAPDAGAALAGKLRSGDR |
| SMVEVLADHPGELVRTDSPNFLCSVLPTHWRCNKTLPIAFKVVALGDVP |
| DGTLVTVMAGNDENYSAELRNATAAMKNQVARFNDLRFVGRSGRGKSSF |
| TLTITVFTNPPQVATYHRAIKITVDGPREPRRHRQKLDDQTKPGSLSFS |
| ERLSELEQLRRTAMRVSPHHPAPTPNPRASLNHSTAFNPQPQSQMQDTR |
| QIQPSPPQSYDQSYQYLGSIASPSVHPATPISPGRASGMTTLSAELSSR |
| LSTAPDLTAFSDPRQFPALPSISDPRMHYPGAFTYSPTPVTSGIGIGMS |
| AMGSATRYHTYLPPPYPGSSQAQGGPFQASSPSYHLYYGASAGSYQFSM |
| VGGERSPPRILPPCTNASTGSALLNPSLPNQSDVVEAEGSHSNSPTNMA |
| PSARLEEAVWRPY |
Positions 80 through 84, 135 through 143, and 168 through 177 of SEQ ID NO: 1 have been predicted to relate to interactions with DNA. Positions 291 through 371 have been predicted to relate to interaction with Lysine Acetyltransferase 6A (KAT6A). Positions 307 through 400 have been predicted to relate to interaction with Lysine Acetyltransferase 6B (KAT6B). Positions 362 through 402 have been predicted to relate to interaction with Forkhead Box P3 (FOXP3).
Amino acid sequences of additional isoforms are publically available in the UniProt database under accession numbers Q01196-2 (SEQ ID NO: 2); Q01196-3 (SEQ ID NO: 3); Q01196-4 (SEQ ID NO: 4); Q01196-5 (SEQ ID NO: 5), Q01196-6 (SEQ ID NO: 6); Q01196-7 (SEQ ID NO: 7); Q01196-8 (SEQ TD NO: 8); Q01196-9 (SEQ ID NO: 9), Q01196-10 (SEQ ID NO: 10); and Q01196-11 (SEQ ID NO: 11).
A nucleotide sequence that encodes human RUNX1 is publically available in the GenBank database under accession number NM_001001890.2 (SEQ ID NO. 12) and is as follows (start and stop codon are bolded and underlined):
| CATAGAGCCAGCGGGCGCGGGCGGGACGGGCGCCCCGCGGCCGGACCCAGCCA | |
| GGGCACCACGCTGCCCGGCCCTGCGCCGCCAGGCACTTCTTTCCGGGGCTCCTAG | |
| GGACGCCAGAAGGAAGTCAACCTCTGCTGCTTGTCCTTGGCCTGCGTTGGACCTT | |
| CCTTTTTTTGTTGTTTTTTTTTGTTTTTCCCCTTTCTTCCTTTTGAATTAACTGGCTT | |
| CTTGGCTGGATGTTTTCAACTTCTTTCCTGGCTGCGAACTTTTCCCCAATTGTTTTC | |
| CTTTTACAACAGGGGGAGAAAGTGCTCTGTGGTCCGAGGCGAGCCGTGAAGTTG | |
| CGTGTGCGTGGCAGTGTGCGTGGCAGGATGTGCGTGCGTGTGTAACCCGAGCCG | |
| CCCGATCTGTTTCGATCTGCGCCGCGGAGCCCTCCCTCAAGGCCCGCTCCACCTG | |
| CTGCGGTTACGCGGCGCTCGTGGGTGTTCGTGCCTCGGAGCAGCTAACCGGCGGG | |
| TGCTGGGCGACGGTGGAGGAGTATCGTCTCGCTGCTGCCCGAGTCAGGGCTGAG | |
| TCACCCAGCTGATGTAGACAGTGGCTGCCTTCCGAAGAGTGCGTGTTTGCATGTG | |
| TGTGACTTCTGCGGCTGCTCAACTCCCAACAAACCAGAGGACCAGCCACAAACTT | |
| AACCAACATCCCCAAACCCGAGTTCACAGATGTGGGAGAGCTGTAGAACCCTGA | |
| GTGTCATCGACTGGGCCTTCTTATGATTGTTGTTTTAAGATTAGCTGAAGATCTCT | |
| GAAACGCTGAATTTTCTGCACTGAGCGTTTTGACAGAATTCATTGAGAGAACAGA | |
| GAACATGACAAGTACTTCTAGCTCAGCACTGCTCCAACTACTGAAGCTGATTTTC | |
| AAGGCTACTTAAAAAAATCTGCAGCGTACATTAATGGATTTCTGTTGTGTTTAAA | |
| TTCTCCACAGATTGTATTGTAAATATTTTATGAAGTAGAGCATATGTATATATTTA | |
| TATATACGTGCACATACATTAGTAGCACTACCTTTGGAAGTCTCAGCTCTTGCTTT | |
| TCGGGACTGAAGCCAGTTTTGCATGATAAAAGTGGCCTTGTTACGGGAGATAATT | |
| GTGTTCTGTTGGGACTTTAGACAAAACTCACCTGCAAAAAACTGACAGGCATTAA | |
| CTACTGGAACTTCCAAATAATGTGTTTGCTGATCGTTTTACTCTTCGCATAAATAT | |
| TTTAGGAAGTGTATGAGAATTTTGCCTTCAGGAACTTTTCTAACAGCCAAAGACA | |
| GAACTTAACCTCTGCAAGCAAGATTCGTGGAAGATAGTCTCCACTTTTTAATGCA | |
| CTAAGCAATCGGTTGCTAGGAGCCCATCCTGGGTCAGAGGCCGATCCGCAGAAC | |
| CAGAACGTTTTCCCCTCCTGGACTGTTAGTAACTTAGTCTCCCTCCTCCCTAACC | |
| ACCCCCGCCCCCCCCCACCCCCCGCAGTAATAAAGGCCCCTGAACGTGTATGTTG | |
| GTCTCCCGGGAGCTGCTTGCTGAAGATCCGCGCCCCTGTCGCCGTCTGGTAGGAG | |
| CTGTTTGCAGGGTCCTAACTCAATCGGCTTGTTGTGATGCGTATCCCCGTAGATG | |
| CCAGCACGAGCCGCCGCTTCACGCCGCCTTCCACCGCGCTGAGCCCAGGCAAGA | |
| TGAGCGAGGCGTTGCCGCTGGGCGCCCCGGACGCCGGCGCTGCCCTGGCCGGCA | |
| AGCTGAGGAGCGGCGACCGCAGCATGGTGGAGGTGCTGGCCGACCACCCGGGCG | |
| AGCTGGTGCGCACCGACAGCCCCAACTTCCTCTGCTCCGTGCTGCCTACGCACTG | |
| GCGCTGCAACAAGACCCTGCCCATCGCTTTCAAGGTGGTGGCCCTAGGGGATGTT | |
| CCAGATGGCACTCTGGTCACTGTGATGGCTGGCAATGATGAAAACTACTCGGCTG | |
| AGCTGAGAAATGCTACCGCAGCCATGAAGAACCAGGTTGCAAGATTTAATGACC | |
| TCAGGTTTGTCGGTCGAAGTGGAAGAGGGAAAAGCTTCACTCTGACCATCACTGT | |
| CTTCACAAACCCACCGCAAGTCGCCACCTACCACAGAGCCATCAAAATCACAGT | |
| GGATGGGCCCCGAGAACCTCGAAGACATCGGCAGAAACTAGATGATCAGACCAA | |
| GCCCGGGAGCTTGTCCTTTTCCGAGCGGCTCAGTGAACTGGAGCAGCTGCGGCGC | |
| ACAGCCATGAGGGTCAGCCCACACCACCCAGCCCCCACGCCCAACCCTCGTGCC | |
| TCCCTGAACCACTCCACTGCCTTTAACCCTCAGCCTCAGAGTCAGATGCAGGATA | |
| CAAGGCAGATCCAACCATCCCCACCGTGGTCCTACGATCAGTCCTACCAATACCT | |
| GGGATCCATTGCCTCTCCTTCTGTGCACCCAGCAACGCCCATTTCACCTGGACGT | |
| GCCAGCGGCATGACAACCCTTTCTGCAGAACTTTCCACTTCGACTCTCAACGGCAC | |
| CCGACCTGACAGCGTTCAGCGACCCGCGCTAGTTCCCCGCGCTGCCCTCCATCTC | |
| CGACCCCCGCATGCACTATCCAGGCGCCTTCACCTACTCCCCGACGCCGGTCACC | |
| TCGGGCATCGGCATCGGCATGTCGGCCATGGGCTCGGCCACGCGCTACCACACCT | |
| ACCTGCCGCCGCCCTACCCCGGCTCGTCGCAAGCGCAGGGAGGCCCGTTCCAAG | |
| CCAGCTCGCCCTCCTACCACCTGTACTACGGCGCCTCGGCCGGCTCCTACCAGTT | |
| CTCCATGGTGGGCGGCGAGCGCTCGCCGCCGCGCATCCTGCCGCCCTGCACCAAC | |
| GCCTCCACCGGCTCCGCGCTGCTCAACCCCAGCCTCCCGAACCAGAGCGACGTG | |
| GTGGAGGCCGAGGGCAGCCACAGCAACTCCCCCACCAACATGGCGCCCTCCGCG | |
| CGCCTGGAGGAGGCCGTGTGGAGGCCCTACTGAGGCGCCAGGCCTGGCCCGGCT | |
| GGGCCCCGCGGGCCGCCGCCTTCGCCTCCGGGCGCGCGGGCCTCCTGTTCGCGAC | |
| AAGCCCGCCGGGATCCCGGGCCCTGGGCCCGGCCACCGTCCTGGGGCCGAGGGC | |
| GCCCGACGGCCAGGATCTCGCTGTAGGTCAGGCCCGCGCAGCCTCCTGCGCCCA | |
| GAAGCCCACGCCGCCGCCGTCTGCTGGCGCCCCGGCCCTCGCGGAGGTGTCCGA | |
| GGCGACGCACCTCGAGGGTGTCCGCCGGCCCCAGCACCCAGGGGACGCGCTGGA | |
| AAGCAAACAGGAAGATTCCCGGAGGGAAACTGTGAATGCTTCTGATTTAGCAAT | |
| GCTGTGAATAAAAAGAAAGATTTTATACCCTTGACTTAACTTTTTAACCAAGTTG | |
| TTTATTCCAAAGAGTGTGGAATTTTGGTTGGGGTGGGGGGAGAGGAGGGATGCA | |
| ACTCGCCCTGTTTGGCATCTAATTCTTATTTTTAATTTTTCCGCACCTTATCAATTG | |
| CAAAATGCGTATTTGCATTTGGGTGGTTTTTATTTTTATATACGTTTATATAAATA | |
| TATATAAATTGAGCTTGCTTCTTTCTTGCTTTGACCATGGAAAGAAATATGATTCC | |
| CTTTTCTTTAAGTTTTATTTAACTTTTCTTTTGGACTTTTGGGTAGTTGTTTTTTTTT | |
| GTTTTCTTTTTGTTTTTTTGAGAAACAGGTACAGCTTTGGGTCATTTTTAACTACTG | |
| TATTCCCACAAGGAATCCCCAGATATTTATGTATCTTGATGTTCAGACATTTATGT | |
| GTTGATAATTTTTTAATTATTTAAATGTACTTATATTAAGAAAAATATCAAGTACT | |
| ACATTTTCTTTTGTTCTTGATAGTAGCCAAAGTTAAATGTATCACATTGAAGAAG | |
| GCTAGAAAAAAAGAATGAGTAATGTGATCGCTTGGTTATCCAGAAGTATTGTTTA | |
| CATTAAACTCCCTTTCATGTTAATCAAACAAGTGAGTAGCTCACGCAGCAACGTT | |
| TTTAATAGGATTTTTAGACACTGAGGGTCACTCCAAGGATCAGAAGTATGGAATT | |
| TTTCTGCCAGGCTCAACAAGGGTCTCATATCTAACTTCCTCCTTAAAACAGAGAAG | |
| GTCAATCTAGTTCCAGAGGGTTGAGGCAGGTGCCAATAATTACATCTTTGGAGAG | |
| GATTTGATTTCTGCCCAGGGATTTGCTCACCCCAAGGTCATCTGATAATTTCACA | |
| GATGCTGTGTAACAGAACACAGCCAAAGTAAACTGTGTAGGGGAGCCACATTTA | |
| CATAGGAACCAAATCAATGAATTTAGGGGTTACGATTATAGCAATTTAAGGGCC | |
| CACCAGAAGCAGGCCTCGAGGAGTCAATTTGCCTCTGTGTGCCTCAGTGGAGAC | |
| AAGTGGGAAAACATGGTCCCACCTGTGCGAGACCCCCTGTCCTGTGCTGCTCACT | |
| CAACAACATCTTTGTGTTGCTTTCACCAGGCTGAGACCCTACCCTATGGGGTATA | |
| TGGGCTTTTACCTGTGCACCAGTGTGACAGGAAAGATTCATGTCACTACTGTCCG | |
| TGGCTACAATTCAAAGGTATCCAATGTCGCTGTAAATTTTATGGCACTATTTTTAT | |
| TGGAGGATTTGGTCAGAATGCAGTTGTTGTACAACTCATAAATACTAACTGCTGA | |
| TTTTGACACATGTGTGCTCCAAATGATCTGGTGGTTATTTAACGTACCTCTTAAAA | |
| TTCGTTGAAACGATTTCAGGTCAACTCTGAAGAGTATTTGAAAGCAGGACTTCAG | |
| AACAGTGTTTGATTTTTATTTTATAAATTTAAGCATTCAAATTAGGCAAATCTTTG | |
| GCTGCAGGCAGCAAAAACAGCTGGACTTATTTAAAACAACTTGTTTTTGAGTTTT | |
| CTTATATATATATTGATTATTTGTTTTACACACATGCAGTAGCACTTTGGTAAGAG | |
| TTAAAGAGTAAAGCAGCTTATGTTGTCAGGTCGTTCTTATCTAGAGAAGAGCTAT | |
| AGCAGATCTCGGACAAACTCAGAATATATTCACTTTCATTTTTGACAGGATTCCC | |
| TCCACAACTCAGTTTCATATATTATTCCGTATTACATTTTTGCAGCTAAATTACCA | |
| TAAAATGTCAGCAAATGTAAAAATTTAATTTCTGAAAAGCACCATTAGCCCATTT | |
| CCCCCAAATTAAACGTAAATGTTTTTTTTCAGCACATGTTACCCATGTCTGACCTGC | |
| AAAAATGCTGGAGAAAAATGAAGGAAAAAATTATGTTTTTCAGTTTAATTCTGTT | |
| AACTGAAGATATTCCAACTCAAAACCAGCCTCATGCTCTGATTAGATAATCTTTT | |
| ACATTGAACCTTTACTCTCAAAGCCATGTGTGGAGGGGGCTTGTCACTATTGTAG | |
| GCTCACTGGATTGGTCATTTAGAGTTTCACAGACTCTTACCAGCATATATAGTATT | |
| TAATTGTTTCAAAAAAAATCAAACTGTAGTTGTTTTGGCGATAGGTCTCACGCAA | |
| CACATTTTTGTATGTGTGTGTGTGTGCGTGTGTGTGTGTGTGTGTGAAAAATTGCA | |
| TTCATTGACTTCAGGTAGATTAAGGTATCTTTTTATTCATTGCCCTCAGGAAAGTT | |
| AAGGTATCAATGAGACCCTTAAGCCAATCATGTAATAACTGCATGTGTCTGGTCC | |
| AGGAGAAGTATTGAATAAGCCATTTCTACTGCTTACTCATGTCCCTATTTATGATT | |
| TCAACATGGATACATATTTCAGTTCTTTCTTTTTCTCACTATCTGAAAATACATTT | |
| CCCTCCCTCTCTTCCCCCCAATATCTCCCTTTTTTTCTCTCTTCCTCTATCTTCCAA | |
| ACCCCACTTTCTCCCTCCTCCTTTTCCTGTGTTCTCTTAAGCAGATAGCACATACC | |
| CCCACCCAGTACCAAATTTCAGAACACAAGAAGGTCCAGTTCTTCCCCCTTCACA | |
| TAAAGGAACATGGTTTGTCAGCCTTTCTCCTGTTTATGGGTTTCTTCCAGCAGAAC | |
| AGAGACATTGCCAACCATATTGGATCTGCTTGCTGTCCAAACCAGCAAACTTTCC | |
| TGGGCAAATCACAATCAGTGAGTAAATAGACAGCCTTTCTGCTGCCTTGGGTTTC | |
| TGTGCAGATAAACAGAAATGCTCTGATTAGAAAGTGAAATGAATGGTTCCACTCA | |
| AATGTCCTGCAATTTAGGATTGCAGATTTCTGCCTTGAAATACCTGTTTCTTTGGG | |
| ACATTCCGTCCTGATGATTTTTATTTTTGTTGGTTTTTATTTTTGGGGCGAATGAC | |
| ATGTTTGGGTCTTTTATACATGAAAATTTGTTTGACAATAATCTCACAAAACATAT | |
| TTTACATCTGAACAAAATGCCTTTTTTTTTACCGTAGCGTATACATTTGTTTTGGG | |
| ATTTTTGTGTGTTTGTTGGGAATTTTGTTTTTAGCCAGGTCAGTATTGATGAGGCT | |
| GATCATTTGGCTCTTTTTTTCCTTCCAGAAGAGTTGCATCAACAAAGTTAATTGTA | |
| TTTATGTATGTAAATAGATTTTAAGCTTCATTATAAAATATTGTTAATGCCTATAA | |
| CTTTTTTTCAATTTTTTTGTGTGTGTTTCTAAGGACTTTTTCTTAGGTTTGCTAAAT | |
| ACTGTAGGGAAAAAAATGCTTCTTTCTACTTTGTTTATTTTAGACTTTAAAATGAG | |
| CTACTTCTTATTCACTTTTGTAAACAGCTAATAGCATGGTTCCAATTTTTTTTAAG | |
| TTCACTTTTTTTGTTCTAGGGGAAATGAATGTGCAAAAAAAGAAAAAGAACTGTT | |
| GGTTATTTGTGTTATTCTGGATGTATAAAAATCAATGGAAAAAAATAAACTTTCA | |
| AATTGAAATGACGGTATAACACATCTACTGAAAAAGCAACGGGAAATGTGGTCC | |
| TATTTAAGCCAGCCCCCACCTAGGGTCTATTTGTGTGGCAGTTATTGGGTTTGGTC | |
| ACAAAACATCCTGAAAATTCGTGCGTGGGCTTCTTTCTCCCTGGTACAAACGTAT | |
| GGAATGCTTCTTAAAGGGGAACTGTCAAGCTGGTGTCTTCAGCCAGATGACATGA | |
| GAGAATATCCCAGAACCCTCTCTCCAAGGTGTTTCTAGATAGCACAGGAGAGCA | |
| GGCACTGCACTGTCCACAGTCCACGGTACACAGTCGGGTGGGCCGCCTCCCCTCT | |
| CCTGGGAGCATTCGTCGTGCCCAGCCTGAGCAGGGCAGCTGGACTGCTGCTGTTC | |
| AGGAGCCACCAGAGCCTTCCTCTCTTTGTACCACAGTTTCTTCTGTAAATCCAGTG | |
| TTACAATCAGTGTGAATGGCAAATAAACAGTTTGACAAGTACATACACCATA |
Additional RUNX1-encoding nucleotide sequences are publically available in the GenBank database under accession numbers NM_001754.4 (SEQ ID NO: 13); NM_001122607.1 (SEQ ID NO: 14); XM_005261068.3 (SEQ ID NO: 15); XM_011529770.2 (SEQ ID NO: 16); XR_937576.2 (SEQ ID NO: 17); XM_011529768.2 (SEQ ID NO: 18); XM_005261069.4 (SEQ ID NO: 19); XM_017028487.1 (SEQ ID NO: 20); XM_011529767.2 (SEQ ID NO: 21); and XM_011529766.2 (SEQ ID NO: 22).
In some embodiments, the RUNX1 is RUNX1a. In certain embodiments, the RUNX1 is RUNXb. In various embodiments, the RUNX1 is RUNX1a and RUNX1b. In some embodiments, the level of RUNX1 expression is measured in CD31+ cells, and the RUNX1 is RUNX1b. In certain embodiments, the RUNX1 is any combination of 2, 3, 4, 5, 6, 7, 8, 9, 10, or 11 of RUNX1a, RUNX1b, RUNX1c, RUNX1e, RUNX1fa, RUNX1fb, RUNX1fc, RUNX1g, RUNX1h, RUNX1i, and/or RUNX1l. In some embodiments, the RUNX1 is RUNX1a, RUNX1b, RUNX1c, RUNX1e, RUNX1fa, RUNX1fb, RUNX1fc, RUNX1g, RUNX1h, RUNX1i, and RUNX1l. In various embodiments, the RUNX1 comprises RUNX1a. In some embodiments, the RUNX1 comprises RUNX1b. In certain embodiments, the RUNX1 comprises RUNX1c. In various embodiments, the RUNX1 comprises RUNX1e. In some embodiments, the RUNX1 comprises RUNX1fa. In certain embodiments, the RUNX1 comprises RUNX1fb. In various embodiments, the RUNX1 comprises RUNX1fc. In some embodiments, the RUNX1 comprises RUNX1g. In certain embodiments, the RUNX1 comprises RUNX1h. In various embodiments, the RUNX1 comprises RUNX1i. In come embodiments, the RUNX1 comprises RUNX1l.
An amino acid sequence for human RUNX1a is publically available in the UniProt database under accession number Q01196-2 (SEQ ID NO: 2) and is as follows:
| MRIPVDASTSRRFTPPSTALSPGKMSEALPLGAPDAGAALAGKLRSGDR |
| SMVEVLADHPGELVRTDSPNFLCSVLPTHVVRCNKTLPIAFKVVALGDV |
| PDGILVTVMAGNDENYSAELRNATAAMKNQVARFNDLRFVGRSGRGKSF |
| TLTITVFTNPPQVATYHRAIKITVDGPREPRRHRQKLDDQTKPGSLSFS |
| ERLSELEQLRRTAMRVSPHHPAPTPNPRASLNHSTAFNPQPQSQMQDTR |
| QIQPSPPVVSYDQSYQYLGSIASPSVHPATPISPGRASGIVITTLSAEL |
| SSRLSTAPDLTAFSDPRQFPALPSISDPRMHYPGAFTYSPTPVTSGIGI |
| GMSAMGSATRYHTYLPPPYPGSSQAQGGPFQASSPSYHLYYGASAGSYQ |
| FSMVGGERSPPRILPPCTNASTGSALLNPSLPNQSDVVEAEGSHSNSPT |
| NMGGASCSRQARRDPGPVVARTPSWGRGRPTDRISL |
An amino acid sequence for human RUNX1c is publically available in the UniProt database under accession number Q01196-3 (SEQ ID NO: 3) and is as follows:
| MRIPVDASTSRPFTPRSTALSPGKMSEALPLGAPD | |
| AGAALAGKLPSGDRSMVEVLADHPGELVRTDSPNF | |
| LCSVLPTHWRCNKTLPIAFKVVALGDVPDGILVTV | |
| MAGNDENYSAELRNATAAMKNQVARFNDLRFVGRS | |
| GRGKSFTLT1TVFTNPPQVATYHRAIKITVDGPRE | |
| PRRHRQKLDDQTKPGSLSFSERLSELEQLRRTAMR | |
| VSPHHPAPTPNPRASLNHSTAFNPQPQSQMQEEDT | |
| APWRC |
An amino acid sequence for human RUNX1e is publically available in the UniProt database under accession number Q01196-4 (SEQ ID NO: 4) and is as follows:
| MRIPVDASTSRRFTPPSTALSPGKMSEALPLGAPD | |
| AGAALAGKLRSGDRSMVEVLADHPGELVRTDSPNF | |
| LCSVLPTHWRCNKTLPIAFKVVALGDVPDGILVTV | |
| MAGNDENYSAELRNATAAMKNQVARFNDLRFVGRS | |
| GRGKSFTLTITVFTNPPQVATYHRAIKITVDGPRE | |
| PRRHRQKLDDQTKPGSLSFSERLSELEQLRRTAMR | |
| VSPHHPAPTPNPRASLNHSTAFNPQPQSQMQDTRQ | |
| IQPSPPWSYDQS |
An amino acid sequence for human RUNX1fa is publically available in the UniProt database under accession number 001196-5 (SEQ ID NO: 5) and is as follows:
| MRIPVDASTSRRFTPPSTALSPGKMSEALPLGAPD | |
| AGAALAGKLRSGDRSMVEVLADHPGELVRTDSPNF | |
| LCSVLPTHWRCNKTLPIAFKVVALGDVPDGTLVTV | |
| MAGNDENYSAELRNATAAMKNQVARFNDLRFVGRS | |
| GRGKSFTLTITVFTNPPQVATYHRAIKITVDGPRE | |
| PRSKCIHLGLVHPPGWYTLQAGILRDHVSDSLGST | |
| FPPGGWQAPVKPKS |
An amino acid sequence for human RUNX1fb is publically available in the UniProt database under accession number Q01196-6 (SEQ ID NO: 6) and is as follows:
| MRIPVDASTSRRFTPPSTALSPGKMSEALPLGAPD | |
| AGAALAGKLRSGDRSMVEVLADHPGELVRTDSPNF | |
| LCSVLPTHWRCNKTLPIAFKVVALGDVPDGTLVTV | |
| MAGNDENYSAELRNATAAMKNQVARFNDLRFVGRS | |
| GRGKSFTLTSTVFTNPPQVATYHRAIKITVDGPRE | |
| PRNSLTWPRYPHI |
An amino acid sequence for human RUNX1fc is publically available in the UniProt database under accession number Q01196-7 (SEQ ID NO: 7) and is as follows:
| MRIPVDASTSRRFTPPSTALSPGKMSEALPLGAPD | |
| AGAALAGKLRSGDRSMVEVLADHPGELVRTDSPNF | |
| LCSVLPTHWRCNKTLPIAFKVVALGDVPDGTLVTV | |
| MAGNDENYSAELRNATAAMKNQVARFNDLRFVDGP | |
| REPRRHRQKLDDQTKPGSLSFSERLSELEQLRRTA | |
| MRVSPHHPAPTPNPRASLNHSTAFNPQPQSQMQDT | |
| RQIQPSPPWSYDQSYQYLGSlASPSVHPATPI |
An amino acid sequence for human RUNX1g is publically available in the UniProt database under accession number Q01196-8 (SEQ ID NO: 8) and is as follows:
| MASDSIFESFPSYPQCFMRECILGMNPSRDVHDAS | |
| TSRRFTPPSTALSPGKMSEALPLGAPDAGAALAGK | |
| LRSGDRSMVEVLADHPGELVRTDSPNFLCSVLPTH | |
| WRCNKTLPIAFKVVALGDVPDGTLVTVMAGNDENY | |
| SAELRNATAAMKNQVARFNDLRFVGRSGRGKSFTL | |
| TITVFTNPPQVATYHRAIKITVDGPREPRRHRQKL | |
| DDQTKPGSLSFSERLSELEQLRRTAMRVSPHHPAP | |
| TPNPRASLNHSTAFNPQPQSQMQDTRQIQPSPPWS | |
| YDQSYQYLGSIASPSVHPATPISPGRASGMTTLSA | |
| ELSSRLSTAPDLTAFSDPRQFPALPSISDPRMHYP | |
| GAFTYSPTPVTSGIGIGMSAMGSATRYHTYLPPPY | |
| PGSSQAQGGPFQASSPSYHLYYGASAGSYQFSMVG | |
| GERSPPRILPPCTNASTGSALLNPSLPNQSDVVEA | |
| EGSHSNSPTNMAPSARLEEAVWRPY |
An amino acid sequence for human RUNX1h is publically available in the UniProt database under accession number Q01196-9 (SEQ ID NO: 9) and is as follows:
| MNPSRDVHDASTSRRFTPPSTALSPGKMSEALPLG | |
| APDAGAALAGKLRSGDRSMVEVLADHPGELVRTDS | |
| PNFLCSVLPTHWRCNKTLPIAFKVVALGDVPDGTL | |
| VTVMAGNDENYSAELRNATAAMKNQVARFNDLRFV | |
| GRSGRGKSFTLTITVFTNPPQVATYHRAIKITVDG | |
| PREPRRHRQKLDDQTKPGSLSFSERLSELEQLRRT | |
| AMRVSPHHPAPTPNPRASLNHSTAFNPQPQSQMQD | |
| TRQIGPSPPWSYDQSYQYLGSIASPSVHPATPISP | |
| GRASGMTTLSAELSSRLSTAPDLTAFSDPRQFPAL | |
| PSISDPRMHYPGAFTYSPTPVTSGIGIGMSAMGSA | |
| TRYHTYLPPPYPGSSQAQGGPFQASSPSYHLYYGA | |
| SAGSYQFSMVGGERSPPR1LPPCTNASTGSALLNP | |
| SLPNQSDWEAEGSHSNSPTNMAPSARLEEAVWRPY |
An amino acid sequence for human RUNX1i is publically available in the UniProt database under accession number Q01196-10 (SEQ ID NO: 10) and is as follows:
| MPAAPRGPAGGEAAARTRSRDASTSRRFTPPSTAL | |
| SPGKMSEALPLGAPDAGAALAGKLRSGDRSMVEVL | |
| ADHPGELVRTDSPNFLCSVLPTHWRCNKTLPIAFK | |
| VVALGDVPDGTLVTVMAGNDENYSAELRNATAAMK | |
| NGVARFNDLRFVGRSGRGKSFTLTITVFTNPPQVA | |
| TYHRAIK1TVDGPREPRRHRQKLDDQTKPGSLSFS | |
| ERLSELEQLRRTAMRVSPHHPAPTPNPRASLNHST | |
| AFNPQPQSQMQDTRQIQPSPPWSYDQSYQYLGSIA | |
| SPSVHPATPISPGRASGMTTLSAELSSRLSTAPDL | |
| TAFSDPRGFPALPS1SDPRMHYPGAFTYSPTPVTS | |
| GIGIGMSAMGSATRYHTYLPPPYPGSSQAQGGPFQ | |
| ASSPSYHLYYGASAGSYQFSMVGGERSPPRILPPC | |
| TNASTGSALLNPSLPNQSDWEAEGSHSNSPTNMAP | |
| SARLEEAVWRPY |
An amino acid sequence for human RUNX1l is publically available in the UniProt database under accession number Q01196-11 (SEQ ID NO: 11) and is as follows:
| MAGNDENYSAELRNATAAMKNQVARFNDLRFVGRS | |
| GRGKSFTLTITVFTNPPQVATYHRAIKITVDGPRE | |
| PRRHRQKLDDQTKPGSLSFSERLSELEQLRRTAMR | |
| VSPHHPAPTPNPRASLNHSTAFNPQPQSQMQDTRQ | |
| IQPSPPWSYDQSYQYLGSIASPSVHPATPISPGRA | |
| SGMTTLSAELSSRLSTAPDLTAFSDPRQFPALPSI | |
| SDPRMHYPGAFTYSPTPVTSGIGIGMSAMGSATRY | |
| HTYLPPPYPGSSQAQGGPFQASSPSYHLYYGASAG | |
| SYQFSMVGGERSPPRILPPCTNASTGSALLNPSLP | |
| NQSDVVEAEGSHSNSPTNMAPSARLEEAVWRPY |
PIM3 (PIM3 Proto-Oncogene, Serine/Threonine Kinase) is a protein that in humans is encoded by the PIM3 gene. The PIM3 gene has been reported to be overexpressed in hematological and epithelial tumors, and has been associated with MYC coexpression. It plays a role in the regulation of signal transduction cascades, contributing to both cell proliferation and survival, and provides a selective advantage in tumorigenesis.
An amino acid sequence for human PIM3 is publically available in the UniProt database under accession number Q86V86 (SEQ ID NO: 23) and is as follows:
| MLLSKFGSLAHLCGPGGVDHLPVKILQPAKADKES | |
| FEKAYQVGAVLGSGGFGTVYAGSRIADGLPVAVKH | |
| VVKERVTEWGSLGGATVPLEVVLLRKVGAAGGARG | |
| VIRLLDWFERPDGFLLVLERPEPAQDLFDFITERG | |
| ALDEPLARRFFAQVLAAVRHCHSCGVVHRDIKDEN | |
| LVDLRSGELKLIDFGSGALLKDTVYTDFDGTRVYS | |
| PPEWIRYHRYHGRSATVWSLGVLLYDMVCGDIPFE | |
| QDEEILRGRLLFRRRVSPECQQLIRWCLSLRPSER | |
| PSLDQIAAHPWMLGADGGVPESCDLRLCTLDPDDV | |
| ASTTSSSESL |
Positions 40 through 293 of SEQ ID NO: 23 have been predicted to be a protein kinase domain.
Additional amino acid sequences for human PIM3 are publically available in the European Nucleotide Archive database under accession numbers BAD42438.1 (SEQ ID NO: 24), BAF84694.1 (SEQ ID NO: 25), and AA141856.1 (SEQ ID NO: 26).
A nucleotide sequence that encodes human PIM3 is publically available in the GenBank database under accession number NM 001001852 (SEQ ID NO: 27) and is as follows (start and stop codon are bolded and underlined):
| GAGAGCGTGAGCGCGGAGAGCGGACCGACGCGACA | |
| CGCCGTGCGCCTCCGCGGCTGCGCTACGAAAACGA | |
| GTCCCGGAGCGGCCCCGCGCCCGCCGCACCCGGCC | |
| CTCGCCCGCCCGAAGACAGGCGCCAAGCTGCCCC | |
| GCCGTCTCCCCAGCTAGCGCCC | |
| GGCCGCCGCCGCCTCGCGGGCCCCGGGCGGAAGGG | |
| GGCGGGGTCCCGATTCGCCCCGCCCCCGCGGAGGG | |
| ATACGCGGCGCCGCGGCCCAAAACCCCCGGGCGAG | |
| GCGGCCGGGGCGGGTGAGGCGCTCCGCCTGCTGCG | |
| CGTCTACGCGGTCCCCGCGGGCCTTCCGGGCCCAC | |
| rGCGCCGCGCGGACCGCCTCGGGCTCGGACGGCCGG | |
| TGTCCCCGGCGCGCCGCTCGCCCGGATCGGCCGCG | |
| GCTTCGGCGCCTGGGGCTCGGGGCTCCGGGGAGGC | |
| CGTCGCCCGCGATGCTGCTCTCCAAGTTCGGCTCC | |
| CTGGCGCACCTCTGCGGGCCCGGCGGCGTGGACCA | |
| CCTCCCGGTGAAGATCCTGCAGCCAGCCAAGGCGG | |
| ACAAGGAGAGCTTCGAGAAGGCGTACCAGGTGGGC | |
| GCCGTGCTGGGTAGCGGCGGCTTCGGCACGGTCTA | |
| CGCGGGTAGCCGCATCGCCGACGGGCTCCCGGTGG | |
| CTGTGAAGCACGTGGTGAAGGAGCGGGTGACCGAG | |
| TGGGGCAGCCTGGGCGGCGCGACCGTGCCCCTGGA | |
| GGTGGTGCTGCTGCGCAAGGTGGGCGCGGCGGGCG | |
| GCGCGCGCGGCGTCATCCGCCTGCTGGACTGGTTC | |
| GAGCGGCCCGACGGCTTCCTGCTGGTGCTGGAGCG | |
| GCCCGAGCCGGCGCAGGACCTCTTCGACTTTATCA | |
| CGGAGCGCGGCGCCCTGGACGAGCCGCTGGCGCGC | |
| CGCTTCTTCGCGCAGGTGCTGGCCGCCGTGCGCCA | |
| CTGCCACAGCTGCGGGGTCGTGCACCGCGACATTA | |
| AGGACGAAAATCTGCTTGTGGACCTGCGCTCCGGA | |
| GAGCTCAAGCTCATCGACTTCGGTTCGGGTGCGCT | |
| GCTCAAGGACACGGTCTACACCGACTTCGACGGCA | |
| CCCGAGTGTACAGCCCCCCGGAGTGGATCCGCTAC | |
| CACCGCTACCACGGGCGCTCGGCCACCGTGTGGTC | |
| GCTGGGCGTGCTTCTCTACGATATGGTGTGTGGGG | |
| ACATCCCCTTCGAGCAGGACGAGGAGATCCTCCGA | |
| GGCCGCCTGCTCTTCCGGAGGAGGGTCTCTCCAGA | |
| GTGCCAGCAGCTGATCCGGTGGTGCCTGTCCCTGC | |
| GGCCCTCAGAGCGGCCGTCGCTGGATCAGATTGCG | |
| GCCCATCCCTGGATGCTGGGGGCTGACGGGGGCGT | |
| CCCGGAGAGCTGTGACCTGCGGCTGTGCACCCTCG | |
| ACCCTGATGACGTGGCCAGCACCACGTCCAGCAGC | |
| GAGAGCTTGTGAGGAGCTGCACCTGACTGGGAGCT | |
| AGGGGACCACCTGCCTTGGCCAGACCTGGGACGCC | |
| CCCAGACCCTGACTTTCTCCTGCGTGGGCCGTCTC | |
| CTCCTGCGGAAGCAGTGACCTCTGACCCCTGGTGA | |
| CCTTCGCTTTGAGTGCCTTTTGAACGCTGGTCCCG | |
| CGGGACTTGGTTTTCTCAAGCTCTGTCTGTCCAAA | |
| GACGCTCCGGTCGAGGTCCCGCCTGCCCTGGGTGG | |
| ATACTTGAACCCCAGACGCCCCTCTGTGCTGCTGT | |
| GTCCGGAGGCGGCCTTCCCATCTGCCTGCCCACCC | |
| GGAGCTCTTTCCGCCGGCGCAGGGTCCCAAGCCCA | |
| CCTCCCGCCCTCAGTCCTGCGGTGTGCGTCTGGGC | |
| ACGTCCTGCACACACAATGCAAGTCCTGGCCTCCG | |
| CGCCCGCCCGCCCACGCGAGCCGTACCCGCCGCCA | |
| ACTCTGTTATTTATGGTGTGACCCCCTGGAGGTGC | |
| CCTCGGCCCACCGGGGCTATTTATTGTTTAATTTA | |
| TTTGTTGAGGTTATTTCCTCTGAGCAGTCTGCCTC | |
| TCCCAAGCCCCA | |
| GGGGACAGTGGGGAGGCAGGGGAGGGGGTGGCTGT | |
| GGTCCAGGGACCCCAGGCCCTGATTCCTGTGCCTG | |
| GCGTCTGTCCCGGCCCCGCCTGTCAGAAGATGAAC | |
| ATGTATAGTGGCTAACTTAAGGGGAGTGGGTGACC | |
| CTGACACTTCCAGGCACTGTGCCCAGGGTTTGGGT | |
| TTTAAATTATTGACTTTGTACAGTCTGCTTGTGGG | |
| CTCTGAAAGCTGGGGTGGGGCCAGAGCCTGAGCGT | |
| TTAATTTATTCAGTACCTGTGTTTGTGTGAATGCG | |
| GTGTGTGCAGGCATCGCAGATGGGGGTTCTTTCAG | |
| TTCAAAAGTGAGATGTCTGGAGATCATATTTTTTT | |
| ATACAGGTATTTGAATTAAAATGTTTTTGTACATA | |
| AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA |
Additional PIM3-encoding nucleotide sequences are publically available in the GenBank database under accession number BC141855.1 (SEQ ID NO: 28) as well as in the European Nucleotide Archive under accession numbers AB114795.1 (SEQ ID NO: 29), and AK292005.1 (SEQ ID NO: 30).
IGFBP3 is a protein that in humans is encoded by the IGFBP3 gene. IGFBP-3 has been reported to exert antiproliferative effects in many cell types by blocking the ability of IGF-1 and IGF-2 to activate the IGF1R (which stimulates cell proliferation). For example, in esophageal epithelial cells, responsiveness to IGF-1 stimulation is suppressed by secreted IGFBP-3 and restored when IGFBP-3 is downregulated by epidermal growth factor.
An amino acid sequence for human TGFBP3 is publically available in the UniProt database under accession number P17936-1 (SEQ ID NO: 31) and is as follows:
| MQRARPTLWAAALTLLVLLRGPPVARAGASSAGLG | |
| PVVRCEPCDARALAQCAPPPAVCAELVREPGCGCC | |
| LTCALSEGQPCGIYTERCGSGLRCQPSPDEARPLQ | |
| ALLDGRGLCVNASAVSRLRAYLLPAPPAPGNASES | |
| EEDRSAGSVESPSVSSTHRVSDPKFHPLHSKIIII | |
| KKGHAKDSQRYKVDYESQSTDTQNFSSESKRETEY | |
| GPCRREMEDTLNHLKFLNVLSPRGVHIPNCDKKGF | |
| YKKKQCRPSKGRKRGFCWCVDKYGQPLPGYTTKGK | |
| EDVHCYSMQSK |
Positions 28 through 134 of SEQ ID NO: 31 have been predicted to be an IGF-binding domain. Positions 210 through 285 of SEQ ID NO: 31 have been predicted to be a thyroglobulin type-1 domain.
Additional amino acid sequences for human IGFBP3 are publically available in the UniProt database under accession number P17936-2 (SEQ ID NO: 32), as well as the NCBI database under accession numbers NP_000589.2 (SEQ ID NO: 33) and NP_001013416.1 (SEQ ID NO: 34).
A nucleotide sequence that encodes human IGFBP3 is publically available in the GenBank database under accession number NM_001013398.1 SEQ ID NO: 35) and is as follows (start and stop codon are bolded and underlined):
| AGATGCGAGCACTGCGGCTGGGCGCTGAGGATCAG | |
| CCGCTTCCTGCCTGGATTCCACAGCTTCGCGCCGT | |
| GTACTGTCGCCCCATCCCTGCGCGCCCAGCCTGCC | |
| AAGCAGCGTGCCCCGGTTGCAGGCGTCATGCAGCG | |
| GGCGCGACCCACGCTCTGGGCCGCTGCGCTGACTC | |
| TGCTGGTGCTGCTCCGCGGGCCGCCGGTGGCGCGG | |
| GCTGGCGCGAGCTCGGCGGGCTTGGGTCCCGTGGT | |
| GCGCTGCGAGCCGTGCGACGCGCGTGCACTGGCCC | |
| AGTGCGCGCCTCCGCCCGCCGTGTGCGCGGAGCTG | |
| GTGCGCGAGCCGGGCTGCGGCTGCTGCCTGACGTG | |
| CGCACTGAGCGAGGGCCAGGCGTGCGGCATCTAGA | |
| CCGAGCGCTGTGGCTCCGGCCTTCGCTGCCAGCCG | |
| TCGCCCGACGAGGCGCGACCGCTGCAGGCGCTGCT | |
| GGACGGCCGCGGGCTCTGCGTCAACGCTAGTGCCG | |
| TCAGCCGCCTGCGCGCCTACCTGCTGCCAGCGCCG | |
| CCAGCTCCAGGTGAGCCGCCCGCGCCAGGAAATGC | |
| TACTGAGTCGGAGGAAGACCGCAGCGCCGGCAGTG | |
| TGGAGAGCCCGTCCGTCTCCAGCACGCACCGGGTG | |
| TCTGATCCCAAGTTCCACCCCCTCCATTCAAAGAT | |
| AATCATCATCAAGAAAGGGCATGCTAAAGACAGCC | |
| AGCGCTAGAAAGTTGACTACGAGTCTCAGAGCACA | |
| GATACCCAGAACTTCTCCTCCGAGTCCAAGCGGGA | |
| GACAGAATATGGTCCCTGCCGTAGAGAAATGGAAG | |
| ACACACTGAATCACCTGAAGTTCCTCAATGTGCTG | |
| AGTCCCAGGGGTGTACACATTCCCAACTGTGACAA | |
| GAAGGGATTTTATAAGAAAAAGCAGTGTCGCCCTT | |
| CCAAAGGCAGGAAGCGGGGCTTCTGCTGGTGTGTG | |
| GATAAGTATGGGCAGCCTCTCCCAGGCTAGACCAC | |
| CAAGGGGAAGGAGGACGTGCACTGCTACAGCATGC | |
| AGAGCAAGTAGACGCCTGCCGCAAGGTTAATGTGG | |
| AGCTCAAATATGCCTTATTTTGCACAAAAGACTGC | |
| CAAGGACATGACCAGCAGCTGGCTACAGCCTCGAT | |
| TTATATTTCTGTTTGTGGTGAACTGATTTTTTTTA | |
| AACCAAAGTTTAGAAAGAGGTTTTTGAAATGCCTA | |
| TGGTTTCTTTGAATGGTAAACTTGAGCATCTTTTC | |
| ACTTTCCAGTAGTCAGCAAAGAGCAGTTTGAATTT | |
| TCTTGTCGCTTCCTATCAAAATATTCAGAGACTCG | |
| AGCACAGCACCCAGACTTCATGCGCCCGTGGAATG | |
| CTCACCACATGTTGGTCGAAGCGGCCGACCACTG | |
| ACTTTGTGACTTAGGCGGCTGTGTTGCCTATGTAG | |
| AGAACACGCTTCACCCCCACTCCCCGTACAGTGCG | |
| CACAGGCTTTATCGAGAATAGGAAAACCTTTAAAC | |
| CCCGGTCATCCGGACATCCCAACGCATGCTCCTGG | |
| AGCTCACAGCCTTCTGTGGTGTCATTTCTGAAACA | |
| AGGGCGTGGATCCCTCAACCAAGAAGAATGTTTAT | |
| GTCTTCAAGTGACCTGTACTGCTTGGGGACTATTG | |
| GAGAAAATAAGGTGGAGTCCTACTTGTTTAAAAAA | |
| TATGTATCTAAGAATGTTCTAGGGCACTCTGGGAA | |
| CCTATAAAGGCAGGTATTTCGGGCCCTCCTCTTCA | |
| GGAATCTTCCTGAAGACATGGCCCAGTCGAAGGCC | |
| CAGGATGGCTTTTGCTGCGGCCCCGTGGGGTAGGA | |
| GGGACAGAGAGACAGGGAGAGTCAGCCTCCACATT | |
| CAGAGGCATCACAAGTAATGGCACAATTCTTCGGA | |
| TGACTGCAGAAAATAGTGTTTTGTAGTTCAACAAC | |
| TCAAGACGAAGCTTATTTCTGAGGATAAGCTCTTT | |
| AAAGGCAAAGCTTTATTTTCATCTCTCATCTTTTG | |
| TCCTCCTTAGCACAATGTAAAAAAGAATAGTAATA | |
| TCAGAACAGGAAGGAGGAATGGCTTGCTGGGGAGC | |
| CCATCCAGGACACTGGGAGCACATAGAGATTCACC | |
| CATGTTTGTTGAACTTAGAGTCATTCTCATGCTTT | |
| TCTTTATAATTCACACATATATGCAGAGAAGATAT | |
| GTTCTTGTTAACATTGTATACAACATAGCCCCAAA | |
| TATAGTAAGATCTATACTAGATAATCCTAGATGAA | |
| ATGTTAGAGATGCTATATGATACAACTGTGGCCAT | |
| GACTGAGGAAAGGAGCTCACGCCCAGAGACTGGGC | |
| TGCTCTCCCGGAGGCCAAACCCAAGAAGGTCTGGC | |
| AAAGTCAGGCTCAGGGAGACTCTGCCCTGCTGCAG | |
| ACCTCGGTGTGGACACACGCTGCATAGAGCTCTCC | |
| TTGAAAACAGAGGGGTCTCAAGACATTCTGCCTAC | |
| CTATTAGCTTTTCTTTATTTTTTTAACTTTTTGGG | |
| GGGAAAAGTATTTTTGAGAAGTTTGTCTTGCAATG | |
| TATTTATAAATAGTAAATAAAGTTTTTACCATTAA | |
| AAAAATATCTTTCCCTTTGTTATTGACCATCTCTG | |
| GGCTTTGTATCACTAATTATTTTATTTTATTATAT | |
| AATAATTATTTTATTATAATAAAATCCTGAAAGGG | |
| GAAAATAAAAAAAA |
An additional IGFBP3-encoding nucleotide sequence is publically available in the GenBank database under accession number NM_000598.4 (SEQ ID NO: 36).
Aspects of the present subject matter relate to the administration of an RUNX1 inhibitor and/or a PIM3 inhibitor. In various embodiments, an inhibitor may be, e.g., an aptamer, an oligonucleotide (e.g., an antisense oligonucleotide, a ribozyme, or an RNA interfering molecule), a peptide, an antibody or a fragment thereof, or a small molecule, that specifically binds to RUNX1 or PIM3 or a polynucleotide that encodes RUNX1 or PIM3.
Small Molecules
In various embodiments, the RUNX1 inhibitor is a small molecule inhibitor. Non-limiting examples include:
or pharmaceutically acceptable salts or esters thereof, wherein each R1 is individually selected from halogen, alkyl, aryl, heteroaryl, or alkoxy; R2 is selected from aryl or heteroaryl; and a is 0 to 4;
or a pharmaceutically acceptable salt or ester thereof, wherein each R1 is individually selected from halogen, alkyl, aryl, heteroaryl, or alkoxy; R2 is selected from aryl or heteroaryl; and a is 0 to 4; or
or a pharmaceutically acceptable salt or ester thereof, wherein each R1 is individually selected from halogen, alkyl, aryl, heteroaryl, or alkoxy; R2 is selected from aryl or heteroaryl; R3 is alkyl or aryl; and a is 0 to 4.
In certain embodiments of formulae I-III, R2 is a heteroaryl, particularly pyrrolyl, and especially pyrrol-2-yl. In certain embodiments of formulae I-III, R1 is a halogen, particularly Cl or F. In certain embodiments of formula III, R3 is a lower alkyl. In certain embodiments of formulae I-III, R2 is a heteroaryl, particularly pyrrolyl, and especially pyrrol-2-yl; and R1 is a halogen, particularly Cl or F. In certain embodiments of formula III, R2 is a heteroaryl, particularly pyrrolyl, and especially pyrrol-2-yl; R1 is a halogen, particularly Cl or F; and R3 is a lower alkyl.
The term “alkoxy” refers to a group of the formula —OR, wherein R is an organic group such as an alkyl group, optionally substituted with an alkenyl, alkynyl, aryl, aralkyl, cycloalkyl, halogenated alkyl, or heterocycloalkyl group. Suitable alkoxy groups include methoxy, ethoxy, n-propoxy, i-propoxy, n-butoxy, i-butoxy, sec-butoxy, tert-butoxy cyclopropoxy, cyclohexyloxy, and the like.
The term “alkyl” refers to a branched or unbranched saturated hydrocarbon group of 1 to 24 carbon atoms, such as methyl, ethyl, n-propyl, isopropyl, n-butyl, isobutyl, t-butyl, pentyl, hexyl, heptyl, octyl, decyl, tetradecyl, hexadecyl, eicosyl, tetracosyl and the like. A “lower alkyl” group is a saturated branched or unbranched hydrocarbon having from 1 to 10 carbon atoms. Alkyl groups may be substituted alkyls wherein one or more hydrogen atoms are substituted with a substituent such as halogen, cycloalkyl, alkoxy, amino, hydroxyl, aryl, or carboxyl. For example, an “alkoxyalkyl” has the structure —ROR, wherein R is an alkyl group.
The term “aryl” refers to any carbon-based aromatic group including, but not limited to, benzyl, naphthyl, etc. The term “aromatic” also includes “heteroaryl group,” which is defined as an aromatic group that has at least one heteroatom incorporated within the ring of the aromatic group. Examples of heteroatoms include, but are not limited to, nitrogen, oxygen, sulfur, and phosphorous. The aryl group can be optionally substituted with one or more groups including, but not limited to, alkyl, alkynyl, alkenyl, aryl, halide, nitro, amino, ester, ketone, aldehyde, hydroxy, carboxylic acid, or alkoxy, or the aryl group can be unsubstituted.
The term “heteroaryl” refers to a mono- or poly-cyclic (e.g., bi-, or tri-cyclic or more) fused or non-fused, radical or ring system having at least one aromatic ring, having from five to ten ring atoms of which one ring atom is selected from S, O and N; zero, one or two ring atoms are additional heteroatoms independently selected from S, O and N, and the remaining ring atoms are carbon. Heteroaryl includes, but is not limited to, pyridinyl, pyrazinyl, pyrimidinyl, pyrrolyl, pyrazolyl, imidazolyl, thiazolyl, oxazolyl, isooxazolyl, thiadiazolyl, oxadiazolyl, thiophenyl, furanyl, quinolinyl, isoquinolinyl, benzimidazolyl, benzooxazolyl, quinoxalinyl, and the like.
The term “derivative” refers to a compound or portion of a compound that is derived from or is theoretically derivable from a parent compound.
The term “pharmaceutically acceptable salt or ester” refers to salts or esters prepared by conventional means that include basic salts of inorganic and organic acids, including but not limited to hydrochloric acid, hydrobromic acid, sulfuric acid, phosphoric acid, methanesulfonic acid, ethanesulfonic acid, malic acid, acetic acid, oxalic acid, tartaric acid, citric acid, lactic acid, fumaric acid, succinic acid, maleic acid, salicylic acid, benzoic acid, phenylacetic acid, mandelic acid and the like. “Pharmaceutically acceptable salts” of the presently disclosed compounds also include those formed from cations such as sodium, potassium, aluminum, calcium, lithium, magnesium, zinc, and from bases such as ammonia, ethylenediamine, N-methyl-glutamine, lysine, arginine, ornithine, choline, N,N′-dibenzylethylenediamine, chloroprocaine, diethanolamine, procaine, N-benzylphenethylamine, diethylamine, piperazine, tris(hydroxymethyl)aminomethane, and tetramethylammonium hydroxide. These salts may be prepared by standard procedures, for example by reacting the free acid with a suitable organic or inorganic base. Any chemical compound recited in this specification may alternatively be administered as a pharmaceutically acceptable salt thereof. “Pharmaceutically acceptable salts” are also inclusive of the free acid, base, and zwitterionic forms. Descriptions of suitable pharmaceutically acceptable salts can be found in Handbook of Pharmaceutical Salts, Properties, Selection and Use, Wiley VCH (2002). When compounds disclosed herein include an acidic function such as a carboxy group, then suitable pharmaceutically acceptable cation pairs for the carboxy group are well known to those skilled in the art and include alkaline, alkaline earth, ammonium, quaternary ammonium cations and the like. Such salts are known to those of skill in the art. For additional examples of “pharmacologically acceptable salts,” see Berge et al., J. Pharm. Sci. 66:1 (1977). “Pharmaceutically acceptable esters” includes those derived from compounds described herein that are modified to include a hydroxy or a carboxyl group. An in vivo hydrolysable ester is an ester, which is hydrolysed in the human or animal body to produce the parent acid or alcohol. Suitable pharmaceutically acceptable esters for carboxy include C1-6 alkoxymethyl esters for example methoxy-methyl, C1-6 alkanoyloxymethyl esters for example pivaloyloxymethyl, phthalidyl esters, C3-8 cycloalkoxycarbonyloxy C1-6alkyl esters for example 1-cyclohexylcarbonyl-oxyethyl; 1,3-dioxolen-2-onylmethyl esters for example 5-methyl-1,3-dioxolen-2-onylmethyl; and C1.6 alkoxycarbonyloxyethyl esters for example 1-methoxycarbonyl-oxyethyl which may be formed at any carboxy group in the compounds.
In some embodiments relating to a small molecule inhibitor that binds RUNX1, the small molecule inhibitor comprises Ro5-3335, Ro24-7429, NSC140873, MILS000548294, MLS001048862, or NSC156594. See, e.g., Cunningham et al. (2012) Proc Natl Acad Sci USA, 109(36): 14592-14597 and U.S. Patent Application Publication No. 2014/0004082, the entire contents of each of which are incorporated herein by reference. Additional examples of RUNX1 inhibitors are described in U.S. Pat. Nos. 5,641,773; 5,164,376; 5,141,735; 5,041,438; 5,036,101; and 3,405,122, as well as U.S. Patent Application Publication No. 2014/0004082, the entire contents of each of which are hereby incorporated herein by reference.
Ro5-3335 has the following structure:
The CAS Registry Number for Ro5-3335 is 30195-30-3.
Ro24-7429 has the following structure:
The CAS Registry Number for Ro24-7429 is 139339-45-0. Additional non-limiting descriptions showing that Ro24-7429 was found to be safe in a clinical trial relating to human immunodeficiency virus (HIV) treatment are provided in Haubrich et al. (1995) J Infect Dis. 172(5):1246-52, the entire content of which is incorporated herein by reference.
NSC140873 has the following structure:
The CAS Registry Number for NSC140873 is 106410-13-3.
MLS000548294 has the following structure:
The PubChem ID for MLS000548294 is 768985.
MLS001048862 has the following structure:
The PubChem ID for MLS001048862 is 2772042.
NSC156594 has the following structure:
The PubChem ID for NSC156594 is 457993.
The synthesis of several of the compounds disclosed above and analogs thereof have been previously described, for example, in U.S. Pat. Nos. 5,641,773; 5,164,376; 5,141,735; 5,041,438; 5,036,101; and 3,405,122, the entire contents of each of which are incorporated herein by reference.
In some embodiments, the RUNX1 inhibitor inhibits RUNX1 via inhibition of CBFβ, which is the transcriptional partner of RUNX1. In certain embodiments, the CBFβ inhibitor is a pyridyl benzimidazole.
Non-limiting examples of CBFβ inhibitors include:
Non-limiting descriptions of CBFβ inhibitors and aspects thereof are described in Illendula et al. (2016) EBioMedicine 8: 117-131, the entire content of which is incorporated herein by reference. In some embodiments, the CBFβ inhibitor is
In various embodiments, the RUNX1 inhibitor is a gamma-secretase inhibitor or modulator. In some embodiments, the gamma-secretase inhibitor reduces the expression of RUNX1. In certain embodiments, the gamma-secretase inhibitor is Compound E. The molecular formula for Compound E is C27H24F2N4O3. Compound E has the following structure and is commercially available from Cayman Chemical (Ann Arbor, Mich., USA; Item No. 15579; CAS No. 209986-17-4):
Additional non-limiting examples of gamma-secretase inhibitors include PF-3084014, MK-0752, R04929079, Semagacestat, BMS-906024, DAPT, and LY411575. Details regarding these inhibitors are described in Ran et al. (2017) EMBO Molecular Medicine, 9: 950-966, the entire content of which is incorporated herein by reference. The structures of these inhibitors are as follows:
In various embodiments, the PIM3 inhibitor is a small molecule inhibitor. Non-limiting examples of small molecule PIM3 inhibitors include AZD1208, CX-6258, SGI-1776, and M-110.
AZD1208 has the following structure:
The CAS Registry Number for AZD1208 is 1204144-28-4. The molecular formula for AZD1208 is C21H21N3O2S. AZD1208 is commercially available from several sources, including Selleck Chemicals (Houston, Tex., USA).
CX-6258 HCl has the following structure:
The CAS Registry Number for CX-6258 is 1353859-00-3.
SGI-1776 has the following structure:
The CAS Registry Number for SGI-1776 is 1025065-69-3.
M-110 has the following structure:
Synonyms for M-110 include N′-(1-(4-Chloro-2-hydroxyphenyl)propylidene)-2-((3-morpholinopropyl)amino)isonicotinohydrazide and PIM3 kinase inhibitor VII. M-110 is available from, e.g., EMD Millipore (Billerica Mass. USA; Cat. No. 526526). Non-limiting descriptions relating to M-110 are provided in Chang, M., et al. 2010. Mol. Cancer Ther. 9, 2478-2487, the entire content of which is incorporated herein by reference.
Additional non-limiting examples of PIM3 inhibitors are described in U.S. Pat. No. 8,053,454, issued Nov. 8, 2011; U.S. Patent Application Publication No. 20140249135, published Sep. 4, 2014; and Nakano et al. Bioorg Med Chem Lett. 2015 Dec. 15; 25(24):5687-93, the entire contents of each of which are incorporated herein by reference in their entireties.
In some embodiments, the PIM3 inhibitor inhibits PIM3 as well as PIM1 and/or PIM2. In certain embodiments, the PIM3 inhibitor inhibits PIM3 as well as PIM1. In various embodiments, the PIM3 inhibitor inhibits PIM3 as well as PIM2. In some embodiments, the PIM3 inhibitor inhibits PIM3 as well as PIM1 and PIM2. In certain embodiments, the PIM3 inhibitor is a pan-PIM inhibitor.
Non-limiting examples of pan-PIM inhibitors such as N-substituted 7-azaindoles that may be used as PIM3 inhibitors are described in Barberis et al. (2017) Bioorganic & Medicinal Chemistry Letters 27:4735-4740, and include:
The entire content of Barberis et al. (2017) Bioorganic & Medicinal Chemistry Letters 27:4735-4740 is incorporated herein by reference.
Additional non-limiting example of PIM inhibitors that can be used as PIM3 inhibitors include:
These and other PIM inhibitors that may be used as PIM3 inhibitors are described in Wang et al. (2017) J. Med. Chem. 60, 4458-4473, the entire content of which is incorporated herein by reference.
Non-limiting examples of PIM inhibitors that may be used as PIM3 inhibitors also include:
These and other PIM inhibitors that may be used as PIM3 inhibitors are described in Bataille et al. (2017) Bioorganic & Medicinal Chemistry 25:2657-2665, the entire content of which is incorporated herein by reference.
Additional non-limiting examples of PIM inhibitors that may be used as PIM3 inhibitors include:
which are described together with others in Pettus et al. (2016) J. Med. Chem. 59, 6407-6430, the entire content of which is incorporated herein by reference.
In various embodiments, a PIM3 inhibitor is co-administered with an USP7 inhibitor. Non-limiting aspects and descriptions of USP7 inhibitors are described in Kategaya et al. (2017) Nature, 550:534-538, the entire content of which (including all supplemental information and data) is incorporated herein by reference. Examples of USP7 inhibitors shown in Kategaya a et al. 2017 include:
Proteins and Peptides
In some embodiments, a protein, peptide, or a fragment thereof is used to inhibit RUNX1 or PIM3. A non-limiting example of such an inhibitor for RUNX1 is a dominant negative CBF-Beta protein (CBFB-MYH11). See, e.g., Castilla et al. (1996) (Cell. 1996; 87:687-696, the entire content of which is hereby incorporated herein by reference.
Aptamers
Aptamers are small, single stranded biomolecules, typically oligonucleotides (either DNA or RNA) or peptides, that bind to a specific target molecule (e.g. a protein or small molecule such as a steroid). They can be considered analogous to antibodies in their specificity but, unlike antibodies, aptamers are have a relatively low molecular weight. Peptide-based aptamers are generally less than thirty residues long while nucleotide-based aptamers are typically less than one hundred residues long.
Non-limiting examples of methods that are useful for designing aptamers that target a particular protein, such as RUNX1 or PIM3, are described in U.S. Pat. Nos. 8,484,010; 5,582,981; PCT International Patent Application No. WO 2015/049356; Blackwell et al., (1993) Science 250:1104-1110; Blackwell, et al., (1990) Science 250:1149-1152; Tuerk and Gold (1990) Science 249:505-510; and Joyce (1989) Gene 82:83-87, the entire contents of each of which are incorporated herein by reference.
Antisense Oligonucleotides
As used herein, an “antisense oligonucleotide” is an oligonucleotide that inhibits gene expression by a mechanism other than RNAi. Non-limiting examples of antisense oligonucleotides which decrease the amount of RUNX1 or PIM3 produced by cells that can be employed in the methods described herein include antisense oligonucleotides that are complementary (e.g., at least about 90, 95, 96, 97, 98, 99, or 100% complementary) to a stretch of at least about 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29 or 30 consecutive nucleotides having a sequence found within a nucleotide sequence that encodes RUNX1 or PIM3, such as any of the RUNX1- or PIM3-encoding nucleotide sequences disclosed herein.
Antisense oligonucleotides comprise nucleotide sequences which are complementary to a specific DNA or RNA sequence. Once introduced into a cell, the complementary nucleotides combine with natural sequences produced by the cell to form complexes and block either transcription or translation. Preferably, an antisense oligonucleotide is at least 11 nucleotides in length, but can be at least 12, 15, 20, 25, 30, 35, 40, 45, or 50 or more nucleotides long. Longer sequences also can be used. Antisense oligonucleotide molecules can be provided in a DNA construct and introduced into a cell as described above to decrease the level of RUNX1 or PIM3 gene products in the cell.
Antisense oligonucleotides can comprise deoxyribonucleotides, ribonucleotides, or a combination of both. Antisense oligonucleotides can be synthesized manually or by an automated synthesizer, by covalently linking the 5′ end of one nucleotide with the 3′ end of another nucleotide with non-phosphodiester internucleotide linkages such alkylphosphonates, phosphorothioates, phosphorodithioates, alkylphosphonothioates, alkylphosphonates, phosphoramidates, phosphate esters, carbamates, acetamidate, carboxymethyl esters, carbonates, and phosphate triesters.
Modifications of gene expression can be obtained by designing antisense oligonucleotides which will form duplexes to the control, 5′, or regulatory regions of the gene. Antisense oligonucleotides that target the transcription initiation site, e.g., between positions −10 and +10 from the start site, are used in some embodiments. Similarly, inhibition can be achieved using “triple helix” base-pairing methodology. Triple helix pairing is useful because it causes inhibition of the ability of the double helix to open sufficiently for the binding of polymerases, transcription factors, or chaperons. Therapeutic advances using triplex DNA have been described in the literature (Nicholls et al., 1993, J Immunol Meth 165:81-91). Antisense oligonucleotides that are complementary to a sequence that includes the translational start site, and/or that are complementary to a portion of a target mRNA within 10 nucleotides of the translational start site, are used in various embodiments.
An antisense oligonucleotide also can be designed to block translation of mRNA by preventing the transcript from binding to ribosomes Precise complementarity is not required for successful complex formation between an antisense oligonucleotide and the complementary sequence of a RUNX1 or PIM3 polynucleotide. Antisense oligonucleotides which comprise, for example, 2, 3, 4, or 5 or more stretches of contiguous nucleotides which are precisely complementary to a RUNX1 or PIM3 polynucleotide, each separated by a stretch of contiguous nucleotides which are not complementary to adjacent RUNX1 or PIM3 nucleotides, can provide sufficient targeting specificity for RUNX1 or PIM3 mRNA. In some embodiments, each stretch of complementary contiguous nucleotides is at least 4, 5, 6, 7, or 8 or more nucleotides in length. Noncomplementary intervening sequences may be, e.g., 1, 2, 3, or 4 nucleotides in length. One skilled in the art can easily use the calculated melting point of an antisense-sense pair to determine the degree of mismatching which will be tolerated between a particular antisense oligonucleotide and a particular RUNX1 or PIM3 polynucleotide sequence. Antisense oligonucleotides can be modified without affecting their ability to hybridize to a RUNX1 or PIM3 polynucleotide. These modifications can be internal or at one or both ends of the antisense molecule. For example, internucleoside phosphate linkages can be modified by adding cholesteryl or diamine moieties with varying numbers of carbon residues between the amino groups and terminal ribose. Modified bases and/or sugars, such as arabinose instead of ribose, or a 3′ or 5′-substituted oligonucleotide in which the 3′ hydroxyl group and/or the 5′ phosphate group is substituted, also can be employed in a modified antisense oligonucleotide. These modified antisense oligonucleotides can be prepared by methods well known in the art.
Ribozymes
Ribozymes are RNA molecules with catalytic activity (Uhlmann et al., 1987, Tetrahedron. Lett. 215, 3539-3542). Ribozymes can be used to inhibit gene function by cleaving an RNA sequence, as is known in the art. The mechanism of ribozyme action involves sequence-specific hybridization of the ribozyme molecule to complementary target RNA, followed by endonucleolytic cleavage. Examples include engineered hammerhead motif ribozyme molecules that can specifically and efficiently catalyze endonucleolytic cleavage of specific nucleotide sequences. The coding sequence of a polynucleotide can be used to generate ribozymes which will specifically bind to mRNA transcribed from the polynucleotide. Methods of designing and constructing ribozymes which can cleave other RNA molecules in trans in a highly sequence specific manner have been developed and described in the art. For example, the cleavage activity of ribozymes can be targeted to specific RNAs by engineering a discrete “hybridization” region into the ribozyme. The hybridization region contains a sequence complementary to the target RNA and thus specifically hybridizes with the target RNA.
Specific ribozyme cleavage sites within an RNA target can be identified by scanning the target molecule for ribozyme cleavage sites which include the following sequences: GUA, GUU, and GUC. Once identified, short RNA sequences of between 15 and 20 ribonucleotides corresponding to the region of the target RNA containing the cleavage site can be evaluated for secondary structural features which may render the target inoperable. Suitability of candidate RNA targets also can be evaluated by testing accessibility to hybridization with complementary oligonucleotides using ribonuclease protection assays. The nucleotide sequences shown in SEQ ID NOs: 12-22 and 27-30 and their complements provide sources of suitable hybridization region sequences. Longer complementary sequences can be used to increase the affinity of the hybridization sequence for the target. The hybridizing and cleavage regions of the ribozyme can be integrally related such that upon hybridizing to the target RNA through the complementary regions, the catalytic region of the ribozyme can cleave the target.
Ribozymes can be introduced into cells as part of a DNA construct. Mechanical methods, such as microinjection, liposome-mediated transfection, electroporation, or calcium phosphate precipitation, can be used to introduce a ribozyme-containing DNA construct into cells in which it is desired to decrease RUNX1 or PIM3 expression. Alternatively, if it is desired that the cells stably retain the DNA construct, the construct can be supplied on a plasmid and maintained as a separate element or integrated into the genome of the cells, as is known in the art. A ribozyme-encoding DNA construct can include transcriptional regulatory elements, such as a promoter element, an enhancer element, and a transcriptional terminator signal, for controlling transcription of ribozymes in the cells (U.S. Pat. No. 5,641,673). Ribozymes also can be engineered to provide an additional level of regulation, so that destruction of mRNA occurs only when both a ribozyme and a target gene are induced in the cells.
RNA Interference
As used herein, an “RNA interference” inducing compound refers to a compound capable of inducing RNA interference or “RNAi” of target gene (e.g., RUNX1 or PIM3) expression, depending on the context. RNAi involves mRNA degradation. The use of RNAi has been described in Fire et al. (1998) Nature 19; 391(6669).806-11, Elbashir et al. (2001) EMBO J. 20(23); 6877-6888, and Cheloufi et al. (2010) Nature 465, 584-589, the entire contents of each of which are incorporated herein by reference.
Isolated RNA molecules can mediate RNAi. That is, the isolated RNA molecules of the present subject matter mediate degradation or block expression of mRNA that is the transcriptional product of the gene, which is also referred to as a target gene. For convenience, such mRNA may also be referred to herein as mRNA to be degraded. RNAi molecules may be, e.g., double-stranded RNA, small interfering RNA (siRNA), hairpin RNA, microRNA molecules which may be altered compared to naturally occurring RNA by the addition, deletion, substitution and/or alteration of one or more nucleotides. Such alterations can include addition of non-nucleotide material, such as to the end(s) of the RNA or internally (at one or more nucleotides of the RNA). Nucleotides in the RNA molecules of the present invention can also comprise nonstandard nucleotides, including non-naturally occurring nucleotides or deoxyribonucleotides. Collectively, all such altered RNAi molecules may be referred to as analogs or analogs of naturally-occurring RNA. RNA of the present invention need only be sufficiently similar to natural RNA that it has the ability to mediate RNAi.
As used herein the phrase “mediate RNAi” refers to and indicates the ability to distinguish which mRNA molecules are to be afflicted with the RNAi machinery or process. RNA that mediates RNAi interacts with the RNAi machinery such that it directs the machinery to degrade particular mRNAs or to otherwise reduce the expression of the target protein. In some embodiments, the present invention relates to RNA molecules that direct cleavage of specific mRNA to which their sequence corresponds. It is not necessary that there be perfect correspondence of the sequences, but the correspondence must be sufficient to enable the RNA to direct RNAi inhibition by cleavage or blocking expression of the target mRNA. In some embodiments, an RNAi molecule comprises a stretch of about 16 to 29, 18 to 23, 21-23, or at least 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, or 25 nucleotides having a sequence that is at least about 90, 95, 96, 97, 98, 99, or 100% complementary to a target sequence. As noted above, the RNA molecules of the present invention may comprise an RNA portion and some additional portion, for example a deoxyribonucleotide portion.
Antibodies
In some embodiments, the RUNX1 or PIM3 inhibitor is an antibody or a fragment thereof.
As used herein, the term “antibody” refers to immunoglobulin molecules and immunologically active portions of immunoglobulin (Ig) molecules, i.e., molecules that contain an antigen binding site that specifically binds (immunoreacts with) an antigen. Such antibodies include, but are not limited to, polyclonal, monoclonal, chimeric, single chain, Fab, Fab′ and F(ab′)2 fragments, an Fab expression library, single-chain antibody molecules (e.g., scFv), and multispecific antibodies formed from antibody fragments. By “specifically bind” or “immunoreacts with” is meant that the antibody reacts with one or more antigenic determinants of the desired antigen and does not react (i.e., bind) with other polypeptides or binds at much lower affinity (Kd>10−6) with other polypeptides.
An “antibody fragment” refers to a molecule other than an intact antibody that comprises a portion of an intact antibody that binds the antigen to which the intact antibody binds. The terms “full length antibody,” “intact antibody,” and “whole antibody” are used herein interchangeably to refer to an antibody having a structure substantially similar to a native antibody structure or having heavy chains that contain an Fc region.
The basic antibody structural unit is known to comprise a tetramer. Each tetramer is composed of two identical pairs of polypeptide chains, each pair having one “light” (about 25 kDa) and one “heavy” chain (about 50-70 kDa). The amino-terminal portion of each chain includes a variable region of about 100 to 110 or more amino acids primarily responsible for antigen recognition. The carboxy-terminal portion of each chain defines a constant region primarily responsible for effector function. Human light chains are classified as kappa and lambda light chains. Heavy chains are classified as mu, delta, gamma, alpha, or epsilon, and define the antibody's isotype as IgM, IgD, IgA, and IgE, respectively. Within light and heavy chains, the variable and constant regions are joined by a “J” region of about 12 or more amino acids, with the heavy chain also including a “D” region of about 10 more amino acids. See generally, Fundamental Immunology Ch. 7 (Paul, W., ea., 2nd ed. Raven Press, N.Y. (1989)). The variable regions of each light/heavy chain pair form the antibody binding site.
In general, antibody molecules obtained from humans relate to any of the classes IgG, IgM, IgA, IgE and IgD, which differ from one another by the nature of the heavy chain present in the molecule. Certain classes have subclasses as well, such as IgG1, IgG2, and others. Furthermore, in humans, the light chain may be a kappa chain or a lambda chain.
The term “antigen-binding site” or “binding portion” refers to the part of the immunoglobulin molecule that participates in antigen binding. The antigen binding site is formed by amino acid residues of the N-terminal variable (“V”) regions of the heavy (“H”) and light (“L”) chains. Three highly divergent stretches within the V regions of the heavy and light chains, referred to as “hypervariable regions,” are interposed between more conserved flanking stretches known as “framework regions,” or “FRs.” Thus, the term “FR” refers to amino acid sequences which are naturally found between, and adjacent to, hypervariable regions in immunoglobulins. In an antibody molecule, the three hypervariable regions of a light chain and the three hypervariable regions of a heavy chain are disposed relative to each other in three dimensional space to form an antigen-binding surface. The antigen-binding surface is complementary to the three-dimensional surface of a bound antigen, and the three hypervariable regions of each of the heavy and light chains are referred to as “complementarity-determining regions,” or “CDRs.” The assignment of amino acids to each domain is in accordance with the definitions of Kabat Sequences of Proteins of Immunological Interest (National Institutes of Health, Bethesda, Md. (1987 and 1991)), or Chothia & Lesk J. Mol. Biol. 196:901-917 (1987), Chothia et al. Nature 342:878-883 (1989).
An “Fv” fragment is an antibody fragment which contains a complete antigen recognition and binding site. This region consists of a dimer of one heavy and one light chain variable domain in tight association, which can be covalent in nature, for example in scFv. It is in this configuration that the three hypervariable regions (HVRs) of each variable domain interact to define an antigen binding site on the surface of the VH-VL dimer. Collectively, the six HVRs or a subset thereof confer antigen binding specificity to the antibody. However, even a single variable domain (or half of an Fv comprising only three HVRs specific for an antigen) has the ability to recognize and bind antigen, although usually at a lower affinity than the entire binding site.
A “Fab” fragment contains a variable and constant domain of the light chain and a variable domain and the first constant domain (CHI) of the heavy chain. F(ab′) 2 antibody fragments comprise a pair of Fab fragments which are generally covalently linked near their carboxy termini by hinge cysteines between them. Other chemical couplings of antibody fragments are also known in the art,
“Single-chain Fv” or “scFv” antibody fragments comprise the VH and VL domains of an antibody, wherein these domains are present in a single polypeptide chain. Generally the Fv polypeptide further comprises a polypeptide linker between the VH and L domains, which enables the scFv to form the desired structure for antigen binding. For a review of scFv, see Pluckthun in The Pharmacology of Monoclonal Antibodies, Vol 113, Rosenburg and Moore eds. Springer-Verlag, New York, pp. 269-31S (1994).
The term “diabodies” refers to small antibody fragments with two antigen-binding sites, which fragments comprise a heavy chain variable domain (VH) connected to a light chain variable domain (VL) in the same polypeptide chain (VH and VL). By using a linker that is too short to allow pairing between the two domains on the same chain, the domains are forced to pair with the complementary domains of another chain and create two antigen-binding sites. Diabodies are described more fully in, for example, BP 404,097; WO 93/11161; and Hollinger et al., Proc. Natl. Acad. Sci. USA, 90:6444-6448 (1993).
The expression “linear antibodies” refers to the antibodies described in Zapata et al., Protein Eng., 8 (10): 1057-1062 (1995) Briefly, these antibodies comprise a pair of tandem segments which, together with complementary light chain polypeptides, form a pair of antigen binding regions. Linear antibodies can be bispecific or monospecific.
The term “monoclonal antibody” as used herein refers to an antibody obtained from a population of substantially homogeneous antibodies, i.e., the individual antibodies comprising the population are identical and/or bind the same epitope, except for possible variant antibodies, e.g., containing naturally occurring mutations or arising during production of a monoclonal antibody preparation, such variants generally being present in minor amounts. In contrast to polyclonal antibody preparations, which typically include different antibodies directed against different determinants (epitopes), each monoclonal antibody of a monoclonal antibody preparation is directed against a single determinant on an antigen. Thus, the modifier “monoclonal” indicates the character of the antibody as being obtained from a substantially homogeneous population of antibodies, and is not to be construed as requiring production of the antibody by any particular method. For example, the monoclonal antibodies to be used may be made by a variety of techniques, including but not limited to the hybridoma method, recombinant DNA methods, phage-display methods, and methods utilizing transgenic animals containing all or part of the human immunoglobulin loci, such methods and other exemplary methods for making monoclonal antibodies being described herein.
As used herein, the term “epitope” includes any protein determinant capable of specific binding to an antibody, an antibody fragment, or a T-cell receptor. Epitopic determinants usually consist of chemically active surface groupings of molecules such as amino acids or sugar side chains and usually have specific three dimensional structural characteristics, as well as specific charge characteristics. An antibody is said to specifically bind an antigen when the dissociation constant is ≤1 μM; preferably ≤100 nM and most preferably ≤10 nM.
Antibodies can be produced according to any method known in the art.
Methods of preparing monoclonal antibodies are known in the art. For example, monoclonal antibodies may be prepared using hybridoma methods, such as those described by Kohler and Milstein (1975) Nature 256:495. In a hybridoma method, a mouse, hamster, or other appropriate host animal, is typically immunized with an immunizing agent to elicit lymphocytes that produce or are capable of producing antibodies that will specifically bind to the immunizing agent. Alternatively, the lymphocytes may be immunized in vitro. The immunizing agent will typically include a full length protein or a fragment thereof. Generally, either peripheral blood lymphocytes (“PBLs”) are used if cells of human origin are desired, or spleen cells or lymph node cells are used if non-human mammalian sources are desired. The lymphocytes are then fused with an immortalized cell line using a suitable fusing agent, such as polyethylene glycol, to form a hybridoma cell (see pp. 59-103 in Goding (1986) Monoclonal Antibodies: Principles and Practice Academic Press). Immortalized cell lines are usually transformed mammalian cells, particularly myeloma cells of rodent, bovine and human origin. Usually, rat or mouse myeloma cell lines are employed. The hybridoma cells may be cultured in a suitable culture medium that preferably contains one or more substances that inhibit the growth or survival of the unfused, immortalized cells. For example, if the parental cells lack the enzyme hypoxanthine guanine phosphoribosyl transferase (HGPRT or HPRT), the culture medium for the hybridomas typically will include hypoxanthine, aminopterin, and thymidine (“HAT medium”), which substances prevent the growth of HGPRT-deficient cells.
In some examples, the antibodies to an epitope for an interested protein as described herein or a fragment thereof are humanized antibodies. Humanized forms of non-human (e.g., murine) antibodies are chimeric molecules of immunoglobulins, immunoglobulin chains or fragments thereof (such as Fv, Fab, Fab′, F(ab′)2 or other antigen-binding subsequences of antibodies) which contain minimal sequence derived from non-human immunoglobulin. Humanized antibodies include human immunoglobulins (recipient antibody) in which residues from a complementary determining region (CDR) of the recipient are replaced by residues from a CDR of a non-human species (donor antibody) such as mouse, rat or rabbit having the desired specificity, affinity and capacity. In some instances, Fv framework residues of the human immunoglobulin are replaced by corresponding non-human residues. Humanized antibodies may also comprise residues which are found neither in the recipient antibody nor in the imported CDR or framework sequences. In general, a humanized antibody will comprise substantially all of at least one, and typically two, variable domains, in which all or substantially all of the CDR regions correspond to those of a non-human immunoglobulin and all or substantially all of the framework (FR) regions are those of a human immunoglobulin consensus sequence. The humanized antibody optimally also will comprise at least a portion of an immunoglobulin constant region (Fc), typically that of a human immunoglobulin (Jones et al. 1986. Nature 321:522-525; Riechmann et al 1988 Nature 332:323-329; Presta 1992. Curr. Op. Stnuct. Biol 2:593-596). Humanization can be essentially performed following methods of Winter and co-workers (see, e.g., Jones et al. 1986. Nature 321.522-525, Riechmann et al. 1988. Nature 332:323-327; and Verhoeyen et al. 1988. Science 239:1534-1536), by substituting rodent CDRs or CDR sequences for the corresponding sequences of a human antibody. Accordingly, such humanized antibodies are chimeric antibodies (e.g., U.S. Pat. No. 4,816,567), wherein substantially less than an intact human variable domain has been substituted by the corresponding sequence from a non-human species.
In various examples the antibodies to an epitope of an interested protein as described herein or a fragment thereof are human antibodies. Human antibodies can also be produced using various techniques known in the art, including phage display libraries (Hoogenboom and Winter. 1991. J. Mol. Biol. 227:381-388; Marks et al. 1991. J. Mol. Biol. 222:581-597) or the preparation of human monoclonal antibodies [e.g., Cole et al. 1985. Monoclonal Antibodies and Cancer Therapy Liss; Boerner et al. 1991. J. Immunol. 147(1):86-95]. Similarly, human antibodies can be made by introducing human immunoglobulin loci into transgenic animals, e.g., mice in which the endogenous immunoglobulin genes have been partially or completely inactivated. Upon challenge, human antibody production is observed, which closely resembles that seen in humans in most respects, including gene rearrangement, assembly, and antibody repertoire. This approach is described, e.g., in U.S. Pat. Nos. 5,545,807; 5,545,806; 5,569,825, 5,625,126, 5,633,425; 5,661,016, and in the following scientific publications: Marks et al. 1992. Bio/Technology 10:779-783; Lonberg et al. 1994. Nature 368:856-859; Morrison. 1994. Nature 368:812-13; Fishwild et al. 1996. Nature Biotechnology 14:845-51; Neuberger. 1996. Nature Biotechnology 14:826; Lonberg and Huszar. 1995. Intern. Rev. Immunol. 13:65-93. U.S. Pat. No. 6,719,971 also provides guidance to methods of generating humanized antibodies.
In some embodiments, an intrabody is used to inhibit RUNX1 or PIM3. An “intrabody” (from intracellular and antibody) is an antibody that works within the cell to bind to an intracellular antigen. Intrabodies typically lack disulfide bonds and are capable of modulating the expression or activity of target genes through their specific binding activity. Intrabodies include single domain fragments such as isolated VH and VL domains and scFvs. An intrabody can include sub-cellular trafficking signals attached to the N or C terminus of the intrabody to allow expression at high concentrations in the sub-cellular compartments where a target protein is located. Upon interaction with a target gene, an intrabody modulates target protein function and/or achieves phenotypic/functional knockout by mechanisms such as accelerating target protein degradation and sequestering the target protein in a non-physiological sub-cellular compartment. Other mechanisms of intrabody-mediated gene inactivation can depend on the epitope to which the intrabody is directed, such as binding to the catalytic site on a target protein or to epitopes that are involved in protein-protein, protein-DNA, or protein-RNA interactions. In various embodiments, the intrabody is expressed within a target cell, e.g., by a viral or plasmid expression vector that has been introduced into the target cell. An intrabody may remain in the cytoplasm, or it may have a nuclear localization signal, or it may undergo cotranslational translocation across the membrane into the lumen of the endoplasmic reticulum, provided that it is retained in that compartment through a KDEL sequence. Because antibodies ordinarily are designed to be secreted from the cell, intrabodies require special alterations, including the use of single-chain antibodies (scFvs), modification of immunoglobulin VL domains for hyperstability, selection of antibodies resistant to the more reducing intracellular environment, or expression as a fusion protein with maltose binding protein or other stable intracellular proteins. Non-limiting aspects of intrabodies are described, e.g., in U.S. Pat. No. 9,133,269; U.S. Patent Application Publication No. 2006/0034834; Chen et al. (1994) Human gene therapy 5 (5): 595-601; and Shaki-Loewenstein et al. (2005) Journal of immunological methods 303 (1-2): 19-39, the entire contents of each of which are incorporated herein by reference.
Exemplary antibodies against RUNX1 include, but are not limited to, antibodies obtained from Abcam (Cambridge, Mass., USA) (e.g., Cat. Nos. ab23980, ab35962, ab189172, ab189153, and ab91002), antibodies obtained from Novus Biologicals (Littleton, Colo., USA) (e.g., Cat. Nos. NBP1-89105, H00000861-M05, H00000861-M06, MAB2399, and H00000861-M02), and antibodies obtained from ThermoFisher Scientific (Cambridge, Mass., USA) (e.g., 710233, MA5-15814, PAI-41078, OSR00271W, PA5-17434, PA5-19638, PA5-12409, PA5-40076, and PA5-17351).
Exemplary antibodies against PIM3 include, but are not limited to, antibodies obtained from Abcam (Cambridge, Mass., USA) (e.g., Cat. Nos. ab71321, ab198842, and ab108920), and antibodies obtained from ThermoFisher Scientific (Cambridge, Mass., USA) (e.g., Cat. No. PA5-13976).
Exemplary antibodies against IGFBP3 include, but are not limited to, antibodies obtained from Abcam (Cambridge, Mass., USA) (e.g., Cat. Nos. ab76001, ab4248, ab111931, and ab109790), and antibodies obtained from ThermoFisher Scientific (Cambridge, Mass., USA) (e.g., Cat. No. MA 1-20185).
Gene Therapy
In some embodiments, a gene editing method is used to modulate (e.g., reduce) RUNX1 and/or PIM3 expression and/or activity. In certain embodiments, a gene editing method is used to modulate (e.g., increase) IGFBP3 expression and/or activity. Non-limiting examples of gene editing systems useful in such embodiments include the clustered regularly interspaced short palindromic repeat (CRISPR)-Cas system; zinc finger nuclease (ZFN) systems, and transcription activator-like effector-based nuclease (TALEN) systems.
Exemplary aspects of the CRISPR-Cas system are described in, e.g., U.S. Pat. No. 9,023,649, issued May 5, 2015; U.S. Pat. No. 9,074,199, issued Jul. 7, 2015; and U.S. Pat. No. 8,697,359, issued Apr. 15, 2014 the entire contents of each of which are incorporated herein by reference.
With their highly flexible but specific targeting, CRISPR-Cas systems can be manipulated and redirected to become powerful tools for genome editing. CRISPR-Cas technology permits targeted gene cleavage and gene editing in a variety of eukaryotic cells, and editing can be directed to virtually any genomic locus. Exemplary CRISPR Cas genes include Cas1, Cas2, Cas3′, Cas3″, Cas4, Cas5, Cas6, Cas6e (formerly referred to as CasE, Cse3), Cas6f (i.e., Csy4), Cas7, Cas8a1, Cas8a2, Cas8b, Cas8c, Cas9, Cas10, Cas10d, Csy1, Csy2, CPf1, Csy3, Cse1, Cse2, Csc1, Csc2, Csa5, Csn2, Csm2, Csm3, Csm4, Csm5, Csm6, Cmr1, Cmr3, Cmr4, Cmr5, Cmr6, Csb1, Csb2, Csb3, Csx17, Csx14, Csx10, Csx16, CsaX, Csx3, Csx1, Csx15, Csf1, Csf2, Csf3, and Csf4. These enzymes are known; for example, the amino acid sequence of Streptococcus pyogenes Cas9 protein may be found in the SwissProt database under accession number Q99ZW2.
Non-limiting examples of sequences of Guide RNA for CRISPR-Cas9 targeting of RUNX1 are as follows:
RUNX1 guide RNAs: (20 bp) The proto-spacer adjacent motif (PAM) sequences are underlined.
| 1. | |
| (SEQ ID NO: 255) | |
| GATGAGCGAGGCGTTGCCGCTGG | |
| (exon1) | |
| 2. | |
| (SEQ ID NO: 256) | |
| TAGATGATCAGACEAAGCCCGGG | |
| (exon 4) | |
| 3. | |
| (SEQ ID NO: 257) | |
| TGGCAATGATGAAAACTACTCGG | |
| (exon 2) |
In the guide RNA sequences shown above, each T may optionally be a U.
Other non-limiting examples of approaches for gene editing include the use of zinc finger nucleases, which are artificial restriction enzymes generated by fusing a zinc finger DNA-binding domain to a DNA-cleavage domain. A zinc finger nuclease is a site-specific endonuclease designed to bind and cleave DNA at specific positions. There are two protein domains. The first domain is the DNA binding domain, which consists of eukaryotic transcription factors and contain the zinc finger. The second domain is the nuclease domain, which consists of the FokI restriction enzyme and is responsible for the catalytic cleavage of DNA. The DNA-binding domains of individual ZFNs typically contain between three and six individual zinc finger repeats and can each recognize between 9 and 18 basepairs. If the zinc finger domains are perfectly specific for their intended target site then even a pair of 3-finger ZFNs that recognize a total of 18 basepairs can, in theory, target a single locus in a mammalian genome. Various strategies have been developed to engineer Cys2His2 zinc fingers to bind desired sequences. These include both “modular assembly” and selection strategies that employ either phage display or cellular selection systems. The most straightforward method to generate new zinc-finger arrays is to combine smaller zinc-finger “modules” of known specificity. The most common modular assembly process involves combining three separate zinc fingers that can each recognize a 3 basepair DNA sequence to generate a 3-finger array that can recognize a 9 basepair target site. Other procedures can utilize either 1-finger or 2-finger modules to generate zinc-finger arrays with six or more individual zinc fingers. Numerous selection methods have been used to generate zinc-finger arrays capable of targeting desired sequences. Initial selection efforts utilized phage display to select proteins that bound a given DNA target from a large pool of partially randomized zinc-finger arrays. More recent efforts have utilized yeast one-hybrid systems, bacterial one-hybrid and two-hybrid systems, and mammalian cells. The non-specific cleavage domain from the type IIs restriction endonuclease FokI is typically used as the cleavage domain in ZFNs. This cleavage domain must dimerize in order to cleave DNA and thus a pair of ZFNs are required to target non-palindromic DNA sites. Standard ZFNs fuse the cleavage domain to the C-terminus of each zinc finger domain. In order to allow the two cleavage domains to dimerize and cleave DNA, the two individual ZFNs must bind opposite strands of DNA with their C-termini a certain distance apart. The most commonly used linker sequences between the zinc finger domain and the cleavage domain requires the 5′ edge of each binding site to be separated by 5 to 7 bp.
TALENs are restriction enzymes that can be engineered to cut specific sequences of DNA. They are made by fusing a TAL effector DNA-binding domain to a DNA cleavage domain. Transcription activator-like effectors (TALEs) can be engineered to bind practically any desired DNA sequence, so when combined with a nuclease, DNA can be cut at specific locations. The restriction enzymes can be introduced into cells, for use in gene editing or for genome editing in situ. Alongside zinc finger nucleases and CRISPR/Cas9, TALEN is a prominent tool in the field of genome editing.
NOTCH Signaling Inhibition
NOTCH signaling is an upstream regulator of the expression of Runx genes (Burns C E, et al., Genes and Development, 2005, 19:2331-2342). Modalities of treatment for aberrant angiogenesis conditions based on inhibition of the Notch receptors (NOTCH 1, NOTCH 2, NOTCH 3, NOTCH 4) and or any of their ligands (Delta like 1, Delta like 3, Delta like 4, Jagged 1 and Jagged 2) or other modulators of the NOTCH pathway operate via regulation of RUNX1. These modalities of treatment include inhibition or modulation of gamma-secretase, modulating antibodies against the receptors and the ligands, and other small molecules, biologicals and genetic approaches that inhibit RUNX1 expression via modulation of NOTCH signaling activity.
In some embodiments, a gamma-secretase inhibitor or modulator is used to modulate RUNX1 activity or expression.
In various embodiments, inhibition of any of the NOTCH receptors including NOTCH 1, NOTCH 2, NOTCH 3, and/or NOTCH 4, and/or any of the NOTCH ligands including Jagged 1, Jagged 2, Delta-like 1, Delta-like 3, Delta-like 4, and/or Delta like 5 may be used as means to modulate RUNX1. In some embodiments, NOTCH signaling is modulated to reduce RUNX1 function. For example, a NOTCH inhibitor is used to reduce RUNX1 expression or activity. Non-limiting examples of NOTCH inhibitors include aptamers, oligonucleotides (e.g., antisense oligonucleotides, ribozymes, and RNAi molecules), peptides (e.g., a portion of or the entire extracellular domain of a NOTCH protein), antibodies, antibody fragments, and small molecules that specifically bind to a NOTCH protein or a polynucleotide that encodes a NOTCH protein. Non-limiting examples of small molecule inhibitors for NOTCH proteins include compounds having the following structures:
and
Additional non-limiting examples of NOTCH inhibitors (as well as aspects of NOTCH signaling) are described in Espinoza and Miele, Pharmacol Ther. 2013,139(2): 95-110; and Yuan et al., Cancer Letters 2015, 369(1) 20-27, the entire contents of each of which are incorporated herein in their entireties.
In some embodiments RUNX1 signaling is modulated to reduce NOTCH signaling or function. For example, a RUNX1 inhibitor is used to reduce NOTCH signaling or function.
Pharmaceutical Formulations and Delivery
Dosages, formulations, dosage volumes, regimens, and methods for administering a RUNX1 inhibitor may vary. Thus, minimum and maximum effective dosages vary depending on the method of administration.
“Administering” an inhibitor described herein can be effected or performed using any of the various methods and delivery systems known to those skilled in the art. The administering can be, for example, intravenous, oral, ocular (e.g., subconjunctival, intravitreal, retrobulbar, or intracameral), intramuscular, intravascular, intra-arterial, intracoronary, intramyocardial, intraperitoneal, subcutaneous, inhaled, or intrathecal. Other non-limiting examples include topical administration, or coating of a device to be placed within the subject. Topical administration also includes administration of the inhibitor(s) by eye drop, e.g., contacting the surface of the eye with a liquid (aqueous, lipid, or combination thereof) or gel formulation. In other embodiments, administration is carried by injection, e.g., using a needle, or via a catheter.
As used herein, “effective” when referring to an amount of a therapeutic compound refers to the quantity of the compound that is sufficient to yield a desired therapeutic response without undue adverse side effects (such as toxicity, irritation, or allergic response) commensurate with a reasonable benefit/risk ratio when used in the manner of this disclosure.
As used herein, “pharmaceutically acceptable” carrier or excipient refers to a carrier or excipient that is suitable for use with humans and/or animals without undue adverse side effects (such as toxicity, irritation, and allergic response) commensurate with a reasonable benefit/risk ratio. It can be, e.g., a pharmaceutically acceptable solvent, suspending agent or vehicle, for delivering the instant compounds to the subject.
As used herein, a “monotherapy” is therapy that is administered to inhibit, treat, or prevent a disorder, such as aberrant angiogenesis (or a disease that includes aberrant angiogenesis such as cancer or PDR), without any other therapy that is used to treat the disorder. A monotherapy for treating a disorder may optionally be combined with another treatment that is used to ameliorate a symptom of the disorder while not being directed against the disorder, for example an analgesic compound, an antipyretic compound, and/or an anti-inflammatory compound (e.g., aspirin, ibuprofen, naproxen, or acetaminophen) may be administered concurrently with the monotherapy.
In various embodiments of the invention, a composition comprising a RUNX1 inhibitor may be administered only once or multiple times. For example, a RUNX1 inhibitor may be administered using a method disclosed herein at least about once, twice, three times, four times, five times, six times, or seven times per day, week, month, or year. In some embodiments, a composition comprising a RUNX1 inhibitor is administered once per month. In certain embodiments, the composition is administered once per month via intravitreal injection. In various embodiments, such as embodiments involving eye drops, a composition is self-administered.
For the treatment of an ocular disorder, a RUNX1 inhibitor (e.g., a pharmaceutical composition comprising a RUNX1 inhibitor) may be administered locally, e.g., as a topical eye drop, peri-ocular injection (e.g., sub-tenon), intraocular injection, intravitreal injection, retrobulbar injection, intraretinal injection, subretinal injection, subconjunctival injection, or using iontophoresis, or peri-ocular devices which can actively or passively deliver drug.
Sustained release of drug may be achieved by the use of technologies such as implants (e.g., solid implants) (which may or may not be bio-degradable) or bio-degradable polymeric matrices (e.g., micro-particles). These may be administered, e.g., peri-ocularly or intravitreally.
Pharmaceutical formulations adapted for topical administration may be formulated as aqueous solutions, ointments, creams, suspensions, lotions, powders, solutions, pastes, gels, sprays, aerosols, liposomes, microcapsules, microspheres, or oils.
For treatments of the eye or other external tissues, such as the mouth or skin, the formulations (e.g., a pharmaceutical composition comprising a RUNX1 inhibitor) may be applied as a topical ointment or cream. When formulated in an ointment, a RUNX1 inhibitor may be employed with either a paraffinic or a water-miscible ointment base. Alternatively, a RUNX1 inhibitor may be formulated in a cream with an oil-in-water cream base or a water-in-oil base.
The present subject matter provides compositions comprising a RUNX1 inhibitor and a carrier or excipient suitable for administration to ocular tissue. Such carriers and excipients are suitable for administration to ocular tissue (e.g., sclera, lens, iris, cornea, uvea, retina, macula, or vitreous tissue) without undue adverse side effects (such as toxicity, irritation, and allergic response) commensurate with a reasonable benefit/risk ratio.
Pharmaceutical formulations adapted for topical administrations to the eye include eye drops wherein a RUNX1 inhibitor is dissolved or suspended in a suitable carrier, especially an aqueous solvent. Formulations to be administered to the eye will have ophthalmically compatible pH and osmolality. The term “ophthalmically acceptable vehicle” means a pharmaceutical composition having physical properties (e.g., pH and/or osmolality) that are physiologically compatible with ophthalmic tissues.
In some embodiments, an ophthalmic composition of the present invention is formulated as sterile aqueous solutions having an osmolality of from about 200 to about 400 milliosmoles/kilogram water (“mOsm/kg”) and a physiologically compatible pH. The osmolality of the solutions may be adjusted by means of conventional agents, such as inorganic salts (e.g., NaCl), organic salts (e.g., sodium citrate), polyhydric alcohols (e.g., propylene glycol or sorbitol) or combinations thereof.
In various embodiments, the ophthalmic formulations of the present invention may be in the form of liquid, solid or semisolid dosage form. The ophthalmic formulations of the present invention may comprise, depending on the final dosage form, suitable ophthalmically acceptable excipients. In some embodiments, the ophthalmic formulations are formulated to maintain a physiologically tolerable pH range. In certain embodiments, the pH range of the ophthalmic formulation is in the range of from about 5 to about 9. In some embodiments, pH range of the ophthalmic formulation is in the range of from about 6 to about 8, or is about 6.5, about 7, or about 7.5.
In some embodiments, the composition is in the form of an aqueous solution, such as one that can be presented in the form of eye drops. By means of a suitable dispenser, a desired dosage of the active agent can be metered by administration of a known number of drops into the eye, such as by one, two, three, four, or five drops.
One or more ophthalmically acceptable pH adjusting agents and/or buffering agents can be included in a composition of the invention, including acids such as acetic, boric, citric, lactic, phosphoric, and hydrochloric acids; bases such as sodium hydroxide, sodium phosphate, sodium borate, sodium citrate, sodium acetate, and sodium lactate; and buffers such as citrate/dextrose, sodium bicarbonate, and ammonium chloride. Such acids, bases, and buffers can be included in an amount required to maintain pH of the composition in an ophthalmically acceptable range. One or more ophthalmically acceptable salts can be included in the composition in an amount sufficient to bring osmolality of the composition into an ophthalmically acceptable range. Such salts include those having sodium, potassium, or ammonium cations and chloride, citrate, ascorbate, borate, phosphate, bicarbonate, sulfate, thiosulfate, or bisulfite anions.
The ocular delivery device may be designed for the controlled release of one or more therapeutic agents with multiple defined release rates and sustained dose kinetics and permeability. Controlled release may be obtained through the design of polymeric matrices incorporating different choices and properties of biodegradable/bioerodable polymers (e.g., poly(ethylene vinyl) acetate (EVA), superhydrolyzed PVA), hydroxyalkyl cellulose (HPC), methylcellulose (MC), hydroxypropyl methyl cellulose (HPMC), polycaprolactone, poly(glycolic) acid, poly(lactic) acid, polyanhydride, of polymer molecular weights, polymer crystallinity, copolymer ratios, processing conditions, surface finish, geometry, excipient addition, and polymeric coatings that will enhance drug diffusion, erosion, dissolution, and osmosis.
Formulations for drug delivery using ocular devices may combine one or more active agents and adjuvants appropriate for the indicated route of administration. For example, a RUNX1 inhibitor (optionally with another agent) may be admixed with any pharmaceutically acceptable excipient, lactose, sucrose, starch powder, cellulose esters of alkanoic acids, stearic acid, talc, magnesium stearate, magnesium oxide, sodium and calcium salts of phosphoric and sulphuric acids, acacia, gelatin, sodium alginate, polyvinylpyrrolidine, and/or polyvinyl alcohol, tableted or encapsulated for conventional administration. Alternatively, the compounds may be dissolved in polyethylene glycol, propylene glycol, carboxymethyl cellulose colloidal solutions, ethanol, corn oil, peanut oil, cottonseed oil, sesame oil, tragacanth gum, and/or various buffers. The compounds may also be mixed with compositions of both biodegradable and non-biodegradable polymers, and a carrier or diluent that has a time delay property. Representative examples of biodegradable compositions can include albumin, gelatin, starch, cellulose, dextrans, polysaccharides, poly (D,L-lactide), poly (D,L-lactide-co-glycolide), poly (glycolide), poly (hydroxybutyrate), poly (alkylcarbonate) and poly (orthoesters), and mixtures thereof. Representative examples of non-biodegradable polymers can include EVA copolymers, silicone rubber and poly (methylacrylate), and mixtures thereof.
Pharmaceutical compositions for ocular delivery also include mo situ gellable aqueous composition. Such a composition comprises a gelling agent in a concentration effective to promote gelling upon contact with the eye or with lacrimal fluid. Suitable gelling agents include but are not limited to thermosetting polymers. The term “in situ gellable” as used herein includes not only liquids of low viscosity that form gels upon contact with the eye or with lacrimal fluid, but also includes more viscous liquids such as semi-fluid and thixotropic gels that exhibit substantially increased viscosity or gel stiffness upon administration to the eye. See, for example, Ludwig, Adv. Drug Deliv. Rev. 3; 57:1595-639 (2005), the entire content of which is incorporated herein by reference.
Biocompatible implants for placement in the eye have been disclosed in a number of patents, such as U.S. Pat. Nos. 4,521,210; 4,853,224; 4,997,652; 5,164,188; 5,443,505; 5,501,856; 5,766,242; 5,824,072; 5,869,079; 6,074,661; 6,331,313; 6,369,116; 6,699,493; and 8,293,210, the entire contents of each of which are incorporated herein by reference.
The implants may be monolithic, i.e. having the active agent (e.g., a RUNX1 inhibitor) or agents homogenously distributed through the polymeric matrix, or encapsulated, where a reservoir of active agent is encapsulated by the polymeric matrix. Due to ease of manufacture, monolithic implants are usually preferred over encapsulated forms. However, the greater control afforded by the encapsulated, reservoir-type implant may be of benefit in some circumstances, where the therapeutic level of the drug falls within a narrow window. In addition, the therapeutic component, including a RUNX1 inhibitor, may be distributed in a non-homogenous pattern in the matrix. For example, the implant may include a portion that has a greater concentration of a RUNX1 inhibitor relative to a second portion of the implant.
The intraocular implants disclosed herein may have a size of between about 5 um and about 2 mm, or between about 10 um and about 1 mm for administration with a needle, greater than 1 mm, or greater than 2 mm, such as 3 mm or up to 10 mm, for administration by surgical implantation. The vitreous chamber in humans is able to accommodate relatively large implants of varying geometries, having lengths of, for example, 1 to 10 mm. The implant may be a cylindrical pellet (e.g., rod) with dimensions of about 2 mm×0.75 mm diameter. The implant may be a cylindrical pellet with a length of about 7 mm to about 10 mm, and a diameter of about 0.75 mm to about 1.5 mm.
The implants may also be at least somewhat flexible so as to facilitate both insertion of the implant in the eye, such as in the vitreous, and accommodation of the implant. The total weight of the implant is usually about 250-5000 ug, more preferably about 500-1000 ug. For example, an implant may be about 500 ug, or about 1000 ug. For non-human subject, the dimensions and total weight of the implant(s) may be larger or smaller, depending on the type of subject. For example, humans have a vitreous volume of approximately 3.8 ml, compared with approximately 30 ml for horses, and approximately 60-100 ml for elephants. An implant sized for use in a human may be scaled up or down accordingly for other animals, for example, about 8 times larger for an implant for a horse, or about, for example, 26 times larger for an implant for an elephant.
Implants can be prepared where the center may be of one material and the surface may have one or more layers of the same or a different composition, where the layers may be cross-linked, or of a different molecular weight, different density or porosity, or the like. For example, where it is desirable to quickly release an initial bolus of drug, the center may be a polylactate coated with a polylactate-polyglycolate copolymer, so as to enhance the rate of initial degradation. Alternatively, the center may be polyvinyl alcohol coated with polylactate, so that upon degradation of the polylactate exterior the center would dissolve and be rapidly washed out of the eye.
The implants may be of any geometry including fibers, sheets, films, microspheres, spheres, circular discs, plaques, and the like. The upper limit for the implant size will be determined by factors such as toleration for the implant, size limitations on insertion, ease of handling, etc. Where sheets or films are employed, the sheets or films will be in the range of at least about 0.5 mm×0.5 mm, usually about 3-10 mm x 5-10 mm with a thickness of about 0.1-1.0 mm for ease of handling. Where fibers are employed, the fiber diameter will generally be in the range of about 0.05 to 3 mm and the fiber length will generally be in the range of about 0.5-10 mm. Spheres may be in the range of 0.5 u.m to 4 mm in diameter, with comparable volumes for other shaped particles.
The size and form of the implant can also be used to control the rate of release, period of treatment, and drug concentration at the site of implantation. Larger implants will deliver a proportionately larger dose, but depending on the surface to mass ratio, may have a slower release rate. The particular size and geometry of the implant are chosen to suit the site of implantation.
Microspheres for ocular delivery are described, for example, in U.S. Pat. Nos. 5,837,226; 5,731,005; 5,641,750; 7,354,574; and U.S. Pub. No. 2008-0131484, the entire contents of each of which are incorporated herein by reference.
For oral or enteral formulations for use with the present invention, tablets can be formulated in accordance with conventional procedures employing solid carriers well-known in the art. Capsules employed for oral formulations to be used with the methods of the present invention can be made from any pharmaceutically acceptable material, such as gelatin or cellulose derivatives. Sustained release oral delivery systems and/or enteric coatings for orally administered dosage forms are also contemplated, such as those described in U.S. Pat. Nos. 4,704,295; 4,556,552; 4,309,404; and 4,309,406, the entire contents of each of which are incorporated herein by reference.
Unless specifically defined otherwise, all technical and scientific terms used herein shall be taken to have the same meaning as commonly understood by one of ordinary skill in the art (e.g., in cell culture, molecular genetics, and biochemistry).
As used herein, the term “about” in the context of a numerical value or range means±10% of the numerical value or range recited or claimed, unless the context requires a more limited range.
In the descriptions above and in the claims, phrases such as “at least one of” or “one or more of” may occur followed by a conjunctive list of elements or features. The term “and/or” may also occur in a list of two or more elements or features. Unless otherwise implicitly or explicitly contradicted by the context in which it is used, such a phrase is intended to mean any of the listed elements or features individually or any of the recited elements or features in combination with any of the other recited elements or features. For example, the phrases “at least one of A and B;” “one or more of A and B;” and “A and/or B” are each intended to mean “A alone, B alone, or A and B together.” A similar interpretation is also intended for lists including three or more items. For example, the phrases “at least one of A, B, and C;” “one or more of A, B, and C;” and “A, B, and/or C” are each intended to mean “A alone, B alone, C alone, A and B together, A and C together, B and C together, or A and B and C together.” In addition, use of the term “based on,” above and in the claims is intended to mean, “based at least in part on,” such that an unrecited feature or element is also permissible.
It is understood that where a parameter range is provided, all integers within that range, and tenths thereof, are also provided by the invention. For example, “0.2-5 mg” is a disclosure of 0.2 ng, 0.3 mg, 0.4 mg, 0.5 mg, 0.6 mg etc. up to and including 5.0 mg.
A small molecule is a compound that is less than 2000 daltons in mass. The molecular mass of the small molecule is preferably less than 1000 daltons, more preferably less than 600 daltons, e.g., the compound is less than 500 daltons, 400 daltons, 300 daltons, 200 daltons, or 100 daltons.
As used herein, an “isolated” or “purified” nucleic acid molecule, polynucleotide, polypeptide, or protein, is substantially free of other cellular material, or culture medium when produced by recombinant techniques, or chemical precursors or other chemicals when chemically synthesized. Purified compounds are at least 60% by weight (dry weight) the compound of interest. Preferably, the preparation is at least 75%, more preferably at least 90%, and most preferably at least 99%, by weight the compound of interest. For example, a purified compound is one that is at least 90%. 91%, 92%, 93%. 94%, 95%, 98%, 99%, or 100% (w/w) of the desired compound by weight. Purity is measured by any appropriate standard method, for example, by column chromatography, thin layer chromatography, or high-performance liquid chromatography (HPLC) analysis. A purified or isolated polynucleotide (RNA or DNA) is free of the genes or sequences that flank it in its naturally-occurring state. Purified also defines a degree of sterility that is safe for administration to a human subject, e.g., lacking infectious or toxic agents.
Similarly, by “substantially pure” is meant a nucleotide or polypeptide that has been separated from the components that naturally accompany it. Typically, the nucleotides and polypeptides are substantially pure when they are at least 60%, 70%, 80%, 90%, 95%, or even 99%, by weight, free from the proteins and naturally-occurring organic molecules with they are naturally associated.
The transitional term “comprising,” which is synonymous with “including,” “containing,” or “characterized by,” is inclusive or open-ended and does not exclude additional, unrecited elements or method steps. By contrast, the transitional phrase “consisting of” excludes any element, step, or ingredient not specified in the claim. The transitional phrase “consisting essentially of” limits the scope of a claim to the specified materials or steps “and those that do not materially affect the basic and novel characteristic(s)” of the claimed invention.
The terms “subject,” “patient,” “individual,” and the like as used herein are not intended to be limiting and can be generally interchanged. An individual described as a “subject,” “patient,” “individual,” and the like does not necessarily have a given disease, but may be merely seeking medical advice. The terms “subject,” “patient,” “individual,” and the like as used herein include all members of the animal kingdom that may suffer from the indicated disorder. In some aspects, the subject is a mammal, and in some aspects, the subject is a human. In some embodiments, a subject is a mouse, rat, guinea pig, primate (such as a monkey, a chimpanzee, a gorilla, or a baboon), a cat, a dog, a cow, a camel, a sheep, a horse, an ox, a reindeer, an elephant, a work animal, a zoo animal, a reptile, an amphibian, or a fish.
As used herein, the singular forms “a,” “an,” and “the” include the plural reference unless the context clearly dictates otherwise. Thus, for example, a reference to “a disease,” “a disease state”, or “a nucleic acid” is a reference to one or more such embodiments, and includes equivalents thereof known to those skilled in the art and so forth.
As used herein, “treating” encompasses, e.g., inhibition, regression, or stasis of the progression of a disorder. For purposes of this disclosure, beneficial or desired clinical results include, but are not limited to, alleviation or amelioration of any symptom or symptoms, diminishment of extent of disease, stabilized (i.e., not worsening) state of disease, preventing spread of disease, delay or slowing of disease progression, amelioration or palliation of the disease state, and recovery (whether partial or total), whether detectable or undetectable. As used herein, “inhibition” of disease progression or a disease complication in a subject means preventing or reducing the disease progression and/or disease complication in the subject.
As used herein, a “symptom” associated with a disorder includes any clinical or laboratory manifestation associated with the disorder, and is not limited to what the subject can feel or observe.
A “control” sample or value refers to a sample that serves as a reference, usually a known reference, for comparison to a test sample. For example, a test sample can be taken from a test subject, e.g., a subject in need of diagnosis for a disease, and compared to samples from known conditions, e.g., a subject (or subjects) that does not have the disease (a negative or normal control), or a subject (or subjects) who does have the disease (positive control). A control can also represent an average value gathered from a number of tests or results. One of skill in the art will recognize that controls can be designed for assessment of any number of parameters. One of skill in the art will understand which controls are valuable in a given situation and be able to analyze data based on comparisons to control values. Controls are also valuable for determining the significance of data. For example, if values for a given parameter are variable in controls, variation in test samples will not be considered as significant.
The term, “normal amount” with respect to a compound (e.g., a protein) refers to a normal amount of the protein in an individual known not to be diagnosed with a disease that comprises aberrant angiogenesis. The amount of a protein can be measured in a test sample and compared to the “normal control” level, utilizing techniques such as reference limits, discrimination limits, or risk defining thresholds to define cutoff points and abnormal values (e.g., for a particular neovascularization disorder or a symptom thereof). The normal control level means the level of one or more proteins or combined protein indices typically found in a subject known not suffering from a disease that comprises aberrant angiogenesis. Such normal control levels and cutoff points may vary based on whether a protein is used alone or in a formula combining with other proteins into an index. Alternatively, the normal control level can be a database of protein patterns from previously tested subjects who did not develop a disease that comprises aberrant angiogenesis or a particular symptom thereof (e.g., in the event the disease develops or a subject already having the disease is tested) over a clinically relevant time horizon.
The level that is determined may be the same as a control level or a cut off level or a threshold level, or may be increased or decreased relative to a control level or a cut off level or a threshold level. In some aspects, the control subject is a matched control of the same species, gender, ethnicity, age group, smoking status, body mass index (BMI), current therapeutic regimen status, medical history, or a combination thereof, but differs from the subject being diagnosed in that the control does not suffer from the disease (or a symptom thereof) in question or is not at risk for the disease.
Relative to a control level, the level that is determined may an increased level. As used herein, the term “increased” with respect to level (e.g., protein level) refers to any % increase above a control level. In various embodiments, the increased level may be at least or about a 5% increase, at least or about a 10% increase, at least or about a 15% increase, at least or about a 20% increase, at least or about a 25% increase, at least or about a 30% increase, at least or about a 35% increase, at least or about a 40% increase, at least or about a 45% increase, at least or about a 50% increase, at least or about a 55% increase, at least or about a 60% increase, at least or about a 65% increase, at least or about a 70% increase, at least or about a 75% increase, at least or about a 80% increase, at least or about a 85% increase, at least or about a 90% increase, at least or about a 95% increase, relative to a control level.
Relative to a control level, the level that is determined may a decreased level. As used herein, the term “decreased” with respect to level (e.g., protein level) refers to any % decrease below a control level. In various embodiments, the decreased level may be at least or about a 5% decrease, at least or about a 10% decrease, at least or about a 15% decrease, at least or about a 20% decrease, at least or about a 25% decrease, at least or about a 30% decrease, at least or about a 35% decrease, at least or about a 40% decrease, at least or about a 45% decrease, at least or about a 50% decrease, at least or about a 55% decrease, at least or about a 60% decrease, at least or about a 65% decrease, at least or about a 70% decrease, at least or about a 75% decrease, at least or about a 80% decrease, at least or about a 85% decrease, at least or about a 90% decrease, at least or about a 95% decrease, relative to a control level.
“Risk” in the context of the present disclosure, relates to the probability that an event will occur over a specific time period, as in the development of a neovascularization disorder or a symptom thereof, and can mean a subject's “absolute” risk or “relative” risk. In various embodiments, a “high risk” subject is a subject who is likely to develop a disease that comprises aberrant angiogenesis or a symptom thereof within, e.g., about 1, 2, 3, 4, or 5 years. Absolute risk can be measured with reference to either actual observation post-measurement for the relevant time cohort, or with reference to index values developed from statistically valid historical cohorts that have been followed for the relevant time period. Relative risk refers to the ratio of absolute risks of a subject compared either to the absolute risks of low risk cohorts or an average population risk, which can vary by how clinical risk factors are assessed. Odds ratios, the proportion of positive events to negative events for a given test result, are also commonly used [odds are according to the formula p/(1−p) where p is the probability of event and (1−p) is the probability of no event] to no-conversion.
Embodiments and examples are provided below to facilitate a more complete understanding of the invention. The following embodiments and examples illustrate the exemplary modes of making and practicing the invention. However, the scope of the invention is not limited to specific embodiments disclosed in these embodiments and examples, which are for purposes of illustration only, since alternative methods can be utilized to obtain similar results.
Embodiments include Embodiments P1 to P50 following.
Embodiment P1. A method for inhibiting, treating, or preventing aberrant angiogenesis in a subject in need thereof, comprising administering to said subject an effective amount of a Runt-Related Transcription Factor 1 (RUNX1) inhibitor or a PIM3 Proto-Oncogene, Serine/Threonine Kinase (PIM3) inhibitor.
Embodiment P2. The method of Embodiment P1, wherein said subject comprises proliferative diabetic retinopathy (PDR), macular edema, or non-proliferative diabetic retinopathy.
Embodiment P3. The method of Embodiment P1, wherein said subject comprises a cancer.
Embodiment P4. The method of Embodiment P3, wherein said cancer is other than leukemia.
Embodiment P5. The method of Embodiment P3, wherein said cancer comprises melanoma.
Embodiment P6. The method of Embodiment P3, wherein said cancer comprises a solid tumor.
Embodiment P7. The method of Embodiment P6, wherein said aberrant angiogenesis comprises blood vessel growth toward, into, and/or within said solid tumor.
Embodiment P8. The method of Embodiment P6 or P7, wherein said solid tumor comprises a dimension that is greater than at least about 1, 2, 3, 4, 5, 6, 7, 8, 9, 10 mm or more and/or a volume of at least about 1, 1.5, 2, 3, 4, 5, 6, 7, 8, 9, 10 mm3 or more.
Embodiment P9. The method of any one of Embodiments P1 to P8, wherein said RUNX1 inhibitor or said PIM3 inhibitor is administered as part of a treatment regimen that does not comprise an additional antiangiogenic inhibitor.
Embodiment P10. The method of Embodiment P9, wherein said treatment regimen does not comprise a vascular endothelial growth factor (VEGF) pathway inhibitor.
Embodiment P11. The method of any one of Embodiments P1 to P10, wherein said RUNX1 inhibitor or said PIM3 inhibitor is administered as a monotherapy.
Embodiment P12. The method of any one of Embodiments P1 to P11, wherein said subject is an animal other than a pregnant animal, an infant, a fetus, or an embryo.
Embodiment P13. The method of any one of Embodiments P1 to P12, wherein said subject comprises diabetes.
Embodiment P14. The method of Embodiment P13, wherein said diabetes is type 1 diabetes or type 2 diabetes.
Embodiment P15. The method of any one of Embodiments P1 to P14, wherein said subject comprises retinopathy of prematurity (ROP), diabetic retinopathy (DR), age-related macular degeneration (AMD), a retinal vein occlusion, a vascular malformation, a cerebral cavernous malformation, macular edema, non-proliferative diabetic retinopathy, ocular ischemic syndrome, neovascular glaucoma, a hemangioma, a retinal hemangioma, Coats' Disease, Norrie Disease, or Von Hippel-Lindau disease.
Embodiment P16. The method of any one of Embodiments P1 to P15, wherein said subject is at least about 10, 20, 30, 40, 50, 60, 70, 80, or 90 years old.
Embodiment P17. The method of any one of Embodiments P1 to P16, wherein said RUNX1 or said PIM3 inhibitor comprises an aptamer, an oligonucleotide, a peptide, an antibody or a fragment thereof, or a small molecule.
Embodiment P18. The method of Embodiment P17, wherein said RUNX1 inhibitor binds to RUNX1 and/or CBFβ.
Embodiment P19. The method of Embodiment P17, wherein said RUNX1 inhibitor binds to RUNX1 or said or said PIM3 inhibitor binds to PIM3.
Embodiment P20. The method of Embodiment P17, wherein said RUNX1 inhibitor comprises Ro5-3335.
Embodiment P21. The method of Embodiment P17, wherein said RUNX1 inhibitor or said PIM3 inhibitor comprises an oligonucleotide.
Embodiment P22. The method of Embodiment P21, wherein said oligonucleotide comprises at least about 10, 15, 20, 25, 30, or more nucleotides in a sequence that is complementary to a nucleotide sequence within a gene or mRNA molecule that encodes RUNX1 or PIM3.
Embodiment P23. A method for inhibiting, treating, or preventing aberrant angiogenesis in a subject in need thereof, comprising altering a RUNX1 or PIM3 gene in said subject.
Embodiment P24. The method of Embodiment P23, wherein altering said RUNX1 or PIM3 gene comprises the administration of (i) a Cas protein, a zinc finger nuclease (ZFN), or a transcription activator-like effector-based nuclease (TALEN), or (ii) an expression vector encoding a Cas protein, a ZFN, or a TALEN, to said subject.
Embodiment P25. The method of Embodiment P23 or P24, wherein said gene is altered with via a CRISPR-Cas9 system.
Embodiment P26. A method for inhibiting, treating, or preventing aberrant angiogenesis in a subject in need thereof, comprising administering to said subject a NOTCH inhibitor in an amount that is effective to reduce RUNX1 expression or activity.
Embodiment P27. A composition comprising an effective amount of a RUNX1 inhibitor or a PIM3 inhibitor and an ophthalmically acceptable vehicle.
Embodiment P28. A method for diagnosing aberrant angiogenesis in a subject comprising
Aberrant angiogenesis is a hallmark of proliferative diabetic retinopathy (PDR), wet age-related macular degeneration (AMD), retinopathy of prematurity (ROP), cancer, and other conditions. To identify new genes associated with the abnormal growth of vascular endothelial cells (EC), transcriptome analysis was performed on patient-derived CD31+ vascular endothelial cells obtained from surgically removed fibrovascular membranes (FVMs) from patients with PDR. RNA-sequencing identified 200 genes differentially expressed in FVM-derived CD31+ cells compared to postmortem retina-derived CD31+ cells from nondiabetic individuals with enrichment of inflammatory response and vascular development gene ontology categories. RUNX1, a master regulator of the endothelial-hematopoietic transition and vasculogenesis during development, and its targets CD44, PPIB, and PPIF were found to be upregulated in CD31+ cells derived from PDR. Immunohistochemical staining for RUNX1 showed reactivity of nuclei in vessels of FVMs, angiogenic tufts in the retina of mice with oxygen-induced retinopathy (OIR), and in vessels of human melanoma xenografts. High glucose increased RUNX1 expression, independent of osmotic effects, in cultured human microvascular retinal endothelial cells (HRMECs) and RUNX1 knockdown led to reduced migration and proliferation of these cells. The data herein defines RUNX1 dysregulation as a hallmark of aberrant retinal angiogenesis.
Proliferative diabetic retinopathy is a common cause of blindness in the developed world's working adult population and affects those with both type 1 and type 2 diabetes mellitus. The data herein shows cell population specific profiling of transcriptional changes in CD31+ vascular endothelial cells directly derived from pathologic human samples. It was found that RUNX1 is upregulated in CD31+ cells from proliferative diabetic membranes and functions as a critical regulator of growth and migration of vascular endothelial cells.
A major challenge to understanding neovascularization in PDR is that animal models of diabetes do not develop the proliferative phase of diabetic retinopathy consistently (Jo et al. (2013) J Biomed Sci 20:38; Rakoczy E P, et al. (2010) Am J Pathol 177(5):2659-2670). FVMs in patients are removed to relieve retinal traction with associated retinal detachment and remain largely understudied as they are often discarded after ocular surgery. To establish platforms for discovering the mechanisms underlying aberrant angiogenesis, methods for the isolation and characterization of vascular EC from patient-derived PDR FVMs were developed (Kim L A, et al. (2015) Mol Vis 21:673-687). This cell system was employed to characterize the transcriptomes of freshly isolated ECs using RNA sequencing and identified RUNX1 and other genes as candidates upregulated in neovessels.
Results
RNA-Sequencing of FVM
Whole transcriptomic profiles were constructed for CD31+ cells from FVM and compared to transcriptomes of CD31+ cells from postmortem retinas isolated from non-diabetic individuals (FIG. 9, Table 1) (Lam et al. (2017) Diabetes 66(7):1950-1956; Kim et al. (2015) Mol Vis 21:673-687). The entire content of Lam et al. (2017) Diabetes 66(7):1950-1956, including all supplemental information, is incorporated herein by reference. Postmortem retinas were used to define expression baseline because there is no normal correlate of FVM. CD31+ cells were identified as vascular EC based on their expression of five vascular endothelial markers: CD93, CD31, KLF4, ESAM, and VEGFR1 (Table 2). However, because a single marker, namely CD31, was used for cell isolation, the presence of other cell types cannot be ruled out. Principal component analysis (PCA) of the transcriptomes demonstrated congruent expression profiles for control samples whereas profiles of cells from the FVM samples had more variable gene expression patterns (FIG. 1). The datasets are accessible through the NCBI's Gene Expression Omnibus (GSE94019XEdgar et al. (2002) Nucleic Acids Res 30(1)207-210).
Two hundred genes were identified as differentially expressed in CD31+ cells from FVMs vs. controls by cross-referencing analyses from multiple analytical tools (Partek Flow, Cufflinks, EdgeR, and DESeq2) (inclusion criteria: false discovery rate (FDR)<0.05 and fold change ≥±2). Gene set analysis showed enrichment of functional Gene Ontology categories related to related to wound response, vessel development, angiogenesis, and other categories, consistent with the notion that these genes function in aberrant angiogenesis (FIG. 2, Table 3).
| TABLE 1 |
| Demographic data for control post-mortem retina and |
| FVM from PDR patients used for RNA-sequencing. VH: |
| vitreous hemorrhage, TRD: fractional retinal detachment, |
| RRD: rhegmatogenous retinal detachment. |
| Control Retina Samples |
| Last known HbA1c | Cause of | ||
| Age | Sex | % (mmol/mol) | death |
| 25 | M | Unknown | Metastatic melanoma |
| 54 | M | 5.3 (34) | Colectomy c/b sepsis |
| 77 | M | Unknown | Respiratory failure |
| 87 | F | 5.8 (40) | Right temporoparietal |
| hemorrhage | |||
| Fibrovascular Membrane Samples |
| Type of Diabetes | Last known HbA1c | Surgical | ||
| Age | Sex | Mellitus | % (mmol/mol) | Indication |
| 29 | F | 1 | Unknown | VH/TRD |
| 51 | F | 2 | 6.5 (48) | VH/TRD/RRD |
| 44 | M | 1 | 7.9 (63) | TRD/RRD |
| 71 | M | 1 | Unknown | TRD/RRD |
| 38 | F | 2 | 6.3 (45) | TRD |
| 40 | F | 2 | 14 (130) | VH/TRD |
| 49 | M | 2 | 8.0 (64) | TRD/RRD |
| 48 | F | 2 | 7.2 (55) | TRD/RRD |
| TABLE 2 |
| RNA-sequencing of isolated CD31+ cells. Both control |
| human retinal endothelial cells and CD31+ C-FVM express |
| characteristic vascular endothelial cell markers. Differences |
| in expression levels do not meet criteria for significance. |
| Gene Symbol |
| CD93 | CD31 | KLF4 | ESAM | VEGFR1 | |
| Ctrl 1 | 0.75 | 0.41 | 0.07 | 0.14 | 1.36 |
| Ctrl 2 | 2.17 | 3.26 | 1.09 | 1.41 | 32.83 |
| Ctrl 3 | 59.7 | 47.37 | 2.93 | 20.18 | 257.23 |
| Ctrl 4 | 6.28 | 5.58 | 0.93 | 3.95 | 39.75 |
| FVM 1 | 2.37 | 4.92 | 0.24 | 1.46 | 2.61 |
| FVM 2 | 203.57 | 52.74 | 44.98 | 51.23 | 91 |
| FVM 3 | 78.48 | 15.94 | 30.78 | 0.58 | 88.99 |
| FVM 4 | 103.42 | 156.32 | 31.79 | 36.96 | 38.15 |
| FVM 5 | 304.64 | 93.71 | 73.43 | 59.36 | 189.6 |
| FVM 6 | 164.94 | 50.44 | 33.49 | 19.27 | 63.13 |
| FVM 7 | 423.9 | 116.12 | 57.25 | 101.58 | 298.19 |
| FVM 8 | 313.39 | 76.8 | 27.15 | 55.27 | 136.05 |
| TABLE 3 |
| Gene set enrichment analysis of the 200 differentially expressed genes in FVMs |
| Pathways that met statistical significance are listed with the relevant genes, Both up- and |
| downregulated genes were pooled for the analysis and percentages indicate the number of |
| genes from the list of 200 that were associated with the ontology term. |
| Fold | ||||||
| Term | % | Genes | Enrichment | PValue | Benjamini | FDR |
| GO:0009611~ | 22.11 | C3AR1, TNF, | 6.606348502 | 1.66E−23 | 3.26E−20 | 2.85E−20 |
| response to | CCL2, AIF1, C3, | |||||
| wounding | PDGFA, F13A1, | |||||
| CXCL2, COL3A1, | ||||||
| TLR2, NINJ1, | ||||||
| ITGB2, C1QC, | ||||||
| IL10, CD97, GPX1, | ||||||
| CD44, CCL20, | ||||||
| CXCR4, HMOX1, | ||||||
| IL1B, C2, THBS1, | ||||||
| B4GALT1, IRAK2, | ||||||
| PTPN6, NFKB1Z, | ||||||
| CEBPB, LYN, | ||||||
| OLR1, PDPN, | ||||||
| IL1RN, LYZ, | ||||||
| CCL4L1, PLAUR, | ||||||
| CD163, C1QA, | ||||||
| C1QB, NUPR1, | ||||||
| VCAN, CTSB, | ||||||
| VS1G4, PLAU, | ||||||
| CD14 | ||||||
| GO:00069.54~ | 17.09 | C3AR1, TNT, | 8.324923077 | 4.76E−21 | 4.67E−18 | 8.17E−18 |
| inflammatory | CCL2, A1F1, C3, | |||||
| response | CXCL2, TLR2, | |||||
| ITGB2, C1QC, | ||||||
| IL10, CD97, CD44, | ||||||
| CCL20, CXCR4, | ||||||
| HMOX1, IL1B, C2, | ||||||
| THBS1, B4GALT1, | ||||||
| IRAK2, NFKBIZ, | ||||||
| CEBPB, LYN, | ||||||
| OLR1, PDPN, | ||||||
| IL1RN, LYZ, | ||||||
| CCL4L1, CD163, | ||||||
| C1QA, C1QB, | ||||||
| NUPR1, VSIG4, | ||||||
| CD14 | ||||||
| GO:0006952~ | 22.11 | C3AR1, CCL2, | 5.693275945 | 5.57E−21 | 3.64E−18 | 9.55E−18 |
| defense response | TNF, AIF1, C3, | |||||
| CXCL2, TLR2, | ||||||
| ITGB2, C1QC, | ||||||
| CD74, IL10, CD97, | ||||||
| LGALS3BP, CD44, | ||||||
| CCL20, CXCR4, | ||||||
| HMOX1, IL1B, C2, | ||||||
| THBS1, TYROBP, | ||||||
| B4GALT1, IRAK2, | ||||||
| NFKBIZ, C5AR1, | ||||||
| CEBPB, LYN, | ||||||
| OLR1, PDPN | ||||||
| 1L1RN, LYZ, CST3, | ||||||
| CCL4L1, | ||||||
| COLEC12, CD163, | ||||||
| C1QA, C1QB, | ||||||
| L1LRB2, CD83, | ||||||
| NUPR1, CXCL16, | ||||||
| VSIG4, CD14, | ||||||
| HLA-DRA | ||||||
| GO:0006955~ | 21.61 | GPR183, CCL2, | 4.959113384 | 2.94E−18 | 1.44E−15 | 5.05E−15 |
| immune response | TNF, HLA-DRB1, | |||||
| C3, CXCL2, TLR2, | ||||||
| C1QC, CD74, IL10, | ||||||
| CD97, CCL20, | ||||||
| CXCR4, FCER1G, | ||||||
| IL1B, CD4, C2, | ||||||
| HLA-DOA, THBS1, | ||||||
| LAIR1, C5AR1, | ||||||
| CEBPB, LYN, | ||||||
| OLR1, CMKLR1, | ||||||
| IL1RN, CCL4L1, | ||||||
| COLEC12, GEM, | ||||||
| CTSS, HLA-DQA2, | ||||||
| C1QA, C1QB, | ||||||
| LILRB2, CD83, | ||||||
| RGS1, CXCL16, | ||||||
| IRF8, CD300LF, | ||||||
| VS1G4, LCP1, | ||||||
| CD14, HLA-DRA | ||||||
| GO:0002684~ | 10.55 | IRAK2, C3AR1, | 7.021453287 | 1.64E−11 | 6.44E−9 | 2.82E−08 |
| positive regulation | LYN, C3, TLR2, | |||||
| of immune | C1QC, CD74, | |||||
| system process | THY1, C1QA, | |||||
| CD83, C1QB, | ||||||
| CD37, IL1B, | ||||||
| FCER1G, CD4, C2, | ||||||
| THBS1, VSIG4, | ||||||
| SASH3, SYK, | ||||||
| HLA-DRA | ||||||
| GO:0001944~ | 10.55 | B4GALT1, PDPN, | 6.65779236 | 4.32E−11 | 1.41E−08 | 7.41E−08 |
| vasculature | PDGFA, COL3A1, | |||||
| development | MMP19, COL15A1, | |||||
| MMP2, THY1, | ||||||
| CITED2, CDH13, | ||||||
| GPX1, BGN, CD44 | ||||||
| CXCR4, APOE | ||||||
| HMOX1, IL1B, | ||||||
| COL1A1 THBS1, | ||||||
| TNFAIP2, PLAU | ||||||
| GO:0006935~ | 8.54 | C3AR1, CCL2, | 8.455 | 1.48E−10 | 4.14E−08 | 2.53E−07 |
| chemotaxis | C5AR1, CMKLR1, | |||||
| PDGFA, CXCL2, | ||||||
| CCL4L1, ITGB2, | ||||||
| IL10, PLAUR, | ||||||
| CCL20, CXCR4, | ||||||
| CXCL16, IL1B, | ||||||
| CMTM3, PLAU, | ||||||
| SYK | ||||||
| GO:0042330~ | 8.54 | C3AR1, CCL2, | 8.455 | 1.48E−10 | 4.14E−08 | 2.53E−07 |
| taxis | C5AR1, CMKLR1, | |||||
| PDGFA, CXCL2, | ||||||
| CCL4L1, ITGB2, | ||||||
| IL10, PLAUR, | ||||||
| CCL20, CXCR4, | ||||||
| CXCL16, IL1B, | ||||||
| CMTM3, PLAU, | ||||||
| SYK | ||||||
| GO:0001568~ | 10.05 | B4GALT1, PDGFA, | 6.496038415 | 2.17E−10 | 5.33E−08 | 3.73E−07 |
| blood vessel | COL3A1, MMP19, | |||||
| development | COL15A1, MMP2, | |||||
| THY1, CITED2, | ||||||
| CDH13, GPX1, | ||||||
| BGN, CD44, | ||||||
| CXCR4, APOE, | ||||||
| HMOX1, IL1B, | ||||||
| COL1A1, THBS1, | ||||||
| TNFAIP2, PLAU | ||||||
| GO:0050778~ | 8.04 | IRAK2, C3AR1, | 8.780851927 | 3.52E−10 | 7.67E−08 | 6.04E−07 |
| positive regulation | LYN, C3, TLR2, | |||||
| of immune | C1QC, THY1, | |||||
| response | C1QA, C1QB, | |||||
| IL1B, FCER1G, C2, | ||||||
| VSIG-4, SASH3, | ||||||
| SYK, HLA-DRA | ||||||
| GO:0048584~ | 9.55 | IRAK2, C3AR1, | 6.406580259 | 8.77E−10 | 1.72E−07 | 1.50E−06 |
| positive regulation | TNF, LYN, C3, | |||||
| of response to | TLR2, C1QC, | |||||
| stimulus | THY1, C1QA, | |||||
| CDH13, C1QB, | ||||||
| IL1B, FCER1G, C2, | ||||||
| THBS1, VS1G4, | ||||||
| SASH3, SYK, | ||||||
| HLA-DRA | ||||||
| GO:0010033~ | 15.58 | TNF, CCL2, GRB2, | 3.421457127 | 5.06E−09 | 9.02E−07 | 8.68E−06 |
| response to organic | PDGFA, COL3A1 | |||||
| substance | TLR2, IL10, | |||||
| ACSL1, CD44, | ||||||
| APOE, HMOX1, | ||||||
| IL1B, IDH1, CD4, | ||||||
| THBS1, IRAK2, | ||||||
| IRS2, EGR2, LYN, | ||||||
| IL1RN, NR4A2, | ||||||
| FBP1, COLEC12, | ||||||
| NR4A3, C1QB, | ||||||
| CDH13, CD83, | ||||||
| CCND1, CXCL16 | ||||||
| COL1A1, CD14 | ||||||
| GO:0001817~ | 8.04 | TNF, CEBPB, | 7.03438414 | 7.74E−09 | 1.27E−06 | 1.33E−05 |
| regulation of | ATP6AP2, TLR2, | |||||
| cytokine | IL10, CD83, REL, | |||||
| production | HMOX1, IL1B, | |||||
| FCER1G, CD4, | ||||||
| VSIG4, THBS1, | ||||||
| CD14, SASH3, | ||||||
| SYK | ||||||
| GO:0002253~ | 6.03 | CIQA, IRAK2, | 10.15869837 | 2.35E−08 | 3.55E−06 | 4.04E−05 |
| activation of | C1QB, C3AR1, | |||||
| immune response | LYN, C3, TLR2, | |||||
| C2, VSIG4, C1QC, | ||||||
| THY1, SYK | ||||||
| GO:0002526~ | 6.03 | C1QA, B4GALT1, | 9.744057623 | 3.66E−08 | 5.13E−06 | 6.27E−05 |
| acute inflammatory | C1QB, CEBPB, | |||||
| response | NU-PR1, LYN, C3, | |||||
| IL1B, C2, VSIG4, | ||||||
| C1QC, CD163 | ||||||
| GO:0050865~ | 7.54 | PDPN, PDGFA, | 6.820840336 | 3.91E−08 | 5.12E−06 | 6.71E−05 |
| regulation of cell | CD74, IL10, THY1, | |||||
| activation | CD83, APOE, | |||||
| HMOX1, IL1B, | ||||||
| CD4, VSIG4, HLA- | ||||||
| DOA, THBS1, | ||||||
| SASH3, SYK | ||||||
| GO:0007626~ | 9.05 | C3AR1, CCL2, | 5.227651353 | 5.75E−08 | 7.05E−06 | 9.86E−05 |
| locomotory | C5AR1, CMKLR1, | |||||
| behavior | PDGFA, CXCL2, | |||||
| NR4A2, CCL4L1, | ||||||
| ITGB2, IL10, | ||||||
| PLAUR, CCL20, | ||||||
| CXCR4, CXCL16, | ||||||
| IL1B, CMTM3, | ||||||
| PLAU, SYK | ||||||
| GO:0048514~ | 8.04 | B4GALT1, PDGFA, | 6.034234737 | 6.10E−08 | 7.04E−06 | 1.05E−04 |
| blood vessel | MMP19, COL15A1, | |||||
| morphogenesis | THY1, CITED2, | |||||
| CDH13, GPX1, | ||||||
| BGN, CXCR4, | ||||||
| APOE, HMOX1, | ||||||
| IL1B, THBS1, | ||||||
| TNFAIP2, PLAU | ||||||
| GO:0001525~ | 6.53 | B4GALT1, GPX1, | 6.989825119 | 3.28E−07 | 3.57E−05 | 5.62E−04 |
| angiogenesis | CDH13, CXCR4, | |||||
| PDGFA, HMOX1, | ||||||
| MMP19, COLI5A1, | ||||||
| IL1B, THBS1, | ||||||
| TNFAIP2, PLAU | ||||||
| THY1 | ||||||
| GO:0042127~ | 14.57 | TNF, CCL2, AIF1, | 2.932296883 | 4.64E−07 | 4.80E−05 | 7.97E−04 |
| regulation of cell | PDGFA, IFI30, | |||||
| proliferation | IL10, GPX1, APOE, | |||||
| HMOX1, CHST11, | ||||||
| IL1B, THBS1, | ||||||
| GPNMB, RHOG, | ||||||
| SYK, B4GALT1, | ||||||
| ODC1, PTPN6, | ||||||
| IRS2, LYN, | ||||||
| SPARC, CDH13, | ||||||
| CCND1, NUPR1, | ||||||
| GRN, VSIG4, | ||||||
| PMP22, SASH3, | ||||||
| PLAU | ||||||
| GO:0007155~ | 13.57 | B4GALT1, CCL2, | 3.069378151 | 5.61E−07 | 5.50E−05 | 9.62E−04 |
| cell adhesion | TNF, OLR1, PDPN, | |||||
| COL3A1, | ||||||
| COL15A1, | ||||||
| CCL4L1, N1NJ1, | ||||||
| POSTN, ITGB2, | ||||||
| SIRPA, THY1, | ||||||
| CD97, CDH13, | ||||||
| LGALS3BP, EZR, | ||||||
| CD44, ITGAX, | ||||||
| FAT1, TGFBI, CD4, | ||||||
| VCAN, GPNMB, | ||||||
| MFAP4, THBS1, | ||||||
| SYK | ||||||
| GO:0022610~ | 13.57 | B4GALT1, CCL2, | 3.06499958 | 5.76E−07 | 5.38E−05 | 9.89E−04 |
| biological adhesion | TNF, OLR1, PDPN, | |||||
| COL3A1, | ||||||
| COL15A1, | ||||||
| CCL4L1, NINJ1, | ||||||
| POSTN, ITGB2, | ||||||
| SIRPA, THY1, | ||||||
| CD97, CDH13, | ||||||
| LGALS31BP, EZR, | ||||||
| CD44, ITGAX, | ||||||
| FAT1, TGFBI, CD4, | ||||||
| VCAN, GPNMB, | ||||||
| MEAP4, THBS1, | ||||||
| SYK | ||||||
| GO:0006959~ | 5.03 | C1QA, CD83, | 10.07297096 | 5.83E-07 | 5.201E−05 | 9.99E−04 |
| humoral immune | C1QB, GPR183, | |||||
| response | TNF, CCL2, C3, C2 | |||||
| VS1G4, C1QC | ||||||
| GO:0042981~ | 14.57 | BID, TNF, CCL2, | 2.870295581 | 7.13E−07 | 6.08E−05 | 0.001223367 |
| regulation of | TLR2, AKAP13, | |||||
| apoptosis | IL10, CD74, | |||||
| CITED2, GPX1, | ||||||
| CD44, APOE, | ||||||
| HMOX1, CHST11, | ||||||
| IL1B, THBS1, | ||||||
| BMF, PHLDA1 | ||||||
| B4GALT1, CEBPB, | ||||||
| LGALS1, BCL2A1, | ||||||
| NR4A2, PIM3, | ||||||
| PPIF, CDH13, | ||||||
| NUPR1, CTSB, | ||||||
| TNFAIP3, PRNP | ||||||
| GO:0009719~ | 10.05 | IRS2, TNP, EGR2, | 3.929702251 | 7.32E−07 | 5.98E−05 | 0.001255444 |
| response to | CCL2, LYN, | |||||
| endogenous | PDGFA, GRB2, | |||||
| stimulus | IL1RN, NR4A2, | |||||
| FBP1, NR4A3, | ||||||
| IL10, CDH13, | ||||||
| C1QB, CCND1, | ||||||
| HMOX1, IDH1, | ||||||
| IL1B, COLIA1, | ||||||
| THBS1 | ||||||
| GO:0043067~ | 14.57 | BID, TNF, CCL2, | 2.842016807 | 8.69E−07 | 6.82E−05 | 0.001490175 |
| regulation of | TLR2, AKAP13, | |||||
| programmed cell | IL10, CD74, | |||||
| death | CITED2, GPX1 | |||||
| CD44, APOE, | ||||||
| HMOX1, CHST11, | ||||||
| IL1B, THBS1, | ||||||
| BMF, PHLDA1, | ||||||
| B4GALT1, CEBPB, | ||||||
| LGALS1, BCL2A1, | ||||||
| NR4A2, PIM3, | ||||||
| PPIF, CDH13, | ||||||
| NUPR1, CTSB, | ||||||
| TNFAIP3, PRNP | ||||||
| GO:0010941~ | 14.57 | BID, TNF, CCL2, | 2.831555395 | 9.35E−07 | 7.05E−05 | 0.001603421 |
| regulation of cell | TLR2, AKAP13, | |||||
| death | IL10, CD74, | |||||
| CITED2, GPX1, | ||||||
| CD44, APOE, | ||||||
| HMOX1, CHST11, | ||||||
| IL1B, THBS1, | ||||||
| BMF, PHLDA1 | ||||||
| B4GALT1, CEBPB, | ||||||
| LGALS1, BCL2A1, | ||||||
| NR4A2, PIM3, | ||||||
| PPIF, CDH13, | ||||||
| NUPR1, CTSB, | ||||||
| TNFAIP3, PRNP | ||||||
| GO:0019886~ | 2.51 | IFI30, FCER1G, | 49.73529412 | 1.58E−06 | 1.15E−04 | 0.002714716 |
| antigen processing | HLA-DOA, CD74, | |||||
| and presentation | HLA-DRA | |||||
| of exogenous | ||||||
| peptide antigen | ||||||
| via MHC class II | ||||||
| GO:0002495~ | 2.51 | IFI30, FCER1G, | 49.73529412 | 1.58E−06 | 1.15E−04 | 0.002714716 |
| antigen processing | HLA-DOA, CD74, | |||||
| and presentation | HLA-DRA | |||||
| of peptide | ||||||
| antigen via MHC | ||||||
| class II | ||||||
| GO:0006916~ | 7.04 | CCL2, CEBPB, | 5.40809652 | 1.86E−06 | 1.31E−04 | 0.00319842 |
| anti-apoptosis | TNF, BCL2A1, | |||||
| IL10, CITED2, | ||||||
| CDH13, GPX1, | ||||||
| APOE, HMOX1, | ||||||
| 1L1B, TNFAIP3, | ||||||
| THBS1, PRNP | ||||||
| GO:0016477~ | 8.04 | B4GALT1, GPX1, | 4.61312873 | 1.92E−06 | 1.30E−04 | 0.003292614 |
| cell migration | CDH13, TNF, | |||||
| CCL2, CD44, | ||||||
| CXCR4, CXCL16, | ||||||
| NR4A2, IL1B, | ||||||
| ITGB2, VCAN, | ||||||
| THBS1, IL10, | ||||||
| PLAU, SYK | ||||||
| GO:0006928~ | 10.55 | B4GALT1, | 3.518117647 | 1.97E−06 | 1.29E−04 | 0.003387397 |
| cell motion | DNAH9, TNF, | |||||
| EGR2, CCL2, | ||||||
| NR4A2, CCL4L1, | ||||||
| ITGB2, IL10, | ||||||
| PLAUR, CD97, | ||||||
| CDH13, GPX1, | ||||||
| CD44, CXCR4, | ||||||
| CXCL16, IL1B, | ||||||
| VCAN, THBS1, | ||||||
| PLAU, SYK | ||||||
| GO:0043066~ | 9.05 | TNF, CCL2, | 4.046261216 | 2.12E−06 | 1.34E−04 | 0.003639777 |
| negative regulation | CEBPB, BCL2A1, | |||||
| of apoptosis | NR4A2, PIM3, | |||||
| IL10, CD74, | ||||||
| CITED2, CDH13, | ||||||
| GPX1, APOE, | ||||||
| HMOX1, CHST11, | ||||||
| IL1B, TNFAIP3, | ||||||
| THBS1, PRNP | ||||||
| (GO:0031099~ | 4.52 | GPX1, CCND1, | 10.37953964 | 2.20E−06 | 1.35E−04 | 0.00377086 |
| regeneration | CCL2, AXL, NINJ1 | |||||
| VCAN, NR4A3, | ||||||
| PLAU, PLAUR, | ||||||
| GO:0043069~ | 9.05 | TNF, CCL2, | 3.989906603 | 2.57E−06 | 1.53E−04 | 0.004401468 |
| negative regulation | CEBPB, BCL2A1, | |||||
| of programmed | NR4A2, PIM3, | |||||
| cell death | IL10, CD74, | |||||
| CITED2, CDH13, | ||||||
| GPX1, APOE, | ||||||
| HMOX1, CHST11, | ||||||
| L1B, TNFAIP3, | ||||||
| THBS1, PRNP | ||||||
| GO:0060548~ | 9.05 | TNF, CCL2, | 3.978823529 | 2.66E−06 | 1.51E−04 | 0.004570045 |
| negative regulation | ||||||
| of cell death | CEBPB, BCL2A1, | |||||
| NR4A2, PIM3, | ||||||
| IL10, CD74, | ||||||
| CITED2, CDH13, | ||||||
| GPX1, APOE, | ||||||
| HMOX1, CHST11, | ||||||
| IL1B, TNFAIP3, | ||||||
| THBS1, PRNP | ||||||
| GO:0002504~ | 3.52 | HLA-DRB1, IFI30, | 16.8798574 | 2.91E−06 | 1.63E−04 | 0.0049961.37 |
| antigen processing | FCER1G, HLA- | |||||
| and presentation | DOA, HLA-DQA2, | |||||
| of peptide or | CD74, HLA-DRA | |||||
| polysaccharide | ||||||
| antigen via MHC | ||||||
| class 11 | ||||||
| GO:0009725~ | 9.05 | IRS2, TNT, EGR2, | 3.902933162 | 3.45E−06 | 1.88E−04 | 0.005922811 |
| response to hormone | CCL2, LYN, | |||||
| stimulus | PDGFA, GRB2, | |||||
| IL1RN, FBP1, | ||||||
| NR4A3, IL10, | ||||||
| C1QB, CCND1, | ||||||
| HMOX1, IDH1, | ||||||
| IL1B, COL1A1, | ||||||
| THBS1 | ||||||
| GO:0016064~ | 4.02 | C1QA, C1QB, C3, | 11.78910675 | 4.531E−06 | 2.401E−04 | 0.007772813 |
| immunoglobulin | FCER1G, C2, | |||||
| mediated immune | C1QC, CD74, | |||||
| response | HLA-DRA | |||||
| GO:0002250~ | 4.52 | C1QA, C1QB, C3, | 9.301145913 | 5.08E−06 | 2.62E−04 | 0.008718605 |
| adaptive immune | FCER1G, C2, | |||||
| response | C1QC, CD74, IL10, | |||||
| HLA-DRA | ||||||
| GO:0002460~ | 4.52 | C1QA, C1QB, C3, | 9.301145913 | 5.08E−06 | 2.62E−04 | 0.008718605 |
| adaptive immune | FCER1G, C2, | |||||
| response based | C1QC, CD74, IL10, | |||||
| on somatic | HLA-DRA | |||||
| recombination of | ||||||
| immune receptors | ||||||
| built from | ||||||
| immunoglobulin | ||||||
| superfamily | ||||||
| domains | ||||||
| GO:0051270~ | 6.53 | B4GALT1, IRS2, | 5.360073148 | 5.44E−06 | 2.74E−04 | 0.009339329 |
| regulation of cell | LYN, PDGFA, | |||||
| motion | PDPN, THY1, | |||||
| CITED2, CDH13, | ||||||
| APOE, CXCR4, | ||||||
| HMOX1, CXCL16, | ||||||
| TMBS1 | ||||||
| GO:0019724~ | 4.02 | C1QA, C1QB, C3, | 11.36806723 | 5.81E−06 | 2.85E−04 | 0.00997394 |
| B cell mediated | FCER1G, C2, | |||||
| immunity | C1QC, CD74, | |||||
| HLA-DRA | ||||||
| GO:0007610~ | 10.05 | C3AR1, EGR2, | 3.393452904 | 6.33E−06 | 3.03E−04 | 0.010861559 |
| behavior | CCL2, C5AR1, | |||||
| CMKLR1, PDGFA, | ||||||
| CXCL2, NR4A2, | ||||||
| CCL4L1, ITGB2, | ||||||
| NR4A3, IL10, | ||||||
| PLAUR, CCL20, | ||||||
| CXCR4, CXCL16, | ||||||
| ILIB, CMTM3, | ||||||
| PLAU, SYK | ||||||
| GO:0050900~ | 4.02 | B4GALT1, TNF, | 11.16862745 | 6.55E−06 | 3.06E−04 | 0.011244287 |
| leukocyte | CCL2, CXCL16, | |||||
| migration | 1L1B, ITGB2, IL10, | |||||
| SYK | ||||||
| GO:0051241~ | 6.03 | CD83, TNF | 5.82266858 | 6.59E−06 | 3.01E−04 | 0.011303048 |
| negative regulation | PDGFA, APOE, | |||||
| of multicellular | HMOX1, LGMN, | |||||
| organismal | CST3, APOC1, | |||||
| process | VS1G4, THBS1, | |||||
| IL10, PLAU | ||||||
| GO:0048870~ | 8.04 | B4GALT1 , GPX1, | 4.147307913 | 7.06E−06 | 3.15E−04 | 0.01210256 |
| cell motility | CDH13, TNF, | |||||
| CCL2, CD44, | ||||||
| CXCR4, CXCL16, | ||||||
| NR4A2, IL1B, | ||||||
| ITGB2, VCAN, | ||||||
| THBS1, IL10, | ||||||
| PLAU, SYK | ||||||
| GO:0051674~ | 8.04 | B4GALT1, GPX1, | 4.147307913 | 7.06E−06 | 3.15E−4 | 0.01210256 |
| localization of cell | CDH13, TNF, | |||||
| CCL2, CD44, | ||||||
| CXCR4, CXCL16, | ||||||
| NR4A2, IL1B, | ||||||
| ITGB2, VCAN, | ||||||
| THBS1, IL10, | ||||||
| PLAU, SYK | ||||||
| GO:0002.478~ | 2.51 | IF130, FCER1G, | 36.17112299 | 7.24E−06 | 3.16E−04 | 0.012693 |
| antigen processing | HLA-DOA, CD74, | |||||
| and presentation | HLA-DRA | |||||
| of exogenous | ||||||
| peptide antigen | ||||||
| GO:0002694~ | 6.03 | CD83, HMOX1, | 5.752515946 | 7.40E−06 | 3.16E−04 | 0.012696405 |
| regulation of | IL1B, CD4, HLA- | |||||
| leukocyte | DOA, VSIG4, | |||||
| activation | THBS1, CD74, | |||||
| SASH3, IL10, | ||||||
| THY1, SYK | ||||||
| GO:0070482~ | 5.53 | CCL2, PDPN, | 6.20809345 | 1.07E−05 | 4.47E−04 | 0.018391701 |
| response to oxygen | CXCR4, PDGFA, | |||||
| levels | HMOX1, NR4A2, | |||||
| HIF3A, THBS1, | ||||||
| MMP2, PLAU, | ||||||
| CITED2 | ||||||
| GO:0002443~ | 4.52 | C1QA, C1QB, | 8.327770178 | 1.17E−05 | 4.76E−04 | 0.019987007 |
| ukocyte mediated | LYN, C3, FCER1G, | |||||
| immunity | C2, C1QC, CD74, | |||||
| HLA-DRA | ||||||
| GO:0050863~ | 5.03 | CD83, IL1B, CD4, | 6.801407743 | 1.56E−05 | 6.24E−04 | 0.026744069 |
| regulation of T cell | HLA-DOA, VSIG4 | |||||
| activation | CD74, SASH3, | |||||
| IL10, THY1, SYK | ||||||
| GO:0001819~ | 4.52 | CD83, TNF, | 7.957647059 | 1.63E−05 | 6.40E−04 | 0.027988484 |
| positive regulation | ATP6AP2, TLR2, | |||||
| of cytokine | FCER1G, ILIB, | |||||
| production | TIMS1, SASH3, | |||||
| CD14 | ||||||
| GO:0019884~ | 2.51 | IF130, FCER1G, | 28.42016807 | 2.13E−05 | 8.21E−04 | 0.036600887 |
| antigen processing | HLA-DOA, CD74, | |||||
| and presentation | HLA-DRA | |||||
| of exogenous | ||||||
| antigen | ||||||
| GO:0002449~ | 4.02 | CIQA, C1QB, C3, | 9.094453782 | 2.59E−05 | 9.78E−04 | 0.044487655 |
| lymphocyte | FCER1G, C2, | |||||
| mediated | C1QC, CD74, | |||||
| immunity | HLA-DRA | |||||
| GO:0048545~ | 6.03 | C1QB, CCND1, | 4.973529412 | 2.91E−05 | 0.00107648 | 0.049898956 |
| response to steroid | TNF, CCL2, | |||||
| hormone stimulus | PDGFA, HMOX1 | |||||
| IL1RN, IL1B, | ||||||
| IDH1, COL1A1, | ||||||
| THBS1, IL10 | ||||||
RUNX1 is Upregulated in Cultured EC Exposed to High Glucose
Hyperglycemia is a major risk factor for progression to PDR in diabetic patients (The Diabetes Control and Complications Trial Research Group, Diabetes, 1995, 44(8):968-983). qRT-PCR was used to screen the candidate gene list for genes regulated by high glucose in primary cultures of HRMECs. Four out of one hundred and one genes were glucose responsive consistent with transcriptomic data (fold change ±SEM): RUNX1 (2.9 fold change), peptidyl-prolyl cis-trans isomerase F (PPIF; 3.6 fold change), serine/threonine-protein kinase PIM3 (Pim3; 3.9 fold change), and CD44 (3.5 fold change) (FIG. 3A). These changes were consistent with results from RNA-sequencing (FIG. 3B). RUNX1 is involved in endothelial cell biology and may have a role upstream of PPIF and CD44. Consistent with the transcriptomic and qPCR analyses, exposure of HRMEC cultures to high glucose induced a 30% increase in RUNX1 protein while osmotic controls had no significant effect (FIG. 4).
RUNX1 was focused on for further studies because of its documented roles in EC biology (The Diabetes Control and Complications Trial Research Group (1995) Diabetes 44(8):968-983; McLeod et al. (2012) Invest Ophthalmol Vis Sci 53(13):7912-7927; Iwatsuki et al. (2005) Oncogene 24(7):1129-1137). Exposure of 1HRMEC and HUVEC cultures to high glucose induced a 30% increase in RUNX1 protein while osmotic controls had no significant effect in HRMEC and HUVECs (FIGS. 4 A and B). Lastly, we confirmed increased RUNX1 protein expression in vessels from FVM compared to retina from non-diabetic control using immunohistochemical staining (FIG. 5E).
| TABLE 4 |
| Primer sequences used for qRT-PCR and transcriptomic analysis. |
| siRNA sequences are listed at the bottom of the table. |
| Previously publi shed sequences are denoted by an |
| asterisk (*). The underlined primers are those used |
| for analyses displayed in figures. |
| Gene/ | Abas | Forward Primer | Reverse primer | |
| Symbol | Array | (Genecards.org) | Sequence | Sequence |
| AIF1 * | Wound, | Allograft | GATGATGCTGGGCA | CCTTCAAATCAGG |
| Inflammation, | Inflammatory | AGAGAT | GCAACTC | |
| Proliferation, | Factor I | (SEQ ID NO: 37) | (SEQ ID NO: 38) | |
| Phosphoprotein | ||||
| AMPD3 | Phosphoprotein | Adenosine | AAAAGGAAGCCAAG | GGGACCGAATCAT |
| Monophosphate | GAGAGG | CTTGAAA | ||
| Deaminase 3 | (SEQ ID NO: 39) | (SEQ ID NO: 40) | ||
| APOE* | Signal, | Apolipoprotein E | TTCTGTGGGGTGCGT | FACACTGCCAGGC |
| Apoptosis, | TGCTG | GCTTCTG | ||
| Proliferation, | (SEQ ID NO: 41) | (SEQ ID NO: 42) | ||
| Phosphoprotein | ||||
| ARL4C | Metabolism | ADP-Ribosylation | CCAGTCCCTGCATAT | TTCACGAACTCGTT |
| Factor-Like 4C | CGTCAT | GAACTTGA | ||
| (SEQ ID NO: 43) | (SEQ ID NO: 44) | |||
| ATP6AP | Signal, | ATPase, H | AGGGAGTGAACAAA | TACCATATACACTC |
| 2* | Phosphoprotein | Transporting, | CTGGCTCTA | TATTCTCCAAAGGG |
| Lysosomal | (SEQ ID NO: 45) | TA | ||
| Accessory Protein | (SEQ ID NO: 46) | |||
| 2 | ||||
| AXL | Signal, | AXL Receptor | CCGTGGACCTACTCT | CCTTCTGCGTTATGG |
| Phosphoprotein | Tyrosine Kinase | GGCT | GCTTC | |
| (SEQ ID NO: 47) | (SEQ ID NO: 48) | |||
| B2M | Signal | Beta-2- | ACFGAATTCACCCCC | CCTCCATGATGCTG |
| Microglobulin | ACTGA | CTTACA | ||
| (SEQ ID NO: 49) | (SEQ ID NO: 50) | |||
| BASP1* | Phosphoprotein | Brain Abundant, | CGGAGCCCACTTAG | GAGAGAATGTTTG |
| Membrane | CTTGTC | TCACTCCCAAA | ||
| Attached Signal | (SEQ ID NO: 51) | (SEQ ID NO: 52) | ||
| Protein 1 | ||||
| BGN* | Signal | Biglycan | CTGGCATCCCCAAA | GCTCCCGTTCTCGA |
| GACCTC | TCATCC | |||
| (SEQ ID NO: 53) | (SEQ ID NO: 54) | |||
| BMF* | Apoptosis | Bcl2 Modifying | GACCCAACCCGGGA | GAAGGCCAGGGCC |
| Factor | GCTTGC | ACAGCAG | ||
| (SEQ ID NO: 55) | (SEQ ID NO: 56) | |||
| C10orf10 | Signal | Chromosome 10 | TGCCCACAATTCGG | AGACCTCACGTAG |
| Open Reading | GAGAC | TCATCCAG | ||
| Frame 10 | (SEQ ID NO: 57) | (SEQ ID NO: 58) | ||
| CCL2 | Signal, Wound, | Chemokine (C-C | GCCTCCAGCATGAA | AGGTGACTGGGGC |
| Apoptosis, | Motif) Lsgand 2 | AGTCTC | ATTGAT | |
| Inflammation | (SEQ ID NO: 59) | (SEQ ID NO: 60) | ||
| CCL20 | Signal, Wound, | Chemokine (C-C | GTGCTGCTACTCCAC | CGTGTGAAGCCCA |
| Inflammation | Motif) Ligand 20 | CTCTG | CAATAAA | |
| (SEQ ID NO: 61) | (SEQ ID NO: 62) | |||
| CCND1 | Proliferation, | Cyclin D1 | GCTGCGAAGTGGAA | CCTCCTTCTGCACA |
| Phosphoprotein | ACCATC | CATTTGAA | ||
| (SEQ ID NO: 63) | (SEQ ID NO: 64) | |||
| CD 14 | Signal, Wound, | CD14 Molecule | ACGCCAGAACCTTG | GCATGGATCTCCA |
| Inflammation | TGAGC | CCTCTACTG | ||
| (SEQ ID NO: 65) | (SEQ ID NO: 66) | |||
| CD300L | Signal. | CD300 Molecule- | GGAACCGACCTACT | CTGATGGTGCTGTA |
| F | Phosphoprotein | Like Family | GCAACAT | TFCCGTG |
| Member F | (SEQ ID NO: 67) | (SEQ ID NO: 68) | ||
| CD44* | Signal, Wound, | CD44 Molecule | CGGACACCATGGAC | GAAAGCCTTGCAG |
| Apoptosis, | (Indian Blood | AAGTTT | AGGTCAG | |
| Inflammation, | Group) | (SEQ ID NO: 69) | (SEQ ID NO: 70) | |
| Phosphoprotein | ||||
| CD83 | Signal | CD83 Molecule | CTCCGAAGATGTGG | TCCATCCTCTCTTC |
| ACTTGC | ACCACC | |||
| (SEQ ID NO: 71) | (SEQ ID NO: 72) | |||
| CDCP1 | Signal, | CUB Domain | CTGAACTGCGGGGT | GGCAGAGCAATCT |
| Phosphoprotein | Containing Protein | CTCTAT | CAAAAGC | |
| 1 | (SEQ ID NQ: 73) | (SEQ ID NQ: 74) | ||
| CDH13 | Signal. | Cadherin 13 | AGTGTTCCATATCAA | CGAGACCTCATAG |
| Apoptosis, | TCAGCCAG | CGTAGCTT | ||
| Angiogenesis, | (SEQ ID NQ: 75) | (SEQ ID NO: 76) | ||
| Proliferation, | ||||
| Phosphoprotein | ||||
| CECR1 | Signal | Cat Eye Syndrome | CAGAGAGCATCTGG | TCATGGTGCTCTCC |
| Chromosome | CTTCAA | ACTGAG | ||
| Region, Candidate | (SEQ ID NO: 77) | (SEQ ID NQ: 78) | ||
| CHMP1 | Cell Cycle | Charged | AAAGAACTGAGTAG | TGTATCCTCGCAAC |
| B | Multivesicular | GAGTGCCA | TTCCATGT | |
| Body Protein 1B | (SEQ ID NO: 79) | (SEQ ID NO: 80) | ||
| CITST11 | Apoptosis, | Carbohydrate | TCCCTITGGTGTGGA | GCAGGACAGCAGT |
| Proliferation | (Chondroitin 4) | CATCT | GTTTGAG | |
| Sulfotransferase 11 | (SEQ ID NO: 81) | (SEQ ID NO: 82) | ||
| COLEC1 | Phosphoprote in | Colicctin Sub- | AGAGGAGGAGGAGC | TGATAGAAAACTT |
| 2 | Family Member 12 | TGCAAT | CAGTGCCCA | |
| (SEQ ID NO: 83) | (SEQ ID NO: 84) | |||
| CREGI | Coll Cycle | Cellular Repressor | GGCGTGCCCTATTTC | CAAAGTCATGGTC |
| Of E1A-Stimulated | TACCTG | AGTGTAGCAT | ||
| Genes 1 | (SEQ TD NO: 85) | (SEQ ID NO: 86) | ||
| CST3 | Signal | Cystatin C | CCAGCAACGACATG | CAGCTCCACGTCC |
| TACCAC | AAGAAGT | |||
| (SEQ ID NO: 87) | (SEQ ID NO: 88) | |||
| CTSB | Signal, Wound, | Cathepsin B | ACAACGTGGACATG | TCGGTAAACATAA |
| Apoptosis | AGCTACT | ctctctgggg | ||
| (SEQ ID NO: 89) | (SEQ ID NO: 90) | |||
| CTSD | Signal | Catbepsin D | AGCCCTCCAGCCTTC | CGGATGGACGTGA |
| TG | ACTTGT | |||
| (SEQ ID NO: 91) | (SEQ ID NO: 92) | |||
| CTSL | Metabolism | Cathepsin L | GCGCGTGACTGGTT | AAAGGCAGCAAGG |
| GAG | ATGAGTG | |||
| (SEQ ID NO: 93) | (SEQ ID NO: 94) | |||
| CTSS | Signal | Cathepsin S | CTTGTGGTTGGCTAT | CCTTTATTTCTTGC |
| GGTGAT | CATCCG | |||
| (SEQ ID NO: 95) | (SEQ ID NO: 96) | |||
| CXCL16 | Signal | Chemokine (C-X- | GTGTGTGGAGGCA A | CACAATCCCCGAG |
| C Motif) Ligand 16 | CAAGG | TAAGCAT | ||
| (SEQ ID NO: 97) | (SEQ ID NO: 98) | |||
| CXCL2 | Signal. Wound. | Chemokine (C-X- | GGGCAGAAAGCTTG | GCTTCCTCCTTCCT |
| Inflammation | C Motif) Ligand 2 | TCTCAA | TCTGGT | |
| (SEQ ID NO: 99) | (SEQ ID NO: 300) | |||
| CXCR4* | Wound. | Chemokine (C-X- | CCAGTAGCCACCGC | ATAGTCCCCTGAG |
| Angiogenesis, | C Motif) Receptor | ATCT | CCCATTT | |
| Inflammation, | 4 | (SEQ ID NO: 101) | (SEQ ID NO: 102) | |
| Phosphoprotein | ||||
| DBT | Phosphoprotein | Diazepam Binding | TGGCCACTACAAAC | TCCCTTTCAGCTCA |
| Inhibitor (GABA | AAGCAA | TTCCAG | ||
| Receptor | (SEQ ID NO: 103) | (SEQ ID NO: 104) | ||
| Modulator, Acyl- | ||||
| CoA Binding | ||||
| Protein) | ||||
| DHRS3 | Stress response | Dehyd rogenase/R | TTCCTGCCACGTATG | TTTGGATGTGCAGT |
| eductase (SDR | CTGG | AGTCGATG | ||
| Family) Member 3 | (SEQ ID NO: 105) | (SEQ ID NO: 106) | ||
| EGR2 | Phosphoprotein | Early Growth | TTGACCAGATGAAC | AGCAAAGCTGCTG |
| Response 2 | GGAGTG | GGATATG | ||
| (SEQ ID NO: 107) | (SEQ ID NO: 308) | |||
| EPB41L3 | Cell Structure | Erythrocyte | GAGCCTAGTCCCCA | GCTTGGATTCCGA |
| Membrane Protein | CGC | GTCTGAT | ||
| Band 4.1-Like 3 | (SEQ ID NO: 109) | (SEQ ID NO: 110) | ||
| EZR | Phosphoprotein | Ezrin | ACCAATCAATGTCC | GCCGATAGTCTTTA |
| GAGTTACC | CCACCTGA | |||
| (SEQ ID NO: 111) | (SEQ ID NO: 112) | |||
| FAM49A | Ssgnal | Family With | AGCTAAGCTGGTTC | GACTTTGAGCAGG |
| Sequence | ATCCCA | TTTCCCA | ||
| Similarity 49, | (SEQ ID NO: 113) | (SEQ ID NO: 114) | ||
| Member A | ||||
| FAT1 | Signal, | FAT Atypical | CATCCTGTCAAGAT | TCCGAGAATGTAC |
| Phosphoprotein | Cadherin 1 | GGGTGTTT | TCTTCAGCTT | |
| (SEQ ID NO: 115) | (SEQ ID NO: 116) | |||
| FSCN1 | Phosphoprotein | Fascin Actin- | CAAGGACGAGCTCT | TGATTGGCAGACA |
| Bundling | TTGCTC | GGTCCAT | ||
| Protein 1 | (SEQ ID NO: 117) | (SEQ ID NO: 118) | ||
| G0S2 | Phosphoprotein | GO/G1 Switch 2 | CTGACCGCTGCCAA | CTCCTGGACCGTTT |
| CFG | CCATCT | |||
| (SEQ ID NO: 119) | (SEQ ID NO: 120) | |||
| GAL3ST | Signal | Galactose-3-O- | TCCACATCCTCTGTC | GGTCTCGGACAAT |
| 4 | Sulfotransferase 4 | ACCAC | GGAAAAA | |
| (SEQ ID NO: 121) | (SEQ ID NO: 122) | |||
| GPR183 | Phosphoprotein | G Protein- | ACTGGAGAATCGGA | AATGAAGCGGTCA |
| Coupled Receptor | GATGCCT | ATACTCAGG | ||
| 183 | (SEQ ID NO: 123) | (SEQ ID NO: 124) | ||
| GPX1* | Wound, | Glutathione | CAACCAGTTTGGGC | GTTCACCTCGCACT |
| Apoptosis, | Peroxidase 1 | ATCAGR | TCTCG | |
| Angiogenesis, | (SEQ ID NO: 125) | (SEQ ID NO: 126) | ||
| Proliferation | ||||
| CRN | Signal, | Granulin | AGGAGAACGCTACC | GGCAGCAGGTATA |
| Proliferation | ACGGA | GCCATCTG | ||
| (SEQ ID NO: 127) | (SEQ ID NO: 128) | |||
| GTF2B | Phosphoprotein | General | GCCGGTGATATGAT | GTCATTGCTGAAA |
| Transcription | CTGTCC | GTTCGCC | ||
| Factor IIB | (SEQ ID NO: 129) | (SEQ ID NO: 130) | ||
| HES1 | Signal | Fles Family | ACGTGCGAGGGCGT | GGGGTAGGTCATG |
| BHLH | TAATAC | GCATTGA | ||
| Transcription | (SEQ ID NO: 131) | (SEQ ID NO: 132) | ||
| Factor 1 | ||||
| HIF3A | Stress response | Hypoxia Inducible | CCCAGTCGGAGAGT | GAATGGGTCTGCG |
| Factor 3, Alpha | ATCGTC | AGAGTGT | ||
| Subunit | (SEQ ID NO: 133) | (SEQ ID NO: 134) | ||
| HPRT1 | Metabolism | Hypoxan thine | CCTGGCGTCGTGATT | AGACGTTCAGTCCT |
| Phosphoribosyltran | AGTGAT | GTCCATAA | ||
| sferase 1 | (SEQ ID NO: 135) | (SEQ ID NO: 136) | ||
| HTRA1* | Signal | HtrA Serine | TGGAATCTCCTTTGC | TTCTTGG |
| Peptidase 1 | AATCC | TGATGGCTTTTCC | ||
| (SEQ ID NO: 137) | (SEQ ID NO: 138) | |||
| 1DH1 | Metabolism | Isocitrate | GTCGTCATGCTTATG | CTTTTGGGTTCCGT |
| Dehydrogenase 1 | GGGAT | CACTTG | ||
| (NADP+), Soluble | (SEQ ID NO: 139) | (SEQ ID NO: 140) | ||
| IF130 | Signal, | Interferon, | GCTAGCCTTCCTGAC | CCATGATAGTGTCT |
| Proliferation, | Gamma-Inducible | CATTG | GGCGAC | |
| Phosphoprotein | Protein 30 | (SEQ ID NO: 141) | (SEQ ID NO: 142) | |
| IGFBP3 | Signal, | Insulin-like | CTCTGCGTCAAC | CGGTCTTCCTCC |
| Angiogenesis | growth factor- | GCTAGTGC | GAC TCA CT | |
| binding protein 3 | (SEQ ID NO: 143) | (SEQ ID NO: 144) | ||
| IRAK2 | Wound, | Interleukin-1 | CTGCCACCCCAATGT | AGGGAACCATTTG |
| Inflammation | Receptor- | CTTACC | CCATGTAG | |
| Associated Kinase | (SEQ ID NO: 145) | (SEQ ID NO: 146) | ||
| 2 | ||||
| 1RS2 | Proliferation, | Insulin Receptor | ACCTACGCCAGCAT | CATCCTGGTGATA |
| Phosphoprotein | Substrate 2 | TGACTT | AAGCCAGA | |
| (SEQ ID NO: 147) | (SEQ ID NO: 148) | |||
| LAPTM5 | Hematopoiesis | Lysosomal Protein | AGACCTGCTGCTGCT | CATGGGCCACCTCT |
| Transmembrane 5 | TCAAT | ACTGAG | ||
| (SEQ ID NO: 149) | (SEQ ID NO: 150) | |||
| LGALS1 | Signal | Lee tin. | TCGCCAGCAACCTG | GCACGAAGCTCTT |
| Galactoside- | AATCTC | AGCGTCA | ||
| Binding, | (SEQ ID NO: 151) | (SEQ ID NO: 152) | ||
| Soluble, 1 | ||||
| LGALS3 | Signal, | Lectin, | GAGGAGGCTCCACA | AGCAGCCACACCC |
| BP | Apoptosis, | Galactoside- | CGG | AGAAG |
| Phosphoprotein | Binding, | (SEQ ID NO: 153) | (SEQ ID NO: 154) | |
| Soluble, 3 | ||||
| Binding Protein | ||||
| LGMN | Signal | Legumain | CTGAAGATGGAGGC | TTGCGGTGAATGA |
| AAGCAC | TCTGGTA | |||
| (SEQ ID NO: 155) | (SEQ ID NO: 156) | |||
| LHFPL2 | Signal | Lipoma HMG1C | TCTTCAATGTCTGTG | GTCTATGGCCTTCT |
| Fusion Parmer- | GGCTG | GGCAAC | ||
| Like 2 | (SEQ ID NO: 157) | (SEQ ID NO: 158) | ||
| LST) | Proliferation, | Leukocyte | CTGGCCAGTTTGGA | TCCnPGCTCTTTTA |
| Phosphoprotein | Specific | GTCTGT | GGCGAA | |
| Transcript | (SEQ ID NO: 159) | (SEQ ID NO: 160) | ||
| 1 | ||||
| LTBP2 | Signal, | Latent | ACCTTGGCCAGAGC | TGGGAAGGGTGGG |
| Phosphoprotein | Transforming | ACAG | TCTG | |
| Growth | (SEQ ID NO: 161) | (SEQ ID NO: 162) | ||
| Factor Beta | ||||
| Binding Protein 2 | ||||
| LYN | Wound, | LYN Proto- | CTGAACTCAAGTCA | TCCATCGTCACTCA |
| Inflammation, | Oncogene, Src | CCGTGG | AGCTGT | |
| Proliferation, | Family | (SEQ ID NO: 163) | (SEQ ID NO: 164) | |
| Phosphoprotein | Tyrosine | |||
| Kinase | ||||
| MAFB | Hematopoiesis | V-Maf Avian | CATAGAGAACGTGG | ATGCCCGGAACTTT |
| Musculoaponeurotic | CAGCAA | TTCTTT | ||
| Fibrosarcoma | (SEQ ID NO: 165) | (SEQ ID NO: 166) | ||
| Oncogene | ||||
| Homolog B | ||||
| MMP19 | Signal, | Matrix | GCCTCGTTGTGGCCT | ATGCGGAAAGTCA |
| Angiogenesis | Metallopeptidase | AGAG | GGTGCTTC | |
| 19 | (SEQ ID NO: 167) | (SEQ ID NO: 168) | ||
| MMP2* | Signal, | Matrix | CAGATGCCTGGAAT | GCAGCCTAGCCAG |
| Phosphoprotein | Metallopeptidase 2 | GCCATC | TCGGATT | |
| (SEQ ID NO: 169) | (SEQ ID NO: 170) | |||
| NEK6 | Phosphoprotein | NIMA-Related | CAGGACTGTGTCAA | ATGTTCAGCTCGTT |
| Kinase 6 | GGAGATCG | GTCTTCG | ||
| (SEQ ID NO: 171) | (SEQ ID NO: 172) | |||
| NFKBIZ | Wound, | Nuclear Factor Of | ACACCCACAAACCA | GGCAAAACTGTGA |
| Inflammation | Kappa Light | ACTCTGG | TTCTGGACC | |
| Polypeptide Gene | (SEQ ID NO: 173) | (SEQ ID NO: 174) | ||
| Enhancer In B- | ||||
| Cells Inhibitor, | ||||
| Zeta | ||||
| N1NJ1 | Wound | Ninjurin 1 | ACCGAGGAGTACGA | GCTCTTCTTGCTGG |
| GCTCAA | CGTAAT | |||
| (SEQ ID NO: 175) | (SEQ ID NO: 176) | |||
| NPC'2 | Signal | Niemann-Pick | AGCTACATTCCTGCT | TGGGCTCACATTCA |
| Disease, Type C2 | CCTGG | CTTCCT | ||
| (SEQ ID NO: 177) | (SEQ ID NO: 178) | |||
| NR4A2* | Apoptosis, | Nuclear Receptor | CGACATTTCTGCCTT | GGTAAAGTGTCCA |
| Phosphoprotein | Subfamily 4, Group | CTCC | GGAAAAG | |
| A, Member 2 | (SEQ ID NO: 179) | (SEQ ID NO: 180) | ||
| ODC1 | Proliferation, | Ornithine | GGCTGCGACTCAGG | CCCTTGGAACAGC |
| Phosphoprotein | Decarboxylase 1 | CTC | AGTGAC | |
| (SEQ ID NO: 181) | (SEQ ID NO: 182) | |||
| OLFML2 | Signal | Olfactomedin- | CCCCGAAGAAGAAG | CCATATGTGTTCTG |
| B | Likc 2B | ATGACA | GGTGGTC | |
| (SEQ ID NO: 183) | (SEQ ID NO: 184) | |||
| PDGFA* | Signal, Wound, | Platelet-Derived | TCCACGCCATTAAG | CGTAAATGACCGT |
| Angiogenesis, | Growth Factor | CATGTG | CCTGGTCTT | |
| Proliferation | Alpha Polypeptide | (SEQ ID NO: 185) | (SEQ ID NO: 186) | |
| PHLDA1 | Apoptosis | Pleckstrin | CTCCAACTCTGCCTG | TGTTTTGCTTTTGA |
| Homology-Like | A A AGG | TCCAAGTG | ||
| Domain, Family A, | (SEQ ID NO: 187) | (SEQ ID NO: 188) | ||
| Member 1 | ||||
| PIM3 | Apoptosis, | PIM3 Proto- | AAGGACGAAAATCT | CGAAGTCGGTGTA |
| Phosphoprotein | Oncogene, | GCTTGTGG | GACCGTG | |
| Serine/Threonine | (SEQ ID NO: 189) | (SEQ ID NO: 190) | ||
| Kinase | ||||
| PLAU | Signal, Wound, | Plasminogen | GGGAATGGTCACTT | GGGCATGGTACGT |
| Angiogenesis, | Activator, | TTACCGAG | TTGCTG | |
| Proliferation, | Urokinase | (SEQ ID NO: 191) | (SEQ ID NO: 392) | |
| Phosphoprotein | ||||
| PLAUR | Signal, | Plasminogen | AGCCTTACCGAGGT | AAATGCATTCGAG |
| Wound | Activator, | TGTGTG | GTAACGG | |
| Urokinase | (SEQ ID NO: 193) | (SEQ ID NO: 194) | ||
| Receptor | ||||
| PLD3 | Signal | Phospholipase D | GGAGATCTGCCTCA | CCACGTTGAGTAG |
| Family, Member 3 | ATGGAA | AGCCTTCA | ||
| (SEQ ID NO: 195) | (SEQ ID NO: 196) | |||
| PMP22 | Proliferation | Peripheral Myelin | TCAGGAAATGTCCA | GCTGAAGATGATC |
| Protein 22 | CCACTG | GACAGGA | ||
| (SEQ ID NO: 197) | (SEQ ID NO: 198) | |||
| PPIB | Signal | Peptidylprolyl | AAGGACTTCATGAT | TGAAGTTCTCATCG |
| Isome rase B | CCAGGG | GGGAAG | ||
| (Cyclophilin B) | (SEQ ID NO: 199) | (SEQ ID NO: 200) | ||
| PPIF | Apoptosis | Peptidylprolyl | ACAGGGTGATCCCT | AAGTTCTCGTCAG |
| Isomerase F | TCCTTC | GAAAGCG | ||
| (SEQ ID NO: 201) | (SEQ ID NO: 202) | |||
| PRNP | Signal, | Prion Protein | CACGACTGCGTCAA | CTCCATCATCTTAA |
| Apoptosis, | TATCACA | CGTCGGTC | ||
| Phosphoprotein | (SEQ ID NO: 203) | (SEQ ID NO: 204) | ||
| RCC2 | Phosphoprote in | Regulator of | AAGGAGCGCGTCAA | GCTTGCTGTTTAGG |
| Chromosome | ACTTGAA | CACTTCTT | ||
| Condensation 2 | (SEQ ID NO: 205) | (SEQ ID NO: 206) | ||
| REL | Phosphoprotein | V-Rel Avian | GCAGAGGGGAATGC | AGAAGGGTATGTT |
| Reticulo- | GTTTTAG | CGGTTGTTG | ||
| endothelios | (SEQ ID NO: 207) | (SEQ ID NO: 208) | ||
| is Viral Oncogene | ||||
| Homolog | ||||
| RGS1 | Signal | Regulator of G- | GGAAAAACTTCTTG | TAGTCTTCACAAGC |
| Protein | CCAACC | CAGCCA | ||
| Signaling 1 | (SEQ ID NO: 209) | (SEQ ID NO: 210) | ||
| RHOG | Proliferation | Ras Honiolog | ACGATGCAGAGCAT | TTTGGGGAAAGCG |
| Family Member G | CAAGTG | TTAGTTG | ||
| (SEQ ID NO: 211) | (SEQ ID NO: 212) | |||
| RILPL2 | Signal | Rab Interacting | ACGTGTATGACATCT | ACGCGGACGACTT |
| Lysosomal | CCTACCTG | TGAACTG | ||
| Protein- | (SEQ ID NO: 213) | (SEQ ID NO: 214) | ||
| Like 2 | ||||
| RUNX1* | Phosphoprotein | Runt-Related | TCCACAAACCCACC | CGCTCGGAAAAGG |
| Transciption | GCAAGT | ACAAGC | ||
| Factor | (SEQ ID NO: 215) | (SEQ ID NO 216) | ||
| I | ||||
| RUNX2 | Phosphoprotein | Runt-Related | ACCATGGTGGAGAT | TCCCATCTGCTTACC |
| Tramciption | CATCGCCG | TCTCCGAGGG | ||
| Factor | (SEQ ID NO: 217) | (SEQ ID NO: 218) | ||
| 2 | ||||
| Runx3 | Phosphoprotein | Runt-Related | AGGCAATGACGA | GTGGGGTTGGTG |
| Transciption | GAACTACTCC | AAC ACA GT | ||
| Factor | (SEQ ID NO: 219) | (SEQ ID NO: 220) | ||
| 3 | ||||
| SAMSN1 | Phosphoprotein | SAM Domain, | TGCTCAAGAGAAAG | TTATTCCGAAAAC |
| SH3 Domain And | CCATCC | GATCGAAA | ||
| Nuclear | (SEQ ID NO: 221) | (SEQ ID NO: 222) | ||
| Localization | ||||
| Signals 1 | ||||
| SCO | Phosphoprotein | Stearoyl-CoA | TTCCTACCTGCAAGT | CCGAGCTTTGTAA |
| Desaturase | TCTACACC | GAGCGGT | ||
| (Delta- | (SEQ ID NO: 223) | (SEQ ID NO: 224) | ||
| 9-Desaturase) | ||||
| SDC4 | Signal, | Syndecan 4 | TCCCCACCGAACCC | CCTTGTTGGACACA |
| Phosphoprotein | AAGAA | TCCTCAC | ||
| (SEQ ID NO: 225) | (SEQ ID NO: 226) | |||
| SH2B3 | Phosphoprotein | SH2B Adaptor | CTGGAGCTCTTCGAC | GTTGTCAGGCATCT |
| Protein 3 | CCA | CAAGCC | ||
| (SEQ LD NO: 227) | (SEQ ID NO: 228) | |||
| SMS | Phosphoprotein | Spermine | CCTCACTATGGCAG | TCCTGGAAAATGG |
| Synthase | CAGCAC | ACTGGAG | ||
| (SEQ ID NO: 229) | (SEQ ID NO: 230) | |||
| THBS1 | Signal, Wound, | Thrombospondin | CAATGCCACAGTTC | CACAGCTCGTAGA |
| Apoptosis, | 1 | CTGATG | ACAGGAGG | |
| Angiogenesis, | (SEQ ID NO: 231) | (SEQ ID NO: 232) | ||
| Inflammation, | ||||
| Proliferation | ||||
| THY1* | Signal, | Thy-1 Cell | TCAGGAAATGGCTT | TCCTCAATGAGAT |
| Angiogenesis | Surface Antigen | TTCCCA | GCCATAAGCT | |
| (SEQ ID NO: 233) | (SEQ ID NO. 234) | |||
| TNFA1P | Angiogenesis, | Tumor Necrosis | CACCTACATGCTGCT | CCCATACCCTGCA |
| 2 | Phosphoprotein | Factor, Alpha- | GCTCT | GCTCAC |
| Induced Protein 2 | (SEQ ID NO: 235) | (SEQ ID NO. 236) | ||
| TNFA1P | Apoptosis | Tumor Necrosis | ttgtcctcagtttcg | ACTTCTCGACACCA |
| 3 | Factor. Alpha- | GGAGAT | GTTGAGTT | |
| Induced Protein 3 | (SEQ ID NO: 237) | (SEQ ID NO. 238) | ||
| TTYH2 | Phosphoprotein | Tweety Family | CCCCTGTCTCCGAGT | CTCCCGATTAGTGG |
| Member 2 | ACATGA | CACGTTC | ||
| (SEQ ID NO: 239) | (SEQ ID NO: 240) | |||
| UNC93B | Phosphoprotein | Unc-93 Homolog | TTTTGGAACGAAGT | GGCACAAGCGTGT |
| 1 | B1 (C. Elegans) | GGATGATGT | AGTAGC | |
| (SEQ ID NO: 241) | (SEQ ID NO. 242) | |||
| VAMP8 | Phosphoprotein | Vesicle- | ACTTGGAACATCTCC | CTTCCACCAGAATT |
| Associated | GCAAC | TCCGAG | ||
| Membrane Protein | (SEQ ID NO: 243) | (SEQ ID NO: 244) | ||
| 8 | ||||
| ZSW1M6 | Signal | Zinc Finger, | AAGCGGCTGCGTAG | GGCTCCGATTGTAT |
| SWIM-Type | ACAAC | TGCAGGT | ||
| Containing 6 | (SEQ ID NO: 245) | (SEQ ID NO: 246) | ||
| RUNX1 | small | hs.Ri.RUNX1.13.3 | CCUUUCAUGUUA | UCACUUGUUUGA |
| siRNA1 | interfering RNA | AUCAAACAAGUGA | UUAACAUGAAAGG | |
| (SEQ TO NO: 247) | GA | |||
| (SEQ ID NO: 248) | ||||
| RUNX1 | small | HSC.RNAI.N001 | ACUAGAUGAUCAGA | CCCGGGCUUGGUC |
| siRNA2 | interfering RNA | 001890.12.1 | CC AAGCCCGGG | UGAUCAUCUAGUU |
| (SEQ ID NO: 249) | U | |||
| (SEQ ID NO. 250) | ||||
| Control | small | Negative Control | ||
| siRNA | interfering RNA | 1:DS NC1 | ||
| siRNA sequences: |
| Human RUNX1 |
| Duplex name: hs.Ri.RUNX1.13.3 |
| Duplex sequences |
| 5′-rCrCrUrUrUrCrArUrGrUrUrArArUrCrArArArCrArArGrUGA-3′ |
| (SEQ ID NO: 247) |
| 5′-rUrCrArCrUrUrGrUrUrUrGrArUrUrArArCrArUrGrArArArGrGrGrA-3′ |
| (SEQ ID NO: 248) |
| 5′-CCUUUCAUGUUAAUCAAACAAGUGA-3′ |
| (SEQ ID NO: 247) |
| 3′-AGGGAAAGUACAAUUAGUUUGUUCACU-5′ |
| (SEQ ID NO: 248) |
| Human RUNX1 |
| Duplex name: HSC.RNAI.N001001890.121_10nm |
| Duplex sequences |
| 5′-rArCrUrArGrArUrGrArUrCrArGrArCrCrArArGrCrCrCrGGG-3′ |
| (SEQ ID NO: 249) |
| 5′-rCrCrCrGrGrGrCrUrUrGrGrUrCrUrGrArUrCrArUrCrUrArGrUrUrU-3′ |
| (SEQ ID NO: 250) |
| 5′-ACUAGAUGAUCAGACCAAGCCCGGG-3′ |
| (SEQ ID NO: 249) |
| 3′-UUUGAUCUACUAGUCUGGUUCGGGCCC-5′ |
| (SEQ ID NO: 250) |
| HumanPTM3 |
| Duplexname: hsRi.PIM3.131 |
| Duplex sequences |
| 5′-rGrCrCrUrGrArGrCrGrUrUrUrArArUrUrUrArUrUrCrArGTA-3′ |
| (SEQ ID NO: 251) |
| 5′-rUrArCrUrGrArArUrArArArUrUrArArArUrUrArArArCrGrCrUrCrArG |
| rGrCrUrC-3′(SEQ ID NO: 252) |
| 5′-CCUGAGCGUUUAAUUUAUUCAGTA-3′ |
| (SEQ ID NO: 251) |
| 3′-CUCGGACUCGCAAAUUAAAUAAGUCAU-5′ |
| (SEQ ID NO: 252) |
| Human PIM3 |
| Duplex name: hsRiPIM3.13.2 |
| Duplex sequences |
| 5′-rGrGrCrGrUrGrCrUrUrCrUrCrUrArCrGrArUrArUrGrGrUGT-3′ |
| (SEQ ID NO: 253) |
| 5-rArCrCrCrGrCrArCrGrArArGrArGrArUrGrCrUrArUrArCrCrArCrA-3′ |
| (SEQ ID NO: 254) |
| 5′-GGCGUGCUUCUCUACGAUAUGGUGT-3′ |
| (SEQ ID NO: 253) |
| 3′-ACCCGCACGAAGAGAUGCUAUACCACA-5′ |
| (SEQ ID NO: 254) |
| In the siRNA sequences shown above, each T may optionally be a U. |
RUNX1 is Upregulated in Human FVMs, Retinas of Mice with OIR, and Melanoma Tumor Vessels
To further investigate the relevance of these findings, sections of diabetic patient-derived FVMs and control retinas from non-diabetics were stained for the presence of RUNX1. There was strong RUNX1 staining in blood vessels of FVMs localized to the nuclei (FIG. 5B, D), in contrast to blood vessels in retinas from non-diabetics where RUNX1 immunostaining was undetectable (FIG. 5A, C). To test the hypothesis that elevated RUNX1 is associated with aberrant angiogenesis broadly, retinas from C57BL/6J mice with OIR were stained for RUNX1 expression (Smith L E, et al. (1994) Invest Ophthalmol Vis Sci 35(1):101-111). Immunostaining for isolectin B4 was used to visualize both normal retinal vessels and neovascular tufts. Neovascular tufts in these retina were strongly immuno-positive for RUNX1 whereas the underlying normal retinal vasculature was unstained (FIGS. 6A-C). Paraffin-embedded sections of human melanoma inoculated in nude mice also demonstrated positive immunostaining for Runx1 in nuclei of peritumoral vessels compared to normal capillaries of the hypodermis (Kozlowski et al. (1984) J Natl Cancer Inst 72(4):913-917). Control sections exposed to secondary antibody alone showed no specific staining (FIG. 6D). RUNX1 expression was mainly found in capillaries, consistent with RUNX1's role in angiogenesis (FIG. 6E-F).
RUNX1 Regulates Migration and Proliferation of Endothelial Cells In Vitro
siRNA knockdown was validated for specificity and efficacy and used to test RUNX1's angiogenic functions (FIGS. 10A and B). siRNA knockdown resulted in a 60% decrease in RUNX1 RNA expression and did not significantly affect RUNX2 or RUNX3 RNA expression. In addition, a canonical downstream target of RUNX1 activity was increased significantly for IGFBP3 (330% increase). The contribution of RUNX1 to EC migration was assayed by the scratch-wound assay and its role in proliferation was assayed using labeling of K167, a marker of cell proliferation. Knockdown of RUNX1 resulted in a 60% decrease in wound closure rate, suggesting a major role of RUNX1 in endothelial cell migration (FIG. 7). As a quality check, the coefficient of determination (r2 value) for the simple linear regression was calculated comparing wound closure (dependent variable) to time (independent variable) (control r2=0.99, scramble siRNA r2=0.97, and RUNX1 siRNA r2-0.97). EC transfected with RUNX1 siRNA had 60% fewer K167 positive cells compared to controls, indicating RUNX1 plays a significant role in retinal endothelial cell proliferation (FIG. 8).
Ro5-3335 RUNX1-CBFβ Inhibitor Blocks EC Tube Formation In Vitro and Aberrant Angiogenesis In Vivo
To investigate the potential therapeutic relevance of RUNX1, the small molecule Ro5-3335 RUNX1-CBFβ Inhibitor II was tested in vitro and in vivo (Namba et al. (2000) Oncogene 19(1). 106-114). Treatment with RUNX1 inhibitor reduced total tube length (18% reduction), nodes (35% reduction) and meshes (46% reduction), supporting RUNX1's role in vascular morphogenesis (FIG. 8C).
Neovascular tufts of P17 C57BL/6J mice with OIR identified by isolectin B4 and CD31 staining showed increased expression of RUNX1, whereas RUNX1 staining was absent from the underlying normal retinal vasculature, indicating a role for RUNX1 in active angiogenesis (FIG. 6E). In vivo testing of the effects on aberrant angiogenesis of RUNX1 inhibition was conducted by injecting Ro5-3335 intravitreally in mice with OIR. There was no significant change in the extent of vaso-obliteration and no effect was observed in the contralateral eye (data not shown). Eyes treated with inhibitor exhibited a 50% reduction in neovascularization compared to vehicle treated eyes (FIG. 6E).
Gene Profiling Analysis of Patient Derived Endothelial Cells Reveals Co-Expression of 16 Genes Involved in Angiogenesis. 12 of these Genes have Putative RUNX1 TFBSs.
In order to initially identify increased expression of RUNX1, RNA-Seq was performed on patient-derived ECs from patients with PDR, which led to the discovery of 200 differentially expressed genes (DEGs), these transcriptomes were deposited in the Gene Expression Omnibus (GSE94019). (Lam J D, Oh D J, Wong L L, et al. Identification of RUNX1 as a Mediator of Aberrant Retinal Angiogenesis. Diabetes. 2017.) Gene ontology analysis of this data set using Database for Annotation, Visualization, and Integrated Discovery (DAVID) (Huang da W, Sherman B T, Lempicki R A. Bioinformatics enrichment tools: paths toward the comprehensive functional analysis of large gene lists. Nucleic Acids Res. 2009; 37:1-13) revealed enrichment of several ontological processes directly associated with blood vessel development and differential expression of 16 key proteins involved in angiogenesis: COL4A 1, CCL2, MMP19, MMP2, SYK, THBS1, GPX1, TGFB1, PDGFA, THY1, HMOX1, TNFAIP2, HIF3A, COL15A1, B4GALT1, CDH13. Based on the assumption that these co-expressed genes are co-regulated by RUNX1, used oPOSSUM was used, which integrates a database of predicted, conserved TFBSs and statistical methods for identifying overrepresented gene sets. (Ho Sui S J, Mortimer J R, Arenillas D J, et al. oPOSSUM: identification of over-represented transcription factor binding sites in co-expressed genes. Nucleic Acids Res. 2005; 33:3154-3164) Identification of predicted RUNX1 TFBSs using oPOSSUM revealed that 12 of these transcripts had putative RUNX1 binding sites: B4GALT1, CCL2, CDH13, COL15A1, COL4A1, GPX1, HIF3A, PDGFA, SYK, TGFB1, THBS1, THY1. Thus, 12 out of 16 genes (75%) involved in angiogenesis have putative RUNX1 binding sites, whereas only 75 out of 200 (37.5%) DEGs have RUNX1 binding sites. This enrichment of angiogenic genes with RUNX1 TFBSs was found to be statistically significant with a p-value=0.0015 using a hypergeometric probability function. These data support our rationale that RUNX1 is a potential regulator of critical genes necessary for angiogenesis.
Identification of RUNX1 as a Mediator of Aberrant Angiogenesis
RUNX1 was identified as a gene dysregulated in patient-derived CD31+ vascular endothelial cells obtained from human PDR fibrovascular membranes (FVM) via transcriptomic analysis. In vitro studies using human retinal microvascular endothelial cells (HRMECs) showed increased RUNX1 RNA and protein expression in response to high glucose whereas RUNX1 inhibition reduced HRMEC migration, proliferation, and tube formation. Immunohistochemical staining for RUNX1 showed reactivity in vessels of patient-derived FVM and angiogenic tufts in the retina of mice with oxygen-induced retinopathy (OIR) and human melanoma xenografts, suggesting that RUNX1 upregulation is a hallmark of aberrant retinal angiogenesis. Inhibition of RUNX1 activity with the Ro5-3335 small molecule resulted in a significant reduction of neovascular tufts in OIR, supporting the feasibility of targeting RUNX1 in aberrant retinal angiogenesis.
To identify novel genes underlying aberrant retinal angiogenesis, whole transcriptomes of CD31+ cells from FVMs of PDR patients were analyzed. Gene ontology analysis of differentially regulated genes in ECs from FVMs showed enrichment of genes involved in immune response, wound healing, and vascular development functional categories. Four genes exhibited significant changes in expression in response to high glucose. Analyses of RUNX1 expression in FVMs, OIR samples, and melanoma samples along with in vitro functional studies suggest a role for RUNX1 in the regulation of proliferation, migration, and morphogenesis of EC in aberrant angiogenesis.
RUNX proteins have pleiotropic functions in vascular development, hematopoiesis, and cancer through direct transcriptional regulation of target genes and complex interactions with fundamental signaling mechanisms including Notch and Transforming growth factor beta (TGF-β) pathways [Burns et al. (2005) Genes Dev 19(19):2331-2342; I to Y & Miyazono K (2003) Curr Opin Genet Dev 13(1):43-47]. Mammals express three genes (RUNX1, RUNX2, and RUNX3) encoding the DNA binding α subunit of the core binding factor (CBF) transcriptional complex. Another gene encodes for the β subunit (CBFβ), which stabilizes the RUNX-DNA complex and prevents RUNX degradation [Lichtinger et al. (2010) Blood Cells Mol Dis 44(4):287-290; Michaud J, et al. (2008) BMC Genomics 9:363]. In early development, RUNX1 is a master regulator of the endothelial-hematopoietic transition through which blood cells are generated from endothelium, and though less studied, it is also implicated in angiogenesis and vasculogenesis [Burns et al. (2005) Genes Dev 19(19):2331-2342; Chen et al. (2009) Nature 457(7231):887-891; Iwatsuki K, et al. (2005) Oncogene 24(7):1129-1137; McLeod D S, et al. (2012) Invest Ophthalmol Vis Sci 53(13):7912-7927; Kalev-Zylinska M L, et al. (2002) Development 129(8):2015-2030; Namba K, et al. (2000) Oncogene 19(1):106-114; Lie A L M, et al. (2014) Blood 124(11):el 1-20].
Studies in model organisms have shown that glucose levels regulate hematopoietic stem cell production by endothelial-to-hematopoietic transition (EHT) in a RUNX1-dependent manner [Harris J M, et al. (2013) Blood 121(13):2483-2493]. High glucose triggers RUNX1 expression via reactive-oxygen species-mediated upregulation of hypoxia-inducible factor 1 [Harris J M, et al. (2013) Blood 121(13):2483-2493; Imanirad P, et al. (2014) Stem Cell Res 12(1):24-35]. CD44, PPIB, and PPIF, known targets of RUNX1, are also upregulated in CD31+ cells from PDR (Michaud J, et al. (2008) BMC Genomics 9.363). Without wishing to be bound by any scientific theory, the results herein demonstrate that high glucose can regulate RUNX1 and indicate that RUNX1 is a therapeutic target in conditions with aberrant retinal angiogenesis.
Previous studies of PDR have mainly focused on gene expression in FVMs or biomarkers in the vitreous [Ishikawa K, et al. (2015) Invest Ophthalmol Vis Sci 56(2):932-946; Yoshida S, et al. (2010) Br J Ophthalmol 94(6):795-801; McAuley A K, et al. (2014) J Diabetes Complications 28(3):419-425]. FVMs from PDR may be highly informative pathological tissues but are largely unstudied. The window for processing samples post-surgery is narrow and intraoperative confounders such as FVM size, location, and involvement of sensory retina further complicate successful sample acquisition and limit sample size Employing multiple sequencing analysis algorithms improved confidence in the results and reduced the dataset to a manageable size but reducing the pool of candidate genes invariably also excluded some genes of potential interest. Further characterization of candidate genes using different screening conditions may reveal involvement in other processes related to the pathobiology of PDR such as inflammation and oxidative stress.
The data herein shows elevated RUNX1 expression in ECs of patient-derived FVMs from patients with PDR. Also, the data herein demonstrate a role for RUNX1 in EC migration, proliferation, and vascular morphogenesis. Furthermore, selectively enhanced expression of RUNX1 in neovascular tufts is shown in an experimental model of OIR and that inhibition of RUNX1 function reduced retinal neovascularization. These findings, including the high glucose-dependent expression of RUNX1, indicate that PIM3 and RUNX1 are useful targets for treating aberrant angiogenesis in multiple conditions.
Profiling purified ECs unmasks changes that would otherwise be obscured by analysis of mixed cell populations. These findings, including the glucose activation of RUNX1, identify a novel pathway of for therapeutic targeting, and show that RUNX1 is involved in pathologic retinal angiogenesis. Therefore, inhibition of expression or activity in the eye leads to a clinical benefit to patents afflicted with the pathologies described herein, including retinal neovascular disorders such as PDR, ROP, AMD, retinal vein occlusions, ocular ischemic syndrome, neovascular glaucoma, retinal hemangiomas, and other conditions characterized by aberrant angiogenesis.
Methods
FVMs were collected and CD31+ cells were isolated as previously described [Kim L A, et al. (2015) Mol Vis 21:673-687]. RNA-sequencing was performed using an Illumina HiSeq 2000 (Illumina Inc.), aligned with TopHat (Trapnell et al. (2009) Bioinformatics 25(9):1105-1111], and analyzed using Partek Flow, CuffLinks, EdgeR, and DESeq2. A mixed model ANOVA was used with a threshold false discovery rate (FDR) of <0.05 and fold change ≥±2 for significance. Gene Ontology was determined using the Database for Annotation, Visualization, and Integrated Discovery (DAVID). Gene Ontology was determined using the DAVID [Huang et al. (2009) Nucleic Acids Res 37(1):1-13]. FVMs and cells were immunostained with standard protocols for paraffin embedded samples. HRMECs were exposed to treatment media for 72 h before the following assays were conducted: qRT-PCR followed manufacturer's instructions (Qiagen); gene knockdown was achieved with 100 nM siRNA using DharmaFECT 1; standard western blot protocols were used with fluorescent visualization; scratch assays followed standard protocols, monitored for 12 h, and quantified with the TScratch Matlab module [Liang et al. Nature protocols 2(2):329-333; Geback et al. (2009) Biotechniques 46(4):265-274].
Control retinal samples were obtained from cadaver eyes of subject without a diagnosis of diabetes mellitus.
Human Study Approval and Design: Research protocols adhered to the Association for Research in Vision and Ophthamology (ARVO) Statement on Human Subjects and the tenets of the Declaration of Helsinki.
Inclusion criteria were: aged 18-70, diagnosis of PDR as determined by Early Treatment Diabetic Retinopathy Study (ETDRS) criteria, active fibrovascular proliferation diagnosed by a study ophthalmologist, and evidence of retinal detachment (tractional or rhegmatogenous) or non-clearing vitreous hemorrhage requiring pars plana vitrectomy. Exclusion criteria were: age less than 18 years old, pregnancy, history of prior penetrating eye trauma, not medically cleared for surgery, history of adverse reactions to fluorescein dye, chronic use of systemic or ocular medications for diseases other than diabetes, or PDR with concomitant radiation retinopathy.
Pre- and post-operation assessments were performed in compliance with standards of care; this includes visual acuity assessment, complete ocular examination, fundus photography with wide field imaging (Optos), and fluorescein angiography where indicated and possible. All patients underwent standard 23-gauge three-port pars plana vitrectomy with membrane peeling, endolaser panretinal photocoagulation, and retinal tamponade with either non-expansile perfluoropropane gas (C3F8) or silicone oil.
A total of sixteen surgically removed FVM samples were included in this study. Eight samples (3 male, 5 female), in part or in whole, were used for cell isolation and RNA-sequencing analysis. Of these patients, three patients had type 1 diabetes mellitus and five patients had type 2 diabetes. The mean age of patients was 46.25 (range: 29-71 years). All patients were medically cleared for surgery and all operations were completed without complication. In addition, four post-mortem retinas (3 males, 1 female) were included in this study with a mean age of 60.8 (Table 1).
Processing of FVMs: FVM samples collected perioperatively were dissected into pieces for immunohistochemistry and/or cell isolation. Isolation of CD31+ cells for RNA-sequencing was performed as previously described (Kim L A, et al. (2015) Mol Vis 21:673-687). Briefly, FVM samples were digested with collagenase II (Worthington Biochemical Corporation) for 1 h before incubation with 20 μL of CD31 Dynabeads® (Invitrogen) in phosphate buffered saline (PBS) containing 2% fetal bovine serum (FBS) for 15 min. Cells attached to beads were pulled from solution using a magnetic rack, washed, and lysed directly into RNA extraction buffer (RLT, Qiagen) supplemented with beta-mercaptoethanol.
Whole Transcriptome Sequencing: CD31+ cells were isolated from FVM as previously described (Kim L A 2015 Mol Vis 21:673-687). RNA-sequencing was performed using an lllumina HiSeq 2000 (Illumina), aligned to reference genome UCSC hg19/GRCh37 with TopHat, and analyzed using Partek® Flow® (Partek), CuffLinks, EdgeR, and DESeq2 (Trapnell et al. (2009) Bioinformatics 25(9):1105-1111). A mixed model ANOVA was used with a threshold false discovery rate (FDR) of <0.05 and fold change ≥±2 for significance. Gene Ontology was determined using the Database for Annotation, Visualization, and Integrated Discovery (DAVID) (Huang da W et al. (2009) Nucleic Acids Res 37(1):1-13.
Transcriptome Analysis: Raw sequencing data were processed as follows: data sets were filtered to exclude adaptor sequences and sequences containing 5% or more low quality base calls, trimmed using the Quality Score method, and aligned to the Homo Sapiens reference genome (UCSC hg19/GRCh37) using TopHat version 2.0.5 (Trapnell et al. (2009) Bioinformatics 25(9):1105-1111.). Absolute gene expression was measured by the standard reads per mapping to the genome per kilobase of transcript per million reads sequenced (RPKM) using the built-in Partek E/M method. Differential gene expression analysis was performed using a mixed-model ANOVA comparing normal retinal CD31+ cells to FVM CD31+ cells. A threshold of FDR <0.05 was applied to identify significant genetic changes. Principle mixed model analysis of variance was performed using Partek® Flow® software, version 3.0 Copyright 0; 2015 (Partek Inc.). Comparing alternative differential gene expression analysis methods (CuffLinks, EdgeR, and DESeq2) further refined the dataset.
DAVID Gene Set Enrichment Analysis: Gene set enrichment analysis was performed using DAVID version 6.7 (Iluang et al. (2009) Nucleic Acids Res 37(1):1-13). The list of 200 genes meeting the above inclusion criteria was uploaded to DAVID to identify involved pathways focusing on the ‘GOTERM_BP_FAT’ gene ontology category.
OIR Mouse Model: OIR was induced in wild-type C57BL/6J mice as previously described (Smith L E et al., (1994) Invest Ophthalmol Vis Sci 35(1); 101-111). Intravitreal injections with 1 μL of 75 μM Ro5-3335 RUNX1 inhibitor or DMSO were performed on left eyes only at P13 and P15 under ketamine/xylazine anesthesia. Pups were euthanized at P17 and eyes were collected, fixed in 4% paraformaldehyde, and used for retinal flat mounts (nvehicle=7; nRo5-3335=9). Avascular and neovascular areas were quantified using Photoshop as previously described (Connor H M et al., (2009) Nature Protocols 4(11):1565-1573).
Human Melanoma Mice: Male, pathogen-free nude mice were purchased from Charles River (Wilmington, Mass.) and used when they were 8 weeks of age. The mice were maintained under specific pathogen-free conditions. Tumor cell inoculation: Human melanoma cells (A375SM) were provided by Isaiah J. Fidler (MD Anderson Cancer Center, Houston. Tex.) (Kozlowski et al. (1984) J Natl Cancer Inst 72(4):913-917). A375SM cells were free of mycoplasma, reovirus type 3, pneumonia virus of mice, mouse adenovirus, murine hepatitis virus, lymphocytic choriomeningitis virus, ectromelia virus, and lactate dehydrogenase virus (Microbiological Associates). Tumor cells [106 cells per 100 μl of Hanks' Balanced Salt Soln (HBSS)] were injected subdermally into the right dorsolateral flank of nude mice. Mice were euthanized 4 weeks after tumor cell injection. Mice were necropsied and tumors were fixed in 10% buffered formalin and embedded in paraffin.
Immunohistological Staining: FVMs and cells were incubated with mouse anti-RUNX1 (Santa Cruz) followed by biotinylated secondary antibody (Vector Laboratories), horseradish peroxidase (HRP)-labeled avidin (PerkinElmer), tyramide signal amplification (TSA, PerkinElmer), Vector Red chromogenic substrate (Vector Laboratories) and Gill no. 3 hematoxylin counterstain (Sigma-Aldrich). Immunofluorescent staining for CD31 (mouse anti-CD31; Dako) and Ki67 (rabbit anti-Ki67; Novus Biologicals) was performed as previously described (Kim L A, et al. (2015) Mol Vis 21:673-687). The number of Ki67 positive nuclei was averaged for three fields of view per sample at 20× magnification.
Mouse retinal whole mounts were blocked with 1% BSA, 0.1% Triton X-100, and 3% serum in PBlec buffer, incubated with primary (isolectin IB4 Alexa Fluor 488 Conjugate; Life Technologies, rat anti-CD31; BD Pharmingen and rabbit anti-RUNX1; LifeSpan BioSciences) and secondary (donkey anti-rat Alexa Fluor 594 and donkey anti-rabbit Alexa Fluor 647 or goat anti-rabbit Alexa Fluor 594; Life Technologies) Samples were imaged with an Axioskop 2 MOT Plus microscope (Carl Zeiss) or TCS-SP5 confocal microscope (Leica).
Cell Culture: HRMEC (Cell Systems) and human umbilical vein endothelial cells (HUVEC; Lonza) were grown at 37° C. with 5% CO2 using endothelial growth media plus antibiotics (Lonza) and 2% FBS (Atlanta Biologicals). For the qRT-PCR gene candidate screen in high glucose, cells were treated for 48 h with endothelial basal media-2 with 2% platelet-poor plasma derived serum (Alfa Aesar) and D-glucose (Sigma-Aldrich) or osmotic control (Mannitol and L-glucose; Sigma-Aldrich).
Immunofluorescent Staining of C-FVM and HRMEC: HRMEC were probed for CD31 as previously described (Kim L A, et al. (2015) Mol Vis 21:673-687). Briefly, following fixation, permeabilization, and blocking, cells were incubated with primary antibody for 1 h at room temperature (mouse anti-CD311:50, Dako) followed by secondary antibody (goat anti-mouse Alexa Fluor 647 1:200; Life Technologies Corp.). Prolong Gold anti-fade mounting medium with 4′,6-diamidino-2-phenylindole (DAPI; Life Technologies Corp.) was used for mounting and nuclear counterstain. Samples were washed with PBS three times for 10 min at room temperature between steps. Samples were imaged using a Zeiss Axioskop 2 MOT Plus microscope (Carl Zeiss Inc.).
HRMEC were probed for proliferation with the Ki67 marker as follows: cells were permeabilized with 0.5% Triton X-100 in PBS for 5 min, blocked with 5% goat serum in PBS for 2 h at room temperature, incubated with primary antibody overnight at 4o C (rabbit anti-Ki67 1:50, Novus Biologicals), and incubated with secondary for 2 h at room temperature (goat anti-rabbit Alexa Fluor 594 1:250; Life Technologies Corp.). Samples were imaged using an EVOS® imaging system. The number of Ki67 positive nuclei was averaged for three fields of view per sample at 20× magnification.
siRNA gene knockdown: siRNA (75 nm) (Integrated DNA Technologies; sequences in Table 4) was transfected for 6-8 h using DharmaFECT 1 (GE Life Sciences-Dharmacon) in Opti-MEM (Life Technologies).
qRT-PCR Analysis: RNA was extracted using RNeasy Mini Kits (Qiagen). Primers were purchased from Integrated DNA Technologies for 200 candidate genes (Table 4). Genes were excluded from further analysis if there was no amplification or amplification was outside the linear range. This resulted in a final list of 101 genes analyzed by qRT-PCR. cDNA was prepared using the iScript cDNA synthesis kit (Bio-Rad Laboratories) and probed using FastStart Universal SYBR Green Master (Hoffmann-La Roche). Fluorescent intensities were normalized to spike-in controls (ERCC RNA Spike-in Mix, Life Technologies), HPRT1, and B2M.
Western Blot Analysis: Cells were lysed using RIPA buffer (Cell Signaling Technology (CST)). Samples were separated on a 4-15% SDS-PAGE, transferred to polyvinylidene difluoride membranes, blocked with Odyssey Blocking Buffer (LI-COR Biosciences, Lincoln, Nebr.), and probed with mouse anti-RUNX1 (Santa Cruz Biotechnology Inc.), rabbit anti-β-actin (CST), IRDye 680RD donkey anti-rabbit, and IRDye 800CW donkey anti-mouse (L1-COR) antibodies. Immunoreactive bands were visualized using the Odyssey Infrared Imaging System and band intensities normalized to β-actin were quantified using Image Studio version 2.1 (LI-COR).
Scratch-wound migration assay: Migration was assessed with the scratch-wound assay (Liang C C et al. (2007) Nature Protocols 2(2):329-333). One scratch was generated per well and imaged on an EVOS® imaging system every three hours for 12 h. Images were analyzed with the TScratch Matlab module (Geback et al. (2009) Biotechniques 46(4):265-274).
Tube Forming Assay: HRMEC were treated overnight with 75 μM Ro5-3335 or DMSO before plating 20000 cells onto wells pre-coated with basement membrane extract (Trevigen). Cells were imaged six h after plating and tube formation was quantified using the Angiogenesis Analyzer plugin for ImageJ.
Statistical Analysis: All results are presented as means±SEM. Student's t-test was performed for statistical comparisons between two groups and one-way ANOVA (Kruskal-Wallis test) was used for comparisons between multiple groups. A P value <0.05 was considered a significant result.
Robust expression of RUNX1 was found in angiogenic sprouts from ex-vivo mouse choroidal explant assays (Shao Z, Friedlander M, Hurst C G, et al. Choroid sprouting assay: an ex vivo model of microvascularangiogenesis. PLoS One. 2013; 8:e69552) and in neovessels from a laser-induced CNV mouse model (FIG. 20). (Giani A, Thanos A, Rob M I, et al. In vivo evaluation of laser-induced choroidal neovascularization using spectral-domain optical coherence tomography. Invest Ophthalmol Vis Sci. 2011; 52:3880-3887) Choroidal explants were obtained from 1 mm punch biopsy from P21 mice embedded in Matrigel and cultured for 48 h. For laser-induced CNV, a 532-nm laser (Oculight GLx Laser System; IRIDEX) attached to a slit lamp was used for photocoagulation (100-mW power, 100-μm spot size, and 0.1-s pulse duration) at four sites around the optic nerve in a clockwise manner.
HRMEC were transfected with pCMV5-AML1c (Addgene Plasmid #12426) (the plasmid contains the sequence of RUNX1 encoding 480 amino acids; in the sequences listed herein this corresponds to RUNX1g) or pCMV5 empty vector using the HCAEC Nucleofector kit (VPB-1001, Program S-005) following manufacturer's optimized protocol. Transfection media was removed after 4 hours. qRT-PCR performed 48 hr following transfection demonstrated ˜2.8 fold (p<0.001) increased expression of RUNX1 relative to cells transfected with empty vector and associated ˜2 fold (p<0.05) decrease in IGFBP3 expression (FIG. 21).
While the invention has been described in conjunction with the detailed description thereof, the foregoing description is intended to illustrate and not limit the scope of the invention, which is defined by the scope of the appended claims. Other aspects, advantages, and modifications are within the scope of the following claims.
The patent and scientific literature referred to herein establishes the knowledge that is available to those with skill in the art. All United States patents and published or unpublished United States patent applications cited herein are incorporated by reference. All published foreign patents and patent applications cited herein are hereby incorporated by reference. Genbank and NCBI submissions indicated by accession number cited herein are hereby incorporated by reference. All other published references, documents, manuscripts and scientific literature cited herein are hereby incorporated by reference.
While this invention has been particularly shown and described with references to preferred embodiments thereof, it will be understood by those skilled in the art that various changes in form and details may be made therein without departing from the scope of the invention encompassed by the appended claims.
1. A method for inhibiting, treating, or preventing aberrant angiogenesis or small vessel diseases (SVDs) in a subject, comprising:
(a) administering to said subject an effective amount of a Runt-Related Transcription Factor 1 (RUNX1) inhibitor or a PIM3 Proto-Oncogene, Serin/Threonin Kinase (PIM3) inhibitor, or
(b) administering to said subject a NOTCH inhibitor in an amount that is effective to reduce RUNX1 expression or activity, or
(c) (i) increasing the expression of IGFBP3 in said subject: or (ii) administering to said subject an effective amount of IGFBP3, or
(d) altering a RUNX1 or PIM3 gene in said subject.
2. The method of claim 1, wherein the aberrant angiogenesis is aberrant ocular angiogenesis.
3. The method of claim 1, wherein said subject comprises proliferative diabetic retinopathy (PDR), macular edema, non-proliferative diabetic retinopathy, age-related macular degeneration (AMD), ocular neovascularization, ocular ischemic syndrome, retinopathy of prematurity (ROP), a retinal vein occlusion, ocular ischemic syndrome, neovascular glaucoma, a retinal hemangioma, Coates' disease, FEVR, type 1 diabetes, type 2 diabetes, diabetic retinopathy (DR), a hemangioma, neovascular glaucoma, a vascular malformation, a cerebral cavernous malformation, Von Hippel-Linda disease, or Norrie disease.
4. The method of claim 1, wherein said subject comprises a melanoma, a solid tumor, or a cancer other than leukemia.
5.-7. (canceled)
8. The method of claim 4, wherein said solid tumor comprises a dimension that is greater than at least about 1, 2, 3, 4, 5, 6, 7, 8, 9, 10 mm or more and/or a volume of at least about 1, 1.5, 2, 3, 4, 5, 6, 7, 8, 9, 10 mm3 or more.
9. The method of claim 1, wherein said RUNX1 inhibitor or said PIM3 inhibitor is administered as part of a treatment regimen that does not comprise an additional antiangiogenic inhibitor.
10. The method of claim 9, wherein said treatment regimen does not comprise a vascular endothelial growth factor (VEGF) pathway inhibitor.
11. The method of claim 1, wherein said RUNX1 inhibitor or said PIM3 inhibitor is administered as a monotherapy.
12.-16. (canceled)
17. The method of claim 1, wherein said RUNX1 inhibitor or said PIM3 inhibitor comprises an aptamer, an oligonucleotide, a peptide, an antibody or a fragment thereof, or a small molecule.
18. The method of claim 17, wherein said RUNX1 inhibitor binds to RUNX1 and/or CBFβ.
19. The method of claim 17, wherein said RUNX1 inhibitor binds to RUNX1 or said PIM3 inhibitor binds to PIM3.
20. The method of claim 17, wherein said RUNX1 inhibitor comprises Ro5-3335.
21. (canceled)
22. The method of claim 17, wherein said oligonucleotide comprises at least about 10, 15, 20, 25, 30, or more nucleotides in a sequence that is complementary to a nucleotide sequence within a gene or mRNA molecule that encodes RUNX1 or PIM3.
23. (canceled)
24. The method of claim 1, wherein altering said RUNX1 or PIM3 gene comprises the administration of (i) a Cas protein, a zinc finger nuclease (ZFN), or a transcription activator-like effector-based nuclease (TALEN), or (ii) an expression vector encoding a Cas protein, a ZFN, or a TALEN, to said subject.
25. The method of claim 1, wherein said gene is altered with via a CRISPR-Cas9 system.
26. (canceled)
27. A composition comprising an effective amount of a RUNX1 inhibitor or a PIM3 inhibitor and an ophthalmically acceptable vehicle.
28.-48. (canceled)
49. A kit comprising
(a) (i) an agent for detecting the level of RUNX1; (ii) an agent for detecting the level of PIM3; or (iii) an agent or detecting the level of IGFBP3, and
(b) instructions for using the agent for diagnosing or detecting aberrant angiogenesis, for identifying whether a subject is at risk of developing a disease that comprises aberrant angiogenesis, for determining the progression of the disease, for assessing the efficacy of a treatment for the disease, and/or for adjusting the dose of a compound during the treatment of disease.
50.-51. (canceled)
52. The method of claim 1, wherein the SVD comprises cerebral small vessel disease, cerebral autosomal recessive arteriopathy with subcortical infarcts and leukoencephalopathy (CARASIL), age-related macular degeneration (AMD), cerebral autosomal-dominant arteriopathy with subcortical infarcts and leukoencephalopathy (CADASIL), NOTCH3 loss-of-function-associated SVD, Notch 3 hyperactivation-associated SVD, nephropathy, microangiopathy, heart failure, Alagille syndrome, familial tetralogy of Fallot, patent ductus arteriosus, cerebral cavernous malformation, or diabetic retinopathy.
53.-55. (canceled)