Patent application title:

METHODS FOR MULTIPLEX DETECTION OF ALLELES ASSOCIATED WITH OPHTHALMIC CONDITIONS

Publication number:

US20230348984A1

Publication date:
Application number:

18/064,444

Filed date:

2022-12-12

Abstract:

Systems and methods for detecting at least two genomic alleles associated with corneal dystrophy in a sample from a human subject are disclosed in which cells (e.g., epithelial) of the subject are adhered to a tip of a substrate. The tip of the substrate is agitated in a lysis solution that lyses cells adhered to the substrate. The substrate is removed from the lysis solution upon completion of this agitation. The resulting lysis solution is incubated and then genomic DNA from the lysis solution is isolated to form a gDNA solution. From this, identity of at least two nucleotides present in the human TGFβI gene is determined using at least two oligonucleotide primer pairs and the gDNA solution. These at least two nucleotides are located at respective independent positions of the TGFβI gene corresponding to respective independent single nucleotide polymorphisms (SNPs) associated with corneal dystrophy.

Inventors:

Assignee:

Interested in similar patents?

Get notified when new applications in this technology area are published.

Classification:

C12Q2600/156 »  CPC further

Oligonucleotides characterized by their use Polymorphic or mutational markers

C12Q1/6851 »  CPC further

Measuring or testing processes involving enzymes, nucleic acids or microorganisms ; Compositions therefor; Processes of preparing such compositions involving nucleic acids; Nucleic acid amplification reactions Quantitative amplification

C12Q1/6883 »  CPC main

Measuring or testing processes involving enzymes, nucleic acids or microorganisms ; Compositions therefor; Processes of preparing such compositions involving nucleic acids; Nucleic acid products used in the analysis of nucleic acids, e.g. primers or probes for diseases caused by alterations of genetic material

Description

RELATED APPLICATION

This application is a continuation of U.S. patent application Ser. No. 15/154,895, filed May 13, 2016 (now U.S. Pat. No. 11,525,160), which is a continuation application of International Application No. PCT/US2014/065975, filed Nov. 17, 2014, which claims priority to U.S. Provisional Patent Application Ser. No. 61/905,051, filed Nov. 15, 2013. All of these patent applications are incorporated by reference herein in their entireties.

SEQUENCE LISTING SUBMISSION VIA EFS-WEB

The contents of the electronic sequence listing (070335-5007-US01_Sequence_Listing.xml; Size: 101,518 bytes; and Date of Creation: Jul. 20, 2023) is herein incorporated by reference in its entirety.

FIELD OF THE APPLICATION

This application generally relates to methods for the isolation and detection of disease-associated genetic alleles. In particular, this application relates to an improved method for the detection of an Avellino corneal dystrophy associated allele.

BACKGROUND

Real-time PCR can be used to detect differences between nucleic acid sequences having substantially identical sequences. Through the use of differentially labeled fluorescent nucleic acid probes, for example one that binds to a wild type sequence and one that binds to a mutant sequence, single nucleotide changes in the human genome can be quickly and reliably detected. This resolving power has been applied to medical diagnostics, where single nucleotide polymorphisms (SNPs), i.e., single base changes found within the coding and/or non-coding sequence of a protein, are correlated to human disease.

However, real-time PCR analysis is highly dependent upon the collection and isolation of high quality samples. Poor sample collection and/or isolation require the use of longer assay conditions and greater amounts of real-time PCR reagents, both of which result in increased costs and reduced productivity. Furthermore, failure of a real-time PCR single nucleotide polymorphism detection assay can result in the need to collect additional samples, causing even greater loss in time and resources.

Accordingly, methods resulting in improved sample collection and isolation, which improve the overall success rate of the assay, reduce the reagents required for the assay, and reduce the need to collect additional samples at later time are highly desirable. Furthermore, methods for performing real-time PCR SNP detection assays with lower amounts of sample material will also reduce the challenges associated with the collection and isolation of high quality samples.

Corneal dystrophy can be an autosomal dominant hereditary disease, which initially presents with blurred vision in the center of a patient's cornea. The blurry vision gradually spreads toward the perimeter of cornea, worsening the patient's vision as they age. There are several types of corneal dystrophy that have been characterized, including Avellino corneal dystrophy, Granular corneal dystrophy, lattice type I corneal dystrophy, Thiel-Behnke, and Reis-bucklers corneal dystrophy. Corneal dystrophies are known to be caused, at least in some cases, by mutations in the transforming growth factor beta induced (TGFβI) gene encoding the βIG-H3 protein (also known as TGFβI protein, TGFBI protein, and keratoepithelin).

Heterozygous patients suffering from Avellino corneal dystrophy have increasing loss in vision with age, becoming severe in the later years of life. Homozygous patients, in contrast, present with severe to complete loss of vision by six years of age. Avellino corneal dystrophy was first recognized as a distinct type of corneal dystrophy around 1988. Prior to then, it was likely misclassified as Granular corneal dystrophy. Today, Avellino corneal dystrophy is known to be the most common form of stromal corneal dystrophy world-wide. In Korea, Avellino corneal dystrophy is believed to have a prevalence around 1 in 870 people (see Lee, J. H. et al., Ophthalmic Epidemiol., 17:160, 2010; see also Holland, E. J. et al., Ophthalmology, 99:1564, 1992; Kennedy, S. M. et al., Br. J. Ophthalmol., 80:489, 1996; Dolmetsch, A. M. et al., Can. J. Ophthalmol., 31:29, 1996; Afshari, N. A. et al., Arch. Ophthalmol., 119:16, 2001; Stewart, H. S. Hum. Mutat., 14:126, 1999).

Previously, it was discovered that heterozygous individuals (e.g., having one wild type βIG-H3 allele and one mutant βIG-H3 allele) were highly susceptible to accelerating loss of vision following LASIK surgery. Notably, two years after surgery increased opacity of the cornea was observed in these patients with increasing aggressiveness, eventually resulting in complete loss of vision (Jun, R. M. et al., Opthalmology, 111:463, 2004). Previously, eye surgery has been performed with an expectation that LASIK or Excimer Laser surgery would get rid of vision blurriness of a patient suffering from corneal dystrophy. For a hypothetical number of three hundred thousand cases of LASIK surgery, 300 people would have lost their vision, based on 1/1000 of minimum estimation of heterozygous patients suffering from Avellino corneal dystrophy. Patients who have undergone LASIK surgery are mainly in their 20's and 30's carrying out productive activities; therefore, their vision loss causes serious troubles in both society and economics.

In addition, after approval of LASIK surgery in year 2000 in USA, African American patients suffering from Avellino corneal dystrophy who underwent LASIK surgery have been found to lose eye sight, which infers that plenty of similar cases might be occurring throughout the world.

Therefore, although accurate diagnosis of Avellino corneal dystrophy is required to prevent the progression of Avellino corneal dystrophy by LASIK surgery, the diagnosis of Avellino corneal dystrophy is just conducted by microscopic observation (e.g., slit-lamp examination) of corneal opacity and thus often doctors miss latent symptoms of patients to perform LASIK surgery, which results in vision loss. Therefore, rapid and precise genetic diagnosis of corneal dystrophy is desirable.

A DNA chip for detecting a mutation in βIG-H3 gene, which is responsible for Avellino corneal dystrophy, was developed (Korean Patent Laid-Open Publication No. 10-2007-0076532). However, the diagnosis of Avellino corneal dystrophy using the DNA chip disadvantageously requires several steps, including a step of amplifying DNA in a sample, a step of hybridizing the amplified DNA with the DNA chip, a step of washing the hybridized DNA chip, and a step of detecting a positive response.

Given the above background, what is needed in the art are improved methods for detecting multiple mutated alleles associated with corneal dystrophy.

SUMMARY

The present disclosure provides improved methods for the detection of one or more alleles associated with human disease. The methods described below decrease the time and cost associated with performing assays that yield medical information about a subject. For example, in some embodiments, the improved methods allow for same-day detection of a genomic marker associated with Avellino corneal dystrophy, at a reduced cost to the patient.

In some embodiments, the present disclosure provides methods for detecting at least two genomic alleles associated with corneal dystrophy in a sample from a subject, the method comprising: (A) providing epithelial cells of a subject adhered to a tip of a substrate; (B) agitating the tip of the substrate in a lysis solution that lyses cells adhered to the substrate; (C) removing the substrate from the lysis solution upon completion of the agitating (B); (D) incubating the lysis solution after the removing (C); (E) isolating genomic DNA from the lysis solution to form a gDNA solution; and (F) determining an identity of at least two nucleotides present in the TGFβI gene using at least two oligonucleotide primer pairs and the gDNA solution, wherein the at least two nucleotides are located at respective independent positions of the TGFβI gene corresponding to respective independent single nucleotide polymorphisms (SNPs) associated with corneal dystrophy.

In some embodiments, the at least two nucleotides present in the TGFβI gene are separated in the human genome by at least one nucleotide.

In some embodiments, at least one pair of the at least two oligonucleotide primer pairs comprises a forward PCR primer having a nucleotide sequence comprising SEQ ID NO:1 and a reverse PCR primer having a nucleotide sequence comprising SEQ ID NO:2.

In some embodiments, at least one pair of the at least two oligonucleotide primer pairs comprises a forward PCR primer having a nucleotide sequence comprising SEQ ID NO:43 and a reverse PCR primer having a nucleotide sequence comprising SEQ ID NO:44.

In some embodiments, the at least two oligonucleotide primer pairs comprise a first amplification primer pair and a second amplification primer pair. The first amplification primer pair comprises a forward PCR primer having a nucleotide sequence comprising SEQ ID NO:1 and a reverse PCR primer having a nucleotide sequence comprising SEQ ID NO:2. The second amplification primer pair comprises a forward PCR primer having a nucleotide sequence comprising SEQ ID NO:43 and a reverse PCR primer having a nucleotide sequence comprising SEQ ID NO:44.

In some embodiments, the determining (F) further comprises using: (i) a first wild type detection probe having a nucleotide sequence comprising SEQ ID NO:25 and a first mutant detection probe having a nucleotide sequence comprising SEQ ID NO:26, SEQ ID NO:48, or SEQ ID NO:49; and (ii) a second wild type detection probe having a nucleotide sequence comprising SEQ ID NO:45 or SEQ ID NO:47 and a second mutant detection probe having a nucleotide sequence comprising SEQ ID NO:46 or SEQ ID NO:50.

In some embodiments, the present disclosure provides a method for detecting corneal dystrophy, the method comprising: (A) amplifying at least two TGFβI gene sequences, including a first TGFβI gene sequence comprising nucleotides encoding amino acid residue 124 and a second TGFβI gene sequence comprising nucleotides encoding amino acid residue 555, from a biological sample from a human subject using a reaction mixture comprising at least a first amplification primer pair and at least a second amplification primer pair; (B) hybridizing a first detection probes of a first detection oligonucleotide probe pair to the first TGFβI gene sequence; (C) hybridizing a second detection probe of a second detection oligonucleotide probe pair to the second TGFβI gene sequence; and (D) detecting one or more mutations in the first TGFβI gene sequence and/or the second TGFβI gene sequence based on a use of at least two detection probe pairs, including the first detection oligonucleotide probe pair and the second detection oligonucleotide probe pair.

In some embodiments, detecting the one or more mutations in the first TGFβI gene sequence and/or the second TGFβI gene sequence includes detecting two or more mutations in the first TGFβI gene sequence and/or the second TGFβI gene sequence and the two or more mutations are separated in the human genome by at least one nucleotide.

In some embodiments, the at least first amplification primer pair comprises a first amplification primer and a second amplification primer, wherein the first amplification primer comprises nucleotide sequence SEQ ID NO:1 and wherein the second amplification primer comprises nucleotide sequence SEQ ID NO:2.

In some embodiments, the at least second amplification primer pair comprises a third amplification primer and a fourth amplification primer, wherein the third amplification primer is represented by nucleotide sequence SEQ ID NO:43, and wherein the fourth amplification primer is represented by nucleotide sequence SEQ ID NO:44.

In some embodiments, the first amplification primer pair comprises a first amplification primer and a second amplification primer, the first amplification primer comprises nucleotide sequence SEQ ID NO:1, the second amplification primer comprises nucleotide sequence SEQ ID NO:2, the second amplification primer pair comprises a third amplification primer and a fourth amplification primer, the third amplification primer comprises nucleotide sequence SEQ ID NO:43, and the fourth amplification primer comprises nucleotide sequence SEQ ID NO:44.

In some embodiments, one of the one or more mutations corresponds to, at amino acid 124, arginine mutated to a cysteine (R124C), arginine mutated to a histidine (R124H), and/or arginine mutated to a leucine (R124L) in the encoded TGFBI protein.

In some embodiments, one of the one or more mutations corresponds to, at amino acid 555, arginine mutated to a tryptophan (R555W) and/or arginine mutated to a glutamine (R555Q) in the encoded TGFBI protein.

In some embodiments, each of the at least two detection oligonucleotide probe pairs individually includes a first detection oligonucleotide probe and a second detection oligonucleotide probe, wherein the first detection oligonucleotide probe and the second detection oligonucleotide probe comprise a nucleotide sequence pair individually selected from the group consisting of SEQ ID NOs:25-26, SEQ ID NOs:25 and 48, SEQ ID NOs:25 and 49, SEQ ID NOs:27-28, SEQ ID NOs:29-30, SEQ ID NOs:31-32, SEQ ID NOs:33-34, SEQ ID NOs:35-36, SEQ ID NOs:37-38, SEQ ID NOs:39-40, SEQ ID NOs:41-42, SEQ ID NOs:45-46 and SEQ ID NOs:46-47, SEQ ID NOs: 45 and 50, and SEQ ID NOs: 47 and 50.

In some embodiments, the first detection oligonucleotide probe pair comprises a first detection oligonucleotide probe and a second detection oligonucleotide probe, wherein the first detection oligonucleotide probe and the second detection oligonucleotide probe respectively comprise nucleotide sequence pair SEQ ID NO:25 and SEQ ID NO:26.

In some embodiments, the second detection oligonucleotide probe pair comprises a third detection oligonucleotide probe and a fourth detection oligonucleotide probe, wherein the third detection oligonucleotide probe and the fourth detection oligonucleotide probe respectively comprise nucleotide sequence pair SEQ ID NO:45 and SEQ ID NO:46.

In some embodiments, the second detection oligonucleotide probe pair comprises a third detection oligonucleotide probe and a fourth detection oligonucleotide probe, wherein the third detection oligonucleotide probe and the fourth detection oligonucleotide probe respectively comprise nucleotide sequence pair SEQ ID NO:47 and SEQ ID NO:46.

In some embodiments, the second detection oligonucleotide probe pair comprises a third detection oligonucleotide probe and a fourth detection oligonucleotide probe, wherein the third detection oligonucleotide probe and the fourth detection oligonucleotide probe respectively comprise nucleotide sequence pair SEQ ID NO:25 and SEQ ID NO:48.

In some embodiments, the second detection oligonucleotide probe pair comprises a third detection oligonucleotide probe and a fourth detection oligonucleotide probe, wherein the third detection oligonucleotide probe and the fourth detection oligonucleotide probe respectively comprise nucleotide sequence pair SEQ ID NO:25 and SEQ ID NO:49.

In some embodiments, the second detection oligonucleotide probe pair comprises a third detection oligonucleotide probe and a fourth detection oligonucleotide probe, wherein the third detection oligonucleotide probe and the fourth detection oligonucleotide probe respectively comprise nucleotide sequence pair SEQ ID NO:45 and SEQ ID NO:50.

In some embodiments, the second detection oligonucleotide probe pair comprises a third detection oligonucleotide probe and a fourth detection oligonucleotide probe, wherein the third detection oligonucleotide probe and the fourth detection oligonucleotide probe respectively comprise nucleotide sequence pair SEQ ID NO:47 and SEQ ID NO:50.

In some embodiments, the first detection probe is coupled with a first label and the second detection probe is coupled to a second label.

In some embodiments, the first label is VIC and the second label is FAM.

In some embodiments, the hybridizing (B) and the hybridizing (C) are performed concurrently in a same solution.

In some embodiments, the hybridizing (B) and the hybridizing (C) are performed concurrently or at different time in a same solution or different solutions.

In some embodiments, the present disclosure provides a reaction mixture for detecting corneal dystrophy in a human subject, the reaction mixture comprising: (A) at least a first amplification primer pair and a second amplification primer pair for amplifying and determining (1) a first TGFβI gene sequence of at least two TGFβI gene sequences that comprises nucleotides encoding amino acid residue 124 from a biological sample from the subject and (2) a second TGFβI gene sequence of the at least two TGFβI gene sequences that comprises nucleotides encoding amino acid residue 555 from a biological sample from the subject; and (B) at least two detection probe pairs, wherein a detection probe in each of the at least two detection probe pairs hybridizes to at least one of the at least two TGFβI gene sequences.

In some embodiments, the first amplification primer pair comprises a first amplification primer and a second amplification primer, the first amplification primer comprises a nucleotide sequence SEQ ID NO:1, and the second amplification primer comprises a nucleotide sequence SEQ ID NO:2.

In some embodiments, the second amplification primer pair comprises a third amplification primer and a fourth amplification primer, the third amplification primer comprises a nucleotide sequence SEQ ID NO:43, and the fourth amplification primer comprises a nucleotide sequence SEQ ID NO:44.

In some embodiments, at least one of the at least two detection probe pairs is used to detect a mutation that corresponds to, at amino acid 124, arginine mutated to a cysteine (R124C), arginine mutated to a histidine (R124H), and/or arginine mutated to a leucine (R124L) in the encoded TGFBI protein.

In some embodiments, at least one of the at least two detection probe pairs is used to detect a mutation that corresponds to, at amino acid 555, arginine mutated to a tryptophan (R555W) and/or arginine mutated to a glutamine (R555Q) in the encoded TGFBI protein.

In some embodiments, respective detection probe pairs of the at least two detection probe pairs individually include a first detection oligonucleotide probe and a second detection oligonucleotide probe, wherein the first detection oligonucleotide probe and the second detection oligonucleotide probe comprise a nucleotide sequence pair individually selected from the group consisting of SEQ ID NOs:25-26, SEQ ID NOs:25 and 48, SEQ ID NOs:25 and 49, SEQ ID NOs:27-28, SEQ ID NOs:29-30, SEQ ID NOs:31-32, SEQ ID NOs:33-34, SEQ ID NOs:35-36, SEQ ID NOs:37-38, SEQ ID NOs:39-40, SEQ ID NOs:41-42, SEQ ID NOs: 45-46 and SEQ ID NOs: 46-47, SEQ ID NOs: 45 and 50, and SEQ ID NOs: 47 and 50.

In some embodiments, one of the at least two detection probe pairs comprises a first detection oligonucleotide probe and a second detection oligonucleotide probe, wherein the first detection oligonucleotide probe and the second detection oligonucleotide probe respectively comprise nucleotide sequence pair SEQ ID NO:25 and SEQ ID NO:26.

In some embodiments, one of the at least two detection probe pairs comprises a first detection oligonucleotide probe and a second detection oligonucleotide probe, wherein the first detection oligonucleotide probe and the second detection oligonucleotide probe respectively comprise nucleotide sequence pair SEQ ID NO:45 and SEQ ID NO:46.

In some embodiments, one of the at least two detection probe pairs comprises a first detection oligonucleotide probe and a second detection oligonucleotide probe, wherein the first detection oligonucleotide probe and the second detection oligonucleotide probe respectively comprise nucleotide sequence pair SEQ ID NO:47 and SEQ ID NO:46.

In some embodiments, one of the at least two detection probe pairs comprises a first detection oligonucleotide probe and a second detection oligonucleotide probe, wherein the first detection oligonucleotide probe and the second detection oligonucleotide probe respectively comprise nucleotide sequence pair SEQ ID NO:25 and SEQ ID NO:48.

In some embodiments, one of the at least two detection probe pairs comprises a first detection oligonucleotide probe and a second detection oligonucleotide probe, wherein the first detection oligonucleotide probe and the second detection oligonucleotide probe respectively comprise nucleotide sequence pair SEQ ID NO:25 and SEQ ID NO:49.

In some embodiments, one of the at least two detection probe pairs comprises a first detection oligonucleotide probe and a second detection oligonucleotide probe, wherein the first detection oligonucleotide probe and the second detection oligonucleotide probe respectively comprise nucleotide sequence pair SEQ ID NO:45 and SEQ ID NO:50.

In some embodiments, one of the at least two detection probe pairs comprises a first detection oligonucleotide probe and a second detection oligonucleotide probe, wherein the first detection oligonucleotide probe and the second detection oligonucleotide probe respectively comprise nucleotide sequence pair SEQ ID NO:47 and SEQ ID NO:50.

In some embodiments, a first detection probe of the at least two detection probes is coupled with a first label and a second detection probe of the at least two detection probes is coupled to a second label.

In some embodiments, the first label is VIC and the second label is FAM.

In some embodiments, the present disclosure provides a reaction mixture for detecting corneal dystrophy in a human subject, the reaction mixture comprising: (A) at least a first amplification primer pair for amplifying and determining a TGFβI gene sequence from a biological sample from the subject; and (B) a set of at least three detection probes, wherein one detection probe of the set of at least three detection probes hybridizes to the TGFβI gene sequence when exposed to the TGFβI gene sequence.

In some embodiments, the TGFβI gene sequence comprises nucleotides encoding amino acid residue 124 from the biological sample from the subject.

In some embodiments, the set of at least three detection probes include at least one detection probe selected from the group consisting of SEQ ID NOs:25-42 and 48-49.

In some embodiments, the set of at least three detection probes include at least two or more detection probes selected from the group consisting of SEQ ID NOs:25-42 and 48-49.

In some embodiments, the set of at least three detection probes include at least three or more detection probes selected from the group consisting of SEQ ID NOs:25-42 and 48-49.

In some embodiments, the set of at least three detection probes include a first detection probe SEQ ID NO:25 and a second detection probe SEQ ID NO:26.

In some embodiments, the set of at least three detection probes include a third detection probe selected from the group consisting of SEQ ID NO:48 and SEQ ID NO:49.

In some embodiments, the set of at least three detection probes include a fourth detection probe that is distinct from the third detection probe and that is selected from the group consisting of SEQ ID NO:48 and SEQ ID NO:49.

In some embodiments, the set of at least three detection probes include two or more detection probes selected from the group consisting of SEQ ID NOs:26 and 48-49.

In some embodiments, the first amplification primer pair comprises a first amplification primer and a second amplification primer, the first amplification primer comprises a nucleotide sequence SEQ ID NO:1, and the second amplification primer comprises a nucleotide sequence SEQ ID NO:2.

In some embodiments, the reaction mixture further comprises: (C) at least a second amplification primer pair for amplifying and determining a second TGFβI gene sequence from the biological sample; and (D) a second set of at least three detection probes, wherein one detection probe of the second set of at least three detection probes hybridizes the second TGFβI gene sequence when exposed to the second TGFβI gene sequence.

In some embodiments, the second TGFβI gene sequence comprises nucleotides encoding amino acid residue 555 from the biological sample from the subject.

In some embodiments, the second set of at least three detection probes include at least one detection probe selected from the group consisting of SEQ ID NOs: 45-47 and 50.

In some embodiments, the second set of at least three detection probes include at least two or more detection probes selected from the group consisting of SEQ ID NOs: 45-47 and 50.

In some embodiments, the second set of at least three detection probes include at least three or more detection probes selected from the group consisting of SEQ ID NOs: 45-47 and 50.

In some embodiments, the second set of at least three detection probes include a first detection probe that is SEQ ID NO:45 or SEQ ID NO:47, a second detection probe that is SEQ ID NO:46, and a third detection probe that is SEQ ID NO:50.

In some embodiments, the second amplification primer pair comprises a third amplification primer and a fourth amplification primer, the third amplification primer comprises a nucleotide sequence SEQ ID NO:43, and the fourth amplification primer comprises a nucleotide sequence SEQ ID NO:44.

In some embodiments, the TGFβI gene sequence comprises nucleotides encoding amino acid residue 555 from the biological sample from the subject.

In some embodiments, the set of at least three detection probes include at least one detection probe selected from the group consisting of SEQ ID NOs:45-47 and 50.

In some embodiments, the set of at least three detection probes include at least two or more detection probes selected from the group consisting of SEQ ID NOs: 45-47 and 50.

In some embodiments, the set of at least three detection probes include at least three or more detection probes selected from the group consisting of SEQ ID NOs: 45-47 and 50.

In some embodiments, the set of at least three detection probes include a first detection probe that is SEQ ID NO:45 or SEQ ID NO:47, a second detection probe that is SEQ ID NO:46, and a third detection probe that is SEQ ID NO:50.

In some embodiments, the present disclosure provides a method for detecting corneal dystrophy comprising: (A-1) amplifying a first TGFβI gene sequence from a biological sample from a human subject using a reaction mixture comprising at least a first amplification primer pair and a set of at least three detection probes; (B-1) hybridizing a first detection probe of the set of at least three detection probes to the first TGFβI gene sequence; and (C-1) detecting a mutation in the first TGFβI gene sequence based on (i) the hybridization of the first detection probe of the set of at least three detection probes to the first TGFβI gene sequence and (ii) the failure of a second and a third detection probe of the set of at least three detection probes to hybridize to first TGFβI gene sequence.

In some embodiments, the method further comprises: (A-2) amplifying a second TGFβI gene sequence from the biological sample using the same reaction mixture, wherein the reaction mixture comprises at least a second amplification primer pair and a second set of at least three detection probes; (B-2) hybridizing a first detection probe of the second set of at least three detection probes to the second TGFβI gene sequence; and (C-2) detecting a mutation in the second TGFβI gene sequence based on (i) the hybridization of the first detection probe of the second set of at least three detection probes to the first TGFβI gene sequence and (ii) and (ii) the failure of a second detection probe and a third detection probe of the second set of at least three detection probes to hybridize to the second TGFβI gene sequence.

In some embodiments, the amplifying (A-1), the amplifying (A-2), the hybridizing (B-1), the hybridizing (B-2), the detecting (C-1), and the detecting (C-2) are performed with a same aliquot of the biological sample.

In some embodiments, the amplifying the first TGFβI gene sequence (A-1) and the amplifying the second TGFβI gene sequence (A-2) are performed concurrently.

In some embodiments, the hybridizing (B-1) and the hybridizing (B-2) are performed concurrently.

In some embodiments, the detecting (C-1) and the detecting (C-2) are performed concurrently.

In some embodiments, the reaction mixture has some of the features described above. For brevity, such details are not repeated herein.

In some embodiments, the present disclosure provides use of a reaction mixture, as recited in any above, for predicting the risk of complication following laser eye surgery in a subject through a detection of heterozygous corneal dystrophy in the human subject.

In some embodiments, the laser eye surgery comprises one of Lasik and Excimer laser surgery.

In some embodiments, the present disclosure provides a method for detecting a genomic mutation associated with corneal dystrophy in a sample from a human subject, the method comprising: (A) providing epithelial cells of a human subject adhered to a tip of a substrate; (B) agitating the tip of the substrate in a lysis solution that lyses cells adhered to the substrate; (C) removing the substrate from the lysis solution upon completion of the agitating (B); (D) incubating the lysis solution after the removing (C); (E) isolating genomic DNA from the lysis solution to form a gDNA solution; and (F) determining an identity of at least a nucleotide present in the TGFβI gene using at least a first primer pair, a set of at least three detection probes, and the gDNA solution by concurrently exposing the gDNA solution to the at least three detection probes, wherein: the at least a nucleotide is located at a particular position of the TGFβI gene corresponding to a single nucleotide polymorphism (SNPs) associated with corneal dystrophy, and each of at least two detection probes of the set of the at least three detection probes is configured to detect a different mutation at the particular position of the TGFβI gene.

In some embodiments, the method further comprises: (G) determining an identity of at least a second nucleotide present in the TGFβI gene using at least a second primer pair, a second set of at least three detection probes, and the gDNA solution by concurrently exposing the gDNA solution to the set of at least three detection probes and the second set of at least three detection probes, wherein: the at least a second nucleotide is located at a second particular position, independent of the position of the at least a nucleotide, of the TGFβI gene corresponding to a second single nucleotide polymorphism (SNPs) associated with corneal dystrophy, and at least two detection probes of the second set of the at least three detection probes are configured to detect a respective mutation at the second particular position of the TGFβI gene.

In some embodiments, the determining (F) and the determining (G) are performed concurrently.

In some embodiments, the determining (F) and the determining (G) are performed using the same gDNA solution.

BRIEF DESCRIPTION OF THE DRAWINGS

FIGS. 1A-1B illustrate an improved method 100 for the detection of genomic alleles associated with disease, according to some embodiments.

FIG. 2 provides a list of sequences for forward and reverse PCR primer pairs (SEQ ID NOs:1-24) useful for real-time PCR detection of a single nucleotide polymorphism associated with Avellino corneal dystrophy, in accordance with some embodiments.

FIG. 3 provides a list of sequences for wild type and mutant detection probe pairs (SEQ ID NOs:25-42) useful for real-time PCR detection of a single nucleotide polymorphism associated with Avellino corneal dystrophy, in accordance with some embodiments.

FIG. 4 provides a list of the probe sequences and primers used in the allele detection experiments shown in FIGS. 5 through 8.

FIGS. 5A, 5B, and 5C provide experimental data regarding detection of the R124C, R124H, R124L, R555W and R555Q mutants using the probes described in FIG. 4. FIG. 5A provides an allelic discrimination plot run (left-hand panel) using the indicated reagent mixture and indicated cycling conditions (right-hand panel). FIG. 5B provides the Real-Time PCR plots for the various mutants compared to a normal control. FIG. 5C provides the Real-Time PCR plots for the various mutants compared to a homozygous control.

FIGS. 6A, 6B, and 6C provide experimental data regarding detection of the R124C, R124H, R124L, R555W and R555Q mutants using the probes described in FIG. 4. FIG. 6A provides an allelic discrimination plot run (left-hand panel) using the indicated reagent mixture and indicated cycling conditions (right-hand panel). FIG. 6B provides the Real-Time PCR plots for the various mutants compared to a normal control. FIG. 6C provides the Real-Time PCR plots for the various mutants compared to a homozygous control.

FIG. 7 provides experimental data regarding detection of the R124C, R124H, R124L, R555W and R555Q mutants using the probes described in FIG. 4. FIG. 7 provides an allelic discrimination plot (left-hand panel) run using the indicated reagent mixture and indicated cycling conditions (right-hand panel).

FIG. 8 provides experimental data regarding detection of the R124C, R124H, R124L, R555W and R555Q mutants using the probes described in FIG. 4. In particular, FIG. 8 provides an allelic discrimination plot run using the indicated reagent mixture and indicated cycling conditions (right-hand panel). The designation ā€œBā€ in the allelic discrimination plot (left-hand panel) indicates samples were pre-treated with lysis buffer prior to performing the Real-Time PCR assay. The designation ā€œDW-Aā€ in the allelic discrimination plot (left-hand panel) indicates samples were pre-treated with distilled water prior to performing the Real-Time PCR assay. The circles surrounding the different sample dots show the two matched samples, ā€œBā€ and ā€œDW-Aā€ respectively, for each of the alleles detected (see, the left-hand panel); there are two dots within each circle, one for sample ā€œBā€ and one for sample ā€œDW-Aā€.

DETAILED DESCRIPTION

I. Introduction

The detection of disease-related SNPs is an increasingly more important tool for the diagnosis and prognosis of various medical conditions. For example, the presence of a single nucleotide change in exon 4 of the TGFβI gene is strongly associated with Avellino corneal dystrophy. It was found that individuals heterozygous for this SNP are at high risk for vision loss following LASIK surgery. While LASIK is a medical procedure that greatly improves many people's quality of life, for individuals carrying the G/A TGFβI SNP, it commonly causes a gradual vision impairment over a four to eighteen month period, which may lead to loss of vision. The vision impairment may occur in a longer or shorter period of time. Fortunately, screening can be performed to identify individuals carrying the mutation who should avoid having the LASIK procedure.

The present disclosure is based at least in part on the discovery of methods that improve sample isolation, preparation, and analysis. In some embodiments, methods are provided which allow for the re-use of patient samples, for example, when an assay fails or additional follow-up testing needs to be performed. In some embodiments, these improved methods include gently swirling a substrate (e.g., a rayon-tipped or cotton-tipped applicator) carrying cells sloughed-off the buccal membrane of the patient in a lysis solution at room temperature for 30-45 seconds (rather than extended incubation for 20 minutes at elevated temperature). The lysis solution is then incubated at 45° C. for 30 minutes to improve lysis and increase the yield of genomic sample. Advantageously, the rayon-tipped or cotton-tipped applicator can then be stored (e.g., frozen or refrigerated) for re-isolation of genomic DNA used for re-testing.

In some embodiments, the improvements provided herein are provided through the use of lower amounts of genomic DNA template for the real-time PCR detection assays. In some embodiments, this is achieved by increasing the number of real-time PCR cycles performed (e.g., at about 40 cycles) and/or by using 3 second denaturation cycle times at 95° C. Advantageously, because the amount of sample required is reduced by these methods, so too are the requirements for the real-time PCR reagents. Because many reagents used in diagnostic assays are proprietary, the reagents can be expensive. Reducing the amount of reagent used can also significantly reduce the costs associated with the reagent.

It is contemplated that all combinations of specific conditions (e.g., sample handling, incubation temperature, reaction volumes, reaction cycle numbers, reaction cycle times, reaction cycle temperatures) for performing each of these individual steps can be used to perform the methods described herein for detecting disease-related SNPs, such as the Avellino corneal dystrophy-related SNP found in exon 4 of the TGFβI gene.

II. Select Definitions

The term ā€œinventionā€ or ā€œpresent inventionā€ as used herein is not meant to be limiting to any one specific embodiment of the invention but applies generally to any and all embodiments of the invention as described in the claims and specification.

As used herein, the singular forms ā€œaā€, ā€œanā€, and ā€œtheā€ include plural references unless the context clearly dictates otherwise. Thus, for example, references to ā€œthe methodā€ includes one or more methods, and/or steps of the type described herein which will become apparent to those persons skilled in the art upon reading this disclosure.

As used herein, the term ā€œpolymorphismā€ and variants thereof refers to the occurrence of two or more alternative genomic sequences or alleles between or among different genomes or individuals. The terms ā€œgenetic mutationā€ or ā€œgenetic variationā€ and variants thereof include polymorphisms.

As used herein the term ā€œsingle nucleotide polymorphismā€ (ā€œSNPā€) and variants thereof refers to a site of one nucleotide that varies between alleles. A single nucleotide polymorphism (SNP) is a single base change or point mutation but also includes the so-called ā€œindelā€ mutations (insertions or deletions of a nucleotide), resulting in genetic variation between individuals. SNPs, which make up about 90% of all human genetic variation, occur every 100 to 300 bases along the 3-billion-base human genome. However, SNPs can occur much more frequently in other organisms like viruses. SNPs can occur in coding or non-coding regions of the genome. A SNP in the coding region may or may not change the amino acid sequence of a protein product. A SNP in a non-coding region can alter promoters or processing sites and may affect gene transcription and/or processing. Knowledge of whether an individual has particular SNPs in a genomic region of interest may provide sufficient information to develop diagnostic, preventive and therapeutic applications for a variety of diseases. In some embodiments, the present disclosure relates to the detection of a guanine-to-adenine SNP located in exon 4 of the TGFβI gene associated with Avellino corneal dystrophy.

The term ā€œprimerā€ and variants thereof refers to an oligonucleotide that acts as a point of initiation of DNA synthesis in a PCR reaction. A primer is usually about 15 to about 35 nucleotides in length and hybridizes to a region complementary to the target sequence.

The term ā€œprobeā€ and variants thereof (e.g., detection probe) refers to an oligonucleotide that hybridizes to a target nucleic acid in a PCR reaction. Target sequence refers to a region of nucleic acid that is to be analyzed and comprises the polymorphic site of interest.

Unless defined otherwise, all technical and scientific terms used herein have the same meaning as commonly understood by those of ordinary skill in the art to which the invention pertains. Although any methods and materials similar or equivalent to those described herein can be used in the practice or testing of the present invention, various embodiments of methods and materials are specifically described herein.

III. Sample Preparation

In some embodiments, the disclosure provides improved methods for isolating genomic samples used in real-time PCR single nucleotide polymorphism detection assays. In some embodiments, the improved method 100 uses a combination of steps outlined in FIG. 1.

In some embodiments, the method includes providing a sample of cells from a subject. In some embodiments, the cells are collected by contacting a cellular surface of a patient with a substrate capable of reversibly immobilizing the cells onto a substrate.

The disclosed methods are applicable to a variety of cell types obtained from a variety of samples. In some embodiments, the cell type for use with the disclosed methods include but is not limited to epithelial cells, endothelial cells, connective tissue cells, skeletal muscle cells, endocrine cells, cardiac cells, urinary cells, melanocytes, keratinocytes, blood cells, white blood cells, buffy coat, hair cells (including, e.g., hair root cells) and/or salival cells. In some embodiments, the cells are epithelial cells. In some embodiments, the cells are subcapsular-perivascular (epithelial type 1); pale (epithelial type 2); intermediate (epithelial type 3); dark (epithelial type 4); undifferentiated (epithelial type 5); and large-medullary (epithelial type 6). In some embodiments, the cells are buccal epithelial cells (e.g., epithelial cells collected using a buccal swap). In some embodiments, the sample of cells used in the disclosed methods include any combination of the above identified cell types.

In some embodiments, the method includes providing (102) a sample of cells from a subject. In some embodiments, the cells provided are buccal epithelial cells.

The cell sample is collected by any of a variety of methods which allow for reversible binding of the subjects cells to the substrate. In some embodiments, the substrate is employed in a physical interaction with the sample containing the subject's cells in order to reversibly bind the cells to the substrate. In some embodiments, the substrate is employed in a physical interaction with the body of the subject directly in order to reversibly bind the cells to the substrate. In some embodiments, the sample is a buccal cell sample and the sample of buccal cells is collected by contacting a buccal membrane of the subject (e.g., the inside of their cheek) with a substrate capable of reversibly immobilizing cells that are dislodged from the membrane. In such embodiments, the swab is rubbed against the inside of the subject's cheek with a force equivalent to brushing a person's teeth (e.g., a light amount of force or pressure). Any method which would allow the subject's cells to be reversibly bound to the substrate is contemplated for use with the disclosed methods.

In some embodiments, the sample is advantageously collected in a non-invasive manner and as such sample collection is accomplished anywhere and by almost anyone. For example, in some embodiments the sample is collected at a physician's office, at a subject's home, or at a facility where LASIK surgery is performed or to be performed. In some embodiments the patient, the patient's doctor, nurses or a physician's assistant or other clinical personnel collects the sample.

In some embodiments the substrate is made of any of a variety of materials to which cells are reversibly bound. Exemplary substrates include those made of rayon, cotton, silica, an elastomer, a shellac, amber, a natural or synthetic rubber, cellulose, BAKELITE, NYLON, a polystyrene, a polyethylene, a polypropylene, a polyacrylonitrile, or other materials or combinations thereof. In some embodiments, the substrate is a swab having a rayon tip or a cotton tip.

The tip of the substrate (e.g., the tip of the rayon swab or cotton swab) is then agitated in a lysis solution from about 10 seconds to 60 seconds (1 minute), or about 20 seconds to 60 seconds, about 20 seconds to about 45 seconds, or about 20 seconds to about 30 seconds, about 15 seconds to about 60 seconds, about 15 seconds to about 45 seconds, or about 15 seconds to about 30 seconds, about 10 seconds to about 60 seconds, about 10 seconds to about 45 seconds, or about 10 seconds to about 30 seconds, about 10 seconds to about 15 seconds or about 10 seconds to about 20 seconds. In some embodiments, the agitation occurs for about 60 seconds or about 1 minute. In some embodiments, the agitation occurs for less than a minute (e.g., less than 60 seconds). In some embodiments, the agitation occurs for no more than 15 seconds, 20 seconds, 30 seconds, 45 seconds, 60 seconds, 90 seconds, 120 seconds or more. In some embodiments, the agitation occurs for no more than 45 seconds. In some embodiments, the agitation occurs for no more than 30 seconds. In some embodiments, the agitation occurs for no more than 20 seconds. In some embodiments, the agitation occurs for no more than 15 seconds.

In some embodiments, agitation includes any movement of the substrate in the lysis solution. In some embodiments, the tip of the substrate (e.g., the tip of the rayon swab or cotton swab) is moved gently in the lysis solution, such that a plurality of buccal cells remains affixed to the substrate for isolation at a later time and/or subsequent time. Such movement in the lysis solution includes swirling motions, side to side motions, up and down motions and/or dipping motions, or any other movement of the substrate in the lysis solutions that results in a plurality of buccal cell remain affixed to the tip while allowing for some buccal cells to be dispersed into the lysis solution.

In some embodiments, the agitation step is performed at room temperature, for instance, temperatures between about 15° C. and about 30° C., about 18° C. and about 28° C., about 18° C. and about 25° C. or about 20° C. and about 25° C.

After agitation, the substrate (e.g., a swab with a rayon tip or cotton tip) is removed and, in some embodiments, stored for use later, in case re-testing or further (e.g., different or additional) testing is needed. In some embodiments, the substrate (e.g., buccal swab with a rayon tip or cotton tip) is placed in a container and stored frozen. In some embodiments, the substrate (e.g., buccal swab with a rayon tip or cotton tip) is refrigerated. In some embodiments, the substrate is stored at any of a variety of temperatures and for any of a variety of times while still remaining useful for one or more additional extractions.

In some embodiments, the substrate containing the sample is stored for 0 weeks, 1 week, 2 weeks, 3 weeks, 4 weeks, 5 weeks, 6 weeks, 7 weeks, 8 weeks, 9 weeks, 10 weeks, 11 weeks or 12 weeks or more. In some embodiments, the substrate containing the sample is stored for and/or is capable of being stored for 0 weeks to 12 weeks, 1 week to 12 weeks, 2 weeks to 12 weeks, 3 weeks to 12 weeks, 4 weeks to 12 weeks, 5 weeks to 12 weeks, 6 weeks to 12 weeks, 7 weeks to 12 weeks, 8 weeks to 12 weeks, 9 weeks, 10 weeks to 12 weeks, or 11 weeks to 12 weeks. In some embodiments, the substrate containing the sample is stored for 1, 2, 3, 4, 5, 6, 8, 10, 12, 14, 16, 18, 20, 22, 24, 30, or 36 months or more. In some embodiments, the substrate containing the sample is stored for 1 month to 36 months, 2 months to 36 months, 3 months to 36 months, 4 months to 36 months, 5 months to 36 months, 6 months to 36 months, 7 months to 36 months, 8 months to 36 months, 9 months to 36 months, 10 months to 36 months, 12 months to 36 months, 14 months to 36 months, 16 months to 36 months, 18 months to 36 months. In some embodiments, the substrate containing the sample is stored for 1 month to 30 months, 2 months to 30 months, 3 months to 30 months, 4 months to 30 months, 5 months to 30 months, 6 months to 30 months, 7 months to 30 months, 8 months to 30 months, 9 months to 30 months, 10 months to 30 months, 12 months to 30 months, 14 months to 30 months, 16 months to 30 months or 18 months to 30 months. In some embodiments, the substrate containing the sample is stored for 1 month to 24 months, 2 months to 24 months, 3 months to 24 months, 4 months to 24 months, 5 months to 24 months, 6 months to 24 months, 7 months to 24 months, 8 months to 24 months, 9 months to 24 months, 10 months to 24 months, 12 months to 24 months, 14 months to 24 months, 16 months to 24 months, 18 months to 24 months. In some embodiments, the substrate containing the sample is stored for 1 month to 22 months, 2 months to 22 months, 3 months to 22 months, 4 months to 22 months, 5 months to 22 months, 6 months to 22 months, 7 months to 22 months, 8 months to 22 months, 9 months to 22 months, 10 months to 22 months, 12 months to 22 months, 14 months to 22 months, 16 months to 22 months, 18 months to 22 months. In some embodiments, the substrate containing the sample is stored for 1 month to 20 months, 2 months to 20 months, 3 months to 20 months, 4 months to 20 months, 5 months to 20 months, 6 months to 20 months, 7 months to 20 months, 8 to 20 months, 9 to 20 months, 10 months to 20 months, 12 months to 20 months, 14 months to 20 months, 16 months to 20 months, 18 months to 20 months. In some embodiments, the substrate containing the sample is stored for 1 month to 18 months, 2 months to 18 months, 3 months to 18 months, 4 months to 18 months, 5 months to 18 months, 6 months to 18 months, 7 months to 18 months, 8 months to 18 months, 9 months to 18 months, 10 months to 18 months, 12 months to 18 months, 14 months to 18 months, 16 months to 18 months or 17 months to 18 months. In some embodiments, the substrate containing the sample is stored for 1 month to 12 months, 2 months to 12 months, 3 months to 12 months, 4 months to 12 months, 5 months to 12 months, 6 months to 12 months, 7 months to 12 months, 8 months to 12 months, 9 months to 12 months, 10 months to 12 months or 11 months to 12 months.

In some embodiments, the substrate containing the sample is stored at about 2° C., about 3° C., about 4° C., about 5° C., about 6° C., about 7° C., or about 8° C. In some embodiments, the substrate containing the sample is stored at about 2° C. to about 8° C., about 3° C. to about 8° C., about 4° C. to about 8° C., about 5° C. to about 8° C., about 6° C. to about 8° C. or about 7° C. to about 8° C. In some embodiments, the substrate containing the sample is stored at about āˆ’25° C., about āˆ’24° C., about āˆ’23° C., about āˆ’22° C., about āˆ’21° C., about āˆ’20° C., about āˆ’19° C., about āˆ’18° C., about āˆ’17° C., about āˆ’16° C. or about āˆ’15° C. In some embodiments, the substrate containing the sample is stored at about āˆ’25° C. to about āˆ’15° C., about āˆ’22° C. to about āˆ’17° C., about āˆ’20° C. to about āˆ’15° C. or about āˆ’25° C. to about āˆ’20° C. In some embodiments, the substrate containing the sample is stored at about āˆ’90° C., about āˆ’89° C., about āˆ’88° C., about āˆ’87° C., about āˆ’86° C., about āˆ’85° C., about āˆ’84° C., about āˆ’83° C., about āˆ’82° C., about āˆ’81° C., about āˆ’80° C., about āˆ’79° C., about āˆ’78° C., about āˆ’77° C., about āˆ’76° C., about āˆ’75° C., about āˆ’74° C., about āˆ’73° C., about āˆ’72° C., about āˆ’71° C., about āˆ’70° C., about āˆ’69° C., about āˆ’68° C., about āˆ’67° C., about āˆ’66° C. or about āˆ’65° C. In some embodiments, the substrate containing the sample is stored at about āˆ’90° C. to about āˆ’65° C., about āˆ’85° C. to about āˆ’65° C., about āˆ’80° C. to about āˆ’65° C., about āˆ’75° C. to about āˆ’65° C. or about āˆ’70° C. to about āˆ’65° C. In some embodiments, the substrate containing the sample is stored at āˆ’90° C. to āˆ’65° C.

In some embodiments, the substrate containing the sample is freeze-thawed one or more times (e.g., after being frozen, the substrate containing the sample is thawed, used according to the present methods and re-frozen) and or used in the present methods. In some embodiments, the substrate containing the sample is freeze-thawed 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20 or more times. In some embodiments, the substrate containing the sample is used in the present methods 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20 or more times. In some embodiments, the substrate containing the sample is freeze-thawed 1 to 20 times, 2 to 20 times, 3 to 20 times, 4 to 30 times, 5 to 20 times, 6 to 20 times, 7 to 20 times, 8 to 20 times, 9 to 20 times, 10 to 20 times, 11 to 20 times, 12 to 20 times, 13 to 20 times, 14 to 20 times, 15 to 20 times, 16 to 20 times, 17 to 20 times, 18 to 20 times, 19 to 20 times, 5 to 15 times, 5 to 10 times, 1 to 10 times or 1 to 5 times. In some embodiments, the substrate containing the sample is used in the present methods 1 to 20 times, 2 to 20 times, 3 to 20 times, 4 to 30 times, 5 to 20 times, 6 to 20 times, 7 to 20 times, 8 to 20 times, 9 to 20 times, 10 to 20 times, 11 to 20 times, 12 to 20 times, 13 to 20 times, 14 to 20 times, 15 to 20 times, 16 to 20 times, 17 to 20 times, 18 to 20 times, 19 to 20 times, 5 to 15 times, 5 to 10 times, 1 to 10 times, 1 to 5 times, 1 to 4 times, 1 to 3 times or 1 to 2 times.

In some embodiments, the substrate containing the sample is stored for 1 week at room temperature or about 15° C. to about 30° C. In some embodiments, the sample is stored for about 1, 2 or 3 weeks at about 2° C. to about 8° C. or about 4° C. In some embodiments, the substrate containing the sample is stored for about 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11 or 12 months at about āˆ’25° C. to about āˆ’15° C. or about āˆ’20° C. In some embodiments, the substrate containing the sample is stored for about 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11 or 12 months at about āˆ’90° C. to about āˆ’65° C. or about āˆ’80° C.

Advantageously and surprisingly, it was found that the reduced number of cells extracted from the substrate is countered by increased extraction of nucleic acids from individual cells. In some embodiments, increased extraction is accomplished by incubating the cells for a longer time as compared to standard practices, incubating the cells at an elevated temperature as compared to standard practices, or a combination of both.

In some embodiments, the increased extraction of nucleic acids of cells is accomplished by performing the extraction incubation for an increased or longer period of time as compared to standard practice. In some embodiments, the extraction incubation is performed for about 45 minutes, e.g., 45±5, 45±10, 45±15, or 45±20 minutes. In some embodiments, the extraction incubation is performed for about 25 minutes to about 65 minutes, about 30 minutes to about 60 minutes, about 35 minutes to about 55 minutes, about 45 minutes to about 65 minutes, about 45 minutes to about 55 minutes, or about 40 minutes to about 50 minutes. In some embodiments, the extraction incubation time is about 25 minutes, about 30 minutes, about 35 minutes, about 40 minutes, about 45 minutes, about 50 minutes, about 55 minutes, about 60 minutes or about 65 minutes.

In some embodiments, the increased the extraction of nucleic acids of cells is accomplished by performing the extraction incubation at an increased or higher temperature as compared to standard practice. In some embodiments, the extraction incubation is performed at about 45° C., e.g., 45±2° C., 45±5° C., or 45±10° C. In some embodiments, the extraction incubation temperature is about 35° C. to about 55° C., about 40° C. to about 50° C. or about 43° C. to about 47° C. In some embodiments, the extraction temperature is about 43° C., about 44° C., about 45° C., about 46° C., about 47° C., about 48° C., about 49° C., about 50° C., about 51° C., about 52° C., about 53° C., about 54° C. or about 55° C. In some embodiments, more than one extraction temperature is used. For example in some embodiments, standard temperatures are used for a portion of the extraction and an elevated temperature is used for another portion of the extraction.

In some embodiments, substantially small numbers of cells are released from the substrate for subsequent lysis according to the present systems and methods. In some embodiments, at least 1 cell, at least 2 cells, at least 5 cells, at least 10 cells, at least 15 cells, at least 20 cells, at least 50 cells, at least 75 cells, at least 100 cells, at least 125 cells, at least 150 cells, at least 175 cells, at least 200 cells, at least 250 cells, at least 300 cells, at least 350 cells, at least 400 cells, at least 450 cells, at least 500 cells or more are released from the substrate during agitation.

In some embodiments, about 1 ng/μL to about 50 ng/μL, about 1 ng/μL to about 40 ng/μL, about 1 ng/μL to about 30 ng/μL, about 1 ng/μL to about 20 ng/μL, about 1 ng/μL to about 10 ng/μL, about 1 ng/μL to about 5 ng/μL, about 1 ng/μL to about 4 ng/μL, about 1 ng/μL to about 3 ng/μL or about 1 ng/μL to about 2 ng/μL of nucleic acid with a purity of about 0.55 to 2.00, about 0.6 to about 2.00, about 0.7 to about 2.00 about 0.8 to about 2.00, about 0.9 to about 2.00, about 1.0 to about 2.00 about 1.1 to about 2.00, about 1.2 to about 2.00, about 1.3 to about 2.00, about 1.4 to about 2.00, about 1.5 to about 2.00 about 1.6 to about 2.00 about 1.7 to about 2.00 about 1.8 to about 2.00 or about 1.9 to about 2.00 is employed (obtained) from a single subject with the described methods. In some embodiments, 1 ng/μL to 50 ng/μL with a purity of about 0.55 to 2.00 is employed (obtained) from a single subject with the described methods.

IV. Lysis Solutions

A variety of lysis solutions have been described and are known to those of skill in the art. Any of these well known lysis solutions can be employed with the present methods in order to isolate nucleic acids from a sample. Exemplary lysis solutions include those commercially available, such as those sold by INVITROGENĀ®, QIAGENĀ®, LIFE TECHNOLOGIESĀ® and other manufacturers, as well as those which can be generated by one of skill in a laboratory setting. Lysis buffers have also been well described and a variety of lysis buffers can find use with the disclosed methods, including for example those described in Molecular Cloning (three volume set, Cold Spring Harbor Laboratory Press, 2012) and Current Protocols (Genetics and Genomics; Molecular Biology; 2003-2013), both of which are incorporated herein by reference for all purposes.

Cell lysis is a commonly practiced method for the recovery of nucleic acids from within cells. In many cases, the cells are contacted with a lysis solution, commonly an alkaline solution comprising a detergent, or a solution of a lysis enzyme. Such lysis solutions typically contain salts, detergents and buffering agents, as well as other agents that one of skill would understand to use. After full and/or partial lysis, the nucleic acids are recovered from the lysis solution.

In some embodiments, cells are resuspended in an aqueous buffer, with a pH in the range of from about pH 4 to about 10, about 5 to about 9, about 6 to about 8 or about 7 to about 9.

In some embodiments, the buffer salt concentration is from about 10 mM to about 200 mM, about 10 mM to about 100 mM or about 20 mM to about 80 mM.

In some embodiments, the buffer further comprises chelating agents such as ethylenediaminetetraacetic acid (EDTA) or ethylene glycol tetraacetic acid (EGTA).

In some embodiments, the lysis solution further comprises other compounds to assist with nucleic acid release from cells such as polyols, including for example but not limited to sucrose, as well as sugar alcohols such as maltitol, sorbitol, xylitol, erythritol, and/or isomalt. In some embodiments, polyols are in the range of from about 2% to about 15% w/w, or about 5% to about 15% w/w or about 5% to about 10% w/w.

In some embodiments, the lysis solutions further comprises surfactants, such as for example but not limited to Triton X-100, SDS, CTAB, X-114, CHAPS, DOC, and/or NP-40. In some embodiments such surfactants are in the range of from about 1% to about 5% w/w, about 1% to about 4% w/w, or about 1% to about 3% w/w.

In embodiments, the lysis solution further comprises chaotropes, such as for example but not limited to urea, sodium dodecyl sulfate and/or thiourea. In some embodiments, the chaotrope is used at a concentration in the range of from about 0.5 M to 8 M, about 1 M to about 6 M, about 2 M to about 6 M or about 1 M to 3 M.

In some embodiments, the lysis solution further comprises one or more additional lysis reagents and such lysis reagents are well known in the art. In some embodiments, such lysis reagents include cell wall lytic enzymes, such as for example but not limited to lysozyme. In some embodiments, lysis reagents comprise alkaline detergent solutions, such as 0.1 aqueous sodium hydroxide containing 0.5% sodium dodecyl sulphate.

In some embodiments, the lysis solution further comprises aqueous sugar solutions, such as sucrose solution and chelating agents such as EDTA, for example the STET buffer. In certain embodiments, the lysis reagent is prepared by mixing the cell suspension with an equal volume of lysis solution having twice the desired concentration (for example 0.2 sodium hydroxide, 1.0% sodium dodecyl sulphate).

In some embodiments, after the desired extent of lysis has been achieved, the mixture comprising lysis solution and lysed cells is contacted with a neutralizing or quenching reagent to adjust the conditions such that the lysis reagent does not adversely affect the desired product. In some embodiments, the pH is adjusted to a pH of from about 5 to about 9, about 6 to about 8, about 5 to about 7, about 6 to about 7 or about 6.5 to 7.5 to minimize and/or prevent degradation of the cell contents, including for example but not limited to the nucleic acids. In some embodiments, when the lysis reagent comprises an alkaline solution, the neutralizing reagent comprises an acidic buffer, for example an alkali metal acetate/acetic acid buffer. In some embodiments, lysis conditions, such as temperature and composition of the lysis reagent are chosen such that lysis is substantially completed while minimizing degradation of the desired product, including for example but not limited to nucleic acids.

In some embodiments, a first, second, third, fourth, fifth, sixth, seventh, eighth, ninth, tenth, eleventh, twelfth, thirteenth, fourteenth, fifteenth or twentieth lysis solution is employed with the methods. In some embodiments, the volume of lysis buffer used is about 10 μL, about 20 μL, about 30 μL, about 40 μL, about 50 μL, about 60 μL, about 70 μL, about 80 μL, about 90 μL, about 100 μL, about 120 μL, about 130 μL, about 140 μL, about 150 μL, 160 μL, about 170 μL, about 180 μL, about 190 μL, about 200 μL, about 220 μL, about 230 μL, about 240 μL, about 250 μL, about 260 μL, about 270 μL, about 280 μL, about 290 μL, about 300 μL, about 320 μL, about 330 μL, about 340 μL, about 350 μL, about 360 μL, about 370 μL, about 380 μL, about 390 μL, about 400 μL, about 450 μL, about 500 μL, about 550 μL, about 600 μL, about 650 μL, about 700 μL, about 750 μL, about 800 μL, about 850 μL, 900 μL, 950 μL, 1000 μL, 1500 μL or 2000 μL. In some embodiments, the lysis buffer is between about 10 μL and about 1000 μL, about 10 μL and about 800 μL, about 10 μL and about 600 μL, about 10 μL and about 400 μL, about 20 μL and about 400 μL, about 50 μL and about 300 μL, about 50 μL and about 200 μL, about 50 μL and about 400 μL, about 100 μL and about 400 μL, about 10 μL and about 300 μL or about 100 μL and about 200 μL.

Any combination of the above can be employed by one of skill, as well as combined with other known and routine methods, and such combinations are contemplated by the present invention.

V. Purification of Nucleic Acids from Lysis Buffer

In some embodiments, the nucleic acids, including for example but not limited to genomic DNA, are isolated from lysis buffer prior to performing subsequent analysis. In some embodiments, the nucleic acids are isolated from the lysis buffer prior to the performance of additional analyses, such as for example but not limited to real-time PCR analyses. Any of a variety of methods useful in the isolation of small quantities of nucleic acids are used by various embodiments of the disclosed methods. These include but are not limited to precipitation, gel filtration, density gradients and solid phase binding. Such methods have also been described in for example, Molecular Cloning (three volume set, Cold Spring Harbor Laboratory Press, 2012) and Current Protocols (Genetics and Genomics; Molecular Biology; 2003-2013), incorporated herein by reference for all purposes.

Nucleic Acid precipitation is a well know method for isolation that is known by those of skill in the art. A variety of solid phase binding methods are also known in the art including but not limited to solid phase binding methods that make use of solid phases in the form of beads (e.g., silica, magnetic), columns, membranes or any of a variety other physical forms known in the art. In some embodiments, solid phases used in the disclosed methods reversibly bind nucleic acids. Examples of such solid phases include so-called ā€œmixed-bedā€ solid phases are mixtures of at least two different solid phases, each of which has a capacity to nucleic acids under different solution conditions, and the ability and/or capacity to release the nucleic acid under different conditions; such as those described in US Patent Application No. 2002/0001812, incorporated by reference herein in its entirety for all purposes. Solid phase affinity for nucleic acids according to the disclosed methods can be through any one of a number of means typically used to bind a solute to a substrate. Examples of such means include but are not limited to, ionic interactions (e.g., anion-exchange chromatography) and hydrophobic interactions (e.g., reversed-phase chromatography), pH differentials and changes, salt differentials and changes (e.g., concentration changes, use of chaotropic salts/agents). Exemplary pH based solid phases include but are not limited to those used in the INVITROGEN ChargeSwitch Normalized Buccal Kit magnetic beads, to which bind nucleic acids at low pH (<6.5) and releases nucleic acids at high pH (>8.5) and mono-amino-N-aminoethyl (MANAE) which binds nucleic acids at a pH of less than 7.5 and release nucleic acids at a pH of greater than 8. Exemplary ion exchange based substrates include but are not limited to DEA-SEPHAROSEā„¢, Q-SEPHAROSEā„¢, and DEAE-SEPHADEXā„¢ from PHARMACIA (Piscataway, N.J.), DOWEXĀ® I from The Dow Chemical Company (Midland, Mich.), AMBERLITEĀ® from Rohm & Haas (Philadelphia, Pa.), DUOLITEĀ® from Duolite International, In. (Cleveland, Ohio), DIALON TI and DIALON TII.

Any individual method is contemplated for use alone or in combination with other methods, and such useful combination are well known and appreciated by those of skill in the art.

VI. Nucleic Acid Analyses

The disclosed methods are used to isolate nucleic acids, such as genomic DNA (gDNA) for a variety of nucleic acid analyses, including genomic analyses. In some embodiments, such analysis includes detection of variety of genetic mutations, which include but are not limited to one or more deletions, insertions, transitions and transversions. In some embodiments, the mutation is a single-nucleotide polymorphism (SNP).

A variety of methods for analyzing such isolated nucleic acids, for example but not limited to genomic DNA (gDNA) are known in the art and include PCR methods, such as real-time PCR analysis, microarray analysis, hybridization analysis and nucleic acid sequence analysis, as well as a variety of other methods where nucleic acid compositions are analyzed and which are known to those of skill in the art. See, for example, Molecular Cloning (three volume set, Cold Spring Harbor Laboratory Press, 2012) and Current Protocols (Genetics and Genomics; Molecular Biology; 2003-2013).

a. Real-Time PCR

For the design of Real-Time PCR assays, several parts are coordinated, including the DNA fragment that is flanked by the two primers and subsequently amplified, often referred to as the amplicon, the two primers and the detection probe or probes to be used.

Real-time PCR relies on the visual emission of fluorescent dyes conjugated to short polynucleotides (termed ā€œdetection probesā€) that associate with genomic alleles in a sequence-specific fashion. Real-time PCR probes differing by a single nucleotide can be differentiated in a real-time PCR assay by the conjugation and detection of probes that fluoresce at different wavelengths. Real-Time PCR finds use in detection applications (diagnostic applications), quantification applications and genotyping applications.

Several related methods for performing real-time PCR are disclosed in the art, including assays that rely on TAQMANĀ® probes (U.S. Pat. Nos. 5,210,015 and 5,487,972, and Lee et al., Nucleic Acids Res. 21:3761-6, 1993), molecular beacon probes (U.S. Pat. Nos. 5,925,517 and 6,103,476, and Tyagi and Kramer, Nat. Biotechnol. 14:303-8, 1996), self-probing amplicons (scorpions) (U.S. Pat. No. 6,326,145, and Whitcombe et al., Nat. Biotechnol. 17:804-7, 1999), Amplisensor (Chen et al., Appl. Environ. Microbiol. 64:4210-6, 1998), Amplifluor (U.S. Pat. No. 6,117,635, and Nazarenko et al., Nucleic Acids Res. 25:2516-21, 1997, displacement hybridization probes (Li et al., Nucleic Acids Res. 30:E5, 2002), DzyNA-PCR (Todd et al., Clin. Chem. 46:625-30, 2000), fluorescent restriction enzyme detection (Cairns et al., Biochem. Biophys. Res. Commun. 318:684-90, 2004) and adjacent hybridization probes (U.S. Pat. No. 6,174,670 and Wittwer et al., Biotechniques 22:130-1, 134-8, 1997).

In some instances, real-time PCR can result in detection of a variety of gene mutations, including for example but not limited to SNPs. In some embodiments, detection of SNPs in specific gene candidates is performed using real-time PCR, based on the use of intramolecular quenching of a fluorescent molecule by use of a tethered quenching moiety. Thus, according to exemplary embodiments, real-time PCR methods also include the use of molecular beacon technology. The molecular beacon technology utilizes hairpin-shaped molecules with an internally-quenched fluorophore whose fluorescence is restored by binding to a DNA target of interest (See, e.g., Kramer, R. et al. Nat. Biotechnol. 14:303-308, 1996). In some embodiments, increased binding of the molecular beacon probe to the accumulating PCR product is used to specifically detect SNPs present in genomic DNA.

One of the many suitable genotyping procedures is the TAQMANĀ® allelic discrimination assay. In some instances of this assay, an oligonucleotide probe labeled with a fluorescent reporter dye at the 5′ end of the probe and a quencher dye at the 3′ end of the probe is utilized. The proximity of the quencher to the intact probe maintains a low fluorescence for the reporter. During the PCR reaction, the 5′ nuclease activity of DNA polymerase cleaves the probe, and separates the dye and quencher. This results in an increase in fluorescence of the reporter. Accumulation of PCR product is detected directly by monitoring the increase in fluorescence of the reporter dye. The 5′ nuclease activity of DNA polymerase cleaves the probe between the reporter and the quencher only if the probe hybridizes to the target and is amplified during PCR. The probe is designed to straddle a target SNP position and hybridize to the nucleic acid molecule only if a particular SNP allele is present.

By way of example, to amplify the Avellino corneal dystrophy associated SNP located in exon 4 of the TGFβI gene, forward and reverse PCR primer pairs (SEQ ID NOs:1 to 24 in FIG. 2) were constructed as described in U.S. Patent Publication No. 2012/0077200. In some embodiments, any of the forward and reverse primer pairs disclosed therein are used in the improved methods disclosed herein. In a preferred embodiment, the forward and reverse primer pair of SEQ ID NO:1 (forward) and SEQ ID NO:2 (reverse) are used in the improved methods provided herein.

In order to detect the guanine-to-adenine mutation in exon 4 of TGFβI gene, fluorescently labeled real-time PCR probe pairs for the detection of the wild type (ā€œGā€) and Avellino corneal dystrophy-associated mutant (ā€œAā€) allele having nucleotide sequences according to SEQ ID NOs: 25 to 42, as shown in FIG. 3, were constructed as described in U.S. Patent Publication 2012/0077200. In some embodiments, any of the wild type and mutant probes are used in the improved methods disclosed herein. In a preferred embodiment, the wild type and mutant probe pair of SEQ ID NO:25 (wild type) and SEQ ID NO:26 (mutant) are used in the improved methods provided herein. To differentiate the wild type allele from the disease-associated allele, the wild type probes were labeled with VIC, and the mutant probes were labeled with FAM. The minor groove binder (MGB) was attached to the probe so as to facilitate binding to a complementary gene fragment.

b. Real-Time PCR Cycles

Real-time PCR methods include a variety of steps or cycles as part of the methods for amplification. These cycles include denaturing double-stranded nucleic acids, annealing a forward primer, a reverse primer and a detection probe to the target genomic DNA sequence and synthesizing (i.e., replicating) second-strand DNA from the annealed forward primer and the reverse primer. This three step process is referred to herein as a cycle.

In some embodiments, about 10, 15, 20, 25, 30, 35, 40, 45, 50, 55, or 60 cycles are employed. In some embodiments, about 10 to about 60 cycles, about 20 to about 50 or about 30 to about 40 cycles are employed. In some embodiments, 40 cycles are employed.

In some embodiments, the denaturing double-stranded nucleic acids step occurs at a temperature of about 80° C. to 100° C., about 85° C. to about 99° C., about 90° C. to about 95° C. for about 1 second to about 5 seconds, about 2 seconds to about 5 seconds, or about 3 seconds to about 4 seconds. In some embodiments, the denaturing double-stranded nucleic acids step occurs at a temperature of 95° C. for about 3 seconds.

In some embodiments, the annealing a forward primer, a reverse primer and a detection probe to the target genomic DNA sequence step occurs at about 40° C. to about 80° C., about 50° C. to about 70° C., about 55° C. to about 65° C. for about 15 seconds to about 45 seconds, about 20 seconds to about 40 seconds, about 25 seconds to about 35 seconds. In some embodiments, the annealing a forward primer, a reverse primer and a detection probe to the target genomic DNA sequence step occurs at about 60° C. for about 30 seconds.

In some embodiments, the synthesizing (i.e., replicating) second-strand DNA from the annealed forward primer and the reverse primer occurs at about 40° C. to about 80° C., about 50° C. to about 70° C., about 55° C. to about 65° C. for about 15 seconds to about 45 seconds, about 20 seconds to about 40 seconds, about 25 seconds to about 35 seconds. In some embodiments, the annealing a forward primer, a reverse primer and a detection probe to the target genomic DNA sequence step occurs at about 60° C. for about 30 seconds.

In some embodiments, it was found that about 1 μL, about 2 μL, about 3 μL, about 4 μL or about 5 μL of a genomic DNA sample prepared according to the present methods described herein, are combined with only about 0.05 μL, about 0.10 μL about 0.15 μL, about 0.20 μL, about 0.25 μL or about 0.25 μL of a 30Ɨ, 35Ɨ, 40Ɨ, 45Ɨ, 50Ɨ or 100Ɨ real-time PCR assay mix and distilled water to form the PCR master mix. In some embodiments, the PCR master mix has a final volume of about 5 μL, about 6 μL, about 7 μL, about 8 μL, about 9 μL, about 0 μL, about 11 μL, about 12 μL, about 13 μL, about 14 μL, about 15 μL, about 16 μL, about 17 μL, about 18 μL, about 19 μL or about 20 μL or more. In some embodiments, it was found that 2 μL of a genomic DNA sample prepared as described above, are combined with only about 0.15 μL of a 40Ɨ real-time PCR assay mix and 2.85 μL of distilled water in order to form the PCR master mix.

While exemplary reactions are described herein, one of skill would understand how to modify the temperatures and times based on the probe design. Moreover, the present methods contemplate any combination of the above times and temperatures.

c. PCR Primers and Primer Design

In some embodiments, primers are tested and designed in a laboratory setting. In some embodiments, primers are designed by computer based in silico methods. Primer sequences are based on the sequence of the amplicon or target nucleic acid sequence that is to be amplified. Shorter amplicons typically replicate more efficiently and lead to more efficient amplification as compared to longer amplicons.

In designing primers, one of skill would understand the need to take into account melting temperature (Tm; the temperature at which half of the primer-target duplex is dissociated and becomes single stranded and is an indication of duplex stability; increased Tm indicates increased stability) based on GC and AT content of the primers being designed as well as secondary structure considerations (increased GC content can lead to increased secondary structure). TM's can be calculated using a variety of methods known in the art and those of skill would readily understand such various methods for calculating TM; such methods include for example but are not limited to those available in online tools such as the TM calculators available on the World Wide Web at promega.com/techserv/tools/biomath/calc11.htm. Primer specificity is defined by its complete sequence in combination with the 3′ end sequence, which is the portion elongated by Taq polymerase. In some embodiments, the 3′ end should have at least 5 to 7 unique nucleotides not found anywhere else in the target sequence, in order to help reduce false-priming and creation of incorrect amplification products. Forward and reverse primers typically bind with similar efficiency to the target. In some instances, tools such as NCBI BLAST (located on the World Wide Web at ncbi.nlm.nih.gov) are employed to performed alignments and assist in primer design.

Those of skill in the art would be well aware of the basics regarding primer design for a target nucleic acid sequence and a variety of reference manuals and texts have extensive teachings on such methods, including for example, Molecular Cloning (three volume set, Cold Spring Harbor Laboratory Press, 2012) and Current Protocols (Genetics and Genomics; Molecular Biology; 2003-2013) and Real-Time PCR in Microbiology: From Diagnostics to Characterization (Ian M. MacKay, Calster Academic Press; 2007); PrimerAnalyser Java tool available on the World Wide Web at primerdigital.com/tools/PrimerAnalyser.html and Kalendar R, et al. (Genomics, 98(2): 137-144 (2011)), all of which are incorporated herein in their entireties for all purposes.

An additional aspect of primer design is primer complexity or linguistic sequence complexity (see, Kalendar R, et al. (Genomics, 98(2): 137-144 (2011)). Primers with greater linguistic sequence complexity (e.g., nucleotide arrangement and composition) are typically more efficient. In some embodiments, the linguistic sequence complexity calculation method is used to search for conserved regions between compared sequences for the detection of low-complexity regions including simple sequence repeats, imperfect direct or inverted repeats, polypurine and polypyrimidine triple-stranded cDNA structures, and four-stranded structures (such as G-quadruplexes). In some embodiments, linguistic complexity (LC) measurements are performed using the alphabet-capacity L-gram method (see, A. Gabrielian, A. Bolshoy, Computer & Chemistry 23:263-274 (1999) and Y. L. Orlov, V. N. Potapov, Complexity: an internet resource for analysis of DNA sequence complexity, Nucleic Acids Res. 32: W628-W633(2004)) along the whole sequence length and calculated as the sum of the observed range (xi) from 1 to L size words in the sequence divided by the sum of the expected (E) value for this sequence length. Some G-rich (and C-rich) nucleic acid sequences fold into four-stranded DNA structures that contain stacks of G-quartets (see, the World Wide Web at quadruplex.org). In some instances, these quadruplexes are formed by the intermolecular association of two or four DNA molecules, dimerization of sequences that contain two G-bases, or by the intermolecular folding of a single strand containing four blocks of guanines (see, P. S. Ho, PNAS, 91:9549-9553 (1994); I. A. Il'icheva, V. L. Florent'ev, Russian Journal of Molecular Biology 26:512-531(1992); D. Sen, W. Gilbert, Methods Enzymol. 211:191-199 (1992); P. A. Rachwal, K. R. Fox, Methods 43:291-301 (2007); S. Burge, G. N. Parkinson, P. Hazel, A. K. Todd, K. Neidle, Nucleic Acids Res. 34:5402-5415 (2006); A. GuƩdin, J. Gros, P. Alberti, J. Mergny, Nucleic Acids Res. 38:7858-7868 (2010); O. Stegle, L. Payet, J. L. Mergny, D. J. MacKay, J. H. Leon, Bioinformatics 25:i374-i382 (2009); in some instances, these are eliminated from primer design because of their low linguistic complexity, LC=32% for (TTAGGG)4.

These methods include various bioinformatics tools for pattern analysis in sequences having GC skew, (Gāˆ’C)/(G+C), AT skew, (Aāˆ’T)/(A+T), CGāˆ’AT skew, (Sāˆ’W)/(S+W), or purine-pyrimidine (Rāˆ’Y)/(R+Y) skew regarding CG content and melting temperature and provide tools for determining linguistic sequence complexity profiles. For example the GC skew in a sliding window of n, where n is a positive integer, bases is calculated with a step of one base, according to the formula, (Gāˆ’C)/(G+C), in which G is the total number of guanines and C is the total number of cytosines for all sequences in the windows (Y. Benita, et al., Nucleic Acids Res. 31:e99 (2003)). Positive GC-skew values indicated an overabundance of G bases, whereas negative GC-skew values represented an overabundance of C bases. Similarly, other skews are calculated in the sequence. Such methods, as well as others, are employed to determine primer complexity in some embodiments.

According to non-limiting example embodiments, real-time PCR is performed using exonuclease primers (TAQMANĀ® probes). In such embodiments, the primers utilize the 5′ exonuclease activity of thermostable polymerases such as Taq to cleave dual-labeled probes present in the amplification reaction (See, e.g., Wittwer, C. et al. Biotechniques 22:130-138, 1997). While complementary to the PCR product, the primer probes used in this assay are distinct from the PCR primer and are dually-labeled with both a molecule capable of fluorescence and a molecule capable of quenching fluorescence. When the probes are intact, intramolecular quenching of the fluorescent signal within the DNA probe leads to little signal. When the fluorescent molecule is liberated by the exonuclease activity of Taq during amplification, the quenching is greatly reduced leading to increased fluorescent signal. Non-limiting examples of fluorescent probes include the 6-carboxy-floruescein moiety and the like. Exemplary quenchers include Black Hole Quencher 1 moiety and the like.

A variety of PCR primers can find use with the disclosed methods. Exemplary primers include but are not limited to those described herein. Primers for use in the disclosed methods are also found in U.S. Patent Publication No. 20120077200, which is hereby incorporated by reference for all purposes. In some embodiments, the PCR primers for use in the methods of the present disclosure include but are not limited to the following listed in Table 1 and find use in the detection of the TGFβI gene. Tables 2 and 3 provide biophysical parameters for each primer, as calculated using the World Wide Web at primerdigital.com/tools/PrimerAnalyser.html.

TABLEā€ƒ1
Exemplaryā€ƒPrimersā€ƒforā€ƒtheā€ƒTGFβIā€ƒgene
Primerā€ƒName SEQā€ƒIDā€ƒNO: Primerā€ƒSequence
ACDā€ƒFwā€ƒprimer SEQā€ƒIDā€ƒNO:ā€ƒ1 5′-TCCā€ƒACCā€ƒACCā€ƒACTā€ƒCAGā€ƒCTGā€ƒTA
ACDā€ƒReā€ƒprimer SEQā€ƒIDā€ƒNO:ā€ƒ2 5′-CCAā€ƒTCTā€ƒCAGā€ƒGCCā€ƒTCAā€ƒGCTā€ƒT
(60ā€ƒbp)
AVā€ƒFwā€ƒprimer SEQā€ƒIDā€ƒNO:ā€ƒ3 5′-TGCā€ƒAGCā€ƒCCTā€ƒACCā€ƒACTā€ƒCTCā€ƒAA
AVā€ƒReā€ƒprimer SEQā€ƒIDā€ƒNO:ā€ƒ4 5′-AGGā€ƒCCTā€ƒCGTā€ƒTGCā€ƒTAGā€ƒG
(150ā€ƒbp)
Realā€ƒFwā€ƒprimer SEQā€ƒIDā€ƒNO:ā€ƒ5 5′-TAGā€ƒTCTā€ƒCTTā€ƒATTā€ƒCTAā€ƒATAā€ƒGA
Realā€ƒReā€ƒprimer SEQā€ƒIDā€ƒNO:ā€ƒ6 5′-GCTā€ƒGCAā€ƒGACā€ƒTCTā€ƒGTGā€ƒTTTā€ƒAA
(860ā€ƒbp)
ACDā€ƒFw2ā€ƒprimer SEQā€ƒIDā€ƒNO:ā€ƒ7 5′-CCAā€ƒTCCā€ƒCTCā€ƒCTTā€ƒCTGā€ƒTCTā€ƒTCTā€ƒG
ACDā€ƒRe2ā€ƒprimer SEQā€ƒIDā€ƒNO:ā€ƒ8 5′-CGGā€ƒGCCā€ƒCCTā€ƒCCAā€ƒTCTā€ƒC
(140ā€ƒbp)
ACDā€ƒFw3ā€ƒprimer SEQā€ƒIDā€ƒNO:ā€ƒ9 5′-CAGā€ƒAGAā€ƒAGGā€ƒGAGā€ƒGGTā€ƒGTGā€ƒGTT
ACDā€ƒRe3ā€ƒprimer SEQā€ƒIDā€ƒNO:ā€ƒ10 5′-GGGā€ƒCGAā€ƒAGAā€ƒTGGā€ƒTGAā€ƒAGCā€ƒT
(190ā€ƒbp)
ACDā€ƒFw4ā€ƒprimer SEQā€ƒIDā€ƒNO:ā€ƒ11 5′-TCCā€ƒTCGā€ƒTCCā€ƒTCTā€ƒCCAā€ƒCCTā€ƒGTA
ACDā€ƒRe4ā€ƒprimer SEQā€ƒIDā€ƒNO:ā€ƒ12 5′-AGCā€ƒTGGā€ƒCAAā€ƒGGAā€ƒGGCā€ƒCC
ACDā€ƒFw5ā€ƒprimer SEQā€ƒIDā€ƒNO:ā€ƒ13 5′-TTTā€ƒGGGā€ƒCTTā€ƒTCCā€ƒCACā€ƒATGā€ƒC
ACDā€ƒRe5ā€ƒprimer SEQā€ƒIDā€ƒNO:ā€ƒ14 5′-GGCā€ƒAGAā€ƒCGGā€ƒAGGā€ƒTCAā€ƒTCTā€ƒCA
ACDā€ƒFw6ā€ƒprimer SEQā€ƒIDā€ƒNO:ā€ƒ15 5′-GTAā€ƒGTAā€ƒCCGā€ƒTGCā€ƒTCTā€ƒCTG
ACDā€ƒRe6ā€ƒprimer SEQā€ƒIDā€ƒNO:ā€ƒ16 5′-AGTā€ƒTCCā€ƒCCAā€ƒTAAā€ƒGAAā€ƒTCCā€ƒCCC
ACDā€ƒFw7ā€ƒprimer SEQā€ƒIDā€ƒNO:ā€ƒ17 5′-GGCā€ƒTGGā€ƒACCā€ƒCCCā€ƒAGAā€ƒGG
ACDā€ƒRe7ā€ƒprimer SEQā€ƒIDā€ƒNO:ā€ƒ18 5′-ACCā€ƒCCTā€ƒCGGā€ƒGGAā€ƒAGTā€ƒAAGā€ƒG
ACDā€ƒFw8ā€ƒprimer SEQā€ƒIDā€ƒNO:ā€ƒ19 5′-AACā€ƒCTTā€ƒTACā€ƒGAGā€ƒACCā€ƒCTGā€ƒGGA
ACDā€ƒRe8ā€ƒprimer SEQā€ƒIDā€ƒNO:ā€ƒ20 5′-GACā€ƒTCCā€ƒCATā€ƒCCAā€ƒTCAā€ƒTGCā€ƒCC
ACDā€ƒFw9ā€ƒprimer SEQā€ƒIDā€ƒNO:ā€ƒ21 5′-AGTā€ƒCGTā€ƒTGGā€ƒATCā€ƒCACā€ƒCACā€ƒCA
ACDā€ƒRe9ā€ƒprimer SEQā€ƒIDā€ƒNO:ā€ƒ22 5′-GACā€ƒGTCā€ƒATTā€ƒTCCā€ƒTACā€ƒTGTā€ƒTTCā€ƒAGG
ACDā€ƒFw10ā€ƒprimer SEQā€ƒIDā€ƒNO:ā€ƒ23 5′-CCCā€ƒCCCā€ƒAGAā€ƒAACā€ƒAGCā€ƒCTG
ACDā€ƒRe10ā€ƒprimer SEQā€ƒIDā€ƒNO:ā€ƒ24 5′-TTCā€ƒTAAā€ƒGGGā€ƒGTTā€ƒAAGā€ƒGAGā€ƒAAAā€ƒGCTā€ƒT
GCD1ā€ƒFwā€ƒprimer SEQā€ƒIDā€ƒNO:ā€ƒ43 5′-ACAā€ƒCAGā€ƒTCTā€ƒTTGā€ƒCTCā€ƒCCAā€ƒCAAā€ƒA
GCD1ā€ƒReā€ƒprimer SEQā€ƒIDā€ƒNO:ā€ƒ44 5′-ACTā€ƒTAAā€ƒGTTā€ƒGGTā€ƒCTTā€ƒTACā€ƒCCAā€ƒAGAā€ƒGTCā€ƒT

TABLE 2
Biophysical Parameters for Forward Primers
GC % PCR
Forward Primer Length Tm1 Tm2 Content Complexity Effic.
SEQ ID NO: 1 19 55.4 57.8 57.9 70 70
SEQ ID NO: 3 20 57.1 58 55 81 66
SEQ ID NO: 5 20 40.2 45.7 25 73 38
SEQ ID NO: 7 22 55.9 60.2 54.5 62 43
SEQ ID NO: 9 21 57.5 60.2 57.1 64 40
SEQ ID NO: 11 21 57.6 60.2 57.1 66 57
SEQ ID NO: 13 19 55.4 55.7 52.6 81 80
SEQ ID NO: 15 18 50.6 55.3 55.6 75 66
SEQ ID NO: 17 17 57.8 62.2 76.5 74 60
SEQ ID NO: 19 21 56.6 58.2 52.4 82 73
SEQ ID NO: 21 20 57.4 58 55 78 46
SEQ ID NO: 23 18 56.5 59.9 66.7 69 69
Avg 19.67 54.96 57.80 56.05 72.69 59.85
Median 20 56.55 58.1 55.3 73.5 63
Std Dev 1.50 5.00 4.24 11.78 6.84 14.10

TABLE 3
Biophysical Parameters for Reverse Primers
GC % PCR
Reverse Primer Length Tm1 Tm2 Content Complexity Effic.
SEQ ID NO: 2 19 55.5 57.8 57.9 72 52
SEQ ID NO: 4 16 52.1 54.5 62.5 78 78
SEQ ID NO: 6 20 52.4 53.9 45 84 41
SEQ ID NO: 8 16 55.2 59.6 75 63 53
SEQ ID NO: 10 19 56.5 57.8 57.9 78 69
SEQ ID NO: 12 17 58.5 59.8 70.6 74 66
SEQ ID NO: 14 20 57.6 60.1 60 84 74
SEQ ID NO: 16 21 54.9 58.2 52.4 71 51
SEQ ID NO: 18 19 56.6 60 63.2 78 60
SEQ ID NO: 20 20 56.5 60.1 60 65 65
SEQ ID NO: 22 24 55.5 58.7 45.8 88 67
SEQ ID NO: 24 25 55.3 57.2 40 74 40
Avg 19.69 55.61 58.13 57.33 76.54 60.69
Median 19.5 55.5 58.45 58.95 76 62.5
Std Dev 2.77 1.86 2.10 10.33 7.52 12.30

In some embodiments, the real-time PCR primers for use with the disclosed methods have a linguistic sequence complexity of at least 70%, at least 72%, at least 75%, at least 77%, at least 80%, at least 82%, at least 85%, at least 88%, at least 90%, at least 92%, at least 95%, at least 97% or at least 99%.

d. Detection Probe Design and Detection Probes

A variety of detection probes can find use with the disclosed methods and are employed for genotyping and or for quantification. Detection probes commonly employed by those of skill in the art include but are not limited to hydrolysis probes (also known as TAQMANĀ® probes, 5′ nuclease probes or dual-labeled probes), hybridization probes, and Scorpion primers (which combine primer and detection probe in one molecule). In some embodiments, detection probe design is determined by one of skill in the art based on the desired probe target such that the probe is compatible with the PCR primers employed (e.g., primers and probes should not interfere with one another's functions in the real-time PCR assay). In some embodiments, probes are designed to have higher Tm's than the primers in order to promote efficient signal production. Tm's are calculated using any of a variety of methods known in the art and those of skill would readily understand such various methods for calculating Tm; such methods include for example those available in online tools such as the calculators available on the World Wide Web at promega.com/techserv/tools/biomath/calc11.htm. In some embodiments, the increased Tm of the detection probe provides that the detection probe has bound before the primers are elongated by the polymerase.

In some embodiments, detection probes contain various modifications. In some embodiments, detection probes include modified nucleic acid residues, such as but not limited to 2′-O-methyl ribonucleotide modifications, phosphorothioate backbone modifications, phosphorodithioate backbone modifications, phosphoramidate backbone modifications, methylphosphonate backbone modifications, 3′ terminal phosphate modifications and/or 3′ alkyl substitutions.

In some embodiments, the detection probe has increased affinity for a target sequence due to modifications. Such detection probes include detection probes with increased length, as well as detection probes containing chemical modifications. Such modifications include but are not limited to 2′-fluoro (2′-deoxy-2′-fluoro-nucleosides) modifications, LNAs (locked nucleic acids), PNAs (peptide nucleic acids), ZNAs (zip nucleic acids), morpholinos, methylphosphonates, phosphoramidates, polycationic conjugates and 2′-pyrene modifications. In some embodiments, the detector probes contains one or more modifications including 2′ fluoro modifications (aka, 2′-Deoxy-2′-fluoro-nucleosides), LNAs (locked nucleic acids), PNAs (peptide nucleic acids), ZNAs (zip nucleic acids), morpholinos, methylphosphonates, phosphoramidates, and/or polycationic conjugates.

In some embodiments, the detection probes contain detectable moieties, such as those described herein as well as any detectable moieties known to those of skill in the art. Such detectable moieties include for example but are not limited to fluorescent labels and chemiluminescent labels. Examples of such detectable moieties can also include members of FRET pairs. In some embodiments, the detection probe contains a detectable entity.

Examples of fluorescent labels include but are not limited to AMCA, DEAC (7-Diethylaminocoumarin-3-carboxylic acid); 7-Hydroxy-4-methylcoumarin-3; 7-Hydroxycoumarin-3; MCA (7-Methoxycoumarin-4-acetic acid); 7-Methoxycoumarin-3; AMF (4′-(Aminomethyl)fluorescein); 5-DTAF (5-(4,6-Dichlorotriazinyl)aminofluorescein); 6-DTAF (6-(4,6-Dichlorotriazinyl)aminofluorescein); 6-FAM (6-Carboxyfluorescein; aka FAM; including TAQMANĀ® FAMā„¢); TAQMAN VICĀ®; 5(6)-FAM cadaverine; 5-FAM cadaverine; 5(6)-FAM ethylenediamme; 5-FAM ethylenediamme; 5-FITC (FITC Isomer I; fluorescein-5-isothiocyanate); 5-FITC cadaverin; Fluorescein-5-maleimide; 5-IAF (5-Iodoacetamidofluorescein); 6-JOE (6-Carboxy-4′,5′-dichloro-2′,7′-dimethoxyfluorescein); 5-CR11O (5-Carboxyrhodamine 110); 6-CR11O (6-Carboxyrhodamine 110); 5-CR6G (5-Carboxyrhodamine 6G); 6-CR6G (6-Carboxyrhodamine 6G); 5(6)-Caroxyrhodamine 6G cadaverine; 5(6)-Caroxyrhodamine 6G ethylenediamme; 5-ROX (5-Carboxy-X-rhodamine); 6-ROX (6-Carboxy-X-rhodamine); 5-TAMRA (5-Carboxytetramethylrhodamine); 6-TAMRA (6-Carboxytetramethylrhodamine); 5-TAMRA cadaverine; 6-TAMRA cadaverine; 5-TAMRA ethylenediamme; 6-TAMRA ethylenediamme; 5-TMR C6 maleimide; 6-TMR C6 maleimide; TR C2 maleimide; TR cadaverine; 5-TRITC; G isomer (Tetramethylrhodamine-5-isothiocyanate); 6-TRITC; R isomer (Tetramethylrhodamine-6-isothiocyanate); Dansyl cadaverine (5-Dimethylaminonaphthalene-1-(N-(5-aminopentyl))sulfonamide); EDANS C2 maleimide; fluorescamine; NBD; and pyrromethene and derivatives thereof.

Examples of chemiluminescent labels include but are not limited to those labels used with Southern Blot and Western Blot protocols (see, for e.g., Sambrook and Russell, Molecular Cloning: A Laboratory Manual, (3rd ed.) (2001); incorporated by reference herein in its entirety). Examples include but are not limited to -(2′-spiroadamantane)-4-methoxy-4-(3″-phosphoryloxy)phenyl-1,2-dioxetane (AMPPD); acridinium esters and adamantyl-stabilized 1,2-dioxetanes, and derivatives thereof.

The labeling of probes is known in the art. The labeled probes are used to hybridize within the amplified region during amplification. The probes are modified so as to avoid them from acting as primers for amplification. The detection probe is labeled with two fluorescent dyes, one capable of quenching the fluorescence of the other dye. One dye is attached to the 5′ terminus of the probe and the other is attached to an internal site, so that quenching occurs when the probe is in a non-hybridized state.

Typically, real-time PCR probes consist of a pair of dyes (a reporter dye and an acceptor dye) that are involved in fluorescence resonance energy transfer (FRET), whereby the acceptor dye quenches the emission of the reporter dye. In general, the fluorescence-labeled probes increase the specificity of amplicon quantification.

Real-time PCR that are used in some embodiments of the disclosed methods also include the use of one or more hybridization probes (i.e., detection probes), as determined by those skilled in the art, in view of this disclosure. By way of non-limiting example, such hybridization probes include but are not limited to one or more of those provided in the described methods. Exemplary probes, such as the HEX channel and/or FAM channel probes, are understood by one skilled in the art.

According to example embodiments, detection probes and primers are conveniently selected e.g., using an in silico analysis using primer design software and cross-referencing against the available nucleotide database of genes and genomes deposited at the National Center for Biotechnology Information (NCBI). Some additional guidelines may be used for selection of primers and/or probes in some embodiments. For example, in some embodiments, the primers and probes are selected such that they are close together, but not overlapping. In some embodiments, the primers may have the same (or close TM) (e.g., between about 58° C. and about 60° C.). In some embodiments, the TM of the probe is approximately 10° C. higher than that selected for the TM of the primers. In some embodiments, the length of the probes and primers is selected to be between about 17 and 39 base pairs, etc. These and other guidelines are used in some instances by those skilled in the art in selecting appropriate primers and/or probes.

Probes for use in the methods of the present invention include but are not limited to the following exemplary probes listed in Table 4.

TABLEā€ƒ4
Exemplaryā€ƒProbesā€ƒforā€ƒtheā€ƒTGFβIā€ƒgene
Probeā€ƒName SEQā€ƒIDā€ƒNO: Probeā€ƒSequence
Normalā€ƒprobeā€ƒ1 SEQā€ƒIDā€ƒNO:ā€ƒ25 VIC-CACā€ƒGGAā€ƒCCGā€ƒCACā€ƒGGA-NFQ
(15ā€ƒbp)
Mutantā€ƒprobeā€ƒ1 SEQā€ƒIDā€ƒNO:ā€ƒ26 FAM-CACā€ƒGGAā€ƒCCAā€ƒCACā€ƒGGA-NFQ
Normalā€ƒprobeā€ƒ2 SEQā€ƒIDā€ƒNO:ā€ƒ27 VIC-ACAā€ƒCGGā€ƒACCā€ƒGCAā€ƒCG-NFQ
Mutantā€ƒprobeā€ƒ2 SEQā€ƒIDā€ƒNO:ā€ƒ28 FAM-ACAā€ƒCGGā€ƒACCā€ƒACAā€ƒCG-NFQ
(14ā€ƒbp)
Normalā€ƒprobeā€ƒ3 SEQā€ƒIDā€ƒNO:ā€ƒ29 VIC-TACā€ƒACGā€ƒGACā€ƒCGCā€ƒA-NFQ
Mutantā€ƒprobeā€ƒ3 SEQā€ƒIDā€ƒNO:ā€ƒ30 FAM-TACā€ƒACGā€ƒGACā€ƒCACā€ƒA-NFQ
(13ā€ƒbp)
Normalā€ƒprobeā€ƒ4 SEQā€ƒIDā€ƒNO:ā€ƒ31 VIC-CTGā€ƒTACā€ƒACGā€ƒGACā€ƒCGCā€ƒACG-NFQ
Mutantā€ƒprobeā€ƒ4 SEQā€ƒIDā€ƒNO:ā€ƒ32 FAM-CTGā€ƒTACā€ƒACGā€ƒGACā€ƒCACā€ƒACG-NFQ
(18ā€ƒbp)
Normalā€ƒprobeā€ƒ5 SEQā€ƒIDā€ƒNO:ā€ƒ33 VIC-CTGā€ƒTACā€ƒACGā€ƒGACā€ƒCGCā€ƒACGā€ƒGAG-NFQ
Mutantā€ƒprobeā€ƒ5 SEQā€ƒIDā€ƒNO:ā€ƒ34 FAM-CTGā€ƒTACā€ƒACGā€ƒGACā€ƒCACā€ƒACGā€ƒGAG-NFQ
(21ā€ƒbp)
Normalā€ƒprobeā€ƒ6 SEQā€ƒIDā€ƒNO:ā€ƒ35 VIC-GCTā€ƒGTAā€ƒCACā€ƒGGAā€ƒCCGā€ƒCACā€ƒGGAā€ƒGAA-
NFQ
Mutantā€ƒprobeā€ƒ6 SEQā€ƒIDā€ƒNO:ā€ƒ36 FAM-GCTā€ƒGTAā€ƒCACā€ƒGGAā€ƒCCAā€ƒCACā€ƒGGAā€ƒGM-
NFQ
Normalā€ƒprobeā€ƒ7 SEQā€ƒIDā€ƒNO:ā€ƒ37 VIC-ACCā€ƒGCAā€ƒCGGā€ƒAGAā€ƒAGC-NFQ
Mutantā€ƒprobeā€ƒ7 SEQā€ƒIDā€ƒNO:ā€ƒ38 FAM-ACCā€ƒACAā€ƒCGGā€ƒAGAā€ƒAGC-NFQ
Normalā€ƒprobeā€ƒ8 SEQā€ƒIDā€ƒNO:ā€ƒ39 VIC-ACCā€ƒGCAā€ƒCGGā€ƒAGAā€ƒAGCā€ƒTGAā€ƒGGC-NFQ
Mutantā€ƒprobeā€ƒ8 SEQā€ƒIDā€ƒNO:ā€ƒ40 FAM-ACCā€ƒACAā€ƒCGGā€ƒAGAā€ƒAGCā€ƒTGAā€ƒGGC-NFQ
Normalā€ƒprobeā€ƒ9 SEQā€ƒIDā€ƒNO:ā€ƒ41 VIC-ACCā€ƒGCAā€ƒCGGā€ƒAGAā€ƒAGCā€ƒTGAā€ƒGGCā€ƒCTG-
NFQ
Mutantā€ƒprobeā€ƒ9 SEQā€ƒIDā€ƒNO:ā€ƒ42 FAM-ACCā€ƒACAā€ƒCGGā€ƒAGAā€ƒAGCā€ƒTGAā€ƒGGCā€ƒCTG-
NFQ
Normalā€ƒProbeā€ƒ10 SEQā€ƒIDā€ƒNO:ā€ƒ45 VIC-CACā€ƒCAAā€ƒGAGā€ƒAACā€ƒGGA-NFQ
Mutantā€ƒProbeā€ƒ10 SEQā€ƒIDā€ƒNO:ā€ƒ46 FAM-CACā€ƒCAAā€ƒGAGā€ƒAATā€ƒGG-NFQ
Normalā€ƒProbeā€ƒ10a SEQā€ƒIDā€ƒNO:ā€ƒ47 VIC-CACā€ƒCAAā€ƒGAGā€ƒAACā€ƒGGAā€ƒG-MGBā€ƒNFQ
#TGFBIā€ƒR124C SEQā€ƒIDā€ƒNO:ā€ƒ48 FAM-CACā€ƒGGAā€ƒCTGā€ƒCACā€ƒGGA-MGBā€ƒNFQ
#TGFBIā€ƒR124L SEQā€ƒIDā€ƒNO:ā€ƒ49 FAM-CACā€ƒGGAā€ƒCCTā€ƒCACā€ƒGGA-MGBā€ƒNFQ
#TGFBIā€ƒR555Q-1 SEQā€ƒIDā€ƒNO:ā€ƒ50 FAM-ACā€ƒCAAā€ƒGAGā€ƒAACAā€ƒGAā€ƒG--MGBā€ƒNFQ

VII. Diagnostic Tests

In some embodiments, diagnostic testing is employed to determine one or more genetic conditions by detection of any of a variety of mutations. In some embodiments, diagnostic testing is used to confirm a diagnosis when a particular condition is suspected based on for example physical manifestations, signs and/or symptoms as well as family history information. In some embodiments, the results of a diagnostic test assist those of skill in the medical arts in determining an appropriate treatment regimen for a given patient and allow for more personalized and more effective treatment regimens. In some embodiments, a treatment regimen include any of a variety of pharmaceutical treatments, surgical treatments, lifestyles changes or a combination thereof as determined by one of skill in the art.

The nucleic acids obtained by the disclosed methods are useful in a variety of diagnostic tests, including tests for detecting mutations such as deletions, insertions, transversions and transitions. In some embodiments, such diagnostics are useful for identifying unaffected individuals who carry one copy of a gene for a disease that requires two copies for the disease to be expressed, identifying unaffected individuals who carry one copy of a gene for a disease in which the information could find use in developing a treatment regimen, preimplantation genetic diagnosis, prenatal diagnostic testing, newborn screening, genealogical DNA test (for genetic genealogy purposes), presymptomatic testing for predicting adult-onset disorders such as Huntington's disease, presymptomatic testing for estimating the risk of developing adult-onset cancers and Alzheimer's disease, confirmational diagnosis of a symptomatic individual, and/or forensic/identity testing. In some embodiments, the present methods find use in the detection of corneal dystrophy. In some embodiments, corneal dystrophy is detected for example through detection of Avellino corneal dystrophy-related SNPs, such as those that result in R124 mutations in the TGFβI gene (including for example but not limited to an R124H mutation caused by a G to A transition at nucleotide 418 of TGFβI gene also referred to as a C(G/A)C SNP). In some embodiments, corneal dystrophy is detected for example through detection of granular corneal dystrophy-related SNPs, such as those that result in R555 mutations in the TGFβI gene (including for example but not limited to an R555W mutation caused by a C to T transition at nucleotide 1663 of TGFβI gene also referred to as a (C/T)GG SNP). In some embodiments, corneal dystrophy is detected for example through detection of lattice dystrophy-related SNPs, such as those that result in R124 and/or 626 mutations in the TGFβI gene (including for example but not limited to an R124C mutation caused by a C to T transition at nucleotide 417 of TGFβI gene also referred to as a (C/T)GC SNP or a H626P mutation caused by an A to C transition at nucleotide 1924 of TGFβI gene. In some embodiments, corneal dystrophy is detected for example through detection of Reis-Buckler corneal dystrophy-related SNPs, such as those that result in R124 mutations in the TGFβI gene (including for example but not limited to an R124L mutation caused by a G to T transition at nucleotide 418 of TGFβI gene also referred to as a C(G/T)C SNP). In some embodiments, corneal dystrophy is detected for example through detection of Thiel-Behnke corneal dystrophy-related SNPs, such as those that result in R555 mutations in the TGFβI gene (including for example but not limited to an R555Q mutation caused by a G to A transition at nucleotide 1664 of TGFβI gene also referred to as a C(G/A)G SNP).

In some embodiments, newborn screening includes any genetic screening employed just after birth in order to identify genetic disorders. In some embodiments, newborn screening finds use in the identification of genetic disorders so that a treatment regimen is determined early in life. Such tests include but are not limited to testing infants for phenylketonuria and congenital hypothyroidism.

In some embodiments, carrier testing is employed to identify people who carry a single copy of a gene mutation. In some cases, when present in two copies, the mutation can cause a genetic disorder. In some cases, one copy is sufficient to cause a genetic disorder. In some cases, the presence of two copies is contra-indicated for a particular treatment regimen, such as the presence of the Avellino mutation and pre-screening prior to performing surgical procedures in order to ensure the appropriate treatment regiment is pursued for a given patient. In some embodiments, such information is also useful for individual contemplating procreation and assists individuals with making informed decisions as well as assisting those skilled in the medical arts in providing important advice to individual patients as well as patients' relatives.

In some embodiments, predictive and/or presymptomatic types of testing are used to detect gene mutations associated with a variety of disorders. In some cases, these tests are helpful to people who have a family member with a genetic disorder, but who may exhibit no features of the disorder at the time of testing. In some embodiments, predictive testing identifies mutations that increase a person's chances of developing disorders with a genetic basis, including for example but not limited to certain types of cancer. In some embodiments, presymptomatic testing is useful in determining whether a person will develop a genetic disorder, before any physical signs or symptoms appear. The results of predictive and presymptomatic testing provides information about a person's risk of developing a specific disorder and help with making decisions about an appropriate medical treatment regimen for a patient as well as for a patient's relatives. Predictive testing is also employed, in some embodiments, to detect mutations which are contra-indicated with certain treatment regimens, such as the presence of the Avellino mutation being contra-indicated with performing LASIK surgery and/or other refractive procedures, such as but not limited to Phototherapeutic keratectomy (PTK) and/or Photorefractive keratectomy (PRK). For example, patients exhibiting the Avellino mutation should not undergo LASIK surgery or other refractive procedures.

In some embodiments, diagnostic testing also includes pharmacogenomics which includes genetic testing that determines the influence of genetic variation on drug response. Information from such pharmacogenomic analyses finds use in determining and developing an appropriate treatment regimen. Those of skill in the medical arts employ information regarding the presence and/or absence of a genetic variation in designing appropriate treatment regimen.

In some embodiments, diseases whose genetic profiles are determined using the methods of the present disclosure include but are not limited to ophthalmic disorders, cancer, diabetes mellitus, hypertension, schizophrenia, and most common congenital malformations, such as cleft lip, cleft palate, neural tube defects, Achondroplasia, Alpha-1 Antitrypsin Deficiency, Antiphospholipid Syndrome, Autism, Autosomal Dominant Polycystic Kidney Disease, Charcot-Marie-Tooth, Colon cancer, Cri du chat, Crohn's Disease, Cystic fibrosis, Dercum Disease, Down Syndrome, Duane Syndrome, Duchenne Muscular Dystrophy, Factor V Leiden Thrombophilia, Familial Hypercholesterolemia, Familial Mediterranean Fever, Fragile X Syndrome, Gaucher Disease, Hemochromatosis, Hemophilia, Holoprosencephaly, Huntington's disease, Klinefelter syndrome, Marfan syndrome, Myotonic Dystrophy, Neurofibromatosis, Noonan Syndrome, Osteogenesis imperfecta, Parkinson's disease, Phenylketonuria, Poland Anomaly, Porphyria, Progeria, Retinitis Pigmentosa, Severe Combined Immunodeficiency (SCID), Sickle cell disease, Spinal Muscular Atrophy, Tay-Sachs, Thalassemia, Trimethylaminuria, Turner Syndrome, Velocardiofacial Syndrome, WAGR Syndrome, Wilson Disease, as well as any other disease with a genetic component. Ophthalmic disorders and/or disorders that include an ophthalmic component include but are not limited to chalazion, stye, trichiasis, entropion, ectropion, lagophthalmos, bleharitis, dacryocystitis, orbital cellulitis, ptergium, pterygiumcorneal dystrophy, conjuctivitis, ophtalmia neonatorum, bacterial corneal ulcer, fungal corneal ulcer, glaucoma, Fuchs Dystrophy, keratoconus, Advanced Macular Degeneration, Retinitis pigmentosa, cataracts, retinal disorecers, macular degeneration, diabetic eye problems (for example, diabetic retinopathy), blepharophimosis-ptosis-epicanthus-inversus syndrome (BPES), oculocutaneous albinism, Marfan syndrome, Stickler syndrome, and CHARGE (coloboma, heart anomalies, atresia of the choanae, retardation of growth and development, genital/urinary anomalies, ear abnormalities or deafness) syndrome. Corneal dystrophies include but are not limited to Avellino corneal dystrophy, granular corneal dystrophy, lattice type I corneal dystrophy, Fuchs Dystrophy, Thiel-Behnke and Reis-bucklers corneal dystrophy. Cancers include but are not limited to carcinoma, sarcoma, blastoma, lymphoma, leukemia germ cell tumors, and cancers of unknown origin. In some embodiments, the cancer include but is not limited to head and neck, skin, colon, oral, glioblastoma, breast, laryngeal, esophageal, endothelial, endometrial, ovarian, lung, urogenital, rectal, prostate, kidney, melanoma, renal, pancreatic, gastrointestinal, blood, liver, uterine and brain as well as viral induced cancers such as papilloma virus-induced cancer.

In some embodiments, the present methods find use in development of personalized medicine treatment regimens by providing the genomic DNA which is used in determining the genetic profile for an individual. In some embodiments, such genetic profile information is employed by those skilled in the art in order determine and/or develop a treatment regimen. In some embodiments, the presence and/or absence of various genetic variations and mutations identified in nucleic acids isolated by the described methods are used by those of skill in the art as part of a personalized medicine treatment regimen or plan. For example, in some embodiments, information obtained using the disclosed methods is compared to databases or other established information in order to determine a diagnosis for a specified disease and or determine a treatment regimen. In some cases, the information regarding the presence or absence of a genetic mutation in a particular patient is compared to a database or other standard source of information in order to make a determination regarding a proposed treatment regimen. In some cases, the presence of a genetic mutation indicates pursuing a particular treatment regimen. In some cases the absence of a genetic mutation indicates not pursuing a particular treatment regimen.

In some embodiments, information regarding the presence and/or absence of a particular genetic mutation is used to determine the treatment efficacy of treatment with the therapeutic entity, as well as to tailor treatment regimens for treatment with therapeutic entity. In some embodiments, information regarding the presence and/or absence of a genetic mutation is employed to determine whether to pursue a treatment regimen. In some embodiments, information regarding the presence and/or absence of a genetic mutation is employed to determine whether to continue a treatment regimen. In some embodiments, the presence and/or absence of a genetic mutation is employed to determine whether to discontinue a treatment regimen. In other embodiments, the presence and/or absence of a genetic mutation is employed to determine whether to modify a treatment regimen. In some embodiments the presence and/or absence of a genetic mutation is used to determine whether to increase or decrease the dosage of a treatment that is being administered as part of a treatment regimen. In other embodiments, the presence and/or absence of a genetic mutation is used to determine whether to change the dosing frequency of a treatment administered as part of a treatment regimen. In some embodiments, the presence and/or absence of a genetic mutation is used to determine whether to change the number of dosages per day, per week, times per day of a treatment. In some embodiments the presence and/or absence of a genetic mutation is used to determine whether to change the dosage amount of a treatment. In some embodiments, the presence and/or absence of a genetic mutation is determined prior to initiating a treatment regiment and/or after a treatment regimen has begun. In some embodiments, the presence and/or absence of a genetic mutation is determined and compared to predetermined standard information regarding the presence or absence of a genetic mutation.

In some embodiments, a composite of the presence and/or absence of more than one genetic mutation is generated using the disclosed methods and such composite includes any collection of information regarding the presence and/or absence of more than one genetic mutation. In some embodiments, the presence or absence of 2 or more, 3 or more, 4 or more, 5 or more, 6 or more, 7 or more, 8 or more, 9 or more, 10 or more, 20 or more, 30 or more or 40 or more genetic mutations is examined and used for generation of a composite. Exemplary information in some embodiments includes nucleic acid or protein information, or a combination of information regarding both nucleic acid and/or protein genetic mutations. Generally, the composite includes information regarding the presence and/or absence of a genetic mutation. In some embodiments, these composites are used for comparison with predetermined standard information in order to pursue, maintain or discontinue a treatment regimen.

In some embodiments, corneal dystrophy is detected for example through detection of 2, 3, 4 or 5 SNPs selected from but not limited to Avellino corneal dystrophy-related SNPs, granular corneal dystrophy-related SNPs, lattice dystrophy-related SNPs, Reis-Buckler corneal dystrophy-related SNPs, and/or Thiel-Behnke corneal dystrophy-related SNPs. In some embodiments, corneal dystrophy is detected for example through detection of an Avellino corneal dystrophy-related SNP, in combination with a granular corneal dystrophy-related SNP, a lattice dystrophy-related SNP, a Reis-Buckler corneal dystrophy-related SNP, and/or a Thiel-Behnke corneal dystrophy-related SNP. In some embodiments, corneal dystrophy is detected for example through detection of a granular corneal dystrophy-related SNP in combination with an Avellino corneal dystrophy-related SNP, a lattice dystrophy-related SNPs, a Reis-Buckler corneal dystrophy-related SNPs, and/or a Thiel-Behnke corneal dystrophy-related SNP. In some embodiments, corneal dystrophy is detected for example through detection of a lattice dystrophy-related SNP in combination with an Avellino corneal dystrophy-related SNP, a granular corneal dystrophy-related SNP, a Reis-Buckler corneal dystrophy-related SNP, and/or a Thiel-Behnke corneal dystrophy-related SNP. In some embodiments, corneal dystrophy is detected for example through detection of a Reis-Buckler corneal dystrophy-related SNP in combination with an Avellino corneal dystrophy-related SNP, a granular corneal dystrophy-related SNP, a lattice dystrophy-related SNP, and/or a Thiel-Behnke corneal dystrophy-related SNP. In some embodiments, corneal dystrophy is detected for example through detection of a Thiel-Behnke corneal dystrophy-related SNP in combination with an Avellino corneal dystrophy-related SNP, a granular corneal dystrophy-related SNP, a lattice dystrophy-related SNP and/or a Reis-Buckler corneal dystrophy-related SNP.

In some embodiments, corneal dystrophy is detected for example through detection of 2, 3, 4, 5 and/or 6 SNPs selected from Avellino corneal dystrophy-related SNPs. In some embodiments, the SNPs include SNPs that result in mutations at positions 124, 555 and/or 626 of the polypeptide encoded by the human TGFβI gene. These mutations include those that result in R124 mutations in the TGFβI gene (including for example but not limited to an R124H mutation caused by a G to A transition at nucleotide 418 of TGFβI gene also referred to as a C(G/A)C SNP), granular corneal dystrophy-related SNPs, such as those that result in R555 mutations in the TGFβI gene (including for example but not limited to an R555W mutation caused by a C to T transition at nucleotide 1663 of the TGFβI gene also referred to as a (C/T)GG SNP), lattice dystrophy-related SNPs, such as those that result in R124 mutations in the TGFβI gene (including for example but not limited to an R124C mutation caused by a C to T transition at nucleotide 417 of TGFβI gene also referred to as a (C/T)GC SNP), Reis-Buckler corneal dystrophy-related SNPs, such as those that result in R124 mutations in the TGFβI gene (including for example but not limited to an R124L mutation caused by a G to T transition at nucleotide 418 of TGFβI gene also referred to as a C(G/T)C SNP) and/or Thiel-Behnke corneal dystrophy-related SNPs, such as those that result in R555 mutations in the TGFβI gene (including for example but not limited to an R555Q mutation caused by a G to A transition at nucleotide 1664 of TGFβI gene also referred to as a C(G/A)G SNP). In some embodiments, corneal dystrophy is detected for example through detection of Avellino corneal dystrophy-related SNPs, such as those that result in R124 mutations in the TGFβI gene (including for example but not limited to an R124H mutation caused by a G to A transition at nucleotide 418 of TGFβI gene also referred to as a C(G/A)C SNP) in combination with a granular corneal dystrophy-related SNPs, such as those that result in R555 mutations in the TGFβI gene (including for example but not limited to an R555W mutation caused by a C to T transition at nucleotide 1663 of TGFβI gene also referred to as a (C/T)GG SNP). In some embodiments, corneal dystrophy is detected for example through detection of Avellino corneal dystrophy-related SNPs, such as those that result in H626P mutations in the TGFβI gene (including for example but not limited to an H626P mutation caused by an A to C transition at nucleotide 1924 of TGFβI gene).

In some embodiments, corneal dystrophy is detected for example through detection of 2, 3, 4, 5 and/or 6 of R124C, R124H, R124L, R555W, R555Q and/or H626P. In some embodiments, corneal dystrophy is detected for example through detection of 2, 3, 4 and/or 5 of R124C, R124H, R124L, R555W, and/or R555Q. In some embodiments, corneal dystrophy is detected for example through detection of R124C in combination with one or more of R124H, R124L, R555W and/or R555Q. In some embodiments, corneal dystrophy is detected for example through detection of R124H in combination with one or more of R124C, R124L, R555W and/or R555Q. In some embodiments, corneal dystrophy is detected for example through detection of R555W in combination with one or more of R124C, R124H, R124L and/or R555Q. In some embodiments, corneal dystrophy is detected for example through detection of R555Q in combination with one or more of R124C, R124H, R124L and/or R555W. In some embodiments, R124H is detected in combination with R555W. In some embodiments, corneal dystrophy is detected for example through detection of H262P in combination with one or more of R124C, R124H, R124L, R555W and/or R555Q. In some embodiments, R124C, R124H, R124L, R555W and/or R555Q are all detected. In some embodiments, R124C, R124H, R124L, R555W, R555Q and/or H626P are all detected.

VIII. Diagnostic Kits

In some embodiments, any or all of the reagents described above are packaged into a diagnostic kit. Such kits include any and/or all of the primers, probes, buffers and/or other reagents described herein in any combination. In some embodiments, the kit includes reagents for detection of 2, 3, 4, 5 and/or 6 of R124C, R124H, R124L, R555W, R555Q and/or H626P. In some embodiments, the kit includes reagents for detection of 2, 3, 4, and/or 5 of R124C, R124H, R124L, R555W and R555Q. In some embodiments, the kit includes reagents for detection of R124C, R124H, and R124L. In some embodiments, the kit includes reagents for detection of R555W and R555Q. In some embodiments, the kit includes reagents for detection of R124C. In some embodiments, the kit includes reagents for detection of R124H. In some embodiments, the kit includes reagents for detection of R124L. In some embodiments, the kit includes reagents for detection of R555W. In some embodiments, the kit includes reagents for detection of R555Q.

In some embodiments, the kit includes primers and probes for detection of 2, 3, 4, 5 and/or 6 of R124C, R124H, R124L, R555W, R555Q and/or H626P. In some embodiments, the kit includes primers and probes for detection of 2, 3, 4, and/or 5 of R124C, R124H, R124L, R555W and R555Q. In some embodiments, the kit includes primers and probes for detection of R124C, R124H, and R124L. In some embodiments, the kit includes primers and probes for detection of R555W and R555Q. In some embodiments, the kit includes primers and probes for detection of R124C. In some embodiments, the kit includes primers and probes for detection of R124H. In some embodiments, the kit includes primers and probes for detection of R124L. In some embodiments, the kit includes primers and probes for detection of R555W. In some embodiments, the kit includes primers and probes for detection of R555Q. In some embodiments, the kit includes primers and probes for detection of H626P.

In some embodiments, the reagents in the kit are included as lyophilized powders. In some embodiments, the reagents in the kit are included as lyophilized powders with instructions for reconstitution. In some embodiments, the reagents in the kit are included as liquids. In some embodiments, the reagents are included in plastic and/or glass vials or other appropriate containers. In some embodiments the primers and probes are all contained in individual containers in the kit. In some embodiments, the primers are packaged together in one container, and the probes are packaged together in another container. In some embodiments, the primers and probes are packaged together in a single container.

In some embodiments, the kit further includes control gDNA and/or DNA samples. In some embodiments the control DNA sample included is TGFBI R124 normal. In some embodiments the control DNA sample included corresponds to the mutation being detected, including R124C, R124H, R124L, R555W, R555Q and/or H626P. In some embodiments, a control DNA sample corresponding to TGFBI R124 normal and a mutant DNA sample corresponding to R124C, R124H, R124L, R555W, R555Q and/or H626P are included. In some embodiments, a control DNA sample corresponding to TGFBI R124 normal and a mutant DNA sample corresponding to R124C, R124H, R124L, R555W and/or R555Q are included. In some embodiments, a control DNA sample corresponding to TGFBI R124 normal and a mutant DNA sample corresponding to R124C, R124H and/or R124L are included. In some embodiments, a control DNA sample corresponding to TGFBI R124 normal and a mutant DNA sample corresponding to R555W and/or R555Q are included. In some embodiments, a control DNA sample corresponding to TGFBI R124 normal and a mutant DNA sample corresponding to R124C are included. In some embodiments, a control DNA sample corresponding to TGFBI R124 normal DNA and a mutant DNA sample corresponding to R124H are included. In some embodiments, a control DNA sample corresponding to TGFBI R124 normal and a mutant DNA sample corresponding to R124L are included. In some embodiments, a control DNA sample corresponding to TGFBI R124 normal DNA and a mutant DNA sample corresponding to R555W are included. In some embodiments, a control DNA sample corresponding to TGFBI R124 normal and mutant DNA sample corresponding to R555Q are included. In some embodiments, a control DNA sample corresponding to TGFBI R124 normal and mutant DNA sample corresponding to H626P are included. In some embodiments, the concentration of the control DNA sample is 5 ng/μL, 10 ng/μL, 20 ng/μL, 30 ng/μL, 40 ng/μL, 50 ng/μL, 60 ng/μL, 70 ng/μL, 80 ng/μL, 90 ng/μL, 100 ng/μL, 110 ng/μL, 120 ng/μL, 130 ng/μL, 140 ng/μL, 150 ng/μL, 160 ng/μL, 170 ng/μL, 180 ng/μL, 190 ng/μL or 200 ng/μL. In some embodiments, the concentration of the control DNA sample is 50 ng/μL, 100 ng/μL, 150 ng/μL or 200 ng/μL. In some embodiments, the concentration of the control DNA sample is 100 ng/μL. In some embodiments, the control DNA samples have the same concentration. In some embodiments, the control DNA samples have different concentrations.

In some embodiments, the kit can further include buffers, for example, GTXpress TAQMANĀ® reagent mixture, or any equivalent buffer. In some embodiments, the buffer includes any buffer described herein.

In some embodiments, the kit can further include reagents for use in cloning, such as vectors (including, e.g., M13 vector).

In some embodiments, the kit further includes reagents for use in purification of DNA.

In some embodiments, the kit further includes instructions for using the kit for the detection of corneal dystrophy in a subject. In some embodiments, these instructions include various aspects of the protocols described herein.

EXAMPLES

Example 1: DNA Extraction (DNA Extract All Reagents, ThermoFisher)

DNA was extracted from oral epithelium or hair root or whole blood as described below and in line with the disclosures provided herein.

For DNA extraction from oral epithelium or hair root, the sample was first pre-treated in 1ƗPBS 300 μL. Next, 30 μL Lysis solution was added to tube and the mixture vortexed. The mixture was then incubated at 95° C. for 3 min. Next, 30 μL of DNA Stabilizing Solution (from Life Technologies/Thermo Scientific, USA) was added and the mixture vortexed. The mixture was then centrifuged at 13,000 RPM for 1 min.

For DNA extraction from whole blood, the sample was first pre-treated in 1ƗPBS 300 μL starting with 3 μL of whole blood. Next, 30 μL of lysis solution was added to tube and the mixture vortexed. The mixture was then incubated at 95° C. for 3 min. Next, 30 μL of DNA Stabilizing Solution (from Life Technologies/Thermo Scientific, USA) was added and the mixture vortexed. The mixture was then centrifuged at 13,000 RPM for 1 min.

After the above procedures were completed, the DNA concentration was read using a commercially available Tecan® Infinite® 200 PRO NanoQuant. For quantitation, 100 μL of eluents were pipetted into a clear 96 well plate. Next, 100 μL of prepared blank solution was added to well H12. Concentrations were then read using the manufacturer's instructions provided with the NanoQuant.

Reaction mixtures were prepared using the probes and primers described below in Tables 5 and 6.

TABLEā€ƒ5
Probeā€ƒSequences
PROBE SEQUENCE
TGFBIā€ƒR124Normal VIC-CACā€ƒGGAā€ƒCCG
(SEQā€ƒIDā€ƒNO:ā€ƒ25) CACā€ƒGGA-MGBā€ƒNFQ
TGFBIā€ƒR124H FAM-CACā€ƒGGAā€ƒCCA
(SEQā€ƒIDā€ƒNO:ā€ƒ26) CACā€ƒGGA-MGBā€ƒNFQ
TGFBIā€ƒR124C FAM-CACā€ƒGGAā€ƒCTG
(SEQā€ƒIDā€ƒNO:ā€ƒ48) CACā€ƒGGA-MGBā€ƒNFQ
TGFBIā€ƒR124L FAM-CACā€ƒGGAā€ƒCCT
(SEQā€ƒIDā€ƒNO:ā€ƒ49) CACā€ƒGGA-MGBā€ƒNFQ
TGFBIā€ƒR555Normal VIC-CACā€ƒCAAā€ƒGAG
(SEQā€ƒIDā€ƒNO:ā€ƒ45) AACā€ƒGGA-MGBā€ƒNFQ
TGFBIā€ƒR555W FAM-CACā€ƒCAAā€ƒGAG
(SEQā€ƒIDā€ƒNO:ā€ƒ46) AATā€ƒGG-MGBā€ƒNFQ
TGFBIā€ƒR555Q FAM-ACā€ƒCAAā€ƒGAG
(SEQā€ƒIDā€ƒNO:ā€ƒ50) AACā€ƒAGAā€ƒG-MGBā€ƒNFQ

TABLEā€ƒ6
Primerā€ƒSequences
PRIMER SEQUENCE
TGFBIā€ƒ124ā€ƒF TCCā€ƒACCā€ƒACCā€ƒACTā€ƒCAG
(SEQā€ƒIDā€ƒNO:ā€ƒ1) CTGā€ƒTA
TGFBIā€ƒ124ā€ƒR CCAā€ƒTCTā€ƒCAGā€ƒGCCā€ƒTCA
(SEQā€ƒIDā€ƒNO:ā€ƒ2) GCTā€ƒT
TGFBIā€ƒ555ā€ƒF ACAā€ƒCAGā€ƒTCTā€ƒTTGā€ƒCTC
(SEQā€ƒIDā€ƒNO:ā€ƒ43) CCAā€ƒCAAā€ƒA
TGFBIā€ƒ555ā€ƒR ACTā€ƒTAAā€ƒGTTā€ƒGGTā€ƒCTT
(SEQā€ƒIDā€ƒNO:ā€ƒ44) TACā€ƒCCAā€ƒAGAā€ƒGTCā€ƒT

The components and ratios used in an exemplary reaction mixture are shown below in Table 7.

TABLE 7
Reaction Mixture
All reagent extract (whole blood) 3.00 μl
GTXpress TaqMan ® 10.00 μl 
Primer (124R) (reverse) 10 pMol 0.50 μl
Primer (124F) (forward) 10 pMol 0.50 μl
Primer (555R) (reverse) 10 pMol 0.50 μl
Primer (555F) (forward) 10 pMol 0.50 μl
Probe (NL/VIC) 10 pMol 0.20 μl
Probe (R124H/FAM) 10 pMol 0.30 μl
Probe (R124C/FAM) 10 pMol 0.20 μl
Probe (R124L/FAM) 10 pMol 0.50 μl
Probe (R555N/VIC) 10 pMol 0.20 μl
Probe (R555Q-1/FAM) 10 pMol 0.20 μl
Probe (R555W/FAM) 10 pMol 0.20 μl
DW 3.20 μl

Exemplary PCR cycling conditions are shown below in Table 8.

TABLE 8
PCR Cycling
Pre-read Hold stage Cycling Stage 40 Cycle Post-read
60° C. 95° C. 95° C. 64° C. 60° C.
1 min 20 sec 3 sec 30 sec 1 min

The above protocols were used to generate the Real-Time PCR data provided in FIGS. 4-8.

REFERENCES

All headings and section designations are used for clarity and reference purposes only and are not to be considered limiting in any way. For example, those of skill in the art will appreciate the usefulness of combining various aspects from different headings as appropriate according to the spirit and scope of the invention described herein.

All references cited herein are hereby incorporated by reference herein in their entireties and for all purposes to the same extent as if each individual publication or patent or patent application was specifically and individually indicated to be incorporated by reference in its entirety for all purposes.

Many modifications and variations of this application can be made without departing from its spirit and scope, as will be apparent to those skilled in the art. The specific embodiments and examples described herein are offered by way of example only, and the application is to be limited only by the terms of the appended claims, along with the full scope of equivalents to which the claims are entitled.

ā€ƒā€ƒā€ƒā€ƒ1ā€ƒgcttgcccgtā€ƒcggtcgctagā€ƒctcgctcggtā€ƒgcgcgtcgtcā€ƒccgctccatgā€ƒgcgctcttcg
ā€ƒā€ƒā€ƒ61ā€ƒtgcggctgctā€ƒggctctcgccā€ƒctggctctggā€ƒccctgggcccā€ƒcgccgcgaccā€ƒctggcgggtc
ā€ƒā€ƒ121ā€ƒccgccaagtcā€ƒgccctaccagā€ƒctggtgctgcā€ƒagcacagcagā€ƒgctccggggcā€ƒcgccagcacg
ā€ƒā€ƒ181ā€ƒggtaagccgaā€ƒgccgcctggcā€ƒcaggggctgcā€ƒggaaggtcagā€ƒgtagtcggggā€ƒctcggagcgc
ā€ƒā€ƒ241ā€ƒaagccgctggā€ƒgggcattgaaā€ƒctgggctgggā€ƒggcgcaggggā€ƒacaaagcccgā€ƒaactaaaaac
ā€ƒā€ƒ301ā€ƒcttgcagcatā€ƒggagcgctcgā€ƒgacaccagccā€ƒctgcacgcggā€ƒtggaaggagaā€ƒgagggaggga
ā€ƒā€ƒ361ā€ƒggtggaggacā€ƒcatggagggaā€ƒaagcgggaggā€ƒccgccgctttā€ƒgtagaagggaā€ƒgtggggaagt
ā€ƒā€ƒ421ā€ƒggaccagagaā€ƒctttcgacgcā€ƒaggccaagagā€ƒcctgagacggā€ƒacagcgctttā€ƒcagcttctcc
ā€ƒā€ƒ481ā€ƒtcccagccacā€ƒtgcagaaaggā€ƒgggaaatggcā€ƒaactctttggā€ƒccataatcacā€ƒcgtgggaggg
ā€ƒā€ƒ541ā€ƒtcccaagggcā€ƒaaagcccaccā€ƒcagcagtacaā€ƒcctattccaaā€ƒcccagccaggā€ƒcccccggcca
ā€ƒā€ƒ601ā€ƒgcgactccagā€ƒacaagaacctā€ƒgggccacacaā€ƒcggtggcagcā€ƒatctaaggtgā€ƒccccaggctc
ā€ƒā€ƒ661ā€ƒctgtgctcctā€ƒggccaggcccā€ƒtgcactcagaā€ƒcactgctggcā€ƒacccgacactā€ƒgctctctggg
ā€ƒā€ƒ721ā€ƒtacagcaaggā€ƒgcaatgtggcā€ƒacttcttgtcā€ƒctgcccgatgā€ƒaagagcaggaā€ƒgaatgcactg
ā€ƒā€ƒ781ā€ƒggccctcacaā€ƒcacactgttcā€ƒaaatggggaaā€ƒactgagtcctā€ƒgagtggttccā€ƒactttcccac
ā€ƒā€ƒ841ā€ƒagtcctgaagā€ƒtgtgcactggā€ƒagccaggattā€ƒggagtctgtcā€ƒttaaagtaatā€ƒagctgggttt
ā€ƒā€ƒ901ā€ƒgtaaatgtagā€ƒgacactatcaā€ƒttgcaggaatā€ƒtcctttgagaā€ƒccctgaagatā€ƒgtgttggctt
ā€ƒā€ƒ961ā€ƒtaggagacaaā€ƒactcaagcagā€ƒaaggtctggtā€ƒctgatagtggā€ƒccctaatactā€ƒgacccaggca
ā€ƒ1021ā€ƒgaggcaggcaā€ƒacatttctacā€ƒctcaaaaaccā€ƒaggccataccā€ƒtgcgtcacaaā€ƒatacccaggc
ā€ƒ1081ā€ƒtttgctgcagā€ƒcttccagcctā€ƒacctggttgcā€ƒaccaacttctā€ƒttttcataacā€ƒtaggtaaaac
ā€ƒ1141ā€ƒtatatatgagā€ƒtagaatcttgā€ƒtagtgactccā€ƒtcagaggaagā€ƒcctaaataccā€ƒatcggggtct
ā€ƒ1201ā€ƒggcgttcacaā€ƒcccacaagcaā€ƒatgcccaaacā€ƒctccaagagaā€ƒctgggcagatā€ƒctgtgctcaa
ā€ƒ1261ā€ƒatcaaaactcā€ƒattgttggggā€ƒgtgatagagtā€ƒtgacttcacaā€ƒggccctgaaaā€ƒgtcttggctc
ā€ƒ1321ā€ƒcttgcactagā€ƒgagtgctctgā€ƒggtacgggtaā€ƒcaggctgcccā€ƒcttgtagggcā€ƒatagttgctc
ā€ƒ1381ā€ƒttgtttcctcā€ƒtacttgtggcā€ƒtttatggtctā€ƒaggcctttcaā€ƒggagtttgggā€ƒgctctggcgg
ā€ƒ1441ā€ƒagagggcctgā€ƒctgggagcacā€ƒatctggccacā€ƒcctgcagagtā€ƒgaaatcaaacā€ƒcaggcctggc
ā€ƒ1501ā€ƒtccaacctcaā€ƒacaccctcctā€ƒggaaagaggaā€ƒgaatactgggā€ƒgatatcctggā€ƒggtctttctg
ā€ƒ1561ā€ƒgaagtgggagā€ƒaatcagctttā€ƒgacttgggcaā€ƒgtgtgcagaaā€ƒtagagtgaggā€ƒggggatgtca
ā€ƒ1621ā€ƒgaaagatgagā€ƒagggatatgaā€ƒggcctcaacaā€ƒtcaaaatgcaā€ƒagcacctggcā€ƒatttttatta
ā€ƒ1681ā€ƒtctctgcccaā€ƒcctctccgttā€ƒggtctctctgā€ƒcctttcctgcā€ƒcaatgaattgā€ƒtgttatgttt
ā€ƒ1741ā€ƒgggtgcctcaā€ƒatttgcctagā€ƒgagggttctaā€ƒtttcttctgtā€ƒatcttcgccaā€ƒctaagtcagg
ā€ƒ1801ā€ƒagaagatcctā€ƒtatagcatgcā€ƒcctgcaacagā€ƒtgtcacctgtā€ƒaagggcatctā€ƒctctgcacag
ā€ƒ1861ā€ƒccacagtgaaā€ƒggatcctcaaā€ƒaggtattgagā€ƒggctttccatā€ƒcaagagccatā€ƒctttacagca
ā€ƒ1921ā€ƒaacctctttcā€ƒccttcagagcā€ƒccagaagagtā€ƒgctgaccagcā€ƒtggaaaacagā€ƒggtttttttc
ā€ƒ1981ā€ƒttaaatgcagā€ƒatgctcttgaā€ƒttatgagttcā€ƒcagatattagā€ƒatcaacttccā€ƒccaccatacc
ā€ƒ2041ā€ƒcctgcaggcaā€ƒaagcctcttaā€ƒattagcttccā€ƒtgcagcacagā€ƒctggaaaggcā€ƒctattgtaat
ā€ƒ2101ā€ƒctgtgatgggā€ƒcagagtaatcā€ƒtaagaagtcaā€ƒcaggagcaccā€ƒcctgtcccagā€ƒtagaatctgg
ā€ƒ2161ā€ƒatgcgcaggcā€ƒacatgaaccaā€ƒtggcaaaatgā€ƒgttgcaggcaā€ƒcagttgtattā€ƒtactctgatc
ā€ƒ2221ā€ƒtaactgtcccā€ƒtcttaatgccā€ƒacagggctgcā€ƒctggcctggcā€ƒacacagggctā€ƒgtggcgcctt
ā€ƒ2281ā€ƒgtgcaaatggā€ƒataacgttgtā€ƒtctagctccaā€ƒgcctttcattā€ƒcaaagtgaaaā€ƒactgttagaa
ā€ƒ2341ā€ƒagggaaggaaā€ƒaactttgctaā€ƒttttaaggaaā€ƒttgtagcgtgā€ƒctgcctgataā€ƒtgaaggaaga
ā€ƒ2401ā€ƒaataacagctā€ƒgtgccttgctā€ƒtgtgcgcagcā€ƒactcgattgcā€ƒcgcttttgctā€ƒttcgacctca
ā€ƒ2461ā€ƒccacaacacaā€ƒgtgagatctaā€ƒctgttcatgtā€ƒtcccattttaā€ƒcaggaggtgaā€ƒaactgcagct
ā€ƒ2521ā€ƒtagtgaggtaā€ƒgagagtgactā€ƒtagttcagacā€ƒacagaatgctā€ƒgttgggagagā€ƒtaataactat
ā€ƒ2581ā€ƒgatatggtctā€ƒcttgactcccā€ƒagctatatctā€ƒgtgttgctatā€ƒagggaaggggā€ƒaaaaataata
ā€ƒ2641ā€ƒctgaaagagaā€ƒagtaaaaataā€ƒcaatcacactā€ƒtccaaacatcā€ƒaaccaccaaaā€ƒaactgaactg
ā€ƒ2701ā€ƒaatttcctgaā€ƒagcacttggtā€ƒtttcaaatctā€ƒaagctgaacaā€ƒtcaatgctgtā€ƒtattcttgag
ā€ƒ2761ā€ƒgcccagaagcā€ƒaacttgctcaā€ƒtttcaattaaā€ƒgcttcagcatā€ƒgaacttcctaā€ƒtgtacacagc
ā€ƒ2821ā€ƒccacccacacā€ƒtccccgatgtā€ƒgagaaggagaā€ƒgggtcacagcā€ƒcgcccccagcā€ƒctctgctgct
ā€ƒ2881ā€ƒgccacaaggaā€ƒcagcagcagtā€ƒggaaacattcā€ƒagcaaaggaaā€ƒtcttggagccā€ƒacatccacaa
ā€ƒ2941ā€ƒgagactcactā€ƒgaagattcgcā€ƒcaaacgcctaā€ƒcggaaagtggā€ƒcagggaattcā€ƒattgacagta
ā€ƒ3001ā€ƒattgtttcctā€ƒgcttgatcagā€ƒattgaagagcā€ƒttctgggattā€ƒctgtaacaatā€ƒaaataggacc
ā€ƒ3061ā€ƒgggggctggaā€ƒgtatggccagā€ƒcaaggactctā€ƒtcaggggttaā€ƒttcagggactā€ƒgtctaacctg
ā€ƒ3121ā€ƒtgaatcctagā€ƒgcagcaaacaā€ƒgaaaccaggtā€ƒattcagaaatā€ƒctggaggattā€ƒtggtcaggcc
ā€ƒ3181ā€ƒcagctaggacā€ƒtagggaggcaā€ƒtgggcctctgā€ƒctggctgtggā€ƒtcccttctccā€ƒagccttcact
ā€ƒ3241ā€ƒtctcttgtccā€ƒctagatccttā€ƒacatggattcā€ƒattaatgctcā€ƒattgtccctcā€ƒctgggcccac
ā€ƒ3301ā€ƒtcactttcacā€ƒctgttgaacaā€ƒaaaaactggcā€ƒcaagaggtgaā€ƒcagtcatatcā€ƒaccgcagaag
ā€ƒ3361ā€ƒagacagggcaā€ƒgagaaatgaaā€ƒggggcagaatā€ƒggactcccacā€ƒccaaaagcctā€ƒgactctgaat
ā€ƒ3421ā€ƒatttgagaatā€ƒtgttcaagttā€ƒcctgcagaggā€ƒaatcatgatgā€ƒgggacagtagā€ƒgtgtagtttt
ā€ƒ3481ā€ƒtactgcaataā€ƒttggtgtcttā€ƒcttaacaaatā€ƒacgctgcacaā€ƒtcaagtgatgā€ƒtctgtggatg
ā€ƒ3541ā€ƒgcattcttaaā€ƒagtaacagggā€ƒaaattgatgtā€ƒtaaagaaataā€ƒcttcatccttā€ƒtgggtgatac
ā€ƒ3601ā€ƒctgaagttctā€ƒctgagcttggā€ƒaggtcttgtgā€ƒaaagccctcaā€ƒgtattgtttgā€ƒttttatttgc
ā€ƒ3661ā€ƒtttcctctgaā€ƒcttgtgattcā€ƒagtcagatgcā€ƒatgcctgcctā€ƒctggctcaggā€ƒaagatcaacc
ā€ƒ3721ā€ƒctctcctgacā€ƒtgaccacgccā€ƒtctcctgactā€ƒgaccacgtagā€ƒcacagcagctā€ƒtcctttccct
ā€ƒ3781ā€ƒaggggctcctā€ƒaatgaagcttā€ƒtcacaatcacā€ƒctggcctgagā€ƒcacagtttggā€ƒgtcaggactt
ā€ƒ3841ā€ƒggtatacttgā€ƒaaaaaaacatā€ƒgcaaaaccaaā€ƒaatcctgtggā€ƒttctggaaaaā€ƒggcttcttag
ā€ƒ3901ā€ƒcagaacccccā€ƒagacatttacā€ƒactctgctttā€ƒttcacagggtā€ƒccctgaggatā€ƒtctttggatc
ā€ƒ3961ā€ƒtgggtagtttā€ƒggggagcagtā€ƒattttcaacaā€ƒagttcatttcā€ƒgtgctccttcā€ƒtacaccctgc
ā€ƒ4021ā€ƒctggatgctaā€ƒggccccatctā€ƒagaatgtgaaā€ƒcaacagaacaā€ƒaggcagaacaā€ƒcttgtcctca
ā€ƒ4081ā€ƒaggttctgttā€ƒgagtgttagaā€ƒtccagagaagā€ƒagacacccccā€ƒcacctccccgā€ƒcatcacttac
ā€ƒ4141ā€ƒaggaattctgā€ƒtttggaacccā€ƒaacatcaaatā€ƒaaggaccgtaā€ƒtccactgtcaā€ƒgaggatggga
ā€ƒ4201ā€ƒagcagcatgtā€ƒcatctgggacā€ƒattggagaaaā€ƒggctcctgggā€ƒggaagtgggaā€ƒcttgagctgt
ā€ƒ4261ā€ƒgatctaagtaā€ƒatgaacaactā€ƒgagagttaaaā€ƒtcggagagcaā€ƒtcccctatcaā€ƒgggtcctgag
ā€ƒ4321ā€ƒagcaaccagcā€ƒcatggtttaaā€ƒaccagctataā€ƒaagcctcgggā€ƒtttataggatā€ƒagacagtaac
ā€ƒ4381ā€ƒaatggcttgtā€ƒctttgggagcā€ƒcaagcagctgā€ƒgtccaggcatā€ƒgcagagcatgā€ƒtctgtatgga
ā€ƒ4441ā€ƒgagctgcctgā€ƒagagatgcttā€ƒttgtttacacā€ƒttatcaattgā€ƒcccatgtcaaā€ƒagaaggatat
ā€ƒ4501ā€ƒgtacatgaagā€ƒttacatcagtā€ƒatgtaagagaā€ƒgattttaacaā€ƒatttttgcagā€ƒgggaagcttt
ā€ƒ4561ā€ƒcatgggggctā€ƒgatgggaatcā€ƒtaggtaaacaā€ƒgaaccaaagtā€ƒctaaacccaaā€ƒgatatcccca
ā€ƒ4621ā€ƒgtaccaagacā€ƒtgaaatgactā€ƒctctcctctaā€ƒtctctagaaaā€ƒgttccagtgaā€ƒcccaaggagg
ā€ƒ4681ā€ƒcaaacacgatā€ƒgggagtcattā€ƒaaagtggggtā€ƒggacgtgctgā€ƒatcatcttccā€ƒtaattctgct
ā€ƒ4741ā€ƒgcttttgtttā€ƒtcagccccaaā€ƒcgtgtgtgctā€ƒgtgcagaaggā€ƒttattggcacā€ƒtaataggaag
ā€ƒ4801ā€ƒtacttcaccaā€ƒactgcaagcaā€ƒgtggtaccaaā€ƒaggaaaatctā€ƒgtggcaaatcā€ƒaacgtgagta
ā€ƒ4861ā€ƒtctgtaaccaā€ƒgccaggagacā€ƒcaagctgtatā€ƒgcacgctggcā€ƒtgcagttcccā€ƒcagggcctgg
ā€ƒ4921ā€ƒgccagccttcā€ƒtagaaggtcaā€ƒggttgcctaaā€ƒaaagccatgaā€ƒagatgcatgtā€ƒgcgaacatgt
ā€ƒ4981ā€ƒctgggacctgā€ƒcgtgctagggā€ƒagtggcatttā€ƒttaggaagctā€ƒggccaattttā€ƒgttttgcatt
ā€ƒ5041ā€ƒtttaaggctgā€ƒctgacaagacā€ƒttggagacatā€ƒttttcagggcā€ƒtggtttgggtā€ƒttgcaagaaa
ā€ƒ5101ā€ƒcatgaaacacā€ƒtgcgtgtgtgā€ƒtgtgtgtgtgā€ƒtgtgtttctcā€ƒaatcctcataā€ƒaaataataca
ā€ƒ5161ā€ƒgatatgcagtā€ƒggagaagccaā€ƒccagcatgtgā€ƒactctggaaaā€ƒagaaagcccaā€ƒttggtgaatc
ā€ƒ5221ā€ƒtgtactaaagā€ƒaatgccatccā€ƒctatcttacaā€ƒgtcctaaggtā€ƒaaacaccccaā€ƒaaaagactta
ā€ƒ5281ā€ƒgagcactaaaā€ƒcatatgcagaā€ƒttatgagacaā€ƒgcatagcataā€ƒtaatatttgcā€ƒacagacttcc
ā€ƒ5341ā€ƒtcattcaaacā€ƒcctagctctaā€ƒcctgggccagā€ƒtcgattcatcā€ƒtttagaacccā€ƒtccattgctt
ā€ƒ5401ā€ƒtacctgaaaaā€ƒgttcgtataaā€ƒcaaaaggaccā€ƒcaccttatggā€ƒggttgttacaā€ƒaggattgaat
ā€ƒ5461ā€ƒgaaataatgtā€ƒacataagagaā€ƒctgaatatggā€ƒtgcccagcatā€ƒatatcagtgcā€ƒtcaataaatg
ā€ƒ5521ā€ƒctagctactaā€ƒttattattatā€ƒcaccctagatā€ƒttgcaaatctā€ƒagaccacacaā€ƒagcagaagta
ā€ƒ5581ā€ƒagagtgccaaā€ƒcggggtgtggā€ƒaccagtgtggā€ƒttacaataggā€ƒgcttgttgatā€ƒgtctgtttca
ā€ƒ5641ā€ƒgcaaggagggā€ƒaggcagctttā€ƒtaccccactgā€ƒcccagctcccā€ƒtggtggaatcā€ƒaggtgcatgt
ā€ƒ5701ā€ƒtctaacaattā€ƒctggggaaacā€ƒctaatctgttā€ƒttggcactgtā€ƒcaacagatctā€ƒcaaagctggc
ā€ƒ5761ā€ƒtgtctcctatā€ƒagctaggaagā€ƒatgtgtatgaā€ƒcaaatctcctā€ƒgagccacttgā€ƒtgaaggcctg
ā€ƒ5821ā€ƒaccttcctccā€ƒtgtctccataā€ƒcataatgggaā€ƒtgattaagaaā€ƒactctaagccā€ƒactctcttaa
ā€ƒ5881ā€ƒgcacttttcaā€ƒatgttagggaā€ƒtttttaagttā€ƒtattgttgtgā€ƒacattgctttā€ƒtgagcagaca
ā€ƒ5941ā€ƒtctcctccaaā€ƒtttaatagccā€ƒaactgaaagaā€ƒagagaaaatgā€ƒctctttccttā€ƒaaactgtatg
ā€ƒ6001ā€ƒtcgaaataaaā€ƒtattccaatgā€ƒtgtgaccctgā€ƒattatgttagā€ƒgcaattagcaā€ƒatcctaatat
ā€ƒ6061ā€ƒgaattgagggā€ƒaagttgggatā€ƒtcatggcacaā€ƒgctggggagaā€ƒtaccagcagtā€ƒccctgggagc
ā€ƒ6121ā€ƒctgtccagggā€ƒcaggtccatgā€ƒgcagcttgctā€ƒccatgcctgaā€ƒttgacagcccā€ƒagcctgcaag
ā€ƒ6181ā€ƒctaaaagttgā€ƒagtgagctagā€ƒgaggacacacā€ƒtcccaagattā€ƒcagctaacagā€ƒacacccagcg
ā€ƒ6241ā€ƒatattcttgcā€ƒtgctatgaacā€ƒaaaaggagacā€ƒtatgcaaattā€ƒatacaccaccā€ƒcattcttcca
ā€ƒ6301ā€ƒggatgcctgaā€ƒcttaaaaaatā€ƒaagaaaaaagā€ƒatgggccgggā€ƒcacagtggctā€ƒcacgcctgta
ā€ƒ6361ā€ƒatcccaacacā€ƒtttgggaggcā€ƒcgaggtgggcā€ƒggatcacaagā€ƒgtcaggagacā€ƒagagaccatc
ā€ƒ6421ā€ƒctggctaacaā€ƒtcgtgaaaccā€ƒccgtctctacā€ƒtaaaaaaataā€ƒcaaaaatattā€ƒagcgggcgtg
ā€ƒ6481ā€ƒgtggcgggcaā€ƒcctgtagtccā€ƒcagctactcgā€ƒggaggctgagā€ƒgcaggagaatā€ƒggcgtgaacc
ā€ƒ6541ā€ƒtgggaggcggā€ƒagcttgcagtā€ƒgagccaagatā€ƒcgtgccactgā€ƒcagtccagccā€ƒtgggtgacag
ā€ƒ6601ā€ƒagtgagacacā€ƒcgtctcaaaaā€ƒaaaaaaaaaaā€ƒaaaaagaaaaā€ƒgaaaacctttā€ƒagtactgatt
ā€ƒ6661ā€ƒgattttttccā€ƒcatgtgtgtaā€ƒtattatctacā€ƒtcaaattaacā€ƒaattaattacā€ƒttaattaaac
ā€ƒ6721ā€ƒacaaagccagā€ƒgcctcacctaā€ƒattgcttcttā€ƒggaaggtgacā€ƒcagagtgctaā€ƒgtgccaagca
ā€ƒ6781ā€ƒaacaactcttā€ƒctatatctcaā€ƒagagccctggā€ƒgcttcagaggā€ƒgccatcttttā€ƒttgttaattc
ā€ƒ6841ā€ƒaagtttctctā€ƒgaaaatggagā€ƒacccgtttatā€ƒgatgacaagcā€ƒtggctacaggā€ƒgtagcatctg
ā€ƒ6901ā€ƒccacactgttā€ƒtcgggggtgcā€ƒcgctgggctgā€ƒaagcatttgcā€ƒccagctagttā€ƒaacaatagct
ā€ƒ6961ā€ƒcgataacattā€ƒccctatcagtā€ƒgtccaggctgā€ƒagaatactgtā€ƒcagtgatgagā€ƒtcgccttggc
ā€ƒ7021ā€ƒtcttgtacctā€ƒgtatctttgtā€ƒgtgccaggacā€ƒaaggcacaagā€ƒcaacagagctā€ƒgtgtgttgcc
ā€ƒ7081ā€ƒaaaatgttccā€ƒtgatgagcagā€ƒgtcaacccctā€ƒcgggggcaggā€ƒtttggatatgā€ƒataatgtggt
ā€ƒ7141ā€ƒgatgtggtggā€ƒcgcagctcccā€ƒttacccagtgā€ƒagcacaagggā€ƒgagtcctctaā€ƒggaaaaggaa
ā€ƒ7201ā€ƒgaaatgtctgā€ƒgatgaggtggā€ƒggagatggggā€ƒttcagagtggā€ƒactcaggcaaā€ƒagcccgatgc
ā€ƒ7261ā€ƒccagtcccagā€ƒctgttggcctā€ƒagtctcacaaā€ƒagccagaaggā€ƒatatgacattā€ƒtacattcaac
ā€ƒ7321ā€ƒtcttgaatttā€ƒgtggccactgā€ƒctttgggcaaā€ƒcttcaaagagā€ƒagaaaatgaaā€ƒgatagaaaaa
ā€ƒ7381ā€ƒtattatttgaā€ƒtataaaacttā€ƒctaggacaagā€ƒagaggcccttā€ƒcctggaacatā€ƒtacatgtagt
ā€ƒ7441ā€ƒattaggaaggā€ƒtggagctgccā€ƒctggaaaagaā€ƒtccagagaacā€ƒtcagagagagā€ƒgaagaggtgg
ā€ƒ7501ā€ƒaacccatctcā€ƒtcttcttgtaā€ƒgagagctcagā€ƒtaagagtggcā€ƒttggcagggcā€ƒtcctgtgtac
ā€ƒ7561ā€ƒctgagaccaaā€ƒgaccagtgagā€ƒgaggctactgā€ƒtctgaccaccā€ƒatacggtcagā€ƒaattcagtgc
ā€ƒ7621ā€ƒcatgggtggtā€ƒcaggtgggaaā€ƒggggagaggaā€ƒctgtgctggcā€ƒtggagttgatā€ƒgttatcctgg
ā€ƒ7681ā€ƒggaaagtaggā€ƒtccctagatgā€ƒcctttagttgā€ƒagtgaggagcā€ƒagactgggaaā€ƒatgggagcac
ā€ƒ7741ā€ƒagtagtggttā€ƒggggcaaaaaā€ƒggactgtctcā€ƒtgcatgaggtā€ƒccataggcagā€ƒttggaatttt
ā€ƒ7801ā€ƒctcagcaagaā€ƒctccagagaaā€ƒggaggctggaā€ƒgcagaggtgtā€ƒatgttgggatā€ƒgaaaaggagt
ā€ƒ7861ā€ƒaaagtatcatā€ƒgggggaggagā€ƒgcagctcaggā€ƒttgtcaagggā€ƒtcaagaaaccā€ƒagaaggagaa
ā€ƒ7921ā€ƒtttcaccttgā€ƒgaagcagacaā€ƒacgggtaccaā€ƒagcatacaggā€ƒggaatactttā€ƒgtggtgagag
ā€ƒ7981ā€ƒgtcacacagaā€ƒgatacaggagā€ƒccgacctggtā€ƒgagacaggagā€ƒcctggagccaā€ƒcctgcctgct
ā€ƒ8041ā€ƒtttgtgaggcā€ƒcccagactccā€ƒactgctatcaā€ƒtcaggtgaagā€ƒctctgttgccā€ƒtgcacacaaa
ā€ƒ8101ā€ƒagcttttctgā€ƒcatttacaaaā€ƒgagagaagggā€ƒcctgagtttcā€ƒtggtgcaatgā€ƒcgtcaagctg
ā€ƒ8161ā€ƒacatatggacā€ƒtttattacagā€ƒgaagtggttaā€ƒccagtgggtcā€ƒcctatttagtā€ƒggctgttatt
ā€ƒ8221ā€ƒgtgaattttaā€ƒttgttcggaaā€ƒattcactttaā€ƒgcatttatttā€ƒcagatcctaaā€ƒatagcaccgg
ā€ƒ8281ā€ƒagtgatacaaā€ƒtcgctaatcaā€ƒaacaaagaggā€ƒgctgtggggaā€ƒgcagacagtcā€ƒagcatccccc
ā€ƒ8341ā€ƒtctgtgatttā€ƒcaggccctggā€ƒtttgattagtā€ƒagccataaaaā€ƒttttttacgtā€ƒgtggcacttt
ā€ƒ8401ā€ƒgagcaaaggtā€ƒgcaggaaattā€ƒgtggtcaggaā€ƒagcctggctgā€ƒcctctcgacaā€ƒggcttccttt
ā€ƒ8461ā€ƒgtgctagcccā€ƒcagggagaggā€ƒaggcctatttā€ƒaacagccaagā€ƒtccaagttgaā€ƒcatcatggga
ā€ƒ8521ā€ƒctggaatagtā€ƒcatagcaggaā€ƒgctcagacatā€ƒcataaacgtgā€ƒgcatagggagā€ƒggctggtgga
ā€ƒ8581ā€ƒggagctagcgā€ƒggtatgggtgā€ƒgcagctattcā€ƒattccaaaagā€ƒtcttgaaattā€ƒgtttcacgag
ā€ƒ8641ā€ƒcaacacatttā€ƒcacaagtgcgā€ƒaagcccttctā€ƒctggagccaaā€ƒgatgagctggā€ƒcagagcactc
ā€ƒ8701ā€ƒctgtttctctā€ƒagtagcaagtā€ƒgttcctttgcā€ƒccaggggcaaā€ƒaaatattaatā€ƒactccttcag
ā€ƒ8761ā€ƒcactgcattaā€ƒatgcttaaagā€ƒatttaactttā€ƒtaaagagatcā€ƒagctggtgcaā€ƒtggtcgagct
ā€ƒ8821ā€ƒtttccatcagā€ƒctggcagggcā€ƒtttttcagtaā€ƒggtgtccttcā€ƒtgggcagggcā€ƒactggggaca
ā€ƒ8881ā€ƒgctgacgtgaā€ƒaggtgaagaaā€ƒgagctgtcgtā€ƒtttcctccctā€ƒtatatcccacā€ƒaaccttggtc
ā€ƒ8941ā€ƒccaagaggaaā€ƒaaaaaagaagā€ƒatggtgagaaā€ƒgtcatccaagā€ƒcagaccccagā€ƒacccatacta
ā€ƒ9001ā€ƒgtgcctccttā€ƒtcctgtttcaā€ƒtatccctgtgā€ƒcagccagctgā€ƒggatctcttgā€ƒaataatctgc
ā€ƒ9061ā€ƒtctgggggcaā€ƒctgagattggā€ƒacatacaccaā€ƒaacagcggagā€ƒatcgaccaaaā€ƒcgcctctgtt
ā€ƒ9121ā€ƒgggcagtgttā€ƒtcctgagggtā€ƒtctgtcccatā€ƒtctgtaaactā€ƒaggaggctgaā€ƒctagctgaca
ā€ƒ9181ā€ƒaggaattttaā€ƒttctgttgggā€ƒtatttacatgā€ƒaacctatgtgā€ƒccacctggggā€ƒtaagaccctg
ā€ƒ9241ā€ƒtcgtaggtagā€ƒaaacatgactā€ƒtcccaaaaatā€ƒgtccacatccā€ƒtaatctctaaā€ƒttctgtaaat
ā€ƒ9301ā€ƒatattcccttā€ƒactggaaaaaā€ƒgagactttgcā€ƒaggtgtgattā€ƒaaattaaggaā€ƒtcataagagg
ā€ƒ9361ā€ƒgagagattatā€ƒccaggattatā€ƒttgatgagtcā€ƒtaatataatcā€ƒatcagggtacā€ƒttaaaagagg
ā€ƒ9421ā€ƒgaggcaggctā€ƒgtgcctggtgā€ƒgttcacgcctā€ƒttaatcccagā€ƒcactttgggaā€ƒgactgaggcg
ā€ƒ9481ā€ƒagcgggtcacā€ƒgaggacaggaā€ƒgttggagaccā€ƒagcctgaccaā€ƒacatggtgaaā€ƒactccccctc
ā€ƒ9541ā€ƒtagtaaaaaaā€ƒaaaaatacaaā€ƒaaattagccaā€ƒggcatggtggā€ƒtacacacctgā€ƒtaatcccagc
ā€ƒ9601ā€ƒtactcaggagā€ƒgctgaggcggā€ƒgagaattgctā€ƒtgaacccaggā€ƒaggcagaggtā€ƒtgtggtgagc
ā€ƒ9661ā€ƒtgagatcgcaā€ƒccactgccctā€ƒccagcctgggā€ƒcaacagagcaā€ƒagactccatcā€ƒtcaaaaaaaa
ā€ƒ9721ā€ƒaaaaagagggā€ƒaggcagtgggā€ƒatcagagtcaā€ƒgagaaggcaaā€ƒcgtgatgatgā€ƒaaagctgaca
ā€ƒ9781ā€ƒtttgagtgatā€ƒgcaaccacaaā€ƒgccaaggaatā€ƒgcaggcagctā€ƒtctcaaagctā€ƒggaaaggacg
ā€ƒ9841ā€ƒagcaatggatā€ƒtcttccctacā€ƒagcctctgtgā€ƒaggaatgcagā€ƒcctttgatttā€ƒtaaccccata
ā€ƒ9901ā€ƒaggccgatttā€ƒctgactctagā€ƒcctctggaatā€ƒtgtaagataaā€ƒtttgcatgatā€ƒctcaagccac
ā€ƒ9961ā€ƒtaaatttgtgā€ƒgtaatttgtcā€ƒacagaaagcaā€ƒatgggaagccā€ƒaacacaggccā€ƒttatttgttg
10021ā€ƒacttatagatā€ƒgcatttttctā€ƒttatttcaatā€ƒgtacttttatā€ƒcaatggtctcā€ƒatgtagggta
10081ā€ƒttgctttcaaā€ƒtgaagatattā€ƒaacatagtttā€ƒcaactttaagā€ƒgtttatatctā€ƒggagtttctt
10141ā€ƒtagaagcttcā€ƒacaactgaccā€ƒacttagtaaaā€ƒcagtaagcatā€ƒctgttaagtgā€ƒcttctcatat
10201ā€ƒgtaagttcatā€ƒtcaattctcaā€ƒcaatcacactā€ƒataagataaaā€ƒtatgattattā€ƒagcccattta
10261ā€ƒcagatgaggaā€ƒgacaggctcaā€ƒaaagacttttā€ƒatgcaacctgā€ƒgtcaaagtcaā€ƒttcactggta
10321ā€ƒagctgaggagā€ƒgtctgtccacā€ƒttccttttgcā€ƒtgcccccaggā€ƒgggtatcaagā€ƒcctggcagtt
10381ā€ƒagtgtcagcgā€ƒacttaggaggā€ƒtgaacaagtgā€ƒagcaggcctgā€ƒtaggacctggā€ƒctaaactgcc
10441ā€ƒccaggtctctā€ƒgtctacagccā€ƒtcaaacctgtā€ƒggctgtgggtā€ƒcccagagacaā€ƒaggcctcctc
10501ā€ƒagcatcagagā€ƒaaggatgcctā€ƒttgtctcaggā€ƒgtcatcaaccā€ƒttctccaggtā€ƒtgctcacccc
10561ā€ƒctgctgtaaaā€ƒggggatccccā€ƒaagaccgctcā€ƒatcagacaagā€ƒgagcttgggaā€ƒactgaggaga
10621ā€ƒcacagtcagcā€ƒctccaggagtā€ƒgcccaaaatgā€ƒccctcacatgā€ƒctgcatacagā€ƒattgccacaa
10681ā€ƒataaagtacaā€ƒtccacattctā€ƒgaagactctgā€ƒtcctcatcacā€ƒcaaccaggctā€ƒggcccctggt
10741ā€ƒgagggctgtaā€ƒgtggttgaggā€ƒcctttgttggā€ƒtagacagtagā€ƒgttaaagcaaā€ƒgccatgattt
10801ā€ƒtctattgggaā€ƒggcttcagaaā€ƒtcagctcagcā€ƒtgtgtttccaā€ƒagaccaggagā€ƒggcagaaagc
10861ā€ƒaaaccatcccā€ƒaggcaagcagā€ƒtccatgggccā€ƒatgtcagatgā€ƒtctagacgttā€ƒatgggtctgt
10921ā€ƒgtttgctctgā€ƒccattcctctā€ƒcggaaactatā€ƒgatgccctgtā€ƒatggtttaccā€ƒttcagtcaca
10981ā€ƒggtgactggcā€ƒctacagggccā€ƒattccttgttā€ƒccaacgacttā€ƒctcgagtataā€ƒattaatcccc
11041ā€ƒaggcatttacā€ƒggccagagcaā€ƒgccggccaaaā€ƒtccgtgaagtā€ƒgcagtggttgā€ƒttttaaatta
11101ā€ƒtattaacttcā€ƒttggaaacttā€ƒattttagggaā€ƒgagaaaactcā€ƒagtacttctcā€ƒtctatccaat
11161ā€ƒcttgagtaaaā€ƒaatgttagaaā€ƒgggactggtgā€ƒgagagcctccā€ƒcagacatcccā€ƒtacacataga
11221ā€ƒctttgggttgā€ƒacattatctcā€ƒtttgcaccttā€ƒccttgaaactā€ƒttcttctaaaā€ƒttaggtgcct
11281ā€ƒtccctaatttā€ƒaggcaccttcā€ƒccagtactagā€ƒtctgtgacctā€ƒgttaggaaccā€ƒaggccacaca
11341ā€ƒgcaggagttgā€ƒagtggcagggā€ƒagtgagcattā€ƒattgcctgagā€ƒctccgcctccā€ƒtgtcagatca
11401ā€ƒgcagtggcatā€ƒtagattctcaā€ƒtagcagtccgā€ƒaatactattgā€ƒtgaactgtgcā€ƒgtgtaaggga
11461ā€ƒtctagcttgtā€ƒgcattccttaā€ƒtgagaatctaā€ƒatgcccgatgā€ƒgtctgagatgā€ƒgaagagtttc
11521ā€ƒataccaaaacā€ƒcaccccttccā€ƒccctgccaccā€ƒatctggggaaā€ƒatattgtctaā€ƒccacgaaact
11581ā€ƒgatccctggtā€ƒgccaaaaaggā€ƒttggggaccgā€ƒctgtcctaagā€ƒggatctgcttā€ƒtttctgacct
11641ā€ƒgaggtttttcā€ƒtttattagacā€ƒtgtatctggcā€ƒtgaggagaagā€ƒcctgaagcctā€ƒttaatcggaa
11701ā€ƒcagctttggcā€ƒtgatgagattā€ƒagattcagaaā€ƒaccaacagatā€ƒtggtcttttcā€ƒtatgcaggga
11761ā€ƒagcctaggaaā€ƒctggggggctā€ƒatggctgggaā€ƒagccccctatā€ƒtgtttccatcā€ƒctttcctatg
11821ā€ƒttcatcctggā€ƒaggaatggcaā€ƒtcagacccatā€ƒgcctctgtgaā€ƒttgctcccagā€ƒcccatccaac
11881ā€ƒcacagcatctā€ƒatgttctgccā€ƒtgggaccaggā€ƒgccagggagcā€ƒatggcacactā€ƒgagctgagta
11941ā€ƒtaaggagagtā€ƒggagcaggccā€ƒactgccagccā€ƒcagaaaatttā€ƒtggtcaaagtā€ƒtgcctgaaat
12001ā€ƒcttctcagccā€ƒttcgattcacā€ƒagctgctctcā€ƒtgctgctctgā€ƒgggccatgcaā€ƒgaccagttca
12061ā€ƒgaaaagagttā€ƒaatttgttggā€ƒggcagttggaā€ƒggcaggtggaā€ƒctgccagcttā€ƒtgacaccttc
12121ā€ƒccagcccacaā€ƒggctgctgcaā€ƒctggggctgaā€ƒaggcgtggctā€ƒaacccctgcaā€ƒcacctagaga
12181ā€ƒgtgacagagaā€ƒtcccagactgā€ƒggcagcaggaā€ƒaggcaagaggā€ƒattaagagagā€ƒagcttcctgg
12241ā€ƒctgaaagccaā€ƒcactcggttaā€ƒaccaggaaaaā€ƒagcccttggcā€ƒacgagaagacā€ƒtcagtggcct
12301ā€ƒgagggactgaā€ƒgccttggttgā€ƒttgggcatgtā€ƒgctgcataagā€ƒccatccatgtā€ƒgtgacagtag
12361ā€ƒagtgtagtccā€ƒagccactgtgā€ƒggacatgggtā€ƒgctgaaagacā€ƒcacatggagaā€ƒggaacagtga
12421ā€ƒgtgctgacaaā€ƒgggctagcctā€ƒtgatcactttā€ƒggagacacccā€ƒcctgtgtcttā€ƒctagatgtca
12481ā€ƒgactttccaaā€ƒatctgtctgcā€ƒtatcctccaaā€ƒacgtgcatttā€ƒtcaagagcaaā€ƒtggaaaaagg
12541ā€ƒattggacttgā€ƒatggaatgcaā€ƒgcaagagtccā€ƒtaggtctgttā€ƒactacctaccā€ƒtatgacctta
12601ā€ƒagaaactcctā€ƒtcacccctcaā€ƒgaacccttacā€ƒagctttctttā€ƒctgattctatā€ƒcctgagttac
12661ā€ƒtctactccaaā€ƒgctgagacttā€ƒttctgcttagā€ƒatctatccctā€ƒtcctcctaaaā€ƒcccccaacct
12721ā€ƒccatttctccā€ƒtggtgtctttā€ƒctttacacacā€ƒccctcagcatā€ƒacacacacacā€ƒctagccacag
12781ā€ƒgaaccaatgaā€ƒgttaatatttā€ƒgaggagttggā€ƒttttcttttgā€ƒtcctcaatgaā€ƒgatcctggtg
12841ā€ƒaggccacttgā€ƒagctgttcagā€ƒctcccttgcgā€ƒgtattttgggā€ƒgatggaactcā€ƒagaagccaac
12901ā€ƒaatatagaaaā€ƒaagagtctttā€ƒggccagctttā€ƒcccaggggctā€ƒccatgccataā€ƒgagagtactg
12961ā€ƒcacccgtgtgā€ƒcacagggggcā€ƒcctgacatgaā€ƒggactttgagā€ƒgataacactaā€ƒttcctccaac
13021ā€ƒtctgcttcagā€ƒcatctccatgā€ƒgattttcacaā€ƒcagacactttā€ƒaggaaagaaaā€ƒctaagtttgg
13081ā€ƒggggacttgaā€ƒcctaatcccaā€ƒcatcacagccā€ƒccagtaatacā€ƒagccctggaaā€ƒtttatcacag
13141ā€ƒaaagcctagaā€ƒatcccatgcaā€ƒtatcccatgcā€ƒatatgcatccā€ƒctagtcctatā€ƒgggttcaagg
13201ā€ƒcttggagctcā€ƒtccctggattā€ƒtagctgggaaā€ƒaagttggcagā€ƒacagttcttcā€ƒtctgtcttct
13261ā€ƒagaaatatggā€ƒactagaatcgā€ƒtgagtgtgagā€ƒattgcaagtaā€ƒacttttaaaaā€ƒtcatctagtt
13321ā€ƒtaacttcaccā€ƒccatttcataā€ƒgaccaagaaaā€ƒctgagaccagā€ƒagagagaaatā€ƒggactttcaa
13381ā€ƒgttcaccctgā€ƒctagttactgā€ƒatggatcacaā€ƒagtcaaatctā€ƒcctgattctaā€ƒgcactgtttc
13441ā€ƒtcttacaccaā€ƒcaccacctttā€ƒgaaagtgtgtā€ƒcaatcaaatcā€ƒttactttagtā€ƒtgcagaggat
13501ā€ƒgactttagttā€ƒtctgaagataā€ƒaaattgtgagā€ƒtcaatcaagaā€ƒtgagtcccaaā€ƒgacaatagcc
13561ā€ƒtctttagcccā€ƒttataagttcā€ƒagggatgaaaā€ƒggttagaaagā€ƒaaacaggatgā€ƒgaaggaggac
13621ā€ƒtggagaaaaaā€ƒaacaaaagagā€ƒgaaggaaggaā€ƒggaggaagcaā€ƒaacaggaaaaā€ƒaaaaagaatg
13681ā€ƒtgcatagcttā€ƒgtcactcctcā€ƒagtcatttccā€ƒtgggagcccaā€ƒtttctagcaaā€ƒagtgacagct
13741ā€ƒgcaactccctā€ƒggccacctgaā€ƒgcatcttagcā€ƒtgatctgtctā€ƒctgaaacaccā€ƒccctggagaa
13801ā€ƒcagatgaatcā€ƒaggcttcatcā€ƒttcgcttaacā€ƒtaagtcttccā€ƒctgagacgacā€ƒtccatttaaa
13861ā€ƒtgaacaagagā€ƒcaggatttccā€ƒtgggcacactā€ƒgagagcacctā€ƒtccagaggccā€ƒcctccagagc
13921ā€ƒcctaaagcctā€ƒgtatttcttcā€ƒcagtcggcctā€ƒgtttctttccā€ƒtggtgatgtcā€ƒattaaacgcc
13981ā€ƒctttgagagtā€ƒcccacagtgaā€ƒgcagttctgcā€ƒggtaaaacccā€ƒgctgcaattaā€ƒaagtctgagt
14041ā€ƒcctttcctgtā€ƒctcaaagggcā€ƒatattcatatā€ƒagaagaaaggā€ƒaaaaggaaggā€ƒactggctgtt
14101ā€ƒtgcatttggtā€ƒtccaggcctgā€ƒttgagtagagā€ƒgtcgtgctcaā€ƒctccaccgaaā€ƒggtacagggt
14161ā€ƒagccttcagcā€ƒagaacctgggā€ƒgatttggtttā€ƒtaagcaagtcā€ƒtttcttaggtā€ƒgtgggctttc
14221ā€ƒagaacacttcā€ƒcttccttgcaā€ƒatattatttgā€ƒaaattctcagā€ƒtgttttagccā€ƒgtccccagaa
14281ā€ƒtattggttcgā€ƒttaaagctgtā€ƒgtatttcagaā€ƒtctccagacaā€ƒgtggtcactgā€ƒtttgtatatt
14341ā€ƒttcaatttcaā€ƒaaccagaaaaā€ƒcaaaagttctā€ƒtattgattacā€ƒtttttttattā€ƒtaaaaaataa
14401ā€ƒaaagtaagtaā€ƒtcttcgtaagā€ƒaggagctttgā€ƒttttaattttā€ƒaaagtttaaaā€ƒatttgattgt
14461ā€ƒgaagacagagā€ƒaaaaacttgaā€ƒtgattgtagaā€ƒtatattccccā€ƒtctttggctaā€ƒttcaatcaga
14521ā€ƒgaactagaaaā€ƒatcatgagagā€ƒatttaatgacā€ƒcactgcctgaā€ƒtacacatatgā€ƒtcttttacag
14581ā€ƒatgaggaaacā€ƒtgagacccagā€ƒagagatgatgā€ƒaaattggctgā€ƒaggatggcccā€ƒagctggtcag
14641ā€ƒtgaaagactcā€ƒagagccagagā€ƒctggtgcaggā€ƒgctctttctaā€ƒttccttcctgā€ƒttccctttca
14701ā€ƒggaacactcaā€ƒccatcggcttā€ƒtcctgtgaatā€ƒaatgttgagaā€ƒtaaaatccttā€ƒggtgcattat
14761ā€ƒgttttctagtā€ƒcacaacattgā€ƒactaggctgcā€ƒcagagtcctcā€ƒtgttctcccaā€ƒgttggttggc
14821ā€ƒtgtaggtgttā€ƒggcagccgccā€ƒaggagcattcā€ƒtacagaacagā€ƒaggaggagtgā€ƒagactctcct
14881ā€ƒtgctcaggaaā€ƒaggcagacctā€ƒatgacttagcā€ƒaaataactccā€ƒtaagaggagaā€ƒgtgtttcacc
14941ā€ƒcaccattcctā€ƒcttccttggcā€ƒtgtggaggcaā€ƒacttagtggaā€ƒgaggggccagā€ƒatgacctgtg
15001ā€ƒaggaacagtgā€ƒaagccctgccā€ƒtaacacaatgā€ƒtatggttgtcā€ƒttgttacagaā€ƒgtcatcagct
15061ā€ƒacgagtgctgā€ƒtcctggatatā€ƒgaaaaggtccā€ƒctggggagaaā€ƒgggctgtccaā€ƒgcaggtgaat
15121ā€ƒgaatcctccgā€ƒggccttgcctā€ƒgttggtgtggā€ƒgtggaagggaā€ƒatggtgggagā€ƒagaggagtac
15181ā€ƒccacataaaaā€ƒggcagcagagā€ƒtgtgaatgggā€ƒggcagtggcaā€ƒcaaggacatgā€ƒgcattctccc
15241ā€ƒcacgtgcccaā€ƒctggccccagā€ƒgctctatgcgā€ƒaggggctgagā€ƒgaatggaagcā€ƒtggaaacagc
15301ā€ƒgcatttcctgā€ƒagctgctcctā€ƒcctggcctccā€ƒttaccacactā€ƒggtggagtagā€ƒactccaactg
15361ā€ƒtggcctgtccā€ƒatgcccttccā€ƒcagcaggcacā€ƒaggctcaggcā€ƒtcaggctcttā€ƒggcctctgcc
15421ā€ƒtctggctgggā€ƒagtgattctaā€ƒaacacatccaā€ƒgcagggtcagā€ƒcctgatagccā€ƒcatcagtttc
15481ā€ƒcgatcagctcā€ƒtgctagagagā€ƒccgatgggatā€ƒgtgggaggagā€ƒggggtcactgā€ƒgtgggctggc
15541ā€ƒaaccccaagcā€ƒcatccccatcā€ƒtccctctgtgā€ƒtctaaacttgā€ƒgccctttggaā€ƒgttcggtagg
15601ā€ƒgagaagagccā€ƒataggccaggā€ƒtgggctcaccā€ƒcagagtcagcā€ƒagagagtcccā€ƒacaaatggtt
15661ā€ƒgcactgggcgā€ƒaaagacagcaā€ƒtggcacctgtā€ƒgaattttattā€ƒagagcttttcā€ƒttttagtgct
15721ā€ƒacacacaagtā€ƒgactgtacagā€ƒgggagttagtā€ƒattttgttttā€ƒaattttgaaaā€ƒtagagtcatc
15781ā€ƒttttggtatcā€ƒtgcgggggatā€ƒtgattctaggā€ƒacccattctaā€ƒggatgccataā€ƒtcctcagatg
15841ā€ƒttcaagtcccā€ƒtgatataaagā€ƒtggtatagtaā€ƒtttgcatgtaā€ƒatctatgcatā€ƒattcttccat
15901ā€ƒgtactttaaaā€ƒtcatctcaagā€ƒattacttataā€ƒataccaaataā€ƒtaatgtaaatā€ƒcctatgtaag
15961ā€ƒtagttgttatā€ƒaccctcttttā€ƒaaatttttgtā€ƒattatcttttā€ƒattgtatttcā€ƒaaaaaatatt
16021ā€ƒtttggtccatā€ƒgtttagttgaā€ƒatctgtgggtā€ƒgaagaacccaā€ƒcagatacgaaā€ƒgggccaactg
16081ā€ƒtattggctatā€ƒttttttagttā€ƒaagaatgtgaā€ƒgactgaggccā€ƒaggcgcagtgā€ƒgctcatgcct
16141ā€ƒttgattccagā€ƒcactttgggaā€ƒggccaagaggā€ƒggacgatcacā€ƒctgagccaagā€ƒaattcgagac
16201ā€ƒcagcagcccgā€ƒtccaacatagā€ƒtgagaccttgā€ƒtctcttaaagā€ƒattgtgagacā€ƒtgggctgggc
16261ā€ƒacggtggctcā€ƒacgcctgtaaā€ƒtcctagcactā€ƒttgggaggccā€ƒaaggcaggtgā€ƒgatcaactga
16321ā€ƒggtcaggagtā€ƒttgagatcagā€ƒcctggctaacā€ƒatagtgaaacā€ƒtctgtctctaā€ƒctaaaaatac
16381ā€ƒaaaaaaattaā€ƒgctgggtgtgā€ƒgtggtgggcgā€ƒcctataatccā€ƒcagctactcaā€ƒggaggctgag
16441ā€ƒgcaggagaatā€ƒcgcttgtatcā€ƒcaggaggcggā€ƒaggttgcagtā€ƒgagctgagatā€ƒagggccgttg
16501ā€ƒcactccagccā€ƒtgggcaagaaā€ƒgagcaaaactā€ƒccatctcaaaā€ƒaataaataaaā€ƒtaaataaata
16561ā€ƒaataaatcatā€ƒgagactgagaā€ƒcataacaggaā€ƒaggagggcaaā€ƒtttggttggtā€ƒtccaaggttc
16621ā€ƒctagagtatyā€ƒtgatgggagaā€ƒggttggtgcgā€ƒggtggggccaā€ƒtggaggtactā€ƒgactcaagtg
16681ā€ƒgagggacaggā€ƒtggggaaatgā€ƒggatgggaaaā€ƒagaagattgaā€ƒccttagaaggā€ƒggagctcaac
16741ā€ƒctctgaacccā€ƒtaatttcagaā€ƒcccttcaaaaā€ƒtgaatattaaā€ƒgctcattttgā€ƒgtctaagaaa
16801ā€ƒcaaaaaacaaā€ƒatgaacatgaā€ƒaactcattttā€ƒggtcttataaā€ƒggtctgagaaā€ƒaccccttcta
16861ā€ƒaacttcaagcā€ƒtgctttaagaā€ƒaataacatttā€ƒtattacctgcā€ƒaaatacacacā€ƒagtactttgg
16921ā€ƒagatttataaā€ƒtagtctcttaā€ƒttctaatagaā€ƒagccattaggā€ƒgaaccagtttā€ƒcaataaacag
16981ā€ƒgtaaatctgtā€ƒaagactagttā€ƒtgtaattaggā€ƒatatctgtttā€ƒccagtgtccaā€ƒttcctgcctc
17041ā€ƒtcttatctaaā€ƒatgtctgggaā€ƒacaagagctgā€ƒtgctctgctgā€ƒtctttaaaatā€ƒgattaaaaat
17101ā€ƒcaccaattagā€ƒttgagttcacā€ƒgtagacaggcā€ƒatttgacttaā€ƒttgagttgttā€ƒttaagaagac
17161ā€ƒtataacaagcā€ƒcttaagccccā€ƒccagaaacagā€ƒcctgtctttgā€ƒggctttcccaā€ƒcatgcctcct
17221ā€ƒcgtcctctccā€ƒacctgtagatā€ƒgtaccgtgctā€ƒctctgtcagaā€ƒgaagggagggā€ƒtgtggttggg
17281ā€ƒctggacccccā€ƒagaggccatcā€ƒcctccttctgā€ƒtcttctgctcā€ƒctgcagccctā€ƒaccactctca
17341ā€ƒaacctttacgā€ƒagaccctgggā€ƒagtcgttggaā€ƒtccaccaccaā€ƒctcagctgtaā€ƒcacggaccgc
17401ā€ƒacggagaagcā€ƒtgaggcctgaā€ƒgatggaggggā€ƒcccggcagctā€ƒtcaccatcttā€ƒcgcccctagc
17461ā€ƒaacgaggcctā€ƒgggcctccttā€ƒgccagctgtgā€ƒagatgacctcā€ƒcgtctgcccgā€ƒggggactctt
17521ā€ƒatggggaactā€ƒgccttacttcā€ƒcccgaggggtā€ƒgggcatgatgā€ƒaatgggagtcā€ƒtgcagtcatt
17581ā€ƒtcctactgttā€ƒtcaggaagctā€ƒttctccttaaā€ƒccccttagaaā€ƒaaggctgtggā€ƒaacttgagct
17641ā€ƒaaaatatgtcā€ƒttaccaggttā€ƒgcgtctaatgā€ƒccccccgttcā€ƒcctactgggcā€ƒagaaagactt
17701ā€ƒgggtgcttccā€ƒtgaggagggaā€ƒtccttggcagā€ƒaagagaggccā€ƒtgggctcacgā€ƒagggctgaga
17761ā€ƒacatgtttccā€ƒcagagttgcaā€ƒaggacccatcā€ƒtcttaaacacā€ƒagagtctgcaā€ƒgcccctaact
17821ā€ƒgacaccctgtā€ƒccttcctcctā€ƒaggaagtgctā€ƒggactccctgā€ƒgtcagcaatgā€ƒtcaacattga
17881ā€ƒgctgctcaatā€ƒgccctccgctā€ƒaccatatggtā€ƒgggcaggcgaā€ƒgtcctgactgā€ƒatgagctgaa
17941ā€ƒacacggcatgā€ƒaccctcacctā€ƒctatgtaccaā€ƒgaattccaacā€ƒatccagatccā€ƒaccactatcc
18001ā€ƒtaatggggtaā€ƒggggatccccā€ƒagccatactgā€ƒcatggcccttā€ƒggtgcataatā€ƒgaacccattt
18061ā€ƒctgttccatgā€ƒtgtgggctggā€ƒtttctggggtā€ƒttaagctgtaā€ƒgacaacccacā€ƒcctctttgtg
18121ā€ƒcctgcttctcā€ƒcttgggccctā€ƒctattccacaā€ƒgcttgtggaaā€ƒcccacattttā€ƒgctactgtgt
18181ā€ƒttgaaaacacā€ƒtgttttctccā€ƒtcccggggctā€ƒttgggactatā€ƒgcctctgttgā€ƒtgttgactgc
18241ā€ƒtcatccttgcā€ƒtgcttctctgā€ƒggcagattgtā€ƒaactgtgaacā€ƒtgtgcccggcā€ƒtgctgaaagc
18301ā€ƒcgaccaccatā€ƒgcaaccaacgā€ƒgggtggtgcaā€ƒcctcatcgatā€ƒaaggtcatctā€ƒccaccatcac
18361ā€ƒcaacaacatcā€ƒcagcagatcaā€ƒttgagatcgaā€ƒggacacctttā€ƒgagacccttcā€ƒgggtaaggga
18421ā€ƒctgccctgggā€ƒtggaggcccaā€ƒggcttgggacā€ƒacattgcctcā€ƒccaagaggggā€ƒcctagcagga
18481ā€ƒactcttctgcā€ƒaggagaggtaā€ƒgaggatggctā€ƒcctgtaggggā€ƒaacatagagcā€ƒaggttcccct
18541ā€ƒgaatgcccttā€ƒgaacatggagā€ƒaattcattgaā€ƒccagacattcā€ƒagcttgacctā€ƒaacctgtgaa
18601ā€ƒattctccatcā€ƒttctttataaā€ƒagtgttccctā€ƒtccttgcctcā€ƒccctggaaagā€ƒgtcagtggtg
18661ā€ƒtgtggctgcaā€ƒgcagcacagtā€ƒgtcctctgagā€ƒccctggacctā€ƒgcactgtggcā€ƒttccagaggt
18721ā€ƒggcagttcccā€ƒacatggggtaā€ƒctagaataaaā€ƒtggcctatcaā€ƒggctgtgtgtā€ƒgctttgggat
18781ā€ƒcacatgtcccā€ƒcaccctaggaā€ƒccctggttccā€ƒaaccatacgcā€ƒatgttctcttā€ƒggagcccaga
18841ā€ƒacagcagagaā€ƒagccaccagtā€ƒgtggacacagā€ƒaagtcaagggā€ƒtctgatttccā€ƒagcctggctt
18901ā€ƒctgactgctcā€ƒtggggccgcaā€ƒggaatacggtā€ƒtccttcccccā€ƒatgcccagcaā€ƒggcatttgtc
18961ā€ƒttacaactggā€ƒaggggaaggcā€ƒatgttcctctā€ƒtggcaaggacā€ƒtgctcaggagā€ƒgaagtggagg
19021ā€ƒcaggctgcccā€ƒtgtcagggttā€ƒtttgccttgaā€ƒttcaaggagaā€ƒacttcctaacā€ƒcacaaaggat
19081ā€ƒacaagtgggaā€ƒgtgaggcggaā€ƒccctccctagā€ƒagatctccaaā€ƒcacagagagaā€ƒcaaacacgct
19141ā€ƒggggctggctā€ƒggcactgacaā€ƒggcctcgcagā€ƒgtgtggatggā€ƒctgttagctgā€ƒggagcttcgc
19201ā€ƒtgtctaagctā€ƒcctctcccatā€ƒgcttttcttcā€ƒtgggttgctcā€ƒgaaggacgggā€ƒggtctgcaag
19261ā€ƒaaaatgatgtā€ƒtcccacatagā€ƒttggcagcacā€ƒgtgaacagcaā€ƒattgatccctā€ƒttgcatcacc
19321ā€ƒtcctcttactā€ƒgtttagatttā€ƒggtaaatattā€ƒtcttccttccā€ƒctcttctgacā€ƒcctccatttt
19381ā€ƒgccgatctttā€ƒccttcttataā€ƒacacatacttā€ƒactaggtaccā€ƒtgctacttccā€ƒcgggtgggcc
19441ā€ƒtatgtgccagā€ƒgagtatagagā€ƒgtgaacaaggā€ƒaaggcaaagtā€ƒtctattctcaā€ƒgtagagctaa
19501ā€ƒtactctatctā€ƒggagagagacā€ƒaacaaacaaaā€ƒtcaacaaggtā€ƒagccaggggcā€ƒtgtgataatt
19561ā€ƒtatgtcaagtā€ƒgggcaggtaaā€ƒatcgggagtgā€ƒacagtagtgcā€ƒagggaggattā€ƒggaaagtcag
19621ā€ƒggagttctctā€ƒctggaggaggā€ƒtggcttttgaā€ƒtctgcagcctā€ƒaaaggatgagā€ƒaatgggtcca
19681ā€ƒttatacaaaaā€ƒtgctggggcaā€ƒagagcacaccā€ƒcagtagagggā€ƒgagagtaataā€ƒgcaaaggctc
19741ā€ƒagggcaggaaā€ƒgggcaagggaā€ƒgaggccagtgā€ƒggtgaggtcaā€ƒcatgtgaaggā€ƒgcatacaatg
19801ā€ƒggcaaagacaā€ƒaggccagagtā€ƒggccaggcccā€ƒaatcctccagā€ƒgacttgcagaā€ƒcctgggaaag
19861ā€ƒagtgcatctcā€ƒcatcctgggaā€ƒgcagcaggaaā€ƒaccactcaggā€ƒcctttagaagā€ƒatccttctgg
19921ā€ƒcagctgtgtaā€ƒgagaatgggtā€ƒggtgtgatccā€ƒttccatgcatā€ƒgggctcatgtā€ƒacgtgattac
19981ā€ƒcagtaactgtā€ƒcgagtgacagā€ƒtgtgaggaggā€ƒgctgcaagccā€ƒatgagtgtagā€ƒgcacagcaga
20041ā€ƒcagactcaccā€ƒtttgtctggcā€ƒggtgagatggā€ƒggtgggaagtā€ƒgtgccaagttā€ƒgacctcccaa
20101ā€ƒagaaatgataā€ƒttttagtggaā€ƒagaatgaataā€ƒgaatcagagaā€ƒagcaaagtaaā€ƒgagggaagag
20161ā€ƒcagagaggacā€ƒagcagggacaā€ƒaggacttgggā€ƒggcaggaagaā€ƒggaaaggcagā€ƒgttaaggaca
20221ā€ƒtgaaagatggā€ƒccaggctggcā€ƒtggagctcagā€ƒgcccagcaagā€ƒgccccctgggā€ƒggccatggtc
20281ā€ƒatgggtgagcā€ƒttgggtttggā€ƒcttctgttttā€ƒcgtcttgggcā€ƒttctgtgaaaā€ƒgcctcgagcc
20341ā€ƒcttgcggggaā€ƒaccagtgaagā€ƒctgtgtgtgcā€ƒatcttctgtgā€ƒgggagtgccaā€ƒgagtcttcag
20401ā€ƒggagcactccā€ƒatcttctctcā€ƒctccccacagā€ƒgctgctgtggā€ƒctgcatcaggā€ƒgctcaacacg
20461ā€ƒatgcttgaagā€ƒgtaacggccaā€ƒgtacacgcttā€ƒttggccccgaā€ƒccaatgaggcā€ƒcttcgagaag
20521ā€ƒatccctagtgā€ƒagactttgaaā€ƒccgtatcctgā€ƒggcgacccagā€ƒaagccctgagā€ƒaggtgagcat
20581ā€ƒcctttggctcā€ƒctgctgctgcā€ƒctcatttgtgā€ƒcagctagattā€ƒgagcccaagaā€ƒcctgctctgg
20641ā€ƒtccaagatgaā€ƒacataccaccā€ƒtgccatgaggā€ƒtgaccctcagā€ƒgatatccactā€ƒgcagccatgg
20701ā€ƒgctggggtcaā€ƒtcctgtcctgā€ƒttgcttcagcā€ƒtaaccgtgtcā€ƒtctagcagccā€ƒacactactct
20761ā€ƒgagggctgacā€ƒtacagaatccā€ƒagcagcttttā€ƒgtctgggagaā€ƒgctggactgaā€ƒagagaggcat
20821ā€ƒagctggagacā€ƒccatagctggā€ƒccctggccagā€ƒaaacagggagā€ƒagtgaaaggcā€ƒtggaatagcc
20881ā€ƒaaggccagagā€ƒcaaggctaatā€ƒaggtagagcaā€ƒacagcttacaā€ƒggtgtgggggā€ƒtggcagatac
20941ā€ƒtcgcacccttā€ƒgaaatggattā€ƒcctcatgcccā€ƒacgcttcactā€ƒattcttctctā€ƒgtggctaggg
21001ā€ƒgatttatggaā€ƒtaaaccaaaaā€ƒttacagttaaā€ƒaaaccagccaā€ƒtaggccaggcā€ƒacagtgactc
21061ā€ƒacgcctttaaā€ƒtatcagcactā€ƒttgggaggacā€ƒaaggtgggcgā€ƒgatcacctgaā€ƒgatctggaat
21121ā€ƒttgagaccagā€ƒcctggccaacā€ƒatggcgaaacā€ƒcccatctctaā€ƒctaaaaatacā€ƒaaaaattagc
21181ā€ƒtgggcatggtā€ƒggtgggcaccā€ƒtgtaatcccaā€ƒgttactcaggā€ƒggctgaggcaā€ƒggagaaccac
21241ā€ƒttgaacccagā€ƒgaggtggaggā€ƒttgcagtgagā€ƒccaagcttgcā€ƒaccactgcacā€ƒtccagcctgg
21301ā€ƒgtgacacagcā€ƒgacactccgtā€ƒctcaagaaaaā€ƒaaaaaaaaaaā€ƒaaacagttatā€ƒagtagtcaac
21361ā€ƒttttgactctā€ƒccatttcagaā€ƒtttcgtcatgā€ƒccctcctcaaā€ƒtgagctgctaā€ƒagttaggcag
21421ā€ƒtgcattgattā€ƒattgctgcagā€ƒgagagggaagā€ƒgaaggagctaā€ƒacgtgttttcā€ƒacatgttttc
21481ā€ƒcttttggagaā€ƒtgagaaaggaā€ƒggactctgccā€ƒttccccctacā€ƒcctgccccttā€ƒtctactccag
21541ā€ƒgacctctgaaā€ƒaggccatgagā€ƒcacaaagctgā€ƒctgcctgagtā€ƒcccctgaaatā€ƒgcagggtacg
21601ā€ƒccccaggtctā€ƒctgatgtaccā€ƒccaccacactā€ƒtttcctctcaā€ƒaacatattccā€ƒaggatcactt
21661ā€ƒgatttcttttā€ƒgaatctatttā€ƒaaacccaccgā€ƒtgtcaatgtgā€ƒctatataaaaā€ƒtgtctaatgc
21721ā€ƒatttcagacaā€ƒccctatacatā€ƒctatacatttā€ƒaaagtgttctā€ƒccttctatctā€ƒgtgcagggat
21781ā€ƒgggaaagggcā€ƒatatttctgaā€ƒaagcacagatā€ƒgggaagacggā€ƒgatttgttccā€ƒgtgtccaggt
21841ā€ƒgattatggtaā€ƒcctctatgcgā€ƒcctggccggcā€ƒactggggacaā€ƒgaggccatgaā€ƒaaatgaatac
21901ā€ƒagcacagcctā€ƒttgcctccaaā€ƒgaaacttaagā€ƒacctagtagaā€ƒaatggcaggcā€ƒtttaaaacag
21961ā€ƒgttgttgggaā€ƒtctgatttggā€ƒtgagtgcaatā€ƒgacagagataā€ƒctcacagcacā€ƒaaaatgggga
22021ā€ƒatgagggcggā€ƒgcattgggacā€ƒacacatagccā€ƒttaaggggccā€ƒcaaaggctttā€ƒtagaactgta
22081ā€ƒttccctattaā€ƒaaacatgattā€ƒtgcacagagcā€ƒacattctttgā€ƒctttggagacā€ƒctcagaactc
22141ā€ƒcttactatagā€ƒgccgggcatgā€ƒgttataatccā€ƒcagcactttgā€ƒggaagccaagā€ƒgcgggcagat
22201ā€ƒcacttgaggcā€ƒtgagagttcaā€ƒagaccagcctā€ƒggccaacatgā€ƒgtaaaaccccā€ƒgtctctacta
22261ā€ƒaaaatacaaaā€ƒaattagctggā€ƒgtgtggtggtā€ƒggccacctgtā€ƒaatcccagctā€ƒactcaggagg
22321ā€ƒctgaggtaggā€ƒagaatcacttā€ƒgaacctgggaā€ƒggcagaagttā€ƒgcaataagccā€ƒcagatcatgc
22381ā€ƒcactgcactcā€ƒcagcctgggcā€ƒaacaaagctaā€ƒgactctctcaā€ƒaaagaaaaaaā€ƒacaaaacaaa
22441ā€ƒacaaaacaaaā€ƒacaaaaaaaaā€ƒctccttattaā€ƒtaaactgtaaā€ƒgaaaaaaaagā€ƒgcccctactt
22501ā€ƒcgtcccttttā€ƒgcaaatctgcā€ƒcttttcctacā€ƒtcactaaccaā€ƒgctggttcagā€ƒagcaaggaca
22561ā€ƒctctgtttggā€ƒtgccatcgctā€ƒgcagactggaā€ƒaggaagaggtā€ƒccttgccccaā€ƒcacccaacag
22621ā€ƒtctcctgctgā€ƒttaccggcagā€ƒgttggcaggcā€ƒaggcaggcgaā€ƒgaagcagccaā€ƒgggctggtgg
22681ā€ƒtgtgtccagtā€ƒttgaagactaā€ƒgtttccagccā€ƒctggccctgcā€ƒtcaccctccaā€ƒagtggccctg
22741ā€ƒgcaggttcctā€ƒctaccacatcā€ƒgtggacttcaā€ƒccttccttctā€ƒctaagaagctā€ƒcaatccccaa
22801ā€ƒggcctcattcā€ƒccataggcctā€ƒtctcacccttā€ƒtttctttcccā€ƒtctggctgaaā€ƒtgtggccagc
22861ā€ƒacgggcttccā€ƒaaggccatcaā€ƒactcgtctgcā€ƒagcagccccaā€ƒtgccttgcagā€ƒggcctcagag
22921ā€ƒcttcctcctgā€ƒcctatgacagā€ƒtgtggttttgā€ƒgttcccacacā€ƒttgggatcagā€ƒattgaaactc
22981ā€ƒgcctccgtggā€ƒtgagaatatgā€ƒggacatagagā€ƒcctcggtgacā€ƒcttggtgagcā€ƒagcagtccag
23041ā€ƒgccacctgctā€ƒcagcctggggā€ƒttggggggggā€ƒctcctcctccā€ƒttgactggtcā€ƒcttgcatttg
23101ā€ƒcctccatccaā€ƒgcctgtctggā€ƒgctctccgagā€ƒgcaatggagaā€ƒccagcaggagā€ƒtcacgatggg
23161ā€ƒtcaggagcccā€ƒcctttgggccā€ƒtcagccctgcā€ƒcctgccccctā€ƒaaagtagcacā€ƒttggataagc
23221ā€ƒaaataaattaā€ƒttatacttacā€ƒtatttatgggā€ƒtgtggtgaatā€ƒgggatggcaaā€ƒaggccaagtc
23281ā€ƒttactgatcaā€ƒccaaaccttaā€ƒagatatatccā€ƒtggcagctagā€ƒtagacccttgā€ƒggctaaatga
23341ā€ƒacagaaaactā€ƒggacaaataaā€ƒagtgtacacaā€ƒaataactcaaā€ƒagctgtcattā€ƒtgtacacttt
23401ā€ƒtcgtcttttcā€ƒctactacagtā€ƒttacatttttā€ƒataaaggtgaā€ƒgtagatttctā€ƒaaaatcccgt
23461ā€ƒggtaggctctā€ƒcttgagttttā€ƒtcttgtatccā€ƒctgaagttcaā€ƒgctacaaataā€ƒagctaatcac
23521ā€ƒtaacatttgtā€ƒtgagcatttaā€ƒctctgttgtcā€ƒaggccccgtgā€ƒccgagtgcttā€ƒtaggttcaga
23581ā€ƒatttcatgtcā€ƒatccccacagā€ƒcagccctaggā€ƒagatgaatgcā€ƒaattcttatgā€ƒtccacttgac
23641ā€ƒtgataaggaaā€ƒgttgaggttcā€ƒaaagaggctaā€ƒaatgactctcā€ƒccagggtcccā€ƒacagctggaa
23701ā€ƒagtggccacaā€ƒgggccccagcā€ƒtggttttctaā€ƒgggcagcaggā€ƒcagaaggcgaā€ƒggaggatctg
23761ā€ƒggccctgtggā€ƒtgccccagccā€ƒtcatctgaggā€ƒgtcctcatctā€ƒgagagaacagā€ƒgatcctcaca
23821ā€ƒgcatgggcagā€ƒgctgcaagtgā€ƒgtccctgaggā€ƒttatcgtggaā€ƒgtggaccctgā€ƒacttgacctg
23881ā€ƒagtctgtttgā€ƒgaccccagacā€ƒctgctgaacaā€ƒaccacatcttā€ƒgaagtcagctā€ƒatgtgtgctg
23941ā€ƒaagccatcgtā€ƒtgcggggctgā€ƒtctgtagagaā€ƒccctggagggā€ƒcacgacactgā€ƒgaggtgggct
24001ā€ƒgcagcggggaā€ƒcatgctcactā€ƒatcaacgggaā€ƒaggcgatcatā€ƒctccaataaaā€ƒgacatcctag
24061ā€ƒccaccaacggā€ƒggtgatccacā€ƒtacattgatgā€ƒagctactcatā€ƒcccagactcaā€ƒggtaggccag
24121ā€ƒgcctccggggā€ƒgccttggcccā€ƒtgcctggcccā€ƒaccatctcttā€ƒctgccatcctā€ƒttgtggcggg
24181ā€ƒggaggggaaaā€ƒttcagagatcā€ƒtttgggcgacā€ƒttccctgcctā€ƒggacccagctā€ƒcacagcttct
24241ā€ƒcggccactgcā€ƒaaatgtgtggā€ƒgttgtgaccaā€ƒgactgatgtgā€ƒtcttgagcttā€ƒcaggcttgca
24301ā€ƒagtgcagtggā€ƒagaggcagtgā€ƒgggagctattā€ƒgaaggggtctā€ƒggggacagacā€ƒtcaatcacag
24361ā€ƒaggcctttcaā€ƒgaagatctgcā€ƒctgctgtgcaā€ƒtgggcaaagaā€ƒgggccacttgā€ƒctgacctcag
24421ā€ƒagcatgtgctā€ƒttctcagtagā€ƒtgcccaagctā€ƒgtcccatggtā€ƒcactgacccaā€ƒgttagaatga
24481ā€ƒctgaatggacā€ƒtttggcttgtā€ƒgtctcattagā€ƒgaatcctagcā€ƒcccattctagā€ƒtcttccagtg
24541ā€ƒagatctgtccā€ƒatgagtgaagā€ƒgaatctcacaā€ƒggaaaaaacaā€ƒaaatgcttctā€ƒatgggtgtgg
24601ā€ƒttgctggcctā€ƒtatctacaccā€ƒacagaagccaā€ƒtcacacagacā€ƒtgtctttcttā€ƒcccattgtta
24661ā€ƒgaatgtgcccā€ƒtgaccaagcaā€ƒgcccacagggā€ƒcctgggacagā€ƒaggctgatctā€ƒctgcctaact
24721ā€ƒgagctcacctā€ƒctcctccctcā€ƒtcctcctgacā€ƒtggttagattā€ƒttctaggtgaā€ƒctgttcccct
24781ā€ƒgatgacacaaā€ƒgcccgctgggā€ƒccccagcagtā€ƒgtttagagggā€ƒgttgttgactā€ƒcacgagatga
24841ā€ƒcattcctgctā€ƒgatgtgtgtcā€ƒatgccctgggā€ƒgtggatgaatā€ƒgataaatgaaā€ƒaacagcgctt
24901ā€ƒttaacttttgā€ƒaacccactttā€ƒctccttccttā€ƒgtagccaagaā€ƒcactatttgaā€ƒattggctgca
24961ā€ƒgagtctgatgā€ƒtgtccacagcā€ƒcattgaccttā€ƒttcagacaagā€ƒccggcctcggā€ƒcaatcatctc
25021ā€ƒtctggaagtgā€ƒagcggttgacā€ƒcctcctggctā€ƒcccctgaattā€ƒctgtattcaaā€ƒaggtaacatg
25081ā€ƒgggaaggcatā€ƒccctgttagaā€ƒttgtccctggā€ƒaggcagcttcā€ƒcccacccctgā€ƒtcacctccac
25141ā€ƒaacactctccā€ƒgatttacagcā€ƒaccccatgggā€ƒacattagaacā€ƒttccactcagā€ƒctcaaccaaa
25201ā€ƒagcagatgtgā€ƒacttcagcagā€ƒaaacttcagaā€ƒggctctgttgā€ƒtttcattaggā€ƒcagtgcagag
25261ā€ƒaatgcctttgā€ƒgggagccgttā€ƒcctcagaactā€ƒcaagacttgaā€ƒcatctgggagā€ƒgcagccgttc
25321ā€ƒctcagaactcā€ƒaagacttgacā€ƒatctgggagaā€ƒgcagagcattā€ƒcccttgccttā€ƒtctatttgca
25381ā€ƒgggtcacttgā€ƒccaatgtataā€ƒgtcaagaggtā€ƒcagagtgaggā€ƒgtacagctgaā€ƒgctgcagccc
25441ā€ƒcaggaaggcaā€ƒgagaagggggā€ƒccaagttgtgā€ƒtgcgtgcctgā€ƒcccttccctcā€ƒttagggcaaa
25501ā€ƒactccaaacaā€ƒcccttgattaā€ƒtctggatcttā€ƒctttaattctā€ƒccatagaagaā€ƒtaccagatgt
25561ā€ƒtaaggaatatā€ƒtcgcagcttcā€ƒacttggtttcā€ƒtcaatccctgā€ƒtttccaaactā€ƒcaaggaggga
25621ā€ƒtgggctttttā€ƒcactgtatttā€ƒatctctcatcā€ƒactctcttcaā€ƒttgcaggagcā€ƒacatctctct
25681ā€ƒggacctaaccā€ƒatcaccctttā€ƒcttgtagatgā€ƒgaacccctccā€ƒaattgatgccā€ƒcatacaagga
25741ā€ƒatttgcttcgā€ƒgaaccacataā€ƒattaaagaccā€ƒagctggcctcā€ƒtaagtatctgā€ƒtaccatggac
25801ā€ƒagaccctggaā€ƒaactctgggcā€ƒggcaaaaaacā€ƒtgagagttttā€ƒttttatcgtā€ƒaatgtaagtt
25861ā€ƒctgggtcctaā€ƒaatcatgctcā€ƒctgggaagctā€ƒccttactgtgā€ƒggacttgtatā€ƒtagtgtaaaa
25921ā€ƒaaaaatgtccā€ƒtcaataagcaā€ƒggagtttgcaā€ƒtgagaactggā€ƒttgctgacaaā€ƒggaaggaaat
25981ā€ƒaatttctggaā€ƒaaatatagatā€ƒaacaaaatgaā€ƒgatcctgcagā€ƒaaggattggaā€ƒatctcttttt
26041ā€ƒctggaggcctā€ƒttgagaataaā€ƒaccacacaatā€ƒtatccaacctā€ƒgtattgtgaaā€ƒggaataagtc
26101ā€ƒcttcttgaatā€ƒtcaggaattaā€ƒacacctgggaā€ƒggagggatggā€ƒagttcagactā€ƒctttctgagc
26161ā€ƒttatgagaagā€ƒagaagcccccā€ƒtaaactaaaaā€ƒtacagccctcā€ƒcttggtccaaā€ƒaaggtgcctt
26221ā€ƒctctcttctgā€ƒctgtatcttcā€ƒtttgttttcaā€ƒaacccaacagā€ƒttaccctggaā€ƒaatcaaaaag
26281ā€ƒgaagtacaacā€ƒtcaacatagcā€ƒtcttgcctggā€ƒgaccaaccagā€ƒcaccatttggā€ƒctaaagatgg
26341ā€ƒttatcatctgā€ƒttaaacaaagā€ƒaaataaataaā€ƒatgggttcaaā€ƒcgtatttattā€ƒtcaacattgt
26401ā€ƒcaatggacctā€ƒcatgtgtaacā€ƒtgatattctcā€ƒattatgggacā€ƒctctgtgtgaā€ƒctttattggg
26461ā€ƒgcctctctaaā€ƒccgttctttcā€ƒcttaaggaagā€ƒaccatttattā€ƒgttttatttcā€ƒctggagaaaa
26521ā€ƒtacatcatttā€ƒtatcccagccā€ƒttaataacccā€ƒatcccagtgtā€ƒatactccttcā€ƒatcttcatgg
26581ā€ƒataatgacccā€ƒtcctacatgcā€ƒtctgaacaaaā€ƒtcaggaggccā€ƒcctcgtggaaā€ƒgtataaccag
26641ā€ƒtcctttctttā€ƒctctgtccctā€ƒcttctgtgcaā€ƒgagcctctgcā€ƒattgagaacaā€ƒgctgcatcgc
26701ā€ƒggcccacgacā€ƒaagagggggaā€ƒggtacgggacā€ƒcctgttcacgā€ƒatggaccgggā€ƒtgctgacccc
26761ā€ƒcccaatggggā€ƒactgtcatggā€ƒatgtcctgaaā€ƒgggagacaatā€ƒcgctttaggtā€ƒaattagttcc
26821ā€ƒatccccgggtā€ƒggagcttctgā€ƒcccagtggtcā€ƒatgctggagtā€ƒgggatgtgggā€ƒgccccagcta
26881ā€ƒtttgtcaagcā€ƒtttcttctacā€ƒcttggggattā€ƒcaattaacacā€ƒtagcagtgcaā€ƒctgctgcgac
26941ā€ƒcttccagactā€ƒtgggatggggā€ƒaaaaggcaagā€ƒggtcgccttgā€ƒaaagcttacaā€ƒttgggaagaa
27001ā€ƒgggttacttcā€ƒtaagagtgtaā€ƒatcttcacatā€ƒgcatgggaagā€ƒcagggaggggā€ƒggactacatt
27061ā€ƒtttatgactgā€ƒaagtgcaaggā€ƒaaaacatcacā€ƒcctctcattgā€ƒtaaagctccaā€ƒagtgagccaa
27121ā€ƒgagcacatagā€ƒtttacagtgcā€ƒacgatgagccā€ƒtctcactctcā€ƒtgcgcagtatā€ƒctgtttattg
27181ā€ƒcaactgaagcā€ƒacccttgtgaā€ƒgtttgttttā€ƒttgcccggctā€ƒatctccatttā€ƒctgacttgct
27241ā€ƒcattcaccttā€ƒggggtgctgtā€ƒcatattgaatā€ƒgtttccctgtā€ƒcactgacttcā€ƒagccacctgc
27301ā€ƒacaagggcttā€ƒggagaccacaā€ƒcccctctgccā€ƒctcccagaatā€ƒcatatccctgā€ƒgaggctcagc
27361ā€ƒtagtctctggā€ƒgtcagccataā€ƒcctctgccctā€ƒttcttttcccā€ƒtcctttctccā€ƒtgtggcctct
27421ā€ƒgacgtctggcā€ƒcatttaacagā€ƒagcttagcatā€ƒttttgctgggā€ƒtggagagagcā€ƒtggagcctgg
27481ā€ƒaatcactcccā€ƒtctttgtgcaā€ƒtacggagggcā€ƒatgaaaaccaā€ƒaggtgtgtgcā€ƒattccagtgg
27541ā€ƒcctggactctā€ƒactatcctcaā€ƒgtggtgaggtā€ƒatttaaggaaā€ƒaatacctctcā€ƒagcgtggtga
27601ā€ƒggtatttaagā€ƒgaaaatacctā€ƒgttgacaggtā€ƒgacattttctā€ƒgtgtgtgtatā€ƒctacagcatg
27661ā€ƒctggtagctgā€ƒccatccagtcā€ƒtgcaggactgā€ƒacggagacccā€ƒtcaaccgggaā€ƒaggagtctac
27721ā€ƒacagtctttgā€ƒctcccacaaaā€ƒtgaagccttcā€ƒcgagccctgcā€ƒcaccaagagaā€ƒacggagcaga
27781ā€ƒctcttgggtaā€ƒaagaccaactā€ƒtaagtacacgā€ƒtctccattttā€ƒtctaaagtagā€ƒtgatccctca
27841ā€ƒgggccccagcā€ƒagcaaacagtā€ƒtcgcacatcaā€ƒaggattgactā€ƒtgaagggattā€ƒttatgacaag
27901ā€ƒactattagtgā€ƒaaagagtgggā€ƒcgggactaaaā€ƒggaactagcaā€ƒaaggatgaggā€ƒccaaccaggg
27961ā€ƒactagcaaccā€ƒctgggaagccā€ƒtttactacccā€ƒctaggcctggā€ƒgggaatgggaā€ƒggatgagagc
28021ā€ƒaggaaccaggā€ƒgaggtcatgaā€ƒgccttggacaā€ƒagggcacagaā€ƒacagcagccaā€ƒgagccatgtg
28081ā€ƒcagccagccaā€ƒctgtcagaacā€ƒcatgcaagggā€ƒggaccactcaā€ƒgcgccccagcā€ƒctccctctca
28141ā€ƒgacagttgccā€ƒatctgggtctā€ƒcttgttggctā€ƒgatgcgagagā€ƒcaggagggagā€ƒcccactgatg
28201ā€ƒcagttcatagā€ƒagctcagcctā€ƒcctgggcaggā€ƒaaaccgggcaā€ƒgagaggagtaā€ƒgaaaagaatt
28261ā€ƒaagggtggctā€ƒgcgaccagccā€ƒcagtcactgaā€ƒggcacgtttcā€ƒccactggagaā€ƒcctatgagca
28321ā€ƒcagtgataatā€ƒaaagccagttā€ƒacctgcactgā€ƒactatccctcā€ƒcagacaaaagā€ƒctttcccaag
28381ā€ƒaagttagtcaā€ƒtggctctgagā€ƒagatctagttā€ƒgaggatgtttā€ƒggcaggggatā€ƒctagtggtta
28441ā€ƒcgggtggctaā€ƒagaaaaatgaā€ƒggaaggtaagā€ƒagtatcttgcā€ƒagcctgtgttā€ƒgggaggatta
28501ā€ƒaataggatgcā€ƒcacacacaggā€ƒgccaggcagaā€ƒcagcctggtcā€ƒagtaatagccā€ƒatgacgatgg
28561ā€ƒgggcggggggā€ƒagcaggaatgā€ƒggagttgcagā€ƒtctttagctcā€ƒagatgcatgcā€ƒctgtgagaga
28621ā€ƒtgcttccactā€ƒctcacagaaaā€ƒgatgagaccaā€ƒaggaaaaggaā€ƒggaggaagagā€ƒgaaggacctt
28681ā€ƒgacaaaccttā€ƒggggcccacaā€ƒttgtctacacā€ƒctcccttcctā€ƒgctctagagcā€ƒagaatagaaa
28741ā€ƒgttcaggttgā€ƒcaggcagctcā€ƒtaagttgaatā€ƒtcgtgtcctgā€ƒtttaattttcā€ƒtttattgcta
28801ā€ƒaatgaatgccā€ƒtgtgtctgtgā€ƒatgctgacgtā€ƒatgttcctaaā€ƒggagaggggaā€ƒgaagttcatt
28861ā€ƒctgaacataaā€ƒacttttcatcā€ƒctctctctgtā€ƒccagcaagaaā€ƒtggaatattcā€ƒcccaagtggc
28921ā€ƒctgagccagcā€ƒttggctttctā€ƒttttgttttcā€ƒaattatgtggā€ƒgagttgaggaā€ƒgggggatggg
28981ā€ƒaaaagcttccā€ƒcaaacacaccā€ƒctcccccaggā€ƒcctgaggcacā€ƒccctgggggaā€ƒcagagagtgt
29041ā€ƒtagaggttggā€ƒtacaggtgttā€ƒagagatattgā€ƒaaaggacatcā€ƒccatgcacccā€ƒcaggggctgg
29101ā€ƒtgtggctctgā€ƒtacttccaggā€ƒcaatattttgā€ƒtggaaggggaā€ƒaccttgtcagā€ƒctccaggttg
29161ā€ƒtggatgtttgā€ƒaaaatcagttā€ƒggtacccagtā€ƒggctccatccā€ƒtctggcaggcā€ƒatgtggattt
29221ā€ƒgtcaataaccā€ƒaagtgaactcā€ƒtccaaaataaā€ƒgttaaaacttā€ƒcctcccttctā€ƒcagtttcaag
29281ā€ƒatgctggaaaā€ƒtagctgttcaā€ƒtaagccctggā€ƒggaaatttagā€ƒccctttggctā€ƒggtaatggga
29341ā€ƒgtatccgagaā€ƒtgagagggcaā€ƒgctggaaactā€ƒttcggaatgaā€ƒcctcccacacā€ƒttaatttggg
29401ā€ƒaaatgcctctā€ƒgcacctttatā€ƒgggcaaccagā€ƒatgcctgcccā€ƒcagttgctggā€ƒagacactgat
29461ā€ƒgtgggctgaaā€ƒaggaatgctgā€ƒagacgtgacgā€ƒaggagagatgā€ƒctgcggagggā€ƒaatatccccc
29521ā€ƒtcagccctgaā€ƒcctcatcggcā€ƒtccatggctcā€ƒctccacagtaā€ƒcagctgtctaā€ƒctcttttaag
29581ā€ƒttctcccttcā€ƒaggaaatagcā€ƒcatctcaaacā€ƒagaatgtgcaā€ƒtttgagggcaā€ƒgaatgtgtaa
29641ā€ƒatattgcactā€ƒactgtgttatā€ƒaaccgtcaggā€ƒagccatgctgā€ƒatgatgaaacā€ƒgtcccagatg
29701ā€ƒccggtgctggā€ƒaaaggtccctā€ƒggctttccaaā€ƒgcaaatatttā€ƒatctcatggaā€ƒaacatgagtc
29761ā€ƒatactcacagā€ƒaggagtatggā€ƒattaactcctā€ƒtctcagcagcā€ƒcagggagcccā€ƒagcatcccag
29821ā€ƒacagcatattā€ƒtaacccagagā€ƒgccaactgacā€ƒtgctggggcaā€ƒgatttgtggtā€ƒcatgaacatg
29881ā€ƒtgctttgtgtā€ƒcctctgaccaā€ƒttagacagatā€ƒtgtgggtcacā€ƒaacgttgagtā€ƒatacagtggg
29941ā€ƒagcttaataaā€ƒgtgcttattcā€ƒcctgggcaggā€ƒgagttcttcaā€ƒtttcaggggtā€ƒgaccacttac
30001ā€ƒatcttctcctā€ƒctgggccctcā€ƒcttgaccaggā€ƒctaattaccaā€ƒttcttgggatā€ƒtaactctatc
30061ā€ƒtccttttcccā€ƒgcaacctgcaā€ƒggagatgccaā€ƒaggaacttgcā€ƒcaacatcctgā€ƒaaataccaca
30121ā€ƒttggtgatgaā€ƒaatcctggttā€ƒagcggaggcaā€ƒtcggggccctā€ƒggtgcggctaā€ƒaagtctctcc
30181ā€ƒaaggtgacaaā€ƒgctggaagtcā€ƒagcttggtaaā€ƒgtgtcctgcaā€ƒaatcaaaggcā€ƒtggctaaatt
30241ā€ƒtccccagggcā€ƒagggctccagā€ƒgacatatctcā€ƒacccccaggaā€ƒtggaattataā€ƒcacacacaac
30301ā€ƒcttcaagttgā€ƒcagcccgaatā€ƒctctgagtgtā€ƒaattcgtccaā€ƒaagaaaaagaā€ƒgaaaagagaa
30361ā€ƒgagggtcttcā€ƒagggaaatcaā€ƒagtgagatcaā€ƒtagttagacaā€ƒtgagtaagaaā€ƒcttccagatt
30421ā€ƒtacaagggaaā€ƒtagagcatctā€ƒgatttggcatā€ƒctgagagaggā€ƒctattagatcā€ƒttccttctct
30481ā€ƒtaaggaggttā€ƒgtaggcaactā€ƒagttatgtgaā€ƒctgaagagatā€ƒcagtctgtacā€ƒtcacaccatc
30541ā€ƒccaccccccaā€ƒaacccagggcā€ƒttcactgagtā€ƒtgtaccatgaā€ƒaccagaccatā€ƒcccaagaggc
30601ā€ƒtttttgagttā€ƒctgacacttgā€ƒctctgtgagcā€ƒcttcccttgcā€ƒtctgcacattā€ƒgatgatataa
30661ā€ƒctttgtaactā€ƒgcactaagagā€ƒtgttcctaaaā€ƒgcagatagccā€ƒagccgagctcā€ƒcagaaatctc
30721ā€ƒcctggctgcaā€ƒcctgcagaggā€ƒccactgacccā€ƒctctgtggagā€ƒggaccgctctā€ƒtcagtgtgtg
30781ā€ƒgctggcttctā€ƒactctctgctā€ƒcctctctcttā€ƒggtcttcagcā€ƒcatccattgcā€ƒtcaccagttt
30841ā€ƒctcacgaggaā€ƒgcataggaagā€ƒatatgcatgtā€ƒagggaggtagā€ƒgcacggggatā€ƒgacttgtttg
30901ā€ƒactttagcagā€ƒgtcattcaagā€ƒaatctcctcgā€ƒcacctggtttā€ƒcagatgctggā€ƒggtcctgtct
30961ā€ƒgtcacaggctā€ƒtctgtgcctcā€ƒctacccccttā€ƒgagtttgtcaā€ƒcatggcccttā€ƒcaggaaggcc
31021ā€ƒtgagatagatā€ƒttgccctgggā€ƒtgggcctcctā€ƒatgagaaaatā€ƒcttaagtgagā€ƒgcacccaggc
31081ā€ƒaaaatggaaaā€ƒgagccttttgā€ƒcccagagcagā€ƒgaagcctgtcā€ƒttccatttccā€ƒagctgttcca
31141ā€ƒcctacttagcā€ƒttaaaagaggā€ƒcacttcgcctā€ƒgtcttcagtcā€ƒtcagtctcagā€ƒtctcctcttc
31201ā€ƒtgtggaatggā€ƒgacaataataā€ƒtctactctccā€ƒttatcatacaā€ƒctgctgtgagā€ƒgactgagtgg
31261ā€ƒatcacacaaaā€ƒaaagcattatā€ƒgtaaattgcaā€ƒaagtgctaaaā€ƒtccacacaggā€ƒagatttgaat
31321ā€ƒtaatccaccaā€ƒcactgaaggtā€ƒctgtcaagggā€ƒcagggactgtā€ƒttcattcaccā€ƒagagtatccc
31381ā€ƒcagtctaacaā€ƒcaggacttggā€ƒcatatgaaaaā€ƒgtgttcagtaā€ƒggccgggtgcā€ƒagtggctcat
31441ā€ƒgcctgtaatcā€ƒccagcactttā€ƒgggaggccaaā€ƒagtgggcggaā€ƒtcatctgaggā€ƒtcaggagttc
31501ā€ƒaagtccagccā€ƒtcgccaacgtā€ƒggtgaaaccaā€ƒcatctctactā€ƒaaaaatacaaā€ƒaattagctgg
31561ā€ƒgcgtggtggcā€ƒacatgcctgtā€ƒaatcacagctā€ƒactctggaggā€ƒctgaggcaggā€ƒagaatcactt
31621ā€ƒgaacccaggaā€ƒggcggaggttā€ƒgcagtgagtcā€ƒgagatcatgcā€ƒcactgcactcā€ƒcagcctgggc
31681ā€ƒgacaagattgā€ƒaaactccatcā€ƒtcaaaaacaaā€ƒagaacaaggaā€ƒaaaaaacgaaā€ƒaactgttcag
31741ā€ƒtaaacacttgā€ƒctgaatgaatā€ƒaaaataaataā€ƒtataaatgtaā€ƒtaaataaatgā€ƒctctactttc
31801ā€ƒaaccactactā€ƒctgtttttctā€ƒtttagaaaaaā€ƒcaatgtggtgā€ƒagtgtcaacaā€ƒaggagcctgt
31861ā€ƒtgccgagcctā€ƒgacatcatggā€ƒccacaaatggā€ƒcgtggtccatā€ƒgtcatcaccaā€ƒatgttctgca
31921ā€ƒgcctccaggtā€ƒaagtgtcgcaā€ƒtccccactgaā€ƒctctgcagccā€ƒagtccttttcā€ƒttcatgtggc
31981ā€ƒagttggtggaā€ƒgagaagaaaaā€ƒactgttctaaā€ƒacaatgatgaā€ƒgaataacatgā€ƒtaattgtgat
32041ā€ƒagttaaactgā€ƒtgcctatgtgā€ƒactgattgcaā€ƒgagtgaattgā€ƒggagctgttgā€ƒgttttgaatg
32101ā€ƒcaccacactaā€ƒaggaatgtgaā€ƒggacacattgā€ƒctctttgcggā€ƒagttgcccagā€ƒctatattagc
32161ā€ƒtcccctcggaā€ƒcacagcccagā€ƒttttctgtatā€ƒtcgcgtggatā€ƒgctgtccgcgā€ƒcgattcccag
32221ā€ƒcactcctcttā€ƒacagcatctcā€ƒacctcagtgtā€ƒatgttccttgā€ƒcctccagtgcā€ƒagttgaacct
32281ā€ƒcagtcctgccā€ƒtctcctcatgā€ƒtgtgcattcaā€ƒcctttcttggā€ƒtgctctctccā€ƒccatgggcca
32341ā€ƒagttctaccaā€ƒtgagttatgaā€ƒaacattatggā€ƒagaaaacatgā€ƒtctttggaaaā€ƒtgtgagccag
32401ā€ƒaaagcccaccā€ƒagtgcccctcā€ƒagtcacggttā€ƒgttatgaatgā€ƒacatgctaatā€ƒggtttcactc
32461ā€ƒtcgtcaaaccā€ƒtgccttttctā€ƒttcctcttcaā€ƒgccaacagacā€ƒctcaggaaagā€ƒaggggatgaa
32521ā€ƒcttgcagactā€ƒctgcgcttgaā€ƒgatcttcaaaā€ƒcaagcatcagā€ƒcgttttccagā€ƒggtaagatgc
32581ā€ƒctgctaggttā€ƒtgcgcctagcā€ƒctgagcagccā€ƒtcaggtcctcā€ƒtgtttgggccā€ƒatagaggagc
32641ā€ƒctctccagccā€ƒcctgtcttccā€ƒttggctgctcā€ƒcccagggctcā€ƒtcttaaaactā€ƒtctccccact
32701ā€ƒcccactgaggā€ƒcatcctcagcā€ƒcccagcctgtā€ƒgtcaaattcaā€ƒgagtaaagaaā€ƒccaaggcaac
32761ā€ƒtccctggcttā€ƒtcatgggccaā€ƒaagcgcaggcā€ƒtttcacaccgā€ƒaggcctctgaā€ƒgcctcagatc
32821ā€ƒatggggaagtā€ƒcactgctggaā€ƒgagaacagacā€ƒatagctctggā€ƒaagccatctgā€ƒcccaagaggg
32881ā€ƒcagcccatccā€ƒcaagttcatcā€ƒttacagtggcā€ƒcaggcctgccā€ƒctgagccgggā€ƒgcctctgggt
32941ā€ƒcactcttctgā€ƒctgtccatggā€ƒcattgcccatā€ƒcctgggtgagā€ƒgctggggctcā€ƒtcctgggcac
33001ā€ƒtgtatgtattā€ƒctggatacagā€ƒggatactgggā€ƒctcgctatgtā€ƒgtgtggagccā€ƒatcccttcct
33061ā€ƒtgccccagccā€ƒccacctccctā€ƒctcaaaccctā€ƒctctggctctā€ƒttctgagcttā€ƒcctttcctgc
33121ā€ƒtccccagcttā€ƒgcccagtgctā€ƒcagtgccccaā€ƒcttggctcttā€ƒttgctacttcā€ƒgggtcaggtg
33181ā€ƒgagcctcttgā€ƒggaatgtgaaā€ƒgtgccttacaā€ƒgaaagattgcā€ƒacttcaagagā€ƒgagaggctgc
33241ā€ƒagggagccatā€ƒcctaaacccaā€ƒgaggcctggaā€ƒgcttactgtgā€ƒtcactttactā€ƒtttgtacaca
33301ā€ƒggggtctcctā€ƒtagtgccctcā€ƒgagaaggattā€ƒcttggccctgā€ƒagcttctactā€ƒcctgaggcca
33361ā€ƒcctctgtgcaā€ƒgccccagctcā€ƒcctcaactctā€ƒaggctgtagtā€ƒctcagtgggaā€ƒaagcctggct
33421ā€ƒtgggggtctcā€ƒctaggaatgtā€ƒccacctgaagā€ƒgcacacttgaā€ƒtaggggcttgā€ƒcacaacttat
33481ā€ƒgtctgccaagā€ƒgccacctgagā€ƒgaactccctgā€ƒgtgcctataaā€ƒgttccaccttā€ƒccccttcctc
33541ā€ƒttcctcgcccā€ƒcagcatttttā€ƒtctgagtaggā€ƒggtggcaatgā€ƒggcaaagccaā€ƒttgtcataag
33601ā€ƒcagttgcaggā€ƒtataactttcā€ƒactagaaaacā€ƒctgacaccttā€ƒgtgttttcttā€ƒtcaggcttcc
33661ā€ƒcagaggtctgā€ƒtgcgactaggā€ƒtgagtctggtā€ƒctgggtttgaā€ƒagtcattgcaā€ƒgacctgttta
33721ā€ƒggccttacccā€ƒccaagcaagcā€ƒccaagcctgcā€ƒcatctgctgtā€ƒatatagataaā€ƒgaacatcatg
33781ā€ƒgtgcagtaaaā€ƒagaagcctggā€ƒcctttggagtā€ƒcagaacagcaā€ƒgggtgacttgā€ƒgggtcagacc
33841ā€ƒcagagcacccā€ƒcatttccttcā€ƒtctgtaagatā€ƒgaggataataā€ƒagagtaacaaā€ƒccttttaggg
33901ā€ƒttaaggtgagā€ƒttttcagcttā€ƒaggaagtctgā€ƒggaatattgcā€ƒaaagggcttgā€ƒgcaggaaccc
33961ā€ƒatggtgaggaā€ƒtctagttccaā€ƒagttgataggā€ƒtacagaaaacā€ƒcagaacatcgā€ƒggccttgagt
34021ā€ƒaaagagtgaaā€ƒgtttcacaaaā€ƒccacaaagcaā€ƒcctgctatgtā€ƒgcaggagagcā€ƒatggcagaag
34081ā€ƒgaggctgcttā€ƒggccctggtcā€ƒcttgagattcā€ƒtgacagtgtcā€ƒctagacagacā€ƒatggggagat
34141ā€ƒctgcacctatā€ƒttgacgttacā€ƒcaacttctctā€ƒttttcagcccā€ƒctgtctatcaā€ƒaaagttatta
34201ā€ƒgagaggatgaā€ƒagcattagctā€ƒtgaagcactaā€ƒcaggaggaatā€ƒgcaccacggcā€ƒagctctccgc
34261ā€ƒcaatttctctā€ƒcagatttccaā€ƒcagagactgtā€ƒttgaatgtttā€ƒtcaaaaccaaā€ƒgtatcacact
34321ā€ƒttaatgtacaā€ƒtgggccgcacā€ƒcataatgagaā€ƒtgtgagccttā€ƒgtgcatgtggā€ƒgggaggaggg
34381ā€ƒagagagatgtā€ƒactttttaaaā€ƒtcatgttcccā€ƒcctaaacatgā€ƒgctgttaaccā€ƒcactgcatgc
34441ā€ƒagaaacttggā€ƒatgtcactgcā€ƒctgacattcaā€ƒcttccagagaā€ƒggacctatccā€ƒcaaatgtgga
34501ā€ƒattgactgccā€ƒtatgccaagtā€ƒccctggaaaaā€ƒggagcttcagā€ƒtattgtggggā€ƒctcataaaac
34801ā€ƒaagaaacataā€ƒcaatccagccā€ƒtcatgggaagā€ƒtcctggcacaā€ƒgtttttgtaaā€ƒagcccttgca
34561ā€ƒatgaatcaagā€ƒaatggcatcaā€ƒttataagctaā€ƒtgagttgaaaā€ƒtgttctgtcaā€ƒaatgtgtctc
34621ā€ƒcagctggagaā€ƒgtggcttggaā€ƒggcttttatgā€ƒgggccctgtcā€ƒcaggtagaaaā€ƒagaaatggta
34681ā€ƒacatctacacā€ƒagatttccctā€ƒattgtgacagā€ƒagccatggtgā€ƒtgtttgtaatā€ƒaataaaacca
34741ā€ƒtgtagagctt
TGFβIā€ƒgeneā€ƒproteinā€ƒproductā€ƒ(βIG-H3ā€ƒproteinā€ƒsequence;
NCBIā€ƒReferenceā€ƒnumberā€ƒNGā€ƒ012646.1):
MALFVRLLALALALALGPAATLAGPAKSPYQLVLQHSRLRGRQH
GPNVCAVQKVIGTNRKYFTNCKQWYQRKICGKSTVISYECCPGYEKVPGEKGCPAALP
LSNLYETLGVVGSTTTQLYTDRTEKLRPEMEGPGSFTIFAPSNEAWASLPAEVLDSLV
SNVNIELLNALRYHMVGRRVLTDELKHGMTLTSMYQNSNIQIHHYPNGIVTVNCARLL
KADHHATNGVVHLIDKVISTITNNIQQIIEIEDTFETLRAAVAASGLNTMLEGNGQYT
LLAPTNEAFEKIPSETLNRILGDPEALRDLLNNHILKSAMCAEAIVAGLSVETLEGTT
LEVGCSGDMLTINGKAIISNKDILATNGVIHYIDELLIPDSAKTLFELAAESDVSTAI
DLFRQAGLGNHLSGSERLTLLAPLNSVFKDGTPPIDAHTRNLLRNHIIKDQLASKYLY
HGQTLETLGGKKLRVFVYRNSLCIENSCIAAHDKRGRYGTLFTMDRVLTPPMGTVMDV
LKGDNRFSMLVAAIQSAGLTETLNREGVYTVFAPTNEAFRALPPRERSRLLGDAKELA
NILKYHIGDEILVSGGIGALVRLKSLQGDKLEVSLKNNVVSVNKEPVAEPDIMATNGV
VHVITNVLQPPANRPQERGDELADSALEIFKQASAFSRASQRSVRLAPVYQKLLERMK
H

Claims

1.-19. (canceled)

20. A reaction mixture for detecting corneal dystrophy in a human subject, the reaction mixture comprising:

(A) at least a first amplification primer pair for amplifying and determining a first TGFβI gene sequence from a biological sample from the subject; and

(B) a first set of at least three detection probes including a first detection probe comprising the sequence of SEQ ID NO:45 or 47, a second detection probe comprising the sequence of SEQ ID NO:46 and a third detection probe comprising the sequence of SEQ ID NO:50.

21. The reaction mixture according to claim 20, further comprising a second set of detection probes including a fourth detection probe comprising the sequence of SEQ ID NO:25 and one or two detection probes selected from a group consisting of a fifth detection probe comprising the sequence of SEQ ID NO:26, a sixth detection probe comprising the sequence of SEQ ID NO:48 and a seventh detection probe comprising the sequence of SEQ ID NO:49, and at least a second amplification primer pair for amplifying and determining a second TGFβI gene sequence from the biological sample from the subject.

22. The reaction mixture according to claim 20, wherein the first amplification primer pair comprises a first amplification primer and a second amplification primer, the first amplification primer comprises nucleotide sequence SEQ ID NO:43, and the second amplification primer comprises nucleotide sequence SEQ ID NO:44.

23. The reaction mixture according to claim 20, wherein the first TGFβI gene sequence comprises nucleotides encoding amino acid residue 555 from the biological sample from the subject.

24. The reaction mixture according to claim 21, wherein the first TGFβI gene sequence comprises nucleotides encoding amino acid residue 555 from the biological sample from the subject and the second TGFβI gene sequence comprises nucleotides encoding amino acid residue 124 from the biological sample from the subject.

25. The reaction mixture according to claim 24, wherein the first amplification primer pair comprises a first amplification primer and a second amplification primer, the first amplification primer comprises nucleotide sequence SEQ ID NO:43, and the second amplification primer comprises nucleotide sequence SEQ ID NO:44, and the second amplification primer pair comprises a third amplification primer and a fourth amplification primer, the third amplification primer comprises a nucleotide sequence SEQ ID NO:1, and the fourth amplification primer comprises a nucleotide sequence SEQ ID NO:2.

26. A method for detecting whether or not a human subject carries a mutation that causes corneal dystrophy comprising:

(A) amplifying a first TGFβI gene sequence from a biological sample from the subject using a reaction mixture comprising at least a first amplification primer pair for amplifying a TGFβI gene sequence and a set of at least three detection probes including a first detection probe comprising the sequence of SEQ ID NO:45 or 47, a second detection probe comprising the sequence of SEQ ID NO:46 and a third detection probe comprising the sequence of SEQ ID NO:50;

(B) hybridizing one detection probe of the set of at least three detection probes to the first TGFβI gene sequence; and

(C) detecting whether or not a mutation in the first TGFβI gene sequence based on (i) the hybridization of the one detection probe of the set of at least three detection probes that has hybridized in step (B) to the first TGFβI gene sequence and (ii) the failure of the other two detection probes of the set of at least three detection probes to hybridize to the first TGFβI gene sequence.

27. The method according to claim 26, wherein the reaction mixture comprises:

(A) at least a first amplification primer pair for amplifying and determining a first TGFβI gene sequence from a biological sample from the subject; and

(B) a first set of at least three detection probes including a first detection probe comprising the sequence of SEQ ID NO:45 or 47, a second detection probe comprising the sequence of SEQ ID NO:46 and a third detection probe comprising the sequence of SEQ ID NO:5

28. A method for detecting whether or not a human subject carries a genomic mutation associated with corneal dystrophy in a sample from the subject, the method comprising:

(A) using epithelial cells of the subject adhered to a tip of a substrate;

(B) agitating the tip of the substrate in a lysis solution that lyses cells adhered to the substrate;

(C) removing the substrate from the lysis solution upon completion of the agitating (B);

(D) incubating the lysis solution after the removing (C);

(E) isolating genomic DNA from the lysis solution to form a gDNA solution; and

(F) determining an identity of at least a nucleotide present in the TGFβI gene using at least a first primer pair for amplifying a TGFβI gene sequence, a first set of at least three detection probes including a first detection probe comprising the sequence of SEQ ID NO:45 or 47, a second detection probe comprising the sequence of SEQ ID NO:46 and a third detection probe comprising the sequence of SEQ ID NO:50, and the gDNA solution by concurrently exposing the gDNA solution to the first set of at least three detection probes, wherein:

the at least a nucleotide is located at a particular position of the TGFβI gene corresponding to a single nucleotide polymorphism (SNP) associated with corneal dystrophy.

29. The method according to claim 28, further comprising:

(G) determining an identity of at least a second nucleotide present in the TGFβI gene using at least a second primer pair, a second set of detection probes including a fourth detection probe comprising the sequence of SEQ ID NO:25 and one or two detection probes selected from a group consisting of a fifth detection probe comprising the sequence of SEQ ID NO:26, a sixth detection probe comprising the sequence of SEQ ID NO:48 and a seventh detection probe consisting of the sequence of SEQ ID NO:49, and the gDNA solution by concurrently exposing the gDNA solution to the second set of detection probes, wherein:

the at least second nucleotide is located at a second particular position, independent of the position of the at least a nucleotide, of the TGFβI gene corresponding to a second single nucleotide polymorphism (SNP) associated with corneal dystrophy.

Resources

Images & Drawings included:

Sources:

Similar patent applications:

Recent applications in this class:

Recent applications for this Assignee: