US20230407322A1
2023-12-21
18/092,420
2023-01-02
Provided herein include methods and compositions for making targeted changes to a DNA sequence. In various aspects and embodiments, methods and compositions for modifying a DNA sequence in a cell (such as a plant, bacterial, yeast, fungal, algal, or mammalian cell) are provided. In some aspects and embodiments the modification of DNA involves combining gene repair oligonucleotides with approaches that enhance the availability of components of the target cell gene repair mechanisms, such as a DNA cutter.
Get notified when new applications in this technology area are published.
C12N15/8213 » CPC main
Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor; Recombinant DNA-technology; Introduction of foreign genetic material using vectors; Vectors; Use of hosts therefor; Regulation of expression; Vectors or expression systems specially adapted for eukaryotic hosts for plant cells, e.g. plant artificial chromosomes (PACs); Methods for introducing genetic material into plant cells, e.g. DNA, RNA, stable or transient incorporation, tissue culture methods adapted for transformation Targeted insertion of genes into the plant genome by homologous recombination
C12N2310/20 » CPC further
Structure or type of the nucleic acid; Type of nucleic acid involving clustered regularly interspaced short palindromic repeats [CRISPRs]
C12N2310/321 » CPC further
Structure or type of the nucleic acid; Chemical structure of the sugar 2'-O-R Modification
C12N15/82 IPC
Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor; Recombinant DNA-technology; Introduction of foreign genetic material using vectors; Vectors; Use of hosts therefor; Regulation of expression; Vectors or expression systems specially adapted for eukaryotic hosts for plant cells, e.g. plant artificial chromosomes (PACs)
C12N5/04 » CPC further
Undifferentiated human, animal or plant cells, e.g. cell lines; Tissues; Cultivation or maintenance thereof; Culture media therefor Plant cells or tissues
The present invention is a continuatiuon of U.S. patent application Ser. No. 16/077,028, filed Aug. 9, 2018, which issued as U.S. Pat. No. 11,542,515 on Jan. 3, 2023, which is the U.S. national phase of International Patent Application No. PCT/US2016/052346, filed Sep. 16, 2016, which designated the United States and claims benefit of U.S. Provisional Application No. 62/293,278, filed Feb. 9, 2016, each of which is hereby incorporated by reference in its entirety including all tables, figures, and claims and from which priority is claimed.
The application contains a Sequence Listing which has been submitted electronically in .XML format and is hereby incorporated by reference in its entirety. Said .XML copy, created on Sep. 6, 2023, is named âCIBUS-029-PCT2CT1_SeqListing.xmlâ and is 672 kilobytes in size. The sequence listing contained in this .XML file is part of the specification and is hereby incorporated by reference herein in its entirety.
The instant disclosure relates at least in part to targeted genetic mutations and modifications, including methods and compositions for making such mutations and modifications.
The following discussion is merely provided to aid the reader in understanding and is not admitted to describe or constitute prior art to the present disclosure.
U.S. Pat. No. 6,271,360 discloses methods and compositions for the introduction of predetermined genetic changes in target genes of a living cell by introducing an oligodeoxynucleotide encoding the predetermined change. The oligodeoxynucleotides are effective in mammalian, avian, plant and bacterial cells.
U.S. Pat. No. 8,771,945 discloses vectors and vector systems, some of which encode one or more components of a CRISPR complex, as well as methods for the design and use of such vectors.
U.S. Pat. No. 8,470,973 ârefers to methods for selectively recognizing a base pair in a DNA sequence by a polypeptide, to modified polypeptides which specifically recognize one or more base pairs in a DNA sequence and, to DNA which is modified so that it can be specifically recognized by a polypeptide and to uses of the polypeptide and DNA in specific DNA targeting as well as to methods of modulating expression of target genes in a cell.â
Provided herein include methods and compositions for effecting a targeted genetic change in DNA in a cell. Certain aspects and embodiments relate to improving the efficiency of the targeting of modifications to specific locations in genomic or other nucleotide sequences. As described herein, nucleic acids which direct specific changes to the genome may be combined with various approaches to enhance the availability of components of the natural repair systems present in the cells being targeted for modification.
In a first aspect, provided are methods for introducing a gene repair oligonucleobase (GRON)-mediated mutation into a target deoxyribonucleic acid (DNA) sequence in a plant cell. In certain embodiments the methods may include, inter alia, culturing the plant cell under conditions that increase one or more cellular DNA repair processes prior to, and/or coincident with, delivery of a GRON into the plant cell; and/or delivery of a GRON into the plant cell greater than 15 bases in length, the GRON optionally comprising one or more; or two or more; mutation sites for introduction into the target DNA.
A âgene repair oligonucleotideâ or âGRONâ as used herein means an oligonucleobase (e.g., mixed duplex oligonucleoides, non-nucleotide containing molecules, single stranded oligodeoxynucleotides, double stranded oligodeoxynucleotides and other gene repair molecules) that can under certain conditions direct single, or in some embodiments multiple, nucleotide deletions, insertions or substitutions in a DNA sequence. This oligonucleotide-mediated gene repair editing of the genome may comprise both non-homology based repair systems (e.g., non-homologous end joining) and homology-based repair systems (e.g., homology-directed repair). The GRON is typically designed to align in register with a genomic target except for the designed mismatch(es). These mismatches can be recognized and corrected by harnessing one or more of the cell's endogenous DNA repair systems. In some embodiments a GRON or oligonucleotide can be designed to contain multiple differences when compared to the organisms target sequence. These differences may not all affect the protein sequence translated from said target sequence and in one or more cases be known as silent changes. Numerous variations of GRON structure, chemistry and function are described elsewhere herein. In various embodiments, a GRON as used herein may have one or more modifications. For example, a GRON as used herein may have one or more modifications that attract DNA repair machinery to the targeted (mismatch) site and/or that prevent recombination of part or all of the GRON (other than the desired targeted deletion(s), insertion(s), substitution(s) or the like) into the genomic DNA of the target DNA sequence and/or that increase the stability of the GRON.
In various embodiments, a GRON may have both RNA and DNA nucleotides and/or other types of nucleobases. In some embodiments, one or more of the DNA or RNA nucleotides comprise a modification.
In one aspect, provided is a method of causing a genetic change in a plant cell, wherein the method involves exposing the cell to a DNA cutter and a GRON, for example a GRON that is modified as contemplated herein. In some embodiments the GRON may be modified such as with a Cy3 group, 3PS group, a 2â˛O-methyl group or other modification such as contemplated herein. In another aspect, provided is a plant cell that includes a DNA cutter and a GRON, for example where the GRON is modified such as with a Cy3 group, 3PS group, a 2â˛O-methyl group or other modification. In some embodiments, the DNA cutter is one or more selected from a CRISPR, a TALEN, a zinc finger, meganuclease, and a DNA-cutting antibiotic. In some embodiments, the DNA cutter is a CRISPR. In some embodiments, the DNA cutter is a TALEN. In some embodiments, the GRON is between 15 and 60 nucleobases in length; or between 30 and 40 nucleobases in length; or between 35 and 45 nucleobases in length; or between 20 and 70 nucleobases in length; or between 20 and 200 nucleobases in length; or between 30 and 180 nucleobases in length; or between 50 and 160 nucleobases in length; or between 70 and 150 nucleobases in length; or between 70 and 210 nuceleobases in length; or between 80 and 120 nucleobases in length; or between 90 and 110 nucleobases in length; or between 95 and 105 nucleobases in length; or between 80 and 300 nucleobases in length; or between 90 and 250 nucleobases in length; or between 100 and 150 nucleobases in length; or between 100 and 200 nucleobases in length; or between 100 and 210 nucleobases in length; or between 100 and 300 nucleobases in length; or between 150 and 200 nucleobases in length; or between 200 and 300 nucleobases in length; or between 250 and 350 nucleobases in length; or between 50 and 110 nucleobases in length; or between 50 and 200 nucleobases in length; or between 150 and 210 nucleobases in length; or between 20 and 1000 nucleobases in length; or between 100 and 1000 nucleobases in length; or between 200 and 1000 nucleobases in length; or between 300 and 1000 nucleobases in length; or between 400 and 1000 nucleobases in length; or between 500 and 1000 nucleobases in length; or between 600 and 1000 nucleobases in length; or between 700 and 1000 nucleobases in length; or between 800 and 1000 nucleobases in length; or between 900 and 1000 nucleobases in length; or between 300 and 800 nucleobases in length; or between 400 and 600 nucleobases in length; or between 500 and 700 nucleobases in length; or between 600 and 800 nucleobases in length; or longer than 30 nucleobases in length; or longer than 35 nucleobases in length; or longer than 40 nucleobases in length; or longer than 50 nucleobases in length; or longer than 60 nucleobases in length; or longer than 65 nucleobases in length; or longer than 70 nucleobases in length; or longer than 75 nucleobases in length; or longer than 80 nucleobases in length; or longer than 85 nucleobases in length; or longer than 90 nucleobases in length; or longer than 95 nucleobases in length; or longer than 100 nucleobases in length; or longer than 110 nucleobases in length; or longer than 125 nucleobases in length; or longer than 150 nucleobases in length; or longer than 165 nucleobases in length; or longer than 175 nucleobases in length; or longer than 200 nucleobases in length; or longer than 250 nucleobases in length; or longer than 300 nucleobases in length; or longer than 350 nucleobases in length; or longer than 400 nucleobases in length; or longer than 450 nucleobases in length; or longer than 500 nucleobases in length; or longer than 550 nucleobases in length; or longer than 600 nucleobases in length; or longer than 700 nucleobases in length; or longer than 800 nucleobases in length; or longer than 900 nucleobases in length.
GRONs may be targeted at both non-coding (NC) and coding (C) regions of a target gene. By way of example, FIGS. 27 and 28 respectively depict C-GRONs and NC-GRONs suitable for introducing mutations into the rice genome in order to introduce one or more of the following amino acid substitions to the ACCase gene. The convention is to use the amino acid numbering system for the plastidal ACCase from blackgrass (Alopecurus myosuroides; Am) as the reference. The ACCase numbering used herein is based on the numbering for the blackgrass reference sequence ACCase protein (SEQ ID NO: 1) or at an analogous amino acid residue in an ACCase paralog (V=CY3; H=3â˛DMT dC CPG). The following table lists ACCase mutations that produce one or more of alloxydim, butroxydim, clethodim, cloproxydim, cycloxydim, sethoxydim, tepraloxydim, tralkoxydim, chlorazifop, clodinafop, clofop, diclofop, fenoxaprop, fenoxaprop-P, fenthiaprop, fluazifop, fluazifop-P, haloxyfop, haloxyfop-P, isoxapyrifop, propaquizafop, quizalofop, quizalofop-P, trifop, pinoxaden, agronomically acceptable salts and esters of any of these herbicides, and combinations thereof resistant phenotype.
| Amino | Amino | |||
| Acid | Codon | Acid | Change | |
| Change | Change | Change | Codon | |
| I1781A | ATA > GCT | C2088F | TGC > TTT | |
| ATA > GCC | TGC > TTC | |||
| ATA > GCA | C2088G | TGC > GGT | ||
| ATA > GCG | TGC > GGC | |||
| I1781L | ATA > CTT | TGC > GGA | ||
| ATA > CTC | TGC > GGG | |||
| ATA > CTA | C2088H | TGC > CAT | ||
| ATA > CTG | TGC > CAC | |||
| ATA > TTA | C2088K | TGC > AAA | ||
| ATA > TTG | TGC > AAG | |||
| I1781M | ATA > ATG | C2088L | TGC > CTT | |
| I1781N | ATA > AAT | TGC > CTC | ||
| ATA > AAC | TGC > CTA | |||
| I1781S | ATA > TCT | TGC > CTG | ||
| ATA > TCC | TGC > TTA | |||
| ATA > TCA | TGC > TTG | |||
| ATA > TCG | C2088N | TGC > AAT | ||
| I1781T | ATA > ACT | TGC > AAC | ||
| ATA > ACC | C2088P | TGC > CCT | ||
| ATA > ACA | TGC > CCC | |||
| ATA > ACG | TGC > CCA | |||
| I1781V | ATA > GTT | TGC > CCG | ||
| ATA > GTC | C2088Q | TGC > CAA | ||
| ATA > GTA | TGC > CAG | |||
| ATA > GTG | C2088R | TGC > CGT | ||
| G1783C | GGA > TGT | TGC > CGC | ||
| GGA > TGC | TGC > CGA | |||
| A1786P | GCT > CCT | TGC > CGG | ||
| GCT > CCC | TGC > AGA | |||
| GCT > CCA | TGC > AGG | |||
| GCT > CCG | C2088S | TGC > TCT | ||
| D2078G | GAT > GGT | TGC > TCC | ||
| GAT > GGC | TGC > TCA | |||
| GAT > GGA | TGC > TCG | |||
| GAT > GGG | C2088T | TGC > ACT | ||
| D2078K | GAT > AAA | TGC > ACC | ||
| GAT > AAG | TGC > ACA | |||
| D2078T | GAT > ACT | TGC > ACG | ||
| GAT > ACC | C2088V | TGC > GTT | ||
| GAT > ACA | TGC > GTC | |||
| GAT > ACG | TGC > GTA | |||
| S2079F | AGC > TTT | TGC > GTG | ||
| AGC > TTC | C2088W | TGC > TGG | ||
| K2080E | AAG > GAA | |||
| AAG > GAG | ||||
Similarly, FIGS. 29 and 30 respectively depict (coding) C-GRONs and (non-coding) NC-GRONs suitable for introducing mutations into the flax genome in order to introduce one or more of the following amino acid substitions to the EPSPS gene (with all numbering relative to the amino acid sequence of the E. coli AroA protein (prokaryotic EPSPS equivalent) (such as those described in U.S. Pat. No. 8,268,622). (V=CY3; H=3â˛DMT dC CPG). The following table lists EPSPS mutations that produce glyphosate agronomically acceptable salts and esters of any of these herbicides, and combinations thereof resistant phenotype.
| Amino | ||
| Acid | Codon | |
| Change | Change | |
| G96A | GGA > GCT | |
| GGA > GCC | ||
| GGA > GCA | ||
| GGA > GCG | ||
| T971 | ACA > ATT | |
| ACA > ATC | ||
| ACA > ATA | ||
| P101A | CCG > GCT | |
| CCG > GCC | ||
| CCG > GCA | ||
| CCG > GCG | ||
| P101S | CCG > TCT | |
| CCG > TCC | ||
| CCG > TCA | ||
| CCG > TCG | ||
| P101T | CCG > ACT | |
| CCG > ACC | ||
| CCG > ACA | ||
| CCG > ACG | ||
The term âCRISPRâ as used herein refers to elements; i.e., a cas (CRISPR associated) gene, transcript (e.g., mRNA) or protein and at least one CRISPR spacer sequence (Clustered Regularly Interspaced Short Palindromic Repeats, also known as SPIDRsâSPacer Interspersed Direct Repeats); that when effectively present or expressed in a cell could effect cleavage of a target DNA sequence via CRISPR/CAS cellular machinery such as described in e.g., Cong, L. et al., Science, vol. 339 no 6121 pp. 819-823 (2013); Jinek et al, Science, vol. 337:816-821 (2013); Wang et al., RNA, vol. 14, pp. 903-913 (2008); Zhang et al., Plant Physiology, vol. 161, pp. 20-27 (2013), Zhang et al, PCT Application No. PCT/US2013/074743; and Charpentier et al., PCT Application No. PCT/US2013/032589. In some embodiments, such as for example a CRISPR for use in a eukaryotic cell, a CRISPR as contemplated herein may also include an additional element that includes a sequence for one or more functional nuclear localization signals. CRISPRs as contemplated herein can be expressed in, administered to and/or present in a cell (such as a plant cell) in any of many ways or manifestations. For example a CRISPR as contemplated herein may include or involve one or more of a CRISPR on a plasmid, a CRISPR nickase on a plasmid, a CRISPRa on a plasmid, or a CRISPRi on a plasmid as follows:
CRISPR on a plasmid: A recombinant expression vector comprising:
CRISPR nickase on a plasmid. A recombinant expression vector comprising:
CRISPRa on a plasmid. A recombinant expression vector comprising:
CRISPRi on a plasmid. A recombinant expression vector comprising:
Each of the CRISPR on a plasmid, CRISPR nickase on a plasmid, CRISPRa on a plasmid, and CRISPRi on a plasmid may in some embodiments alternatively have one or more appropriate elements be administered, expressed or present in a cell as an RNA (e.g., mRNA) or a protein rather than on a plasmid. Delivery of protected mRNA may be as described in Kariko, et al, U.S. Pat. No. 8,278,036.
In some embodiments, each of the CRISPRi and CRISPRa may include a deactivated cas9 (dCas9). A deactivated cas9 still binds to target DNA, but does not have cutting activity. Nuclease-deficient Cas9 can result from D10A and H840A point mutations which inactivates its two catalytic domains.
In some embodiments, a CRISPRi inhibits transcription initiation or elongation via steric hindrance of RNA Polymerase II. CRISPRi can optionally be enhanced (CRISPRei) by fusion of a strong repressor domain to the C-terminal end of a dCas9 protein. In some embodiments, a repressor domain recruits and employs chromatin modifiers. In some embodiments, the repressor domain may include, but is not limited to domains as described in Kagale, S. et al., Epigenetics, vol. 6 no 2 pp141-146 (2011):
| 1.âLDLNRPPPVENâ(SEQâIDâNO:â3)â-âOsERF3ârepressor |
| domainâ(LxLxPPâmotif)(SEQâIDâNO:â278) |
| 2.âLRLFGVNMâ(SEQâIDâNO:â4)â-âAtBRDârepressor |
| domainâ(R/KLFGVâmotif)(SEQâIDâNO:â279) |
| 3.âLKLFGVWLâ(SEQâIDâNO:â5)â-âAtHsfB1ârepressor |
| domainâ(R/KLFGVâmotif)(SEQâIDâNO:â279) |
| 4.âLDLELRLGFAâ(SEQâIDâNO:â6)â-âAtSUPârepressor |
| domainâ(EARâmotif) |
| 5.âERSNSIELRNSFYGRARTSPWSYGDYDNCQQDHDYLLGFSWPPRSYT |
| CSFCKREFRSAQALGGHMNVHRRDRARLRLQQSPSSSSTPSPPYPNPNYS |
| YSTMANSPPPHHSPLTLFPTLSPPSSPRYRAGLIRSLSPKSKHTPENACK |
| TKKSSLLVEAGEATRFTSKDACKILRNDEIISLELEIGLINESEQDLDLE |
| LRLGFAâ(SEQâIDâNO:â7)*-âfullâAtSUPâgeneâcontaining |
| repressorâdomainâ(EARâmotif) |
In some embodiments, a CRISPRa activation of transcription achieved by use of dCas9 protein containing a fused C-terminal end transcriptional activator. In some embodiments, an activation may include, but is not limited to VP64 (4ĂVP16), AtERF98 activation domain, or AtERF98Ă4 concatemers such as described in Cheng, A W et al., Cell Research, pp1-9 (2013); Perez-Pinera, P. et al., Nature Methods, vol. 10 pp 913-976 (2013); Maeder, M L. et al., Nature Methods, vol. 10 pp 977-979 (2013) and Mali, P., et al., Nature Biotech., vol. 31 pp 833-838 (2013).
In some embodiments the CRISPR includes a nickase. In certain embodiments, two or more CRISPR nickases are used. In some embodiments, the two or more nickases cut on opposite strands of target nucleic acid. In other embodiments, the two or more nickases cut on the same strand of target nucleic acid.
As used herein, ârepressor proteinâ or ârepressorâ refers to a protein that binds to operator of DNA or to RNA to prevent transcription or translation, respectively.
As used herein, ârepressionâ refers to inhibition of transcription or translation by binding of repressor protein to specific site on DNA or mRNA. In some embodiments, repression includes a significant change in transcription or translation level of at least 1.5 fold, in other embodiments at least two fold, and in other embodiments at least five fold.
As used herein, an âactivator proteinâ or âactivatorâ with regard to gene transcription and/or translation, refers to a protein that binds to operator of DNA or to RNA to enhance or increase transcription or translation, respectively.
As used herein with regard to gene transcription and/or translation, âactivationâ with regard to gene transcription and/or translation, refers to enhancing or increasing transcription or translation by binding of activator protein to specific site on DNA or mRNA. In some embodiments, activation includes a significant change in transcription or translation level of at least 1.5 fold, in some embodiments at least two fold, and in some embodiments at least five fold.
In certain embodiments, conditions that increase one or more cellular DNA repair processes may include one or more of: introduction of one or more sites into the GRON or into the plant cell DNA that are targets for base excision repair, introduction of one or more sites into the GRON or into the plant cell DNA that are targets for non-homologous end joining, introduction of one or more sites into the GRON or into the plant cell DNA that are targets for microhomology-mediated end joining, introduction of one or more sites into the GRON or into the plant cell DNA that are targets for homologous recombination, and introduction of one or more sites into the GRON or into the plant cell DNA that are targets for effecting repair (e.g., base-excision repair (BER); homologous recombination repair (HR); mismatch repair (MMR); non-homologous end-joining repair (NHEJ) which include classical and alternative NHEJ; and nucleotide excision repair (NER)).
As described herein, GRONs for use herein may include one or more of the following alterations from conventional RNA and DNA nucleotides:
The term âwobble baseâ as used herein refers to a change in a one or more nucleotide bases of a reference nucleotide sequence wherein the change does not change the sequence of the amino acid coded by the nucleotide relative to the reference sequence.
The term ânon-nucleotideâ or âabasic nucleotideâ as use herein refers to any group or compound which can be incorporated into a nucleic acid chain in the place of one or more nucleotide units, including either sugar and/or phosphate substitutions, and allows the remaining bases to exhibit their enzymatic activity. The group or compound is abasic in that it does not contain a commonly recognized nucleotide base, such as adenosine, guanine, cytosine, uracil or thymine. It may have substitutions for a 2Ⲡor 3ⲠH or OH as described in the art and herein.
As described herein, in certain embodiments GRON quality and conversion efficiency may be improved by synthesizing all or a portion of the GRON using nucleotide multimers, such as dimers, trimers, tetramers, etc. improving its purity.
In certain embodiments, the target deoxyribonucleic acid (DNA) sequence is within a plant cell, for example the target DNA sequence is in the plant cell genome. The plant cell may be non-transgenic or transgenic, and the target DNA sequence may be a transgene or an endogenous gene of the plant cell.
In certain embodiments, the conditions that increase one or more cellular DNA repair processes comprise introducing one or more compounds which induce single or double DNA strand breaks into the plant cell prior to, or coincident to, or after delivering the GRON into the plant cell. Exemplary compounds are described herein.
The methods and compositions described herein are applicable to plants generally. By way of example only, a plant species may be selected from the group consisting of canola, sunflower, corn, tobacco, sugar beet, cotton, maize, wheat (including but not limited to Triticum spp., Triticum aestivum, Triticum durum Triticum timopheevii, Triticum monococcum, Triticum spelta, Triticum zhukovskyi and Triticum urartu and hybrids thereof), barley (including but not limited to Hordeum vulgare L., Hordeum comosum, Hordeum depressum, Hordeum intercedens, Hordeum jubatum, Hordeum marinum, Hordeum marinum, Hordeum parodii, Hordeum pusillum, Hordeum secalinum, and Hordeum spontaneum), rice (including but not limited to Oryza sativa subsp. indica, Oryza sativa subsp. japonica, Oryza sativa subsp. javanica, Oryza sativa subsp. glutinosa (glutinous rice), Oryza sativa Aromatica group (e.g., basmati), and Oryza sativa (floating rice group)), alfalfa, barley, sorghum, tomato, mango, peach, apple, pear, strawberry, banana, melon, cassava, potato, carrot, lettuce, onion, soy bean, soya spp, sugar cane, pea, chickpea, field pea, fava bean, lentils, turnip, rutabaga, brussel sprouts, lupin, cauliflower, kale, field beans, poplar, pine, eucalyptus, grape, citrus, triticale, alfalfa, rye (including but not limited to Secale sylvestre, Secale strictum, Secale cereale, Secale vavilovii, Secale africanum, Secale ciliatoglume, Secale ancestrale, and Secale montanum), oats, turf (including but not limited to Turf grass include Zoysia japonica, Agrostris palustris, Poa pratensis, Poa annua, Digitaria sanguinalis, Cyperus rotundus, Kyllinga brevifolia, Cyperus amuricus, Erigeron canadensis, Hydrocotyle sibthorpioides, Kummerowia striata, Euphorbia humifusa, and Viola arvensis) and forage grasses, flax, oilseed rape, cotton, mustard, cucumber, morning glory, balsam, pepper, eggplant, marigold, lotus, cabbage, daisy, carnation, tulip, iris, lily, nut-producing plants insofar as they are not already specifically mentioned. These may also apply in whole or in part to all other biological systems including but not limited to bacteria, yeast, fungi, algae, and mammalian cells and even their organelles (e.g., mitochondria and chloroplasts). In some embodiments, the organism or cell is of a species selected from the group consisting of Escherichia coli, Mycobacterium smegmatis, Baccillus subtilis, Chlorella, Bacillus thuringiensis, Saccharomyces cerevisiae, Yarrowia lipolytica, Chlamydamonas rhienhardtii, Pichia pastoris, Corynebacterium, Aspergillus niger, and Neurospora crassa. In some embodiments, the yeast is Yarrowia lypolitica. In other embodiments, the yeast is not Saccharomyces cerevisiae. In some embodiments, the plant or plant cell is of a species selected from the group consisting of Arabidopsis thaliana, Solanum tuberosum, Solanum phureja, Oryza sativa, Glycine max, Amaranthus tuberculatus, Linum usitatissimum, and Zea mays. The plant species may be selected from the group consisting of monocotyledonous plants of the grass family Poaceae. The family Poaceae may be divided into two major clades, the clade containing the subfamilies Bambusoideae, Ehrhartoideae, and Pooideae (the BEP clade) and the clade containing the subfamilies Panicoideae, Arundinoideae, Chloridoideae, Centothecoideae, Micrairoideae, Aristidoideae, and Danthonioideae (the PACCMAD clade). The subfamily Bambusoideae includes tribe Oryzeae. The plant species may relate to plants of the BEP clade, in particular plants of the subfamilies Bambusoideae and Ehrhartoideae. The BET clade includes subfamilies Bambusoideae, Ehrhartoideae, and group Triticodae and no other subfamily Pooideae groups. BET crop plants are plants grown for food or forage that are members of BET subclade, for example barley, corn, etc.
In certain embodiments, the methods further comprise regenerating a plant having a mutation introduced by the GRON from the plant cell, and may comprise collecting seeds from the plant.
In related aspects, the present disclosure relates to plant cells comprising a genomic modification introduced by a GRON according to the methods described herein, a plant comprising a genomic modification introduced by a GRON according to the methods described herein, or a seed comprising a genomic modification introduced by a GRON according to the methods described herein; or progeny of a seed comprising a genomic modification introduced by a GRON according to the methods described herein.
Other embodiments of the disclosure will be apparent from the following detailed description, exemplary embodiments, and claims.
FIG. 1 depicts BFP to GFP conversion mediated by phosphothioate (PS) labeled GRONs (having 3 PS moieties at each end of the GRON) and 5â˛Cy3/3ⲠidC labeled GRONs. Three independent experiments were done, and in each the PEG treatment was applied in tubes or in a 96-well dish. For tubes a total of â90,000 ppl. in 3 samples of â30,000 each per treatment were analyzed, for 96-well dishes a total of â40,000 ppl. in 4 samples of â10,000 each. Because a non-targeting BFP0/Cy3 GRON was not available as a control for the targeting GRON BFP-4/NC-Cy3, the Cy3 control non-targeting GRON that is used for the conversion of a stop GFP was used instead (GFP-3/NC-Cy3).
FIG. 2A depicts GRONs (SEQ ID NOS: 38, 339, 33, and 37, respectively, in order of appearance) comprising RNA/DNA, referred to herein as â2â˛-O-methyl GRONs.â FIG. 2B depicts GRONs (SEQ ID NOS: 38, 339, 33, and 37, respectively, in order of appearance) comprising RNA/DNA, referred to herein as â2â˛-O-methyl GRONs.â
FIG. 3 is a schematic of the location on the bfp gene where the BFP5 CRISPRs target (SEQ ID NOS: 378 and 379). The GRON used with the BFP CRISPR contains a wobble base shown in italics. This wobble base changes the nucleotide sequence of the bfp gene, but does not alter the amino acid sequence. This change in the nucleotide sequence minimizes re-cutting of the bfp gene by the CRISPRs once conversion has happened. The wobble base is located within the PAM sequence itself.
FIG. 4 shows the results of the effect of CRISPRs introduced with either the Cy3 or 3PS GRONs at various lengths, on the percentage of BFP to GFP conversion in a BFP transgenic Arabidopsis thaliana model system. There were three replicate for each sample.
FIG. 5 shows the results of the effect of CRISPRs introduced with the 3PS GRONs at various lengths, on the percentage of BFP to GFP conversion in a BFP transgenic Arabidopsis thaliana model system. There were three replicate for each sample.
FIG. 6A discloses GRON âgcugcccgugâ (SEQ ID NO: 8) used in Example 9. FIG. 6B discloses GRON âgggcgagggcâ (SEQ ID NO: 340) used in Example 9. All GRONs target the bfp gene. The 2â˛-O-Me GRONs are (A) 71 nt in length (71-mer) or (B) 201 nt in length (201-mer). RNA bases are represented in lower case letters (c,g,a and u) with the letters in bold being bases labeled with a 2â˛-O-Me group. There are three different types of 2â˛-O-Me GRONs: (1) none of the 5ⲠRNA bases are labeled with a 2â˛-O-Me group, (2) only the first 5ⲠRNA base is labeled with a 2â˛-O-Me group and (3) the first nine RNA bases are labeled with 2â˛-O-Me groups. 3PS GRONs are (A) 71 nt in length (71-mer) and (B) 201 nt in length (201-mer).
FIG. 7 shows the measurement of mean percentage GFP positive protoplasts from an Arabidopsis thaliana BFP transgenic model system as determined by flow cytometry from 71-mer GRONs. 71-mer GRON concentration is 0.5 ÎźM.
FIG. 8 shows the measurement of GFP positive protoplasts from Arabidopsis thaliana BFP transgenic model system as determined by flow cytometry from 201-mer GRONs. 201-mer GRON concentration is 0.16 ÎźM.
FIG. 9 shows the effect of CRISPRs introduced with coding and non-coding GRONs on the mean percentage of GFP positive cells in a BFP transgenic Arabidopsis thaliana model system. There were three replicate for each sample. CR=BFP CRISPR.
FIG. 10 is a schematic of tethering a single stranded GRON or double stranded DNA to the CRISPR/Cas complex. The DNA, RNA or protein can then be tethered to the linker though simple Watson-Crick base pairing. This methodology would bring repair molecules in close proximity to nuclease activity. An example of the nucleotide sequence of a sgRNA cassette with linker. This example makes use of a modified single guide RNA (sgRNA) sequence (SEQ ID NOS: 341 and 344) containing a sequence (SEQ ID NO: 342) that hybridizes to the target site (SEQ ID NO: 343).
FIG. 11 shows the results of the effect of CRISPRs and GRONs in mediating BFP to GFP conversion in a BFP transgenic Arabidopsis thaliana model system of spacers of differing lengths. To determine the effect of CRISPRs and GRONs in mediating BFP to GFP conversion in the BFP transgenic Arabidopsis thaliana model system at 72 h post delivery of DNA (CRISPR plasmids and GRONs). BFP1 spacers of two different lengths 20-nt and 17-nt where directly compared to one another for effectiveness in mediating BFP to GFP conversion. There were three replicates for each sample. Percentage of GFP positive cells for each treatment was determined using flow cytometry.
FIG. 12 shows the results of the effect of CRISPRs and GRONs in mediating BFP to GFP conversion in a BFP transgenic Arabidopsis thaliana model system of spacers were encoded on a plasmid (gRNA plasmid) or used as an amplicon (gRNA amplicon). To determine the effect of CRISPRs and GRONs in mediating BFP to GFP conversion in the BFP transgenic Arabidopsis thaliana model system at 72 h post delivery of DNA (CRISPR plasmids and GRONs). BFP6 spacers were either encoded on a plasmid (gRNA plasmid) or used as an amplicon (gRNA amplicon) and where directly compared to one another for effectiveness in mediating BFP to GFP conversion. There were three replicates for each sample. Percentage of GFP positive cells for each treatment was determined using flow cytometry.
FIG. 13 shows the results of the effect of CRISPRs and GRONs in mediating BFP to GFP conversion in a BFP transgenic Arabidopsis thaliana model system of unmodified vs. 3PS modified 41-mer GRONs. Measurement of the mean percentage of GFP positive protoplasts from Arabidopsis thaliana BFP transgenic model system 72 h post delivery of GRONs and CRISPR plasmid was determined by flow cytometry.
FIG. 14 shows the results of next generation sequencing of 3- and 6-week old Linum usitatissimum (flax) microcalli derived from shoot tip protoplasts PEG treated with CRISPR plasmid at T=0. 24 hour protoplasts and 3-week old microcalli that are derived from Linum usitatissimum shoot tips were PEG treated with CRISPR plasmid and GRON at T=0. * denotes time after PEG delivery of TALEN plasmids and GRONs. ** denotes protoplasts and microcalli are not from the same experiment.
FIG. 15 shows the results of next generation sequencing of 3- and 6-week old Linum usitatissimum microcalli derived from shoot tip protoplasts PEG treated with CRISPR plasmid at T=0.
FIG. 16a shows the distribution of indels based on size as determined by deep sequencing in protoplasts treated with CRISPR-Cas plasmid (BC-1) at 72 h post delivery. Indels represented 0.79% of the total reads. FIG. 16b shows BFP to GFP editing measured by the percentage of GFP fluorescing protoplasts identified by flow cytometry 72 h post delivery of plasmid (BC-1) and GRON (CG-6). Represented data is not normalized for transfection efficiency. Error bars are s.e.m. (n=9).
FIG. 17a shows a comparison of 3PS and unmodified GRONs in BFP to GFP gene editing as measured by flow cytometry at 72 h after delivery of plasmid (BC-1) and GRONs (CG-1) or (CG-2). FIG. 17b shows a comparison of GRON lengths in BFP to GFP gene editing as measured by flow cytometry at 72 hours post delivery of plasmid (BC-2) and GRONs (CG-5) or (CG-8). FIG. 17c shows a comparison of 3PS to 2â˛-O-Me GRONs for BFP to GFP gene editing as measured by flow cytometry at 72 h post delivery of plasmid (BC-1) and GRONs (CG-6), (CG-9) or (CG-10). FIG. 17d shows a comparison of 3PS- to Cy3GRONs in BFP to GFP gene editing as measured by flow cytometry at 72 h post delivery of plasmid (BC-3) and GRONs (CG-3) or (CG-4). Error bars are s.e.m. (n=3). (CG-1): BFP antisense 41 nb unmodified; (CG-2): BFP antisense 41 nb 3PS modified; (CG-3): BFP sense 41 nb 3PS modified; (CG-4): BFP sense 41 nb Cy3 modified; (CG-5): BFP sense 60 nb 3PS modified; (CG-6): BFP antisense 201 nb 3PS modified; (CG-8): BFP sense 201 nb 3PS modified; (CG-9): BFP antisense 201 nb 2â˛-O-Me modification on the first 5ⲠRNA base; (CG-10): BFP antisense 201 nb 2â˛-O-Me modifications on the first nine 5ⲠRNA bases.
FIG. 18a shows a distribution of indels based on size as determined by deep sequencing in Arabidopsis protoplasts treated with TALEN plasmid (BT-1) at 72 h post delivery. Indels represented 0.51% of the total reads. FIG. 18b shows BFP to GFP gene editing as measured by flow cytometry at 48 h post delivery of plasmid (BT-1) and GRON (CG-7). FIG. 18c shows a representative distribution of indels based on bp length in L. usitatissimum protoplasts treated with a TALEN (LuET-1) targeting the EPSPS genes 7 d after delivery. Total frequency of indels is 0.50%. FIG. 18d shows L. usitatissimum EPSPS gene editing as measured by deep sequencing at 7 d post delivery of plasmid (LuET-1) and GRON (CG-11) into protoplasts. Percentage of total reads represents the number of reads containing both T97I and P101A edits as a percentage of the total reads. Error bars are s.e.m. (n=3). (CG-7): BFP sense 201 nb 3PS modified; (CG-11): EPSPS sense 144 nb Cy3 modified.
FIG. 19 shows effects of the double strand break inducing antibiotics zeocin and phleomycin on BFP to GFP editing in transgenic A. thaliana protoplasts. Protoplasts were treated with zeocin or phleomycin for 90 min before PEG introduction of GRON (CG2). Successful editing resulted in GFP fluorescence. Green fluorescing protoplasts were quantified using an Attune Acoustic Focusing Cytometer.
FIG. 20 shows converted BFP transgenic A. thaliana cells five days after GRON delivery into BFP transgenic protoplasts, targeting the conversion from BFP to GFP. Green fluorescence is indicative of BFP-GFP editing. A brightfield image; B, the same field of view in blue light. Error bars are s.e.m. (n=4); (CG2): BFP antisense 41 nb 3PS modified; (CG12) BFP antisense 41 nb 3PS modified non-targeting. Images were acquired with an ImageXpress Micro system (Molecular Devices, Sunnyvale, CA, USA) Scale bar=20 Îźm
FIG. 21a shows a schematic of the CRISPR-Cas plasmid. The mannopine synthase (Mas) promoter is driving the transcription of the Cas9 gene that is codon optimized for higher plants. The Cas9 gene contains two SV40 nuclear localization signals (NLS) at either end of the gene and a 2ĂFLAG epitope tag. A. thaliana U6 promoter is driving the transcription of the gRNA scaffold and transcription is terminated using a poly(T) signal. FIG. 21b shows a schematic of the TALEN plasmid. The Mas promoter is driving the transcription of the right and left tale arms linked together with a 2A ribosome skipping sequence. A Fok1 endonuclease is linked to the 3Ⲡend of each Tale arm. The 5Ⲡend of the left tale contains a nuclear localization signal (NLS) and a V5 epitope tag. rbcT is the Pisum sativum RBCSE9 gene terminator.
FIG. 22a shows a BFP gene target region (SEQ ID NO: 345) for the CRISPR-Cas protospacers, BC-1, BC-2 and BC-3 (SEQ ID NOS: 346, 347, and 348, respectively) and the TALEN (SEQ ID NO: 349) BT-1, left and right tale arms. The site of BFP to GFP editing is CACâTAC (H66Y). FIG. 22b shows an EPSPS gene target region (SEQ ID NO: 350) for the TALEN, LuET-1, left and right tale arms. The site of EPSPS conversions are ACA>ATA and CCG>GCG (T97I and P101A).
FIG. 23 shows the amino acid sequence of Alopecurus myosuroides (blackgrass) ACCase gene product (SEQ ID NO:1).
FIG. 24 shows the amino acid sequence of Escherichia coli EPSPS gene product (SEQ ID NO:2).
FIG. 25 shows exemplary analogous EPSPS positions.
FIG. 26A shows an Alopecurus myosuroides plastidal ACCase cDNA sequence (SEQ ID NO: 351). FIG. 26B shows an Alopecurus myosuroides plastidal ACCase amino acid sequence (SEQ ID NO: 352). FIG. 26C shows an Oryza sativa plastidal ACCase cDNA sequence (SEQ ID NO: 353). FIG. 26D shows an Oryza sativa plastidal ACCase amino acid sequence (SEQ ID NO: 354). FIG. 26E shows an Oryza sativa plastidal ACCase genomic DNA sequence (SEQ ID NO: 355). FIG. 26F shows an Oryza sativa plastidal ACCase protein sequence (SEQ ID NO: 356). FIG. 26G shows an Oryza sativa ACCase protein sequence (SEQ ID NO: 357).
FIG. 27(a) shows a diagram of the CRISPR-Cas plasmid, BFP_sgRNA-1. The mannopine synthase (Mas) promoter drives transcription of the plant codon optimized Cas9 gene that contains two SV40 nuclear localization signals (NLS) at the N- and C-terminal and a 3ĂFLAG epitope tag on the N-terminal. The AtU6-26 promoter drives transcription of the poly (T) terminated gRNA scaffold.
FIG. 27(b) shows diagram depicting the approach used to target locus H66 of the BFP transgene (SEQ ID NO: 358). BFP_sgRNA-1. Edited nucleotide change (C>T) resulting in conversion from BFP fluorescence to GFP fluorescence encoded by BFP/41 GRON (SEQ ID NO: 359) and BFP/101 GRON (SEQ ID NO: 360) result in an edited locus (SEQ ID NO: 360). Other nucleotide changes depicted are silent mutations.
FIG. 27(c) shows a distribution of indels based on size determined by deep sequencing (n=1).
FIG. 27(d) shows off-target analysis for BFP_sgRNA-1. Indels (SEQ ID NOS: 362 to 366) determined by deep sequencing (n=1), lowercase red font are mismatches to BFP_sgRNA-1 target sequence (SEQ ID NO: 361).
FIG. 27(e) shows BFP to GFP editing by BFP_sgRNA-1 and BFP/41 GRON as analyzed by flow cytometry. R2 gate considered GFP (+) events, error bars are meanÂąs.e.m. (n=5).
FIG. 28(a) shows a comparison of 3PS modified (BFP/41/3PS) and unmodified (BFP/41) GRONs in BFP to GFP precision gene editing as analyzed by flow cytometry. R2 gate considered GFP (+) events, error bars are meanÂąs.e.m. (n=5).
FIG. 28(b) shows a comparison of two GRON lengths, 41 nb and 101 nb, with and without 3PS modification in BFP to GFP precision gene editing as analyzed by flow cytometry, error bars are meanÂąs.e.m. (n=3).
FIG. 29(a) shows a diagram of the CRISPR-Cas9 plasmid EPSPS_sgRNA-2 used in this study (details are described in FIG. 1). Depicted are the target locus (SEQ ID NO: 367); sequence encoded by the EPSPS/144 GRON (SEQ ID NO: 368); and the edited locus (SEQ ID NO: 368).
FIG. 29(b) shows Tissue stages in gene editing workflow: 1âflax protoplasts, bar 10 Îźm; 2âmicrocolony at 3 w, bar 50 Îźm; 3âmicocalli at 7 w bar 100 Îźm; 4âshoot initiation from callus, bar 0.5 c; 5âregenerated shoots, bar 0.5 cm; 6âregenerated plant in soil.
FIG. 29(c) shows a sequence confirmation of edited EPSPS alleles in regenerated plants Y23 and Z15. Boxed regions show a gene-specific single nucleotide polymorphism (SNP), and the ACA>ATA; CCG>GCG edits. Chromatograms are representative of multiple gDNA extractions from each shoot.
FIGS. 30A-C show herbicide tolerance to flax calli and regenerated plants. FIG. 30A shows flax wildtype (wt) callus and callus Y23 with T97I and P101A edits in EPSPS gene 2 were cultured on medium containing glyphosate in a 6-well plate. Images were captured 6 days after initiation of treatment. FIG. 30B shows mean fresh weight of wt and Y23 callus treated with glyphosate after 14 daysÂąs.e.m. (n=3). FIG. 30C shows greenhouse hardened wt and Y23 whole plants were treated with 10.5 or 21.0 mM glyphosate or surfactant only by spray application. Images were captured 6 days after glyphosate application. This experiment was repeated multiple times with similar results. Bar=2 cm
FIGS. 31A-B show RTDS technology applied to BFP to GFP conversion in Arabidopsis. FIG. 31A shows representation of RTDS technology. FIG. 31B shows schematic representing BFP to GFP conversion in our BFP transgenic line by RTDS. Converting locus H66 (CAC) to Y66 (TAC) changes the fluorescence character of the transgene from blue to green. Depicted are the target locus (SEQ ID NO: 369); sequence encoded by the BFP GRON (SEQ ID NO: 370); and the edited locus (SEQ ID NO: 370).
FIG. 32 shows the effect of pre-treatment with phleomycin on RTDS mediated BFP to BFP conversion in Arabidopsis. (a) Protoplasts were pre-treated with 0, 250 or 1000 Îźg/mL phleomycin for 90 min, and then subjected to RTDS using either GRON BFP/41 or BFP/41/NT. Error bars are meanÂąs.e.m. (n=4). (b) Converted A. thaliana cells five days after GRON delivery. Green fluorescence is indicative of BFP to GFP editing. A brightfield image; B, the same field of view in blue light. Images were acquired with an ImageXpress Micro system (Molecular Devices, Sunnyvale, CA, USA) Scale bar=20 Îźm
FIG. 33 shows BT-1 TALEN design and target region. (a) BT-1 TALEN plasmid. MAS-mannopine synthase promoter; V5âV5 epitope tag; NLS-SV40 nuclear localization signal; Fok1 endonuclease is linked to the 3Ⲡend of each Tale arm; rbcTâPisum sativum RBCSE9 gene terminator. (b) Schematic depicting the BT-1 TALEN target site on the BFP gene. Depicted are the target locus (SEQ ID NO: 371); sequence encoded by the ssODN (SEQ ID NO: 372); and the edited locus (SEQ ID NO: 372). (c) BT-1 TALEN design and target diagram. The mannopine synthase (MAS) promoter drives expression of the TALEN monomers. The rbcT (Pisum sativum) RBCSE9 acts as a gene terminator. A V5 epitope tag and SV40 nuclear localization signal (NLS) reside on the N-terminus. The BT-1 Tale left and right binding domains are underlined. The site of BFP to GFP conversion is a (C>T) substitution. BT-1 activity produces a DSB that can be repaired by NHEJ or through ssODNs, resulting in deletions and insertions or BFP to GFP precision editing, respectively. Silent substitutions were used to discourage BT-1 activity after conversion. Depicted are the target locus (SEQ ID NO: 371); sequence encoded by the BFP/41 GRON (SEQ ID NO: 374); sequence encoded by the BFP/1-1 GRON (SEQ ID NO: 375); and the edited locus (SEQ ID NO: 375).
FIG. 34 shows a CRISPR/Cas9 construct design and target region diagram. A, The mannopine synthase (Mas) promoter drives transcription of the plant codon optimized SpCas9 gene that contains two SV40 nuclear localization signals (NLS) at the N- and C-terminal and a 3ĂFLAG epitope tag on the N-terminal. The rbcT (Pisum sativum) RBCSE9 acts as a gene terminator. The AtU6-26 promoter drives transcription of the poly (T) terminated gRNA scaffold. B, Approach used to target the BFP transgene using BC-1 CRISPR/Cas9. The edited nucleotide change (C>T) results in conversion from BFP to GFP. Silent mutations are used to deter BC-1 activity on a converted GFP transgene. Depicted are the target locus (SEQ ID NO: 373); sequence encoded by the ssODN (SEQ ID NO: 372); and the edited locus (SEQ ID NO: 372).
FIG. 35 shows BC-1 CRISPR/Cas9 activity in Arabidopsis protoplasts. A, Imprecise NHEJ repairs events in protoplasts treated with BC-1 as determined by amplicon deep sequencing (n=1). B, Activity of TALEN BT-1 contrasted with CRISPR/Cas9 BC-1 in Arabidopsis protoplasts as determined by the percentage of imprecise NHEJ events. C, Off-target analysis for BC-1 CRISPR/Cas9. Imprecise NHEJ events at five loci homologous to the BC-1 target sequence were measured by amplicon deep sequencing (n=1). Indels (SEQ ID NOS: 362 to 366) were identified. Bases in lowercase red font are mismatches to the BC-1 target sequence (SEQ ID NO: 361. D, ssODNs enhance BFP to GFP editing in Arabidopsis protoplasts treated with BC-1. Protoplasts were treated with BFP/41 or BFP/101 with and without CRISPR/Cas9 or BC-1 CRISPR/Cas9 alone. BFP to GFP edits were measured by flow cytometry 72 h after delivery. Data represent meanÂąSEM (n=5).
FIGS. 36A-D show BT-1 TALEN activity in Arabidopsis protoplasts. FIG. 36A shows distribution of repair events in Arabidopsis protoplasts treated with BT-1 TALEN for 72 h as measured by deep sequencing. FIG. 36B shows percentage of total deletion and insertion repair events with respect to length in bp. FIG. 36C shows percentage of total deletions â¤20 bp by length. FIG. 36D shows percentage of total insertions â¤20 bp by length. Error bars are meanÂąs.e.m. (n=4)
FIG. 37 shows RTDS combined with BT-1 TALEN for editing BFP to GFP in Arabidopsis protoplasts. (a) Schematic of the BFP target region for BFP to GFP editing by RTDS. Converting locus H66 (blue font; CAC) to Y66 (green font; TAC) changes the fluorescence character of the transgene from blue to green. Bases in red are silent mutations used to discourage BT-1 TALEN activity on a corrected GFP gene. (b) BFP to GFP conversion frequency as determined by cytomety in Arabidopsis protoplasts treated with BT-1 TALEN and either BFP/41, BFP/101 or BFP/201 GRON 72 h after introduction. GFP gate considered GFP (+) events, error bars are meanÂąs.e.m. (n=3).
FIG. 38 shows RTDS combined with LuET-1 TALEN for editing the EPSPS loci in flax. (a) LuET-1 TALEN plasmid design. MASâmannopine synthase promoter; V5âV5 epitope tag; NLSâSV40 nuclear localization signal; Fok1 endonuclease is linked to the 3Ⲡend of each Tale arm; rbcTâPisum sativum RBCSE9 gene terminator. (b) Schematic depicting the LuET-1 TALEN target site on conserved sequence of the two flax EPSPS loci. Converting locus T97 (ACA) to 197 (ATA) and P101 (CCG) to A101 (GCG) confers glyphosate tolerance. Depicted are the target locus (SEQ ID NO: 376); sequence encoded by the EPSPS/144 GRON (SEQ ID NO: 377); and the edited locus (SEQ ID NO: 377). (c) Western blot analysis of LuET-1 TALEN transient expression in flax protoplasts 6, 24 and 48 h after introduction. Reversible stain used as load control. Antibody was against the V5 epitope.
FIGS. 39A-D shows LuET-1 TALEN activity in flax protoplasts. FIG. 39A shows distribution of repair events in flax microcolonies treated with LuET-1 TALEN after 7 d as measured by deep sequencing. FIG. 39B shows percentage of total deletion and insertion repair events with respect to length in bp. FIG. 39C shows percentage of total deletions â¤20 bp by length. FIG. 39D shows percentage of total insertions â¤20 bp by length. (n=1).
FIG. 40 shows a diagram depicting TALEN target regions used to generate amplicons for deep sequencing analysis. (a) BT-1 target region on the BFP transgene. BFPF-1 and BFPR-1 primers amplify a region 206 bp in length that flanks the BT-1 TALEN binding region. (b) LuET-1 target region. LuEPF-1 and LuEPR-1 amplify from a conserved region in EPSPS gene 1 and 2, yielding an amplicon flanking the TALEN binding region 194 bp in length. SNPs within the amplicon provide gene 1 and 2 specificity.
Targeted genetic modification mediated by oligonucleotides is a valuable technique for use in the specific alteration of short stretches of DNA to create deletions, short insertions, and point mutations. These methods involve DNA pairing/annealing, followed by a DNA repair/recombination event. First, the nucleic acid anneals with its complementary strand in the double-stranded DNA in a process mediated by cellular protein factors. This annealing creates a centrally located mismatched base pair (in the case of a point mutation), resulting in a structural perturbation that most likely stimulates the endogenous protein machinery to initiate the second step in the repair process: site-specific modification of the chromosomal sequence and/or that in organelles (e.g., mitochondria and chloroplasts). This newly introduced mismatch induces the DNA repair machinery to perform a second repair event, leading to the final revision of the target site. The present methods and compositions in various aspects and embodiments disclosed herein, may improve the methods by providing novel approaches which increase the availability of DNA repair components, thus increasing the efficiency and reproducibility of gene repair-mediated modifications to targeted nucleic acids.
Efficient methods for site-directed genomic modifications are desirable for research, clinical gene therapy, industrial microbiology and agriculture. One approach utilizes triplex-forming oligonucleotides (TFO) which bind as third strands to duplex DNA in a sequence-specific manner, to mediate directed mutagenesis. Such TFO can act either by delivering a tethered mutagen, such as psoralen or chlorambucil (Havre et al., Proc Nat'l Acad Sci, U.S.A. 90:7879-7883, 1993; Havre et al, J Virol 67:7323-7331, 1993: Wang et al., Mol Cell Biol 15:1759-1768, 1995; Takasugi et al. Proc Nat'l Acad Sci. U.S.A. 88:5602-5606, 1991; Belousov et al, Nucleic Acids Res 25:3440-3444, 1997), or by binding with sufficient affinity to provoke error-prone repair (Wang et al., Science 271:802-805, 1996).
Another strategy for genomic modification involves the induction of homologous recombination between an exogenous DNA fragment and the targeted gene. This approach has been used successfully to target and disrupt selected genes in mammalian cells and has enabled the production of transgenic mice carrying specific gene knockouts (Capeechi et alt, Science 244:1288-1292, 1989; Wagner, U.S. Pat. No. 4,873,191). This approach involves the transfer of selectable markers to allow isolation of the desired recombinants. Without selection, the ratio of homologous to non-homologous integration of transfected DNA in typical gene transfer experiments is low, usually in the range of 1:1000 or less (Sedivy et al. Gene Targeting. W. H. Freeman and Co., New York, 1992). This low efficiency of homologous integration limits the utility of gene transfer for experimental use or gene therapy. The frequency of homologous recombination can be enhanced by damage to the target site from UV irradiation and selected carcinogens (Wang et al., Mol Cell Biol 8:196-202, 1988) as well as by site-specific endonucleases (Sedivy et al, Gene Targeting, W. H. Freeman and Co., New York, 1992; Rouet et al., Proc Nat'l Acad Sci, U.S.A. 91:6064-6068, 1994; Segal et al., Proc Nat'l Acad Sci, U.S.A. 92:806-810, 1995). In addition, DNA damage induced by triplex-directed psoralen photoadducts can stimulate recombination within and between extrachromosomal vectors (Segal et al, Proc Nat'l Acad Sci, U.S.A. 92:806-810, 1995; Farugi et al., Mol Cell Biol 16:6820-6828, 1996; Glazer, U.S. Pat. No. 5,962,426).
Linear donor fragments are more recombinogenic than their circular counterparts (Folger et al., Mol Cell Biol 2:1372-1387, 1982). Recombination can in certain embodiments also be influenced by the length of uninterrupted homology between both the donor and target sites, with short fragments often appearing to be ineffective substrates for recombination (Rubnitz et al., Mol Cell Biol 4:2253-2258, 1984). Nonetheless, the use of short fragments of DNA or DNA/RNA hybrids for gene correction is the focus of various strategies. (Kunzelmann et al., Gene Ther 3:859-867, 1996).
âNucleic acid sequence,â ânucleotide sequenceâ and âpolynucleotide sequenceâ as used herein refer to an oligonucleotide or polynucleotide, and fragments or portions thereof, and to DNA or RNA of genomic or synthetic origin which may be single- or double-stranded, and represent the sense or antisense strand.
As used herein, the terms âoligonucleotideâ and âoligomerâ refer to a polymer of nucleobases of at least about 10 nucleobases and as many as about 1000 nucleobases.
The terms âDNA-modifying moleculeâ and âDNA-modifying reagentâ as used herein refer to a molecule which is capable of recognizing and specifically binding to a nucleic acid sequence in the genome of a cell, and which is capable of modifying a target nucleotide sequence within the genome, wherein the recognition and specific binding of the DNA-modifying molecule to the nucleic acid sequence is protein-independent. The term âprotein-independentâ as used herein in connection with a DNA-modifying molecule means that the DNA-modifying molecule does not require the presence and/or activity of a protein and/or enzyme for the recognition of, and/or specific binding to, a nucleic acid sequence. DNA-modifying molecules are exemplified, but not limited to triplex forming oligonucleotides, peptide nucleic acids, polyamides, and oligonucleotides which are intended to promote gene conversion. The DNA-modifying molecules of the present disclosure are in certain embodiments distinguished from the prior art's nucleic acid sequences which are used for homologous recombination (Wong & Capecchi, Molec. Cell. Biol. 7:2294-2295, 1987) in that the prior art's nucleic acid sequences which are used for homologous recombination are protein-dependent. The term âprotein-dependentâ as used herein in connection with a molecule means that the molecule requires the presence and/or activity of a protein and/or enzyme for the recognition of, and/or specific binding of the molecule to, a nucleic acid sequence. Methods for determining whether a DNA-modifying molecule requires the presence and/or activity of a protein and/or enzyme for the recognition of, and/or specific binding to, a nucleic acid sequence are within the skill in the art (see, e.g., Dennis et al. Nucl. Acids Res. 27:4734-4742, 1999). For example, the DNA-modifying molecule may be incubated in vitro with the nucleic acid sequence in the absence of any proteins and/or enzymes. The detection of specific binding between the DNA-modifying molecule and the nucleic acid sequence demonstrates that the DNA-modifying molecule is protein-independent. On the other hand, the absence of specific binding between the DNA-modifying molecule and the nucleic acid sequence demonstrates that the DNA-modifying molecule is protein-dependent and/or requires additional factors.
âTriplex forming oligonucleotideâ (TFO) is defined as a sequence of DNA or RNA that is capable of binding in the major grove of a duplex DNA or RNA helix to form a triple helix. Although the TFO is not limited to any particular length, a preferred length of the TFO is 250 nucleotides or less, 200 nucleotides or less, or 100 nucleotides or less, or from 5 to 50 nucleotides, or from 10 to 25 nucleotides, or from 15 to 25 nucleotides. Although a degree of sequence specificity between the TFO and the duplex DNA is necessary for formation of the triple helix, no particular degree of specificity is required, as long as the triple helix is capable of forming. Likewise, no specific degree of avidity or affinity between the TFO and the duplex helix is required as long as the triple helix is capable of forming. While not intending to limit the length of the nucleotide sequence to which the TFO specifically binds in one embodiment, the nucleotide sequence to which the TFO specifically binds is from 1 to 100, in some embodiments from 5 to 50, yet other embodiments from 10 to 25, and in other embodiments from 15 to 25, nucleotides. Additionally, âtriple helixâ is defined as a double-helical nucleic acid with an oligonucleotide bound to a target sequence within the double-helical nucleic acid. The âdouble-helicalâ nucleic acid can be any double-stranded nucleic acid including double-stranded DNA, double-stranded RNA and mixed duplexes of DNA and RNA. The double-stranded nucleic acid is not limited to any particular length. However, in preferred embodiments it has a length of greater than 500 bp, in some embodiments greater than 1 kb and in some embodiments greater than about 5 kb. In many applications the double-helical nucleic acid is cellular, genomic nucleic acid. The triplex forming oligonucleotide may bind to the target sequence in a parallel or anti-parallel manner.
âPeptide Nucleic Acids,â âpolyamidesâ or âPNAâ are nucleic acids wherein the phosphate backbone is replaced with an N-aminoethylglycine-based polyamide structure. PNAs have a higher affinity for complementary nucleic acids than their natural counter parts following the Watson-Crick base-pairing rules. PNAs can form highly stable triple helix structures with DNA of the following stoichiometry: (PNA)2.DNA. Although the peptide nucleic acids and polyamides are not limited to any particular length, a preferred length of the peptide nucleic acids and polyamides is 200 nucleotides or less, in some embodiments 100 nucleotides or less, and in some embodiments from 5 to 50 nucleotides long. While not intending to limit the length of the nucleotide sequence to which the peptide nucleic acid and polyamide specifically binds, in one embodiment, the nucleotide sequence to which the peptide nucleic acid and polyamide specifically bind is from 1 to 100, in some embodiments from 5 to 50, yet other embodiments from 5 to 25, and other embodiments from 5 to 20, nucleotides.
The term âcellâ refers to a single cell. The term âcellsâ refers to a population of cells. The population may be a pure population comprising one cell type. Likewise, the population may comprise more than one cell type. In the present disclosure, there is no limit on the number of cell types that a cell population may comprise. A cell as used herein includes without limitation plant callus cells, cells with and without cell walls, prokaryotic cells and eukaryotic cells.
The term âsynchronizeâ or âsynchronized,â when referring to a sample of cells, or âsynchronized cellsâ or âsynchronized cell populationâ refers to a plurality of cells which have been treated to cause the population of cells to be in the same phase of the cell cycle. It is not necessary that all of the cells in the sample be synchronized. A small percentage of cells may not be synchronized with the majority of the cells in the sample. A preferred range of cells that are synchronized is between 10-100%. A more preferred range is between 30-100%. Also, it is not necessary that the cells be a pure population of a single cell type. More than one cell type may be contained in the sample. In this regard, only one of cell types may be synchronized or may be in a different phase of the cell cycle as compared to another cell type in the sample.
The term âsynchronized cellâ when made in reference to a single cell means that the cell has been manipulated such that it is at a cell cycle phase which is different from the cell cycle phase of the cell prior to the manipulation. Alternatively, a âsynchronized cellâ refers to a cell that has been manipulated to alter (i.e., increase or decrease) the duration of the cell cycle phase at which the cell was prior to the manipulation when compared to a control cell (e.g., a cell in the absence of the manipulation).
The term âcell cycleâ refers to the physiological and morphological progression of changes that cells undergo when dividing (i.e. proliferating). The cell cycle is generally recognized to be composed of phases termed âinterphase,â âprophase,â âmetaphase,â âanaphase,â and âtelophaseâ. Additionally, parts of the cell cycle may be termed âM (mitosis),â âS (synthesis),â âG0,â âG1 (gap 1)â and âG2 (gap2)â. Furthermore, the cell cycle includes periods of progression that are intermediate to the above named phases.
The term âcell cycle inhibitionâ refers to the cessation of cell cycle progression in a cell or population of cells. Cell cycle inhibition is usually induced by exposure of the cells to an agent (chemical, proteinaceous or otherwise) that interferes with aspects of cell physiology to prevent continuation of the cell cycle.
âProliferationâ or âcell growthâ refers to the ability of a parent cell to divide into two daughter cells repeatably thereby resulting in a total increase of cells in the population. The cell population may be in an organism or in a culture apparatus.
The term âcapable of modifying DNAâ or âDNA modifying meansâ refers to procedures, as well as endogenous or exogenous agents or reagents that have the ability to induce, or can aid in the induction of, changes to the nucleotide sequence of a targeted segment of DNA. Such changes may be made by the deletion, addition or substitution of one or more bases on the targeted DNA segment. It is not necessary that the DNA sequence changes confer functional changes to any gene encoded by the targeted sequence. Furthermore, it is not necessary that changes to the DNA be made to any particular portion or percentage of the cells.
The term ânucleotide sequence of interestâ refers to any nucleotide sequence, the manipulation of which may be deemed desirable for any reason, by one of ordinary skill in the art. Such nucleotide sequences include, but are not limited to, coding sequences of structural genes (e.g., reporter genes, selection marker genes, oncogenes, drug resistance genes, growth factors, etc.), and non-coding regulatory sequences that do not encode an mRNA or protein product (e.g., promoter sequence, enhancer sequence, polyadenylation sequence, termination sequence, regulatory RNAs such as miRNA, etc.).
âAmino acid sequence,â âpolypeptide sequence,â âpeptide sequenceâ and âpeptideâ are used interchangeably herein to refer to a sequence of amino acids.
âTarget sequence,â as used herein, refers to a double-helical nucleic acid comprising a sequence greater than 8 nucleotides in length but less than 201 nucleotides in length. In some embodiments, the target sequence is between 8 to 30 bases. The target sequence, in general, is defined by the nucleotide sequence on one of the strands on the double-helical nucleic acid.
As used herein, a âpurine-rich sequenceâ or âpolypurine sequenceâ when made in reference to a nucleotide sequence on one of the strands of a double-helical nucleic acid sequence is defined as a contiguous sequence of nucleotides wherein greater than 50% of the nucleotides of the target sequence contain a purine base. However, it is preferred that the purine-rich target sequence contain greater than 60% purine nucleotides, in some embodiments greater than 75% purine nucleotides, in other embodiments greater than 90% purine nucleotides and yet other embodiments 100% purine nucleotides.
As used herein, a âpyrimidine-rich sequenceâ or âpolypyrimidine sequenceâ when made in reference to a nucleotide sequence on one of the strands of a double-helical nucleic acid sequence is defined as a contiguous sequence of nucleotides wherein greater that 50% of the nucleotides of the target sequence contain a pyrimidine base. However, it is preferred that the pyrimidine-rich target sequence contain greater than 60% pyrimidine nucleotides and in some embodiments greater than 75% pyrimidine nucleotides. In some embodiments, the sequence contains greater than 90% pyrimidine nucleotides and, in other embodiments, is 100% pyrimidine nucleotides.
A âvariantâ of a first nucleotide sequence is defined as a nucleotide sequence which differs from the first nucleotide sequence (e.g., by having one or more deletions, insertions, or substitutions that may be detected using hybridization assays or using DNA sequencing). Included within this definition is the detection of alterations or modifications to the genomic sequence of the first nucleotide sequence. For example, hybridization assays may be used to detect (1) alterations in the pattern of restriction enzyme fragments capable of hybridizing to the first nucleotide sequence when comprised in a genome (i.e., RFLP analysis), (2) the inability of a selected portion of the first nucleotide sequence to hybridize to a sample of genomic DNA which contains the first nucleotide sequence (e.g., using allele-specific oligonucleotide probes), (3) improper or unexpected hybridization, such as hybridization to a locus other than the normal chromosomal locus for the first nucleotide sequence (e.g., using fluorescent in situ hybridization (FISH) to metaphase chromosomes spreads, etc.). One example of a variant is a mutated wild type sequence.
The terms ânucleic acidâ and âunmodified nucleic acidâ as used herein refer to any one of the known four deoxyribonucleic acid bases (i.e., guanine, adenine, cytosine, and thymine). The term âmodified nucleic acidâ refers to a nucleic acid whose structure is altered relative to the structure of the unmodified nucleic acid. Illustrative of such modifications would be replacement covalent modifications of the bases, such as alkylation of amino and ring nitrogens as well as saturation of double bonds.
As used herein, the terms âmutationâ and âmodificationâ and grammatical equivalents thereof when used in reference to a nucleic acid sequence are used interchangeably to refer to a deletion, insertion, substitution, strand break, and/or introduction of an adduct. A âdeletionâ is defined as a change in a nucleic acid sequence in which one or more nucleotides is absent. An âinsertionâ or âadditionâ is that change in a nucleic acid sequence which has resulted in the addition of one or more nucleotides. A âsubstitutionâ results from the replacement of one or more nucleotides by a molecule which is a different molecule from the replaced one or more nucleotides. For example, a nucleic acid may be replaced by a different nucleic acid as exemplified by replacement of a thymine by a cytosine, adenine, guanine, or uridine. Pyrimidine to pyrimidine (e.g. C to T or T to C nucleotide substitutions) or purine to purine (e.g. G to A or A to G nucleotide substitutions) are termed transitions, whereas pyrimidine to purine or purine to pyrimidine (e.g. G to T or G to C or A to T or A to C) are termed transversions. Alternatively, a nucleic acid may be replaced by a modified nucleic acid as exemplified by replacement of a thymine by thymine glycol. Mutations may result in a mismatch. The term âmismatchâ refers to a non-covalent interaction between two nucleic acids, each nucleic acid residing on a different polynucleic acid sequence, which does not follow the base-pairing rules. For example, for the partially complementary sequences 5â˛-AGT-3Ⲡand 5â˛-AAT-3â˛, a G-A mismatch (a transition) is present. The terms âintroduction of an adductâ or âadduct formationâ refer to the covalent or non-covalent linkage of a molecule to one or more nucleotides in a DNA sequence such that the linkage results in a reduction (in some embodiments from 10% to 100%, in other embodiments from 50% to 100%, and in some embodiments from 75% to 100%) in the level of DNA replication and/or transcription.
The term âDNA cutterâ refers to a moiety that effects a strand break. Non-limited examples include meganucleases, TALEs/TALENs, antibiotics, zinc fingers and CRISPRs or CRISPR/cas systems.
The term âstrand breakâ when made in reference to a double stranded nucleic acid sequence includes a single-strand break and/or a double-strand break. A single-strand break (a nick) refers to an interruption in one of the two strands of the double stranded nucleic acid sequence. This is in contrast to a double-strand break which refers to an interruption in both strands of the double stranded nucleic acid sequence, which may result in blunt or staggered ends. Strand breaks may be introduced into a double stranded nucleic acid sequence either directly (e.g., by ionizing radiation or treatment with certain chemicals) or indirectly (e.g., by enzymatic incision at a nucleic acid base).
The terms âmutant cellâ and âmodified cellâ refer to a cell which contains at least one modification in the cell's genomic sequence.
The term âportionâ when used in reference to a nucleotide sequence refers to fragments of that nucleotide sequence. The fragments may range in size from 5 nucleotide residues to the entire nucleotide sequence minus one nucleic acid residue.
DNA molecules are said to have â5Ⲡendsâ and â3Ⲡendsâ because mononucleotides are reacted to make oligonucleotides in a manner such that the 5Ⲡphosphate of one mononucleotide pentose ring is attached to the 3Ⲡoxygen of its neighbor in one direction via a phosphodiester linkage. Therefore, an end of an oligonucleotide is referred to as the â5Ⲡendâ if its 5Ⲡphosphate is not linked to the 3Ⲡoxygen of a mononucleotide pentose ring. An end of an oligonucleotide is referred to as the â3Ⲡendâ if its 3Ⲡoxygen is not linked to a 5Ⲡphosphate of another mononucleotide pentose ring. As used herein, a nucleic acid sequence, even if internal to a larger oligonucleotide, also may be said to have 5Ⲡand 3Ⲡends. In either a linear or circular DNA molecule, discrete elements are referred to as being âupstreamâ or 5Ⲡof the âdownstreamâ or 3Ⲡelements. This terminology reflects that transcription proceeds in a 5Ⲡto 3Ⲡdirection along the DNA strand. The promoter and enhancer elements which direct transcription of a linked gene are generally located 5Ⲡor upstream of the coding region. However, enhancer elements can exert their effect even when located 3Ⲡof the promoter element and the coding region. Transcription termination and polyadenylation signals are located 3Ⲡor downstream of the coding region.
The term ârecombinant DNA moleculeâ as used herein refers to a DNA molecule which is comprised of segments of DNA joined together by means of molecular biological techniques.
The term ârecombinant proteinâ or ârecombinant polypeptideâ as used herein refers to a protein molecule which is expressed using a recombinant DNA molecule.
As used herein, the terms âvectorâ and âvehicleâ are used interchangeably in reference to nucleic acid molecules that transfer DNA segment(s) from one cell to another.
The terms âin operable combination,â âin operable orderâ and âoperably linkedâ as used herein refer to the linkage of nucleic acid sequences in such a manner that a nucleic acid molecule capable of directing the transcription of a given gene and/or the synthesis of a desired protein molecule is produced. The terms also refer to the linkage of amino acid sequences in such a manner so that a functional protein is produced.
The term âtransfectionâ as used herein refers to the introduction of foreign DNA into cells. Transfection may be accomplished by a variety of means known to the art including calcium phosphate-DNA co-precipitation, DEAE-dextran-mediated transfection, polybrene-mediated transfection, electroporation, microinjection, liposome fusion, lipofectin, protoplast fusion, retroviral infection, biolistics (i.e., particle bombardment) and the like.
As used herein, the terms âcomplementaryâ or âcomplementarityâ are used in reference to âpolynucleotidesâ and âoligonucleotidesâ (which are interchangeable terms that refer to a sequence of nucleotides) related by the base-pairing rules. For example, the sequence â5â˛-CAGT-3â˛,â is complementary to the sequence â5â˛-ACTG-3â˛.â Complementarity can be âpartialâ or âtotalâ. âPartialâ complementarity is where one or more nucleic acid bases is not matched according to the base pairing rules. âTotalâ or âcompleteâ complementarity between nucleic acids is where each and every nucleic acid base is matched with another base under the base pairing rules. The degree of complementarity between nucleic acid strands may have significant effects on the efficiency and strength of hybridization between nucleic acid strands. This may be of particular importance in amplification reactions, as well as detection methods which depend upon binding between nucleic acids. For the sake of convenience, the terms âpolynucleotidesâ and âoligonucleotidesâ include molecules which include nucleosides.
The terms âhomologyâ and âhomologousâ as used herein in reference to nucleotide sequences refer to a degree of complementarity with other nucleotide sequences. There may be partial homology or complete homology (i.e., identity). When used in reference to a double-stranded nucleic acid sequence such as a cDNA or genomic clone, the term âsubstantially homologousâ refers to any nucleic acid sequence (e.g., probe) which can hybridize to either or both strands of the double-stranded nucleic acid sequence under conditions of low stringency as described above. A nucleotide sequence which is partially complementary, i.e., âsubstantially homologous,â to a nucleic acid sequence is one that at least partially inhibits a completely complementary sequence from hybridizing to a target nucleic acid sequence. The inhibition of hybridization of the completely complementary sequence to the target sequence may be examined using a hybridization assay (Southern or Northern blot, solution hybridization and the like) under conditions of low stringency. A substantially homologous sequence or probe will compete for and inhibit the binding (i.e., the hybridization) of a completely homologous sequence to a target sequence under conditions of low stringency. This is not to say that conditions of low stringency are such that non-specific binding is permitted; low stringency conditions require that the binding of two sequences to one another be a specific (i.e., selective) interaction. The absence of non-specific binding may be tested by the use of a second target sequence which lacks even a partial degree of complementarity (e.g., less than about 30% identity); in the absence of non-specific binding the probe will not hybridize to the second non-complementary target.
Low stringency conditions comprise conditions equivalent to binding or hybridization at 68° C. in a solution consisting of 5ĂSSPE (43.8 g/l NaCl, 6.9 g/l NaH2PO4¡H2O and 1.85 g/l EDTA, pH adjusted to 7.4 with NaOH), 0.1% SDS, 5ĂDenhardt's reagent (50ĂDenhardt's contains per 500 ml: 5 g Ficoll (Type 400, Pharmacia), 5 g BSA (Fraction V; Sigma)) and 100 Îźg/ml denatured salmon sperm DNA followed by washing in a solution comprising 2.0ĂSSPE, 0.1% SDS at room temperature when a probe of about 100 to about 1000 nucleotides in length is employed.
In addition, conditions which promote hybridization under conditions of high stringency (e.g., increasing the temperature of the hybridization and/or wash steps, the use of formamide in the hybridization solution, etc.) are well known in the art. High stringency conditions, when used in reference to nucleic acid hybridization, comprise conditions equivalent to binding or hybridization at 68° C. in a solution consisting of 5ĂSSPE, 1% SDS, 5ĂDenhardt's reagent and 100 g/ml denatured salmon sperm DNA followed by washing in a solution comprising 0.1ĂSSPE and 0.1% SDS at 68° C. when a probe of about 100 to about 1000 nucleotides in length is employed.
It is well known in the art that numerous equivalent conditions may be employed to comprise low stringency conditions; factors such as the length and nature (DNA, RNA, base composition) of the probe and nature of the target (DNA, RNA, base composition, present in solution or immobilized, etc.) and the concentration of the salts and other components (e.g., the presence or absence of formamide, dextran sulfate, polyethylene glycol), as well as components of the hybridization solution may be varied to generate conditions of low stringency hybridization different from, but equivalent to, the above listed conditions.
The term âequivalentâ when made in reference to a hybridization condition as it relates to a hybridization condition of interest means that the hybridization condition and the hybridization condition of interest result in hybridization of nucleic acid sequences which have the same range of percent (%) homology. For example, if a hybridization condition of interest results in hybridization of a first nucleic acid sequence with other nucleic acid sequences that have from 50% to 70% homology to the first nucleic acid sequence, then another hybridization condition is said to be equivalent to the hybridization condition of interest if this other hybridization condition also results in hybridization of the first nucleic acid sequence with the other nucleic acid sequences that have from 50% to 70% homology to the first nucleic acid sequence.
As used herein, the term âhybridizationâ is used in reference to the pairing of complementary nucleic acids using any process by which a strand of nucleic acid joins with a complementary strand through base pairing to form a hybridization complex. Hybridization and the strength of hybridization (i.e., the strength of the association between the nucleic acids) is impacted by such factors as the degree of complementarity between the nucleic acids, stringency of the conditions involved, the Tm of the formed hybrid, and the G:C ratio within the nucleic acids.
As used herein the term âhybridization complexâ refers to a complex formed between two nucleic acid sequences by virtue of the formation of hydrogen bonds between complementary G and C bases and between complementary A and T bases; these hydrogen bonds may be further stabilized by base stacking interactions. The two complementary nucleic acid sequences hydrogen bond in an antiparallel configuration. A hybridization complex may be formed in solution (e.g., Cot or Rot analysis) or between one nucleic acid sequence present in solution and another nucleic acid sequence immobilized to a solid support (e.g., a nylon membrane or a nitrocellulose filter as employed in Southern and Northern blotting, dot blotting or a glass slide as employed in in situ hybridization, including FISH (fluorescent in situ hybridization)).
As used herein, the term âTmâ is used in reference to the âmelting temperature.â The melting temperature is the temperature at which a population of double-stranded nucleic acid molecules becomes half dissociated into single strands. The equation for calculating the Tm of nucleic acids is well known in the art. As indicated by standard references, a simple estimate of the Tm value may be calculated by the equation: Tm=81.5+0.41 (% G+C), when a nucleic acid is in aqueous solution at 1 M NaCl (see e.g., Anderson and Young, Quantitative Filter Hybridization, in Nucleic Acid Hybridization, 1985). Other references include more sophisticated computations which take structural as well as sequence characteristics into account for the calculation of Tm.
As used herein the term âstringencyâ is used in reference to the conditions of temperature, ionic strength, and the presence of other compounds such as organic solvents, under which nucleic acid hybridizations are conducted. âStringencyâ typically occurs in a range from about Tmâ5° C. (5° C. below the melting temperature of the probe) to about 20° C. to 25° C. below Tm. As will be understood by those of skill in the art, a stringent hybridization can be used to identify or detect identical polynucleotide sequences or to identify or detect similar or related polynucleotide sequences.
The terms âspecific binding,â âbinding specificity,â and grammatical equivalents thereof when made in reference to the binding of a first nucleotide sequence to a second nucleotide sequence, refer to the preferential interaction between the first nucleotide sequence with the second nucleotide sequence as compared to the interaction between the second nucleotide sequence with a third nucleotide sequence. Specific binding is a relative term that does not require absolute specificity of binding; in other words, the term âspecific bindingâ does not require that the second nucleotide sequence interact with the first nucleotide sequence in the absence of an interaction between the second nucleotide sequence and the third nucleotide sequence. Rather, it is sufficient that the level of interaction between the first nucleotide sequence and the second nucleotide sequence is greater than the level of interaction between the second nucleotide sequence with the third nucleotide sequence. âSpecific bindingâ of a first nucleotide sequence with a second nucleotide sequence also means that the interaction between the first nucleotide sequence and the second nucleotide sequence is dependent upon the presence of a particular structure on or within the first nucleotide sequence; in other words the second nucleotide sequence is recognizing and binding to a specific structure on or within the first nucleotide sequence rather than to nucleic acids or to nucleotide sequences in general. For example, if a second nucleotide sequence is specific for structure âAâ that is on or within a first nucleotide sequence, the presence of a third nucleic acid sequence containing structure A will reduce the amount of the second nucleotide sequence which is bound to the first nucleotide sequence.
As used herein, the term âamplifiable nucleic acidâ is used in reference to nucleic acids which may be amplified by any amplification method. It is contemplated that âamplifiable nucleic acidâ will usually comprise âsample template.â
The terms âheterologous nucleic acid sequenceâ or âheterologous DNAâ are used interchangeably to refer to a nucleotide sequence which is ligated to a nucleic acid sequence to which it is not ligated in nature, or to which it is ligated at a different location in nature. Heterologous DNA is not endogenous to the cell into which it is introduced, but has been obtained from another cell. Generally, although not necessarily, such heterologous DNA encodes RNA and proteins that are not normally produced by the cell into which it is expressed. Examples of heterologous DNA include reporter genes, transcriptional and translational regulatory sequences, selectable marker proteins (e.g., proteins which confer drug resistance), etc.
âAmplificationâ is defined as the production of additional copies of a nucleic acid sequence and is generally carried out using polymerase chain reaction technologies well known in the art (Dieffenbach C W and G S Dveksler (1995) PCR Primer, a Laboratory Manual, Cold Spring Harbor Press, Plainview, N.Y.). As used herein, the term âpolymerase chain reactionâ (âPCRâ) refers to the method of K. B. Mullis U.S. Pat. Nos. 4,683,195, and 4,683,202, hereby incorporated by reference, which describe a method for increasing the concentration of a segment of a target sequence in a mixture of genomic DNA without cloning or purification. The length of the amplified segment of the desired target sequence is determined by the relative positions of two oligonucleotide primers with respect to each other, and therefore, this length is a controllable parameter. By virtue of the repeating aspect of the process, the method is referred to as the âpolymerase chain reactionâ (âPCRâ). Because the desired amplified segments of the target sequence become the predominant sequences (in terms of concentration) in the mixture, they are said to be âPCR amplified.â
With PCR, it is possible to amplify a single copy of a specific target sequence in genomic DNA to a level detectable by several different methodologies (e.g., hybridization with a labeled probe; incorporation of biotinylated primers followed by avidin-enzyme conjugate detection; incorporation of 32P-labeled deoxynucleotide triphosphates, such as dCTP or dATP, into the amplified segment). In addition to genomic DNA, any oligonucleotide sequence can be amplified with the appropriate set of primer molecules. In particular, the amplified segments created by the PCR process itself are, themselves, efficient templates for subsequent PCR amplifications.
One such preferred method, particularly for commercial applications, is based on the widely used TaqManÂŽ real-time PCR technology, and combines Allele-Specific PCR with a Blocking reagent (ASB-PCR) to suppress amplification of the wildtype allele. ASB-PCR can be used for detection of germ line or somatic mutations in either DNA or RNA extracted from any type of tissue, including formalin-fixed paraffin-embedded tumor specimens. A set of reagent design rules are developed enabling sensitive and selective detection of single point substitutions, insertions, or deletions against a background of wild-type allele in thousand-fold or greater excess. (Morlan J, Baker J, Sinicropi D Mutation Detection by Real-Time PCR: A Simple, Robust and Highly Selective Method. PLoS ONE 4(2): e4584, 2009)
The terms âreverse transcription polymerase chain reactionâ and âRT-PCRâ refer to a method for reverse transcription of an RNA sequence to generate a mixture of cDNA sequences, followed by increasing the concentration of a desired segment of the transcribed cDNA sequences in the mixture without cloning or purification. Typically, RNA is reverse transcribed using a single primer (e.g., an oligo-dT primer) prior to PCR amplification of the desired segment of the transcribed DNA using two primers.
As used herein, the term âprimerâ refers to an oligonucleotide, whether occurring naturally as in a purified restriction digest or produced synthetically, which is capable of acting as a point of initiation of synthesis when placed under conditions in which synthesis of a primer extension product which is complementary to a nucleic acid strand is induced, (i.e., in the presence of nucleotides and of an inducing agent such as DNA polymerase and at a suitable temperature and pH). In some embodiments, the primer is single stranded for maximum efficiency in amplification, but may alternatively be double stranded. If double stranded, the primer is first treated to separate its strands before being used to prepare extension products. In some embodiments, the primer is an oligodeoxyribonucleotide. The primer must be sufficiently long to prime the synthesis of extension products in the presence of the inducing agent. The exact lengths of the primers will depend on many factors, including temperature, source of primer and the use of the method.
As used herein, the term âprobeâ refers to an oligonucleotide (i.e., a sequence of nucleotides), whether occurring naturally as in a purified restriction digest or produced synthetically, recombinantly or by PCR amplification, which is capable of hybridizing to another oligonucleotide of interest. A probe may be single-stranded or double-stranded. Probes are useful in the detection, identification and isolation of particular gene sequences. It is contemplated that any probe used in the present disclosure will be labeled with any âreporter molecule,â so that it is detectable in any detection system, including, but not limited to enzyme (e.g., ELISA, as well as enzyme-based histochemical assays), fluorescent, radioactive, and luminescent systems. It is not intended that the present disclosure be limited to any particular detection system or label.
As used herein, the terms ârestriction endonucleasesâ and ârestriction enzymesâ refer to bacterial enzymes, each of which cut or nick double- or single-stranded DNA at or near a specific nucleotide sequence, for example, an endonuclease domain of a type IIS restriction endonuclease (e.g., FokI can be used, as taught by Kim et al., 1996, Proc. Nat'l. Acad. Sci. USA, 6:1 156-60).
As used herein, the term âan oligonucleotide having a nucleotide sequence encoding a geneâ means a nucleic acid sequence comprising the coding region of a gene, i.e. the nucleic acid sequence which encodes a gene product. The coding region may be present in either a cDNA, genomic DNA or RNA form. When present in a DNA form, the oligonucleotide may be single-stranded (i.e., the sense strand) or double-stranded. Additionally âan oligonucleotide having a nucleotide sequence encoding a geneâ may include suitable control elements such as enhancers, promoters, splice junctions, polyadenylation signals, etc. if needed to permit proper initiation of transcription and/or correct processing of the primary RNA transcript. Further still, the coding region of the present disclosure may contain endogenous enhancers, splice junctions, intervening sequences, polyadenylation signals, etc.
Transcriptional control signals in eukaryotes comprise âenhancerâ elements. Enhancers consist of short arrays of DNA sequences that interact specifically with cellular proteins involved in transcription (Maniatis, T. et al., Science 236:1237, 1987). Enhancer elements have been isolated from a variety of eukaryotic sources including genes in plant, yeast, insect and mammalian cells and viruses. The selection of a particular enhancer depends on what cell type is to be used to express the protein of interest.
The presence of âsplicing signalsâ on an expression vector often results in higher levels of expression of the recombinant transcript. Splicing signals mediate the removal of introns from the primary RNA transcript and consist of a splice donor and acceptor site (Sambrook, J. et al., Molecular Cloning: A Laboratory Manual, 2nd ed., Cold Spring Harbor Laboratory Press, New York, pp. 16.7-16.8, 1989). A commonly used splice donor and acceptor site is the splice junction from the 16S RNA of SV40.
Efficient expression of recombinant DNA sequences in eukaryotic cells requires expression of signals directing the efficient termination and polyadenylation of the resulting transcript. Transcription termination signals are generally found downstream of the polyadenylation signal and are a few hundred nucleotides in length. The term âpoly A siteâ or âpoly A sequenceâ as used herein denotes a DNA sequence which directs both the termination and polyadenylation of the nascent RNA transcript. Efficient polyadenylation of the recombinant transcript is desirable as transcripts lacking a poly A tail are unstable and are rapidly degraded. The poly A signal utilized in an expression vector may be âheterologousâ or âendogenous.â An endogenous poly A signal is one that is found naturally at the 3Ⲡend of the coding region of a given gene in the genome. A heterologous poly A signal is one which is isolated from one gene and placed 3Ⲡof another gene.
The term âpromoter,â âpromoter elementâ or âpromoter sequenceâ as used herein, refers to a DNA sequence which when placed at the 5Ⲡend of (i.e., precedes) an oligonucleotide sequence is capable of controlling the transcription of the oligonucleotide sequence into mRNA. A promoter is typically located 5Ⲡ(i.e., upstream) of an oligonucleotide sequence whose transcription into mRNA it controls, and provides a site for specific binding by RNA polymerase and for initiation of transcription.
The term âpromoter activityâ when made in reference to a nucleic acid sequence refers to the ability of the nucleic acid sequence to initiate transcription of an oligonucleotide sequence into mRNA.
The term âtissue specificâ as it applies to a promoter refers to a promoter that is capable of directing selective expression of an oligonucleotide sequence to a specific type of tissue in the relative absence of expression of the same oligonucleotide in a different type of tissue. Tissue specificity of a promoter may be evaluated by, for example, operably linking a reporter gene to the promoter sequence to generate a reporter construct, introducing the reporter construct into the genome of a plant or an animal such that the reporter construct is integrated into every tissue of the resulting transgenic animal, and detecting the expression of the reporter gene (e.g., detecting mRNA, protein, or the activity of a protein encoded by the reporter gene) in different tissues of the transgenic plant or animal. Selectivity need not be absolute. The detection of a greater level of expression of the reporter gene in one or more tissues relative to the level of expression of the reporter gene in other tissues shows that the promoter is specific for the tissues in which greater levels of expression are detected.
The term âcell type specificâ as applied to a promoter refers to a promoter which is capable of directing selective expression of an oligonucleotide sequence in a specific type of cell in the relative absence of expression of the same oligonucleotide sequence in a different type of cell within the same tissue. The term âcell type specificâ when applied to a promoter also means a promoter capable of promoting selective expression of an oligonucleotide in a region within a single tissue. Again, selectivity need not be absolute. Cell type specificity of a promoter may be assessed using methods well known in the art, e.g., immunohistochemical staining as described herein. Briefly, tissue sections are embedded in paraffin, and paraffin sections are reacted with a primary antibody which is specific for the polypeptide product encoded by the oligonucleotide sequence whose expression is controlled by the promoter. As an alternative to paraffin sectioning, samples may be cryosectioned. For example, sections may be frozen prior to and during sectioning thus avoiding potential interference by residual paraffin. A labeled (e.g., peroxidase conjugated) secondary antibody which is specific for the primary antibody is allowed to bind to the sectioned tissue and specific binding detected (e.g., with avidin/biotin) by microscopy.
The terms âselective expression,â âselectively expressâ and grammatical equivalents thereof refer to a comparison of relative levels of expression in two or more regions of interest. For example, âselective expressionâ when used in connection with tissues refers to a substantially greater level of expression of a gene of interest in a particular tissue, or to a substantially greater number of cells which express the gene within that tissue, as compared, respectively, to the level of expression of, and the number of cells expressing, the same gene in another tissue (i.e., selectivity need not be absolute). Selective expression does not require, although it may include, expression of a gene of interest in a particular tissue and a total absence of expression of the same gene in another tissue. Similarly, âselective expressionâ as used herein in reference to cell types refers to a substantially greater level of expression of, or a substantially greater number of cells which express, a gene of interest in a particular cell type, when compared, respectively, to the expression levels of the gene and to the number of cells expressing the gene in another cell type.
The term âcontiguousâ when used in reference to two or more nucleotide sequences means the nucleotide sequences are ligated in tandem either in the absence of intervening sequences, or in the presence of intervening sequences which do not comprise one or more control elements.
As used herein, the terms ânucleic acid molecule encoding,â ânucleotide encoding,â âDNA sequence encodingâ and âDNA encodingâ refer to the order or sequence of deoxyribonucleotides along a strand of deoxyribonucleic acid. The order of these deoxyribonucleotides determines the order of amino acids along the polypeptide (protein) chain. The DNA sequence thus codes for the amino acid sequence.
The term âisolatedâ when used in relation to a nucleic acid, as in âan isolated oligonucleotideâ refers to a nucleic acid sequence that is separated from at least one contaminant nucleic acid with which it is ordinarily associated in its natural source. Isolated nucleic acid is nucleic acid present in a form or setting that is different from that in which it is found in nature. In contrast, non-isolated nucleic acids are nucleic acids such as DNA and RNA which are found in the state they exist in nature. For example, a given DNA sequence (e.g., a gene) is found on the host cell chromosome in proximity to neighboring genes; RNA sequences, such as a specific mRNA sequence encoding a specific protein, are found in the cell as a mixture with numerous other mRNAs which encode a multitude of proteins. However, isolated nucleic acid encoding a polypeptide of interest includes, by way of example, such nucleic acid in cells ordinarily expressing the polypeptide of interest where the nucleic acid is in a chromosomal or extrachromosomal location different from that of natural cells, or is otherwise flanked by a different nucleic acid sequence than that found in nature. The isolated nucleic acid or oligonucleotide may be present in single-stranded or double-stranded form. Isolated nucleic acid can be readily identified (if desired) by a variety of techniques (e.g., hybridization, dot blotting, etc.). When an isolated nucleic acid or oligonucleotide is to be utilized to express a protein, the oligonucleotide will contain at a minimum the sense or coding strand (i.e., the oligonucleotide may be single-stranded). Alternatively, it may contain both the sense and anti-sense strands (i.e., the oligonucleotide may be double-stranded).
As used herein, the term âpurifiedâ or âto purifyâ refers to the removal of one or more (undesired) components from a sample. For example, where recombinant polypeptides are expressed in bacterial host cells, the polypeptides are purified by the removal of host cell proteins thereby increasing the percent of recombinant polypeptides in the sample.
As used herein, the term âsubstantially purifiedâ refers to molecules, either nucleic or amino acid sequences, that are removed from their natural environment, isolated or separated, and are at least 60% free, in some embodiments 75% free and other embodiments 90% free from other components with which they are naturally associated. An âisolated polynucleotideâ is, therefore, a substantially purified polynucleotide.
As used herein the term âcoding regionâ when used in reference to a structural gene refers to the nucleotide sequences which encode the amino acids found in the nascent polypeptide as a result of translation of a mRNA molecule. The coding region is bounded, in eukaryotes, on the 5Ⲡside generally by the nucleotide triplet âATGâ which encodes the initiator methionine and on the 3Ⲡside by one of the three triplets which specify stop codons (i.e., TAA, TAG, TGA).
By âcoding sequenceâ is meant a sequence of a nucleic acid or its complement, or a part thereof, that can be transcribed and/or translated to produce the mRNA for and/or the polypeptide or a fragment thereof. Coding sequences include exons in a genomic DNA or immature primary RNA transcripts, which are joined together by the cell's biochemical machinery to provide a mature mRNA. The anti-sense strand is the complement of such a nucleic acid, and the encoding sequence can be deduced therefrom.
By ânon-coding sequenceâ is meant a sequence of a nucleic acid or its complement, or a part thereof that is not transcribed into amino acid in vivo, or where tRNA does not interact to place or attempt to place an amino acid. Non-coding sequences include both intron sequences in genomic DNA or immature primary RNA transcripts, and gene-associated sequences such as promoters, enhancers, silencers, etc.
As used herein, the term âstructural geneâ or âstructural nucleotide sequenceâ refers to a DNA sequence coding for RNA or a protein which does not control the expression of other genes. In contrast, a âregulatory geneâ or âregulatory sequenceâ is a structural gene which encodes products (e.g., transcription factors) which control the expression of other genes.
As used herein, the term âregulatory elementâ refers to a genetic element which controls some aspect of the expression of nucleic acid sequences. For example, a promoter is a regulatory element which facilitates the initiation of transcription of an operably linked coding region. Other regulatory elements include splicing signals, polyadenylation signals, termination signals, etc.
As used herein, the term âpeptide transcription factor binding siteâ or âtranscription factor binding siteâ refers to a nucleotide sequence which binds protein transcription factors and, thereby, controls some aspect of the expression of nucleic acid sequences. For example, Sp-1 and AP1 (activator protein 1) binding sites are examples of peptide transcription factor binding sites.
As used herein, the term âgeneâ means the deoxyribonucleotide sequences comprising the coding region of a structural gene. A âgeneâ may also include non-translated sequences located adjacent to the coding region on both the 5Ⲡand 3Ⲡends such that the gene corresponds to the length of the full-length mRNA. The sequences which are located 5Ⲡof the coding region and which are present on the mRNA are referred to as 5Ⲡnon-translated sequences. The sequences which are located 3Ⲡor downstream of the coding region and which are present on the mRNA are referred to as 3Ⲡnon-translated sequences. The term âgeneâ encompasses both cDNA and genomic forms of a gene. A genomic form or clone of a gene contains the coding region interrupted with non-coding sequences termed âintronsâ or âintervening regionsâ or âintervening sequences.â Introns are segments of a gene which are transcribed into heterogenous nuclear RNA (hnRNA); introns may contain regulatory elements such as enhancers. Introns are removed or âspliced outâ from the nuclear or primary transcript; introns therefore are absent in the messenger RNA (mRNA) transcript. The mRNA functions during translation to specify the sequence or order of amino acids in a nascent polypeptide. A gene is generally a single locus. In a normal diploid organism, a gene has two alleles. In tetraploid potato, however, each gene has 4 alleles. In sugarcane, which is dodecaploid there can be 12 alleles per gene. Particular examples include flax which has two EPSPS loci each with two alleles and rice which has a single homomeric plastidal ACCase with two alleles.
In addition to containing introns, genomic forms of a gene may also include sequences located on both the 5Ⲡand 3Ⲡend of the sequences which are present on the RNA transcript. These sequences are referred to as âflankingâ sequences or regions (these flanking sequences are located 5Ⲡor 3Ⲡto the non-translated sequences present on the mRNA transcript). The 5Ⲡflanking region may contain regulatory sequences such as promoters and enhancers which control or influence the transcription of the gene. The 3Ⲡflanking region may contain sequences which direct the termination of transcription, post-transcriptional cleavage and polyadenylation.
A ânon-human animalâ refers to any animal which is not a human and includes vertebrates such as rodents, non-human primates, ovines, bovines, ruminants, lagomorphs, porcines, caprines, equines, canines, felines, aves, etc. Preferred non-human animals are selected from the order Rodentia. âNon-human animalâ additionally refers to amphibians (e.g. Xenopus), reptiles, insects (e.g. Drosophila) and other non-mammalian animal species.
As used herein, the term âtransgenicâ refers to an organism or cell that has DNA derived from another organism inserted into which becomes integrated into the genome either of somatic and/or germ line cells of the plant or animal. A âtransgeneâ means a DNA sequence which is partly or entirely heterologous (i.e., not present in nature) to the plant or animal in which it is found, or which is homologous to an endogenous sequence (i.e., a sequence that is found in the animal in nature) and is inserted into the plantâ or animal's genome at a location which differs from that of the naturally occurring sequence. Transgenic plants or animals which include one or more transgenes are within the scope of this disclosure. Additionally, a âtransgenicâ as used herein refers to an organism that has had one or more genes modified and/or âknocked outâ (made non-functional or made to function at reduced level, i.e., a âknockoutâ mutation) by the disclosure's methods, by homologous recombination, TFO mutation or by similar processes. For example, in some embodiments, a transgenic organism or cell includes inserted DNA that includes a foreign promoter and/or coding region.
A âtransformed cellâ is a cell or cell line that has acquired the ability to grow in cell culture for multiple generations, the ability to grow in soft agar, and/or the ability to not have cell growth inhibited by cell-to-cell contact. In this regard, transformation refers to the introduction of foreign genetic material into a cell or organism. Transformation may be accomplished by any method known which permits the successful introduction of nucleic acids into cells and which results in the expression of the introduced nucleic acid. âTransformationâ includes but is not limited to such methods as transfection, microinjection, electroporation, nucleofection and lipofection (liposome-mediated gene transfer). Transformation may be accomplished through use of any expression vector. For example, the use of baculovirus to introduce foreign nucleic acid into insect cells is contemplated. The term âtransformationâ also includes methods such as P-element mediated germline transformation of whole insects. Additionally, transformation refers to cells that have been transformed naturally, usually through genetic mutation.
As used herein âexogenousâ means that the gene encoding the protein is not normally expressed in the cell. Additionally, âexogenousâ refers to a gene transfected into a cell to augment the normal (i.e. natural) level of expression of that gene.
A peptide sequence and nucleotide sequence may be âendogenousâ or âheterologousâ (i.e., âforeignâ). The term âendogenousâ refers to a sequence which is naturally found in the cell into which it is introduced so long as it does not contain some modification relative to the naturally-occurring sequence. The term âheterologousâ refers to a sequence which is not endogenous to the cell into which it is introduced. For example, heterologous DNA includes a nucleotide sequence which is ligated to, or is manipulated to become ligated to, a nucleic acid sequence to which it is not ligated in nature, or to which it is ligated at a different location in nature. Heterologous DNA also includes a nucleotide sequence which is naturally found in the cell into which it is introduced and which contains some modification relative to the naturally-occurring sequence. Generally, although not necessarily, heterologous DNA encodes heterologous RNA and heterologous proteins that are not normally produced by the cell into which it is introduced. Examples of heterologous DNA include reporter genes, transcriptional and translational regulatory sequences, DNA sequences which encode selectable marker proteins (e.g., proteins which confer drug resistance), etc.
The nucleic acid molecules disclosed herein (e.g., site specific nucleases, or guide RNA for CRISPRs) can be used in the production of recombinant nucleic acid constructs. In one embodiment, the nucleic acid molecules of the present disclosure can be used in the preparation of nucleic acid constructs, for example, expression cassettes for expression in the plant, microorganism, or animal of interest. This expression may be transient for instance when the construct is not integrated into the host genome or maintained under the control offered by the promoter and the position of the construct within the host's genome if it becomes integrated.
Expression cassettes may include regulatory sequences operably linked to the site specific nuclease or guide RNA sequences disclosed herein. The cassette may additionally contain at least one additional gene to be co-transformed into the organism. Alternatively, the additional gene(s) can be provided on multiple expression cassettes.
The nucleic acid constructs may be provided with a plurality of restriction sites for insertion of the site specific nuclease coding sequence to be under the transcriptional regulation of the regulatory regions. The nucleic acid constructs may additionally contain nucleic acid molecules encoding for selectable marker genes.
Any promoter can be used in the production of the nucleic acid constructs. The promoter may be native or analogous, or foreign or heterologous, to the plant, microbial, or animal host nucleic acid sequences disclosed herein. Additionally, the promoter may be the natural sequence or alternatively a synthetic sequence. Where the promoter is âforeignâ or âheterologousâ to the plant, microbial, or animal host, it is intended that the promoter is not found in the native plant, microbial, or animal into which the promoter is introduced. As used herein, a chimeric gene comprises a coding sequence operably linked to a transcription initiation region that is heterologous to the coding sequence.
The site directed nuclease sequences disclosed herein may be expressed using heterologous promoters.
Any promoter can be used in the preparation of constructs to control the expression of the site directed nuclease sequences, such as promoters providing for constitutive, tissue-preferred, inducible, or other promoters for expression in plants, microbes, or animals. Constitutive promoters include, for example, the core promoter of the Rsyn7 promoter and other constitutive promoters disclosed in WO 99/43 838 and U.S. Pat. No. 6,072,050; the core CaMV 35S promoter (Odell et al. Nature 313:810-812; 1985); rice actin (McElroy et al., Plant Cell 2:163-171, 1990); ubiquitin (Christensen et al., Plant Mol. Biol. 12:619-632, 1989 and Christensen et al., Plant Mol. Biol. 18:675-689, 1992); pEMU (Last et al., Theor. Appl. Genet. 81:581-588, 1991); MAS (Velten et al., EMBO J. 3:2723-2730, 1984); ALS promoter (U.S. Pat. No. 5,659,026), and the like. Other constitutive promoters include, for example, U.S. Pat. Nos. 5,608,149; 5,608,144; 5,604,121; 5,569,597; 5,466,785; 5,399,680; 5,268,463; 5,608,142; and 6,177,611.
Tissue-preferred promoters can be utilized to direct site directed nuclease expression within a particular plant tissue. Such tissue-preferred promoters include, but are not limited to, leaf-preferred promoters, root-preferred promoters, seed-preferred promoters, and stem-preferred promoters. Tissue-preferred promoters include Yamamoto et al., Plant J. 12(2):255-265, 1997; Kawamata et al., Plant Cell Physiol. 38(7):792-803, 1997; Hansen et al., Mol. Gen Genet. 254(3):337-343, 1997; Russell et al., Transgenic Res. 6(2):157-168, 1997; Rinehart et al., Plant Physiol. 1 12(3):1331-1341, 1996; Van Camp et al., Plant Physiol. 1 12(2):525-535, 1996; Canevascini et al., Plant Physiol. 112(2): 513-524, 1996; Yamamoto et al., Plant Cell Physiol. 35(5):773-778, 1994; Lam, Results Probl. Cell Differ. 20:181-196, 1994; Orozco et al. Plant Mol Biol. 23(6):1129-1138, 1993; Matsuoka et al., Proc Nat'l. Acad. Sci. USA 90(20):9586-9590, 1993; and Guevara-Garcia et al., Plant J. 4(3):495-505, 1993.
The nucleic acid constructs may also include transcription termination regions. Where transcription terminations regions are used, any termination region may be used in the preparation of the nucleic acid constructs. For example, the termination region may be derived from another source (i.e., foreign or heterologous to the promoter). Examples of termination regions that are available for use in the constructs of the present disclosure include those from the Ti-plasmid of A. tumefaciens, such as the octopine synthase and nopaline synthase termination regions. See also Guerineau et al., Mol. Gen. Genet. 262:141-144, 1991; Proudfoot, Cell 64:671-674, 1991; Sanfacon et al., Genes Dev. 5:141-149, 1991; Mogen et al., Plant Cell 2:1261-1272, 1990; Munroe et al., Gene 91:151-158, 1990; Ballas et al., Nucleic Acids Res. 17:7891-7903, 1989; and Joshi et al., Nucleic Acid Res. 15:9627-9639, 1987.
In conjunction with any of the aspects, embodiments, methods and/or compositions disclosed herein, the nucleic acids may be optimized for increased expression in the transformed plant. That is, the nucleic acids encoding the site directed nuclease proteins can be synthesized using plant-preferred codons for improved expression. See, for example, Campbell and Gowri, (Plant Physiol. 92:1-11, 1990) for a discussion of host-preferred codon usage. Methods are available in the art for synthesizing plant-preferred genes. See, for example, U.S. Pat. Nos. 5,380,831, and 5,436,391, and Murray et al., Nucleic Acids Res. 17:477-498, 1989. See also e.g., Lanza et al., BMC Systems Biology 8:33-43, 2014; Burgess-Brown et al., Protein Expr. Purif. 59:94-102, 2008; Gustafsson et al., Trends Biotechnol 22:346-353, 2004.
In addition, other sequence modifications can be made to the nucleic acid sequences disclosed herein. For example, additional sequence modifications are known to enhance gene expression in a cellular host. These include elimination of sequences encoding spurious polyadenylation signals, exon/intron splice site signals, transposon-like repeats, and other such well-characterized sequences that may be deleterious to gene expression. The G-C content of the sequence may also be adjusted to levels average for a target cellular host, as calculated by reference to known genes expressed in the host cell. In addition, the sequence can be modified to avoid predicted hairpin secondary mRNA structures.
Other nucleic acid sequences may also be used in the preparation of the constructs of the present disclosure, for example to enhance the expression of the site directed nuclease coding sequence. Such nucleic acid sequences include the introns of the maize AdhI, intronl gene (Callis et al., Genes and Development 1:1183-1200, 1987), and leader sequences, (W-sequence) from the Tobacco Mosaic virus (TMV), Maize Chlorotic Mottle Virus and Alfalfa Mosaic Virus (Gallie et al., Nucleic Acid Res. 15:8693-8711, 1987; and Skuzeski et al., Plant Mol. Biol. 15:65-79, 1990). The first intron from the shrunken-1 locus of maize has been shown to increase expression of genes in chimeric gene constructs. U.S. Pat. Nos. 5,424,412 and 5,593,874 disclose the use of specific introns in gene expression constructs, and Gallie et al. (Plant Physiol. 106:929-939, 1994) also have shown that introns are useful for regulating gene expression on a tissue specific basis. To further enhance or to optimize site directed nuclease gene expression, the plant expression vectors disclosed herein may also contain DNA sequences containing matrix attachment regions (MARs). Plant cells transformed with such modified expression systems, then, may exhibit overexpression or constitutive expression of a nucleotide sequence of the disclosure.
The expression constructs disclosed herein can also include nucleic acid sequences capable of directing the expression of the site directed nuclease sequence to the chloroplast or other organelles and structures in both prokaryotes and eukaryotes. Such nucleic acid sequences include chloroplast targeting sequences that encodes a chloroplast transit peptide to direct the gene product of interest to plant cell chloroplasts. Such transit peptides are known in the art. With respect to chloroplast-targeting sequences, âoperably linkedâ means that the nucleic acid sequence encoding a transit peptide (i.e., the chloroplast-targeting sequence) is linked to the site directed nuclease nucleic acid molecules disclosed herein such that the two sequences are contiguous and in the same reading frame. See, for example, Von Heijne et al., Plant Mol. Biol. Rep. 9:104-126, 1991; Clark et al., J. Biol. Chem. 264:17544-17550, 1989; Della-Cioppa et al., Plant Physiol. 84:965-968, 1987; Romer et al., Biochem. Biophys. Res. Commun. 196:1414-1421, 1993; and Shah et al., Science 233:478-481, 1986.
Chloroplast targeting sequences are known in the art and include the chloroplast small subunit of ribulose-1,5-bisphosphate carboxylase (Rubisco) (de Castro Silva Filho et al., Plant Mol. Biol. 30:769-780, 1996; Schnell et al., J. Biol. Chem. 266(5):3335-3342, 1991); 5-(enolpyruvyl)shikimate-3-phosphate synthase (EPSPS) (Archer et al., J. Bioenerg. Biomemb. 22(6):789-810, 1990); tryptophan synthase (Zhao et al., J. Biol. Chem. 270(11):6081-6087, 1995); plastocyanin (Lawrence et al., J. Biol. Chem. 272(33):20357-20363, 1997); chorismate synthase (Schmidt et al., J. Biol. Chem. 268(36):27447-27457, 1993); and the light harvesting chlorophyll a/b binding protein (LHBP) (Lamppa et al., J. Biol. Chem. 263:14996-14999, 1988). See also Von Heijne et al., Plant Mol. Biol. Rep. 9:104-126, 1991; Clark et al., J. Biol. Chem. 264:17544-17550, 1989; Della-Cioppa et al., Plant Physiol. 84:965-968, 1987; Romer et al., Biochem. Biophys. Res. Commun. 196:1414-1421, 1993; and Shah et al., Science 233: 478-481, 1986.
In conjunction with any of the aspects, embodiments, methods and/or compositions disclosed herein, the nucleic acid constructs may be prepared to direct the expression of the mutant site directed nuclease coding sequence from the plant cell chloroplast. Methods for transformation of chloroplasts are known in the art. See, for example, Svab et al., Proc. Nat'l. Acad. Sci. USA 87:8526-8530, 1990; Svab and Maliga, Proc. Nat'l. Acad. Sci. USA 90:913-917, 1993; Svab and Maliga, EMBO J. 12:601-606, 1993. The method relies on particle gun delivery of DNA containing a selectable marker and targeting of the DNA to the plastid genome through homologous recombination. Additionally, plastid transformation can be accomplished by transactivation of a silent plastid-borne transgene by tissue-preferred expression of a nuclear-encoded and plastid-directed RNA polymerase. Such a system has been reported in McBride et al. Proc. Nat'l. Acad. Sci. USA 91:7301-7305, 1994.
The nucleic acids of interest to be targeted to the chloroplast may be optimized for expression in the chloroplast to account for differences in codon usage between the plant nucleus and this organelle. In this manner, the nucleic acids of interest may be synthesized using chloroplast-preferred codons. See, for example, U.S. Pat. No. 5,380,831, herein incorporated by reference.
The nucleic acid constructs can be used to transform plant cells and regenerate transgenic plants comprising the site directed nuclease coding sequences. Numerous plant transformation vectors and methods for transforming plants are available. See, for example, U.S. Pat. No. 6,753,458, An, G. et al., Plant Physiol., 81:301-305, 1986; Fry, J. et al., Plant Cell Rep. 6:321-325, 1987; Block, M., Theor. Appl Genet. 76:767-774, 1988; Hinchee et al., Stadler. Genet. Symp. 203212.203-212, 1990; Cousins et al., Aust. J. Plant Physiol. 18:481-494, 1991; Chee, P. P. and Slightom, J. L., Gene. 118:255-260, 1992; Christou et al., Trends. Biotechnol. 10:239-246, 1992; D'Halluin et al., Bio/Technol. 10:309-3 14, 1992; Dhir et al., Plant Physiol. 99:81-88, 1992; Casas et al., Proc. Nat'l. Acad Sci. USA 90:11212-11216, 1993; Christou, P., In Vitro Cell. Dev. Biol.-Plant 29P:1 19-124, 1993; Davies, et al., Plant Cell Rep. 12:180-183, 1993; Dong, J. A. and Mc Hughen, A., Plant Sci. 91:139-148, 1993; Franklin, C. I. and Trieu, T. N., Plant. Physiol. 102:167, 1993; Golovkin et al., Plant Sci. 90:41-52, 1993; Guo Chin Sci. Bull. 38:2072-2078; Asano, et al., Plant Cell Rep. 13, 1994; Ayeres N. M. and Park, W. D., Crit. Rev. Plant. Sci. 13:219-239, 1994; Barcelo et al., Plant. J. 5:583-592, 1994; Becker, et al., Plant. J. 5:299-307, 1994; Borkowska et al., Acta. Physiol Plant. 16:225-230, 1994; Christou, P., Agro. Food. Ind. Hi Tech. 5:17-27, 1994; Eapen et al., Plant Cell Rep. 13:582-586, 1994; Hartman et al., Bio-Technology 12:919923, 1994; Ritala et al., Plant. Mol. Biol. 24:317-325, 1994; and Wan, Y. C. and Lemaux, P. G., Plant Physiol. 104:3748, 1994. The constructs may also be transformed into plant cells using homologous recombination.
The term âwild-typeâ when made in reference to a peptide sequence and nucleotide sequence refers to a peptide sequence and nucleotide sequence (locus/gene/allele), respectively, which has the characteristics of that peptide sequence and nucleotide sequence when isolated from a naturally occurring source. A wild-type peptide sequence and nucleotide sequence is that which is most frequently observed in a population and is thus arbitrarily designated the ânormalâ or âwild-typeâ form of the peptide sequence and nucleotide sequence, respectively. âWild-typeâ may also refer to the sequence at a specific nucleotide position or positions, or the sequence at a particular codon position or positions, or the sequence at a particular amino acid position or positions.
âConsensus sequenceâ is defined as a sequence of amino acids or nucleotides that contain identical amino acids or nucleotides or functionally equivalent amino acids or nucleotides for at least 25% of the sequence. The identical or functionally equivalent amino acids or nucleotides need not be contiguous.
The term âBrassicaâ as used herein refers to plants of the Brassica genus. Exemplary Brassica species include, but are not limited to, B. carinata, B. elongate, B. fruticulosa, B. juncea, B. napus, B. narinosa, B. nigra, B. oleracea, B. perviridis, B. rapa (syn B. campestris), B. rupestris, B. septiceps, and B. tournefortii.
A nucleobase is a base, which in certain preferred embodiments is a purine, pyrimidine, or a derivative or analog thereof. Nucleosides are nucleobases that contain a pentosefuranosyl moiety, e.g. an optionally substituted riboside or 2â˛-deoxyriboside. Nucleosides can be linked by one of several linkage moieties, which may or may not contain phosphorus. Nucleosides that are linked by unsubstituted phosphodiester linkages are termed nucleotides. The term ânucleobaseâ as used herein includes peptide nucleobases, the subunits of peptide nucleic acids, and morpholine nucleobases as well as nucleosides and nucleotides.
An oligonucleobase is a polymer comprising nucleobases; in some embodiments at least a portion of which can hybridize by Watson-Crick base pairing to a DNA having the complementary sequence. An oligonucleobase chain may have a single 5 and 3Ⲡterminus, which are the ultimate nucleobases of the polymer. A particular oligonucleobase chain can contain nucleobases of all types. An oligonucleobase compound is a compound comprising one or more oligonucleobase chains that may be complementary and hybridized by Watson-Crick base pairing. Ribo-type nucleobases include pentosefuranosyl containing nucleobases wherein the 2Ⲡcarbon is a methylene substituted with a hydroxyl, alkyloxy or halogen. Deoxyribo-type nucleobases are nucleobases other than ribo-type nucleobases and include all nucleobases that do not contain a pentosefuranosyl moiety.
In certain embodiments, an oligonucleobase strand may include both oligonucleobase chains and segments or regions of oligonucleobase chains. An oligonucleobase strand may have a 3Ⲡend and a 5Ⲡend, and when an oligonucleobase strand is coextensive with a chain, the 3Ⲡand 5Ⲡends of the strand are also 3Ⲡand 5Ⲡtermini of the chain.
As used herein the term âcodonâ refers to a sequence of three adjacent nucleotides (either RNA or DNA) constituting the genetic code that determines the insertion of a specific amino acid in a polypeptide chain during protein synthesis or the signal to stop protein synthesis. The term âcodonâ is also used to refer to the corresponding (and complementary) sequences of three nucleotides in the messenger RNA into which the original DNA is transcribed.
As used herein, the term âhomologyâ refers to sequence similarity among proteins and DNA. The term âhomologyâ or âhomologousâ refers to a degree of identity. There may be partial homology or complete homology. A partially homologous sequence is one that has less than 100% sequence identity when compared to another sequence.
âHeterozygousâ refers to having different alleles at one or more genetic loci in homologous chromosome segments. As used herein âheterozygousâ may also refer to a sample, a cell, a cell population or an organism in which different alleles at one or more genetic loci may be detected. Heterozygous samples may also be determined via methods known in the art such as, for example, nucleic acid sequencing. For example, if a sequencing electropherogram shows two peaks at a single locus and both peaks are roughly the same size, the sample may be characterized as heterozygous. Or, if one peak is smaller than another, but is at least about 25% the size of the larger peak, the sample may be characterized as heterozygous. In some embodiments, the smaller peak is at least about 15% of the larger peak. In other embodiments, the smaller peak is at least about 10% of the larger peak. In other embodiments, the smaller peak is at least about 5% of the larger peak. In other embodiments, a minimal amount of the smaller peak is detected.
As used herein, âhomozygousâ refers to having identical alleles at one or more genetic loci in homologous chromosome segments. âHomozygousâ may also refer to a sample, a cell, a cell population or an organism in which the same alleles at one or more genetic loci may be detected. Homozygous samples may be determined via methods known in the art, such as, for example, nucleic acid sequencing. For example, if a sequencing electropherogram shows a single peak at a particular locus, the sample may be termed âhomozygousâ with respect to that locus.
The term âhemizygousâ refers to a gene or gene segment being present only once in the genotype of a cell or an organism because the second allele is deleted, or is not present on the homologous chromosome segment. As used herein âhemizygousâ may also refer to a sample, a cell, a cell population or an organism in which an allele at one or more genetic loci may be detected only once in the genotype.
The term âzygosity statusâ as used herein refers to a sample, a cell population, or an organism as appearing heterozygous, homozygous, or hemizygous as determined by testing methods known in the art and described herein. The term âzygosity status of a nucleic acidâ means determining whether the source of nucleic acid appears heterozygous, homozygous, or hemizygous. The âzygosity statusâ may refer to differences in at a single nucleotide position in a sequence. In some methods, the zygosity status of a sample with respect to a single mutation may be categorized as homozygous wild-type, heterozygous (i.e., one wild-type allele and one mutant allele), homozygous mutant, or hemizygous (i.e., a single copy of either the wild-type or mutant allele).
As used herein, the term âRTDSâ refers to The Rapid Trait Development System⢠(RTDS) developed by Cibus. RTDS is a site-specific gene modification system that is effective at making precise changes in a gene sequence without the incorporation of foreign genes or control sequences.
The term âaboutâ as used herein means in quantitative terms plus or minus 10%. For example, âabout 3%â would encompass 2.7-3.3% and âabout 10%â would encompass 9-11%. Moreover, where âaboutâ is used herein in conjunction with a quantitative term it is understood that in addition to the value plus or minus 10%, the exact value of the quantitative term is also contemplated and described. For example, the term âabout 3%â expressly contemplates, describes and includes exactly 3%.
This disclosure generally relates to novel methods to improve the efficiency of the targeting of modifications to specific locations in genomic or other nucleotide sequences. Additionally, this disclosure relates to target DNA that has been modified, mutated or marked by the approaches disclosed herein. The disclosure also relates to cells, tissue, and organisms which have been modified by the disclosure's methods. The present disclosure builds on the development of compositions and methods related in part to the successful conversion system, the Rapid Trait Development System (RTDSâ˘, Cibus US LLC).
RIDS is based on altering a targeted gene by utilizing the cell's own gene repair system to specifically modify the gene sequence in situ and not insert foreign DNA and gene expression control sequences. This procedure effects a precise change in the genetic sequence while the rest of the genome is left unaltered. In contrast to conventional transgenic GMOs, there is no integration of foreign genetic material, nor is any foreign genetic material left in the plant. The changes in the genetic sequence introduced by RIDS are not randomly inserted. Since affected genes remain in their native location, no random, uncontrolled or adverse pattern of expression occurs.
The RTDS that effects this change is a chemically synthesized oligonucleotide (GRON) as described herein which may be composed of both DNA and modified RNA bases as well as other chemical moieties, and is designed to hybridize at the targeted gene location to create a mismatched base-pair(s). This mismatched base-pair acts as a signal to attract the cell's own natural gene repair system to that site and correct (replace, insert or delete) the designated nucleotide(s) within the gene. Once the correction process is complete the RTDS molecule is degraded and the now-modified or repaired gene is expressed under that gene's normal endogenous control mechanisms.
The methods and compositions disclosed herein can be practiced or made with âgene repair oligonucleobasesâ (GRON) having the conformations and chemistries as described in detail herein and below. The âgene repair oligonucleobasesâ as contemplated herein have also been described in published scientific and patent literature using other names including ârecombinagenic oligonucleobases;â âRNA/DNA chimeric oligonucleotides;â âchimeric oligonucleotides;â âmixed duplex oligonucleotidesâ (NIDONs); âRNA DNA oligonucleotides (RDOs);â âgene targeting oligonucleotides;â âgenoplasts;â âsingle stranded modified oliconucleotides;â âSingle stranded oligodeoxynucleotide mutational vectorsâ (ISSOMVs); âduplex mutational vectors;â and âheteroduplex mutational vectors.â The gene repair oligonucleobase can be introduced into a plant cell using any method commonly used in the art, including but not limited to, microcarriers (biolistic delivery), microfibers, polyethylene glycol (PEG)-mediated uptake, electroporation, and microinjection.
In one embodiment, the gene repair oligonucleobase is a mixed duplex oligonucleotides (MDON) in which the RNA-type nucleotides of the mixed duplex oligonucleotide are made RNase resistant by replacing the 2â˛-hydroxyl with a fluoro, chloro or bromo functionality or by placing a substituent on the 2-O. Suitable substituents include the substituents taught by the Kmiec II. Alternative substituents include the substituents taught by U.S. Pat. No. 5,334,711 (Sproat) and the substituents taught by patent publications EP 629 387 and EP 679 657 (collectively, the Martin Applications), which are hereby incorporated by reference. As used herein, a 2â˛-fluoro, chloro or bromo derivative of a ribonucleotide or a ribonucleotide having a T-OH substituted with a substituent described in the Martin Applications or Sproat is termed a âT-Substituted Ribonucleotide.â As used herein the term âRNA-type nucleotideâ means a T-hydroxyl or 2â˛-Substituted Nucleotide that is linked to other nucleotides of a mixed duplex oligonucleotide by an unsubstituted phosphodiester linkage or any of the non-natural linkages taught by Kmiec I or Kmiec II. As used herein the term âdeoxyribo-type nucleotideâ means a nucleotide having a T-H, which can be linked to other nucleotides of a gene repair oligonucleobase by an unsubstituted phosphodiester linkage or any of the non-natural linkages taught by Kmiec I or Kmiec I.
In a particular embodiment of the present disclosure, the gene repair oligonucleobase is a mixed duplex oligonucleotide (MDON) that is linked solely by unsubstituted phosphodiester bonds. In alternative embodiments, the linkage is by substituted phosphodiesters, phosphodiester derivatives and non-phosphorus-based linkages as taught by Kmiec 11. In yet another embodiment, each RNA-type nucleotide in the mixed duplex oligonucleotide is a 2â˛-Substituted Nucleotide. Particular preferred embodiments of 2â˛-Substituted Ribonucleotides are 2Ⲡfluoro, T-methoxy, 2â˛-propyloxy, 2â˛-allyloxy, 2-hydroxylethyloxy, 2-methoxyethyloxy, T-fluoropropyloxy and 2-trifluoropropyloxy substituted ribonucleotides. More preferred embodiments of 2-Substituted Ribonucleotides are 2-fluoro, 2â˛-methoxy, 2â˛-methoxyethyloxy, and 2-allyloxy substituted nucleotides. In another embodiment the mixed duplex oligonucleotide is linked by unsubstituted phosphodiester bonds,
Although mixed duplex oligonucleotides (MDONs) having only a single type of 2-substituted RNA-type nucleotide are more conveniently synthesized, the methods of the disclosure can be practiced with mixed duplex oligonucleotides having two or more types of RNA-type nucleotides. The function of an RNA segment may not be affected by an interruption caused by the introduction of a deoxynucleotide between two RNA-type trinucleotides, accordingly, the term RNA segment encompasses terms such as âinterrupted RNA segment.â An uninterrupted RNA segment is termed a contiguous RNA segment. In an alternative embodiment an RNA segment can contain alternating RNase-resistant and unsubstituted 2â˛-OH nucleotides. The mixed duplex oligonucleotides in some embodiments have fewer than 100 nucleotides and other embodiments fewer than 85 nucleotides, but more than 50 nucleotides. The first and second strands are Watson-Crick base paired. In one embodiment the strands of the mixed duplex oligonucleotide are covalently bonded by a linker, such as a single stranded hexa, penta or tetranucleotide so that the first and second strands are segments of a single oligonucleotide chain having a single 3Ⲡand a single 5Ⲡend. The 3Ⲡand 5Ⲡends can be protected by the addition of a âhairpin capâ whereby the 3Ⲡand 5Ⲡterminal nucleotides are Watson-Crick paired to adjacent nucleotides. A second hairpin cap can, additionally, be placed at the junction between the first and second strands distant from the 3Ⲡand 5Ⲡends, so that the Watson-Crick pairing between the first and second strands is stabilized.
The first and second strands contain two regions that are homologous with two fragments of the target gene/allele, i.e., have the same sequence as the target gene/allele. A homologous region contains the nucleotides of an RNA segment and may contain one or more DNA-type nucleotides of connecting DNA segment and may also contain DNA-type nucleotides that are not within the intervening DNA segment. The two regions of homology are separated by, and each is adjacent to, a region having a sequence that differs from the sequence of the target gene, termed a âheterologous region.â The heterologous region can contain one, two or three mismatched nucleotides. The mismatched nucleotides can be contiguous or alternatively can be separated by one or two nucleotides that are homologous with the target gene/allele. Alternatively, the heterologous region can also contain an insertion or one, two, three or of five or fewer nucleotides. Alternatively, the sequence of the mixed duplex oligonucleotide may differ from the sequence of the target gene/allele only by the deletion of one, two, three, or five or fewer nucleotides from the mixed duplex oligonucleotide. The length and position of the heterologous region is, in this case, deemed to be the length of the deletion, even though no nucleotides of the mixed duplex oligonucleotide are within the heterologous region. The distance between the fragments of the target gene that are complementary to the two homologous regions is identical to the length of the heterologous region where a substitution or substitutions is intended. When the heterologous region contains an insertion, the homologous regions are thereby separated in the mixed duplex oligonucleotide farther than their complementary homologous fragments are in the gene/allele, and the converse is applicable when the heterologous region encodes a deletion.
The RNA segments of the mixed duplex oligonucleotides are each a part of a homologous region. i.e., a region that is identical in sequence to a fragment of the target gene, which segments together in some embodiments contain at least 13 RNA-type nucleotides and in some embodiments from 16 to 25 RNA-type nucleotides or yet other embodiments 18-22 RNA-type nucleotides or in some embodiments 20 nucleotides. In one embodiment, RNA segments of the homology regions are separated by and adjacent to, i.e., âconnected byâ an intervening DNA segment. In one embodiment, each nucleotide of the heterologous region is a nucleotide of the intervening DNA segment. An intervening DNA segment that contains the heterologous region of a mixed duplex oligonucleotide is termed a âmutator segment.â
In another embodiment of the present disclosure, the gene repair oligonucleobase (GRON) is a single stranded oligodeoxynucleotide mutational vector (SSOMV), such as disclosed in International Patent Application PCT/USOO/23457, U.S. Pat. Nos. 6,271,360, 6,479,292, and 7,060,500 which is incorporated by reference in its entirety. The sequence of the SSOMV is based on the same principles as the mutational vectors described in U.S. Pat. Nos. 5,756,325; 5.871.984; 5,760,012; 5,888,983; 5,795,972; 5,780,296; 5,945,339; 6,004,804; and 6,010,907 and in International Publication Nos. WO 98/49350; WO 99/07865; WO 99/58723; WO 99/58702; and WO 99/40789. The sequence of the SSOMV contains two regions that are homologous with the target sequence separated by a region that contains the desired genetic alteration termed the mutator region. The mutator region can have a sequence that is the same length as the sequence that separates the homologous regions in the target sequence, but having a different sequence. Such a mutator region can cause a substitution. Alternatively, the homologous regions in the SSOMV can be contiguous to each other, while the regions in the target gene having the same sequence are separated by one, two or more nucleotides. Such an SSOMV causes a deletion from the target gene of the nucleotides that are absent from the SSOMV. Lastly, the sequence of the target gene that is identical to the homologous regions may be adjacent in the target gene but separated by one, two, or more nucleotides in the sequence of the SSOMV. Such an SSOMV causes an insertion in the sequence of the target gene. In certain embodiments, a SSOMV does not anneal to itself.
The nucleotides of the SSOMV are deoxyribonucleotides that are linked by unmodified phosphodiester bonds except that the 3Ⲡterminal and/or 5Ⲡterminal internucleotide linkage or alternatively the two 3Ⲡterminal and/or 5Ⲡterminal internucleotide linkages can be a phosphorothioate or phosphoamidate. As used herein an internucleotide linkage is the linkage between nucleotides of the SSOMV and does not include the linkage between the 3Ⲡend nucleotide or 5Ⲡend nucleotide and a blocking substituent. In a specific embodiment the length of the SSOMV is between 21 and 55 deoxynucleotides and the lengths of the homology regions are, accordingly, a total length of at least 20 deoxynucleotides and at least two homology regions should each have lengths of at least 8 deoxynucleotides.
The SSOMV can be designed to be complementary to either the coding or the non-coding strand of the target gene. When the desired mutation is a substitution of a single base, it is preferred that both the mutator nucleotide and the targeted nucleotide be a pyrimidine. To the extent that is consistent with achieving the desired functional result, it is preferred that both the mutator nucleotide and the targeted nucleotide in the complementary strand be pyrimidines. Particularly preferred are SSOMVs that encode transversion mutations, i.e., a C or T mutator nucleotide is mismatched, respectively, with a C or T nucleotide in the complementary strand.
Okazaki Fragment/2â˛-OME GRON Design. In various embodiments, a GRON may have both RNA and DNA nucleotides and/or other types of nucleobases. In some embodiments, one or more of the DNA or RNA nucleotides comprise a modification. In certain embodiments, the first 5Ⲡnucleotide is an RNA nucleotide and the remainder of the nucleotides are DNA. In still further embodiments, the first 5ⲠRNA nucleotide is modified with a 2-O-Me. In other embodiments, the first two, three, four, five, six, seven, eight, nine, ten or more 5Ⲡnucleotides are an RNA nucleotide and the remainder of the nucleotides are DNA. In still further embodiments, one or more of the first two, three, four, five, six, seven, eight, nine, ten or more 5ⲠRNA nucleotide are modified with a 2-O-Me. In plant cells, double-strand beaks in DNA are typically repaired by the NHEJ DNA repair pathway. This pathway does not require a template to repair the DNA and is therefore error prone. The advantage of using this pathway to repair DNA for a plant cell is that it is quick, ubiquitous and most importantly can occur at times when a cell is not undergoing DNA replication. Another DNA repair pathway that functions in repairing double-strand breaks outside of the replication fork in plant cells is called homologous recombination (HR); however, unlike the NHEJ pathway this type of repair is precise and requires the use of a DNA template (GRON). Since these GRONs mimic Okazaki fragments at the DNA replication fork of targeted genes, it is not obvious to use them with a double-strand DNA cutter to those skilled in the art.
The present disclosure provides a number of approaches to increase the effectiveness of conversion of a target gene using repair oligonucleotides, and which may be used alone or in combination with one another. These include:
Examples of the foregoing approaches are provided in Table 1.
| TABLE 1 |
| Exemplary GRON chemistries. |
| Oligo type | Modifications | |
| 5Ⲡmods | T/A clamp | T/A clamp |
| Backbone | Phosphothioate | PS |
| modifications | ||
| Intercalating dyes | 5ⲠAcridine 3Ⲡ| idC Acridine, idC |
| 2â˛-O-methyl | DNA/RNA | |
| Cy3 replacements | DY547 | |
| Facilitators | 2â˛-O-Me oligos designed | 2â˛-O-Me |
| 5Ⲡand 3Ⲡof the | ||
| converting oligo | ||
| Abasic | Abasic site placed in | Abasic 2 |
| various locations 5Ⲡand 3Ⲡ| ||
| to the converting base. | ||
| 44 mer | ||
| Assist | Assist approach | Cy3, idC on one, |
| Overlap: | none on the other: | |
| 2 oligos: 1 with Cy3/idC, | ||
| 1 unmodified repair oligo | ||
| Assist | Assist approach | only make the |
| No overlap: | unmodified oligo | |
| 2 oligos: 1 with Cy3/idC, | ||
| 1 unmodified | ||
| repair oligo | ||
| Abasic | THF site placed in various | Tetrahydrofuran |
| locations 5Ⲡand 3Ⲡto the | (dspacer) | |
| converting base. 44 mer | ||
| Backbone | 2â˛-O-Me | |
| modifications | ||
| Trimers | Trimer amidites, | |
| Cy3, idC | ||
| Pushing repair | 8â˛oxo dA, | |
| 5ⲠCy3, idC | ||
| Pushing repair | 8â˛oxo dA, | |
| 5ⲠCy3, idC | ||
| Double | Bleomycin | |
| Strand Break | ||
| Crosslinker | Cisplatin | |
| Crosslinker | Mitomycin C | |
| Facilitators | super bases 5Ⲡand 3Ⲡ| 2 amino dA and |
| of converting oligo | 2- thio T | |
| Super oligos | 2â˛amino d, | |
| 5ⲠCy3, idC | ||
| Super oligos | 2-thio T, | |
| 5ⲠCy3, idC | ||
| Super oligos | 7-deaza A, | |
| 5ⲠCy3, idC | ||
| Super oligos | 7-deaza G, | |
| 5ⲠCy3, idC | ||
| Super oligos | propanyl dC, | |
| 5ⲠCy3, idC | ||
| Intercalating dyes | 5ⲠPsoralen/3ⲠidC | Psoralen, idC |
| Intercalating dyes | 5ⲠEthidium bromide | Ethidium bromide |
| Intercalating dyes | 5ⲠSyber stains | Syber stains |
| 5Ⲡmods | 5ⲠChol/3ⲠidC | Cholesterol |
| Double mutation | Long oligo (55+ bases) | Any modification |
| w/ 2 mutation | ||
| 5Ⲡmods | 5ⲠSIMA HEX/3â˛idC | SIMA HEX, idC |
| Backbone | 9 | Methyl |
| modifications | phosphonates | |
| Backbone | LNA | |
| modifications | ||
| Backbone | 1 | MOE |
| modifications | (methoxyethyl) | |
| Cy3 replacements | Cy3.5 | |
| Cy3 replacements | Cy5 | |
| Backbone | di PS | |
| modifications | ||
| 5Ⲡmods | riboC for | |
| branch nm | ||
| Backbone | PNA | |
| modifications | ||
| Cy3 replacements | DY647 | |
| 5Ⲡmods | 5Ⲡbranch | symmetric branch |
| amidite/idC | ||
The foregoing modifications may also include known nucleotide modifications such as methylation, 5Ⲡintercalating dyes, modifications to the 5Ⲡand 3Ⲡends, backbone modifications, crosslinkers, cyclization and âcapsâ and substitution of one or more of the naturally occurring nucleotides with an analog such as inosine. Modifications of nucleotides include the addition of acridine, amine, biotin, cascade blue, cholesterol, Cy3@, Cy5@, Cy5.5@ Daboyl, digoxigenin, dinitrophenyl, Edans, 6-FAM, fluorescein, 3â˛-glyceryl, HEX, IRD-700, IRD-800, JOE, phosphate psoralen, rhodamine, ROX, thiol (SH), spacers, TAMRA, TET, AMCA-Sâł, SE, BODIPYÂŽ, Marina Blue@, Pacific Blue@, Oregon Green@, Rhodamine Green@, Rhodamine Red@, Rhodol Green@ and Texas Red@. Polynucleotide backbone modifications include methylphosphonate, 2â˛-OMe-methylphosphonate RNA, phosphorothiorate, RNA, 2â˛-OMeRNA. Base modifications include 2-amino-dA, 2-aminopurine, 3â˛-(ddA), 3ⲠdA (cordycepin), 7-deaza-dA, 8-Br-dA, 8-oxo-dA, N6-Me-dA, abasic site (dSpacer), biotin dT, 2â˛-OMe-5Me-C, 2â˛-OMe-propynyl-C, 3â˛-(5-Me-dC), 3â˛-(ddC), 5-Br-dC, 5-1-duc, 5-Me-dC, 5-F-dC, carboxy-dT, convertible dA, convertible dC, convertible dG, convertible dT, convertible dU, 7-deaza-dG, 8-Br-dG, 8-oxo-dG, 06-Me-dG, S6-DNP-dG, 4-methyl-indole, 5-nitroindole, 2â˛-OMe-inosine, 2â˛-dl, o6-phenyl-dl, 4-methyl-indole, 2â˛-deoxynebularine, 5-nitroindole, 2-aminopurine, dP (purine analogue), dK (pyrimidine analogue), 3-nitropyrrole, 2-thio-dT, 4-thio-dT, biotin-dT, carboxy-dT, 04-Me-dT, 04-triazol dT, 2â˛-OMe-propynyl-U, 5-Br-dU, 2â˛-dU, 5-F-dU, 5-1-dU, 04-triazol dU. Said terms also encompass peptide nucleic acids (PNAs), a DNA analogue in which the backbone is a pseudopeptide consisting of N-(2-aminoethyl)-glycine units rather than a sugar. PNAs mimic the behavior of DNA and bind complementary nucleic acid strands. The neutral backbone of PNA results in stronger binding and greater specificity than normally achieved. In addition, the unique chemical, physical and biological properties of PNA have been exploited to produce powerful biomolecular tools, antisense and antigene agents, molecular probes and biosensors.
Oligonucleobases may have nick(s), gap(s), modified nucleotides such as modified oligonucleotide backbones, abasic nucleotides, or other chemical moieties. In a further embodiment, at least one strand of the oligonucleobase includes at least one additional modified nucleotide, e.g., a 2â˛-O-methyl modified nucleotide such as a MOE (methoxyethyl), a nucleotide having a 5â˛-phosphorothioate group, a terminal nucleotide linked to a cholesteryl derivative, a 2â˛-deoxy-2â˛-fluoro modified nucleotide, a 2â˛-deoxy-modified nucleotide, a locked nucleotide, an abasic nucleotide (the nucleobase is missing or has a hydroxyl group in place thereof (see, e.g., Glen Research, www.glenresearch.com/GlenReports/GR21-14), a 2â˛-amino-modified nucleotide, a 2â˛-alkyl-modified nucleotide, a morpholino nucleotide, a phosphoramidite, and a non-natural base comprising nucleotide. Various salts, mixed salts and free acid forms are also included.
Preferred modified oligonucleotide backbones include, for example, phosphorothioates, chiral phosphorothioates, phosphoro-dithioates, phosphotriesters, aminoalkylphosphotriesters, methyl and other alkyl phosphonates including 3â˛-alkylene phosphonates, 5â˛-alkylene phosphonates and chiral phosphonates, phosphinates, phosphoramidates including 3â˛-amino phosphoramidate and aminoalkylphosphoramidates, thionophosphoramidates, thionoalkyl-phosphonates, thionoalkylphosphotriesters, selenophosphates and boranophosphates having normal 3â˛-5Ⲡlinkages, 2â˛-5Ⲡlinked analogs of these, and those having inverted polarity wherein one or more internucleotide linkages is a 3Ⲡto 3â˛, 5Ⲡto 5Ⲡor 2Ⲡto 2Ⲡlinkage. Preferred oligonucleotides having inverted polarity comprise a single 3Ⲡto 3Ⲡlinkage at the 3â˛-most internucleotide linkage i.e. a single inverted nucleoside residue which may be abasic (the nucleobase is missing or has a hydroxyl group in place thereof). The most common use of a linkage inversion is to add a 3â˛-3Ⲡlinkage to the end of an antisense oligonucleotide with a phosphorothioate backbone. The 3â˛-3Ⲡlinkage further stabilizes the antisense oligonucleotide to exonuclease degradation by creating an oligonucleotide with two 5â˛-OH ends and no 3â˛-OH end. Linkage inversions can be introduced into specific locations during oligonucleotide synthesis through use of âreversed phosphoramiditesâ. These reagents have the phosphoramidite groups on the 5â˛-OH position and the dimethoxytrityl (DMT) protecting group on the 3â˛-OH position. Normally, the DMT protecting group is on the 5â˛-OH and the phosphoramidite is on the 3â˛-OH.
Examples of modified bases include, but are not limited to, 2-aminopurine, 2â˛-amino-butyryl pyrene-uridine, 2â˛-aminouridine, 2â˛-deoxyuridine, 2â˛-fluoro-cytidine, 2â˛-fluoro-uridine, 2,6-diaminopurine, 4-thio-uridine, 5-bromo-uridine, 5-fluoro-cytidine, 5-fluorouridine, 5-indo-uridine, 5-methyl-cytidine, inosine, N3-methyl-uridine, 7-deaza-guanine, 8-aminohexyl-amino-adenine, 6-thio-guanine, 4-thio-thymine, 2-thio-thymine, 5-iodo-uridine, 5-iodo-cytidine, 8-bromo-guanine, 8-bromo-adenine, 7-deaza-adenine, 7-diaza-guanine, 8-oxo-guanine, 5,6-dihydro-uridine, and 5-hydroxymethyl-uridine. These synthetic units are commercially available; (for example, purchased from Glen Research Company) and can be incorporated into DNA by chemical synthesis.
Examples of modification of the sugar moiety are 3â˛-deoxylation, 2â˛-fluorination, and arabanosidation, however, it is not to be construed as being limited thereto. Incorporation of these into DNA is also possible by chemical synthesis.
Examples of the 5Ⲡend modification are 5â˛-amination, 5â˛-biotinylation, 5â˛-fluoresceinylation, 5â˛-tetrafluoro-fluoreceinyaltion, 5â˛-thionation, and 5â˛-dabsylation, however it is not to be construed as being limited thereto.
Examples of the 3Ⲡend modification are 3â˛-amination, 3â˛-biotinylation, 2,3-dideoxidation, 3â˛-thionation, 3â˛-dabsylation, 3â˛-carboxylation, and 3â˛-cholesterylation, however, it is not to be construed as being limited thereto.
In one preferred embodiment, the oligonucleobase can contain a 5Ⲡblocking substituent that is attached to the 5Ⲡterminal carbons through a linker. The chemistry of the linker is not critical other than its length, which should in some embodiments be at least 6 atoms long and that the linker should be flexible. A variety of non-toxic substituents such as biotin, cholesterol or other steroids or a non-intercalating cationic fluorescent dye can be used. Particularly preferred reagents to make oligonucleobases are the reagents sold as Cy31Ⲡand Cy5Tm by Glen Research, Sterling Va. (now GE Healthcare), which are blocked phosphoroamidites that upon incorporation into an oligonucleotide yield 3,3,3â˛, 3â˛-tetramethyl N,Nâ˛-isopropyl substituted indomonocarbocyanine and indodicarbocyanine dyes, respectively. Cy3 is particularly preferred. When the indocarbocyanine is N-oxyalkyl substituted it can be conveniently linked to the 5Ⲡterminal of the oligodeoxynucleotide as a phosphodiester with a 5Ⲡterminal phosphate. When the commercially available Cy3 phosphoramidite is used as directed, the resulting 5Ⲡmodification consists of a blocking substituent and linker together which are a N-hydroxypropyl, Nâ˛-phosphatidylpropyl 3,3,3â˛, 3Ⲡtetramethyl indomonocarbocyanine. Other dyes contemplated include Rhodamine6G, Tetramethylrhodarine, Sulforhodamine 101, Merocyanine 540, Atto565, Atto550 26, Cy3.5, Dy547, Dy548, Dy549, Dy554, Dy555, Dy556, Dy560, mStrawberry and mCherry.
In a preferred embodiment the indocarbocyanine dye is tetra substituted at the 3 and 3Ⲡpositions of the indole rings. Without limitations as to theory these substitutions prevent the dye from being an intercalating dye. The identity of the substituents at these positions is not critical.
The oligo designs herein described might also be used as more efficient donor templates in combination with other DNA editing or recombination technologies including, but not limited to, gene targeting using site-specific homologous recombination by zinc finger nucleases, Transcription Activator-Like Effector Nucleases (TALENs) or Clustered Regularly Interspaced Short Palindromic Repeats (CRISPRs).
The present disclosure in certain aspects and embodiments generally relates to methods for the efficient modification of genomic cellular DNA and/or recombination of DNA into the genomic DNA of cells. Although not limited to any particular use, some methods provided herein may in certain embodiments be useful in, for example, introducing a modification into the genome of a cell for the purpose of determining the effect of the modification on the cell. For example, a modification may be introduced into the nucleotide sequence which encodes an enzyme to determine whether the modification alters the enzymatic activity of the enzyme, and/or determine the location of the enzyme's catalytic region. Alternatively, the modification may be introduced into the coding sequence of a DNA-binding protein to determine whether the DNA binding activity of the protein is altered, and thus to delineate the particular DNA-binding region within the protein. Yet another alternative is to introduce a modification into a non-coding regulatory sequence (e.g., promoter, enhancer, regulatory RNA sequence (miRNA), etc.) in order to determine the effect of the modification on the level of expression of a second sequence which is operably linked to the non-coding regulatory sequence. This may be desirable to, for example, define the particular sequence which possesses regulatory activity.
One strategy for producing targeted gene disruption is through the generation of single strand or double strand DNA breaks using a DNA cutter such as a site-specific endonuclease. Endonucleases are most often used for targeted gene disruption in organisms that have traditionally been refractive to more conventional gene targeting methods, such as algae, plants, and large animal models, including humans. For example, there are currently human clinical trials underway involving zinc finger nucleases for the treatment and prevention of HIV infection. Additionally, endonuclease engineering is currently being used in attempts to disrupt genes that produce undesirable phenotypes in crops.
One class of artificial endonucleases is the zinc finger endonucleases. Zinc finger endonucleases combine a non-specific cleavage domain, typically that of FokI endonuclease, with zinc finger protein domains that are engineered to bind to specific DNA sequences. The modular structure of the zinc finger endonucleases makes them a versatile platform for delivering site-specific double-strand breaks to the genome. As FokI endonuclease cleaves as a dimer, one strategy to prevent off-target cleavage events has been to design zinc finger domains that bind at adjacent 9 base pair sites. See also U.S. Pat. Nos. 7,285,416; 7,521,241; 7,361,635; 7,273,923; 7,262,054; 7,220,719; 7,070,934; 7,013,219; 6,979,539; 6,933,113; 6,824,978; each of which is hereby herein incorporated by reference in its entirety.
TALENs are targetable nucleases are used to induce single- and double-strand breaks into specific DNA sites, which are then repaired by mechanisms that can be exploited to create sequence alterations at the cleavage site.
The fundamental building block that is used to engineer the DNA-binding region of TALENs is a highly conserved repeat domain derived from naturally occurring TALEs encoded by Xanthomonas spp. proteobacteria. DNA binding by a TALEN is mediated by arrays of highly conserved 33-35 amino acid repeats that are flanked by additional TALE-derived domains at the amino-terminal and carboxy-terminal ends of the repeats.
These TALE repeats specifically bind to a single base of DNA, the identity of which is determined by two hypervariable residues typically found at positions 12 and 13 of the repeat, with the number of repeats in an array corresponded to the length of the desired target nucleic acid, the identity of the repeat selected to match the target nucleic acid sequence. In some embodiments, the target nucleic acid is between 15 and 20 base pairs in order to maximize selectivity of the target site. Cleavage of the target nucleic acid typically occurs within 50 base pairs of TALEN binding. Computer programs for TALEN recognition site design have been described in the art. See, e.g., Cermak et al., Nucleic Acids Res. 2011 July; 39(12): e82.
Once designed to match the desired target sequence, TALENs can be expressed recombinantly and introduced into protoplasts as exogenous proteins, or expressed from a plasmid within the protoplast or administered as mRNA.
The homing endonucleases, also known as meganucleases, are sequence specific endonucleases that generate double strand breaks in genomic DNA with a high degree of specificity due to their large (e.g., >14 bp) cleavage sites. While the specificity of the horning endonucleases for their target sites allows for precise targeting of the induced DNA breaks, homing endonuclease cleavage sites are rare and the probability of finding a naturally occurring cleavage site in a targeted gene is low.
Another class of artificial endonucleases is the engineered meganucleases. Engineered horning endonucleases are generated by modifying the specificity of existing homing endonucleases. In one approach, variations are introduced in the amino acid sequence of naturally occurring horning endonucleases and then the resultant engineered homing endonucleases are screened to select functional proteins which cleave a targeted binding site. In another approach, chimeric homing endonucleases are engineered by combining the recognition sites of two different horning endonucleases to create a new recognition site composed of a half-site of each horning endonuclease. See e.g., U.S. Pat. No. 8,338,157.
CRISPR-Cas system contains three basic design components: 1) Cas gene, transcript (e.g., mRNA) or protein; 2) guide RNA (gRNA); and 3) crRNAs (CRISPR RNA) are RNA segments processed from RNA transcripts encoding the CRISPR repeat arrays, which harbor a âprotospacerâ region that are complementary to a foreign DNA site (e.g., endogenous DNA target region) and a part of the CRISPR repeat. See e.g., PCT Applciation Nos. WO/2014/093661 and WO/2013/176772.
Cas (CRISPR Associated) Gene, Transcript (e.g., mRNA) or Protein
Transient Cas expression from a plasmid vector, direct delivery of Cas protein and or direct delivery of Cas mRNA into plant cells. Cas genes are codon optimized for expression in higher plants, algae or yeast and are driven by either a constitutive, inducible, tissue-specific or species-specific promoter when applicable. Cas transcript termination and polyadenlyation signals are either NosT, RBCT, HSP18.2T or other gene specific or species-specific terminators. Cas gene cassettes or mRNA may contain introns, either native or in combination with gene-specific promoters and or synthetic promoters. Cas protein may contain one or more nuclear localization signal sequences (NLS), mutations, deletions, alterations or truncations. In transient expression systems, Cas gene cassettes may be combined with other components of the CRISPR-Cas system such as gRNA cassettes on the same transient expression vector. Alternatively, Cas gene cassettes may be located and expressed from constructs independent of gRNA cassettes or from other components of the CRISPR-Cas system. CRISPR associated (Cas) geneâencode for proteins with a variety of predicted nucleic acid-manipulating activities such as nucleases, helicases and polymerase. Cas genes include cas9. Cas9 is a gene encoding a large protein containing a predicted RuvC-like and HNH endonuclease domains and is associated with the CRISPR adaptive immunity system that is present in most archaea and many bacteria. Cas9 protein consists of two lobes:
In other embodiments, the cas gene may be a homolog of cas9 in which the RuvC, HNH, REC and BH domains are highly conserved. In some embodiments, cas genes are those from the following species.
Guide RNA (gRNA)
gRNA or sgRNA (single guide RNA) is engineered as a fusion between a crRNA and part of the transactivating CRISPR RNA (tracrRNA) sequence, which guides the Cas9 to a specific target DNA sequence that is complementary to the protospacer region. Guide RNA may include an expression cassette containing a chimeric RNA design with a long tracerRNA hybrid, short tracrRNA hybrid or a native CRISPR array+tracrRNA conformation. Chimeric gRNA combines the targeting specificity of the crRNA with the scaffolding properties of the tracrRNA into a single transcript. gRNA transient expression is controlled by species-specific higher plant RNA Polymerase III promoters such as those from the U6 or U3 snRNA gene family (Wang et al 2008). gRNA transcript termination is controlled by a 6-20 nucleotide tract of poly dT as per Wang et al 2008, gRNA expression cassettes are located on the same or different transient expression vectors from other components of the CRISPR-Cas system. gRNA transcripts may be synthesized in-vitro and delivered directly into plant cells, independent of or in combination with gRNA transient expression vectors.
Guide RNAs contain two components that define specificity to a DNA target region, a proto-spacer and a proto-spacer adjacent motif (PAM). Proto-spacer sequence, typically 20 nucleotides but can vary based on the DNA target, provides DNA sequence specificity for the CRISPR-Cas complex. DNA targets also contain a NNG or NAG tri-nucleotide sequence (PAM) where N denotes any nucleotide, immediately 3Ⲡor downstream of the proto-spacer.
Similar to Le Cong et al. (2013) and others, a simplified âone component approachâ to CRISPR-Cas gene editing wherein a single transient expression construct contains all components of the CRISPR-Cas complex, i.e. both the gRNA and the Cas expressions cassettes. This allows for an easy modular design for targeting single or multiple loci in any given plant or crop. Targeting multiple loci can be achieved by simply swapping in the target-specific gRNA cassettes. Additionally, species specific promoters, terminators or other expressing enhancing elements can easily be shuttled in and out of âone component approachâ transient vectors allowing for optimal expression of both gRNA and Cas protein in a species specific manner.
In the two component approach, Cas and gRNA expression cassettes are located on different transient expression vectors. This allows for delivery of a CRISPR-Cas editing components separately, allowing for different ratios of gRNA to Cas within the same cell. Similar to the one component approach, the two component approach also allows for promoters, terminators or other elements affecting expression of CRISPR-Cas components to be easily altered and allow targeting of DNA in a species-specific manner.
Another class of endonucleases are antibiotics which are DNA cleaving glycopeptides such as the bleomycin family of antibiotics are DNA cleaving glycopeptides which include bleomycin, zeocin, phleomycin, tallysomycin, pepleomycin and others which are further described herein.
Other DNA-modifying molecules may be used in targeted gene recombination. For example, peptide nucleic acids may be used to induce modifications to the genome of the target cell or cells (see, e.g. Ecker, U.S. Pat. No. 5,986,053 herein incorporated by reference). In brief, synthetic nucleotides comprising, at least, a partial peptide backbone are used to target a homologous genomic nucleotide sequence. Upon binding to the double-helical DNA, or through a mutagen ligated to the peptide nucleic acid, modification of the target DNA sequence and/or recombination is induced to take place. Targeting specificity is determined by the degree of sequence homology between the targeting sequence and the genomic sequence.
Furthermore, the present disclosure is not limited to the particular methods which are used herein to execute modification of genomic sequences. Indeed, a number of methods are contemplated. For example, genes may be targeted using triple helix forming oligonucleotides (TFO). TFOs may be generated synthetically, for example, by PCR or by use of a gene synthesizer apparatus. Additionally, TFOs may be isolated from genomic DNA if suitable natural sequences are found. TFOs may be used in a number of ways, including, for example, by tethering to a mutagen such as, but not limited to, psoralen or chlorambucil (see, e.g., Havre et al., Proc Nat'l Acad Sci, U.S.A. 90:7879-7883, 1993; Havre et al., J Virol 67:7323-7331, 1993; Wang et al., Mol Cell Biol 15:1759-1768, 1995; Takasugi et al., Proc Nat'l Acad Sci, U.S.A. 88:5602-5606, 1991; Belousov et al., Nucleic Acids Res 25:3440-3444. 1997). Furthermore, for example, TFOs may be tethered to donor duplex DNA (see, e.g., Chan et al., J Biol Chem 272:11541-11548, 1999). TFOs can also act by binding with sufficient affinity to provoke error-prone repair (Wang et al., Science 271:802-805, 1996).
The methods disclosed herein are not necessarily limited to the nature or type of DNA-modifying reagent which is used. For example, such DNA-modifying reagents release radicals which result in DNA strand breakage. Alternatively, the reagents alkylate DNA to form adducts which would block replication and transcription. In another alternative, the reagents generate crosslinks or molecules that inhibit cellular enzymes leading to strand breaks. Examples of DNA-modifying reagents which have been linked to oligonucleotides to form TFOs include, but are not limited to, indolocarbazoles, napthalene diimide (NDI), transplatin, bleomycin, analogues of cyclopropapyrroloindole, and phenanthodihydrodioxins. In particular, indolocarbazoles are topoisomerase I inhibitors. Inhibition of these enzymes results in strand breaks and DNA protein adduct formation (Arimondo et al., Bioorganic and Medicinal Chem. 8, 777, 2000). NDI is a photooxidant that can oxidize guanines which could cause mutations at sites of guanine residues (Nunez, et al., Biochemistry, 39, 6190, 2000). Transplatin has been shown to react with DNA in a triplex target when the TFO is linked to the reagent. This reaction causes the formation of DNA adducts which would be mutagenic (Columbier, et al., Nucleic Acids Research, 24: 4519, 1996). Bleomycin is a DNA breaker, widely used as a radiation mimetic. It has been linked to oligonucleotides and shown to be active as a breaker in that format (Sergeyev, Nucleic Acids Research 23, 4400, 1995; Kane, et al., Biochemistry, 34, 16715, 1995). Analogues of cyclopropapyrroloindole have been linked to TEOs and shown to alkylate DNA in a triplex target sequence. The aikylated DNA would then contain chemical adducts which would be mutagenic (Lukhtanov, et al., Nucleic Acids Research, 25, 5077, 1997). Phenanthodihydrodioxins are masked quinones that release radical species upon photoactivation. They have been linked to TEDs and have been shown to introduce breaks into duplex DNA on photoactivation (Bendinskas et al., Bioconjugate Chem. 9, 555, 1998).
Other methods of inducing modifications and/or recombination are contemplated by the present disclosure. For example, another embodiment involves the induction of homologous recombination between an exogenous DNA fragment and the targeted gene (see e.g., Capecchi et al., Science 244:1288-1292, 1989) or by using peptide nucleic acids (PNA) with affinity for the targeted site. Still other methods include sequence specific DNA recognition and targeting by polyamides (see e.g., Dervan et al., Curr Opin Chem Biol 3:688-693, 1999; Biochemistry 38:2143-2151, 1999) and the use nucleases with site specific activity (e.g., zinc finger proteins, TALENs, Meganucleases and/or CRISPRs).
The present disclosure is not limited to any particular frequency of modification and/or recombination. In some embodiments the methods disclosed herein result in a frequency of modification in the target nucleotide sequence of from 0.2% to 3%. Nonetheless, any frequency (i.e., between 0% and 100%) of modification and/or recombination is contemplated to be within the scope of the present disclosure. The frequency of modification and/or recombination is dependent on the method used to induce the modification and/or recombination, the cell type used, the specific gene targeted and the DNA mutating reagent used, if any. Additionally, the method used to detect the modification and/or recombination, due to limitations in the detection method, may not detect all occurrences of modification and/or recombination. Furthermore, some modification and/or recombination events may be silent, giving no detectable indication that the modification and/or recombination has taken place. The inability to detect silent modification and/or recombination events gives an artificially low estimate of modification and/or recombination. Because of these reasons, and others, the disclosure is not necessarily limited to any particular modification and/or recombination frequency. In one embodiment, the frequency of modification and/or recombination is between 0.01% and 100%. In another embodiment, the frequency of modification and/or recombination is between 0.01% and 50%. In yet another embodiment, the frequency of modification and/or recombination is between 0.1% and 10%. In still yet another embodiment, the frequency of modification and/or recombination is between 0.1% and 5%.
The term âfrequency of mutationâ as used herein in reference to a population of cells which are treated with a DNA-modifying molecule that is capable of introducing a mutation into a target site in the cells' genome, refers to the number of cells in the treated population which contain the mutation at the target site as compared to the total number of cells which are treated with the DNA-modifying molecule. For example, with respect to a population of cells which is treated with the DNA-modifying molecule TFO tethered to psoralen which is designed to introduce a mutation at a target site in the cells' genome, a frequency of mutation of 5% means that of a total of 100 cells which are treated with TFO-psoralen, 5 cells contain a mutation at the target site.
Although the present disclosure is not necessarily limited to any degree of precision in the modification and/or recombination of DNA in the cell, it is contemplated that some embodiments of the present disclosure require higher degrees of precision, depending on the desired result. For example, the specific sequence changes required for gene repair (e.g., particular base changes) require a higher degree of precision as compared to producing a gene knockout wherein only the disruption of the gene is necessary. With the methods of the present disclosure, achievement of higher levels of precision in modification and/or homologous recombination techniques is greater than with prior art methods.
Delivery of Gene Repair Oligonucleobases into Plant Cells
Any commonly known method used to transform a plant cell can be used for delivering the gene repair oligonucleobases. Illustrative methods are listed below. The methods and compositions herein may involve any of many methods to transfect the cells with the DNA-modifying reagent or reagents. Methods for the introduction of DNA modifying reagents into a cell or cells are well known in the art and include, but are not limited to, microinjection, electroporation, passive adsorption, calcium phosphate-DNA co-precipitation, DEAE-dextran-mediated transfection, polybrene-mediated transfection, liposome fusion, lipofectin, nucleofection, protoplast fusion, retroviral infection, biolistics (i.e., particle bombardment) and the like.
The use of metallic microcarriers (microspheres) for introducing large fragments of DNA into plant cells having cellulose cell walls by projectile penetration is well known to those skilled in the relevant art (henceforth biolistic delivery). U.S. Pat. Nos. 4,945,050; 5,100,792 and 5,204,253 describe general techniques for selecting microcarriers and devices for projecting them.
Specific conditions for using microcarriers in the methods disclosed herein may include the conditions described in International Publication WO 99/07865. In an illustrative technique, ice cold microcarriers (60 mg/mL), mixed duplex oligonucleotide (60 mg/mL) 2.5 M CaCl2) and 0.1 M spermidine are added in that order; the mixture gently agitated, e.g., by vortexing, for 10 minutes and then left at room temperature for 10 minutes, whereupon the microcarriers are diluted in 5 volumes of ethanol, centrifuged and resuspended in 100% ethanol. Good results can be obtained with a concentration in the adhering solution of 8-10 Îźg/ÎźL microcarriers, 14-17 Îźg/mL mixed duplex oligonucleotide, 1.1-1.4 M CaCl2 and 18-22 mM spermidine. Optimal results were observed under the conditions of 8 Îźg/ÎźL microcarriers, 16.5 Îźg/mL mixed duplex oligonucleotide, 1.3 M CaCl2 and 21 mM spermidine.
Gene repair oligonucleobases can also be introduced into plant cells using microfibers to penetrate the cell wall and cell membrane. U.S. Pat. No. 5,302,523 to Coffee et al describes the use of silicon carbide fibers to facilitate transformation of suspension maize cultures of Black Mexican Sweet. Any mechanical technique that can be used to introduce DNA for transformation of a plant cell using microfibers can be used to deliver gene repair oligonucleobases for transmutation.
An illustrative technique for microfiber delivery of a gene repair oligonucleobase is as follows: Sterile microfibers (2 Îźg) are suspended in 150 ÎźL of plant culture medium containing about 10 Îźg of a mixed duplex oligonucleotide. A suspension culture is allowed to settle and equal volumes of packed cells and the sterile fiber/nucleotide suspension are vortexed for 10 minutes and plated. Selective media are applied immediately or with a delay of up to about 120 h as is appropriate for the particular trait.
In an alternative embodiment, the gene repair oligonucleobases can be delivered to the plant cell by electroporation of a protoplast derived from a plant part. The protoplasts are formed by enzymatic treatment of a plant part, particularly a leaf, according to techniques well known to those skilled in the art. See, e.g., Gallois et al, 1996, in Methods in Molecular Biology 55:89-107, Humana Press, Totowa, N.J.; Kipp et al., 1999, in Methods in Molecular Biology 133:213-221, Humana Press, Totowa, NJ. The protoplasts need not be cultured in growth media prior to electroporation. Illustrative conditions for electroporation are 300,000 protoplasts in a total volume of 0.3 mL with a concentration of gene repair oligonucleobase of between 0.6-4 Îźg/mL.
In an alternative embodiment, nucleic acids are taken up by plant protoplasts in the presence of the membrane-modifying agent polyethylene glycol, according to techniques well known to those skilled in the art. In another alternative embodiment, the gene repair oligonucleobases can be delivered by injecting it with a microcapillary into plant cells or into protoplasts.
In an alternative embodiment, nucleic acids are embedded in microbeads composed of calcium alginate and taken up by plant protoplasts in the presence of the membrane-modifying agent polyethylene glycol (see, e.g., Sone et al., 2002. Liu et al., 2004).
In an alternative embodiment, nucleic acids frozen in water and introduced into plant cells by bombardment in the form of microparticles (see, e.g., Gilmore, 1991, U.S. Pat. No. 5,219,746; Brinegar et al.).
In an alternative embodiment, nucleic acids attached to nanoparticles are introduced into intact plant cells by incubation of the cells in a suspension containing the nanoparticle (see, e.g., Pasupathy et al., 2008) or by delivering them into intact cells through particle bombardment or into protoplasts by co-incubation (see, e.g., Torney et al., 2007).
In an alternative embodiment, nucleic acids complexed with penetrating peptides and delivered into cells by co-incubation (see, e.g., Chugh et al, 2008, WO 2008148223 A1; Eudes and Chugh).
In an alternative embodiment, nucleic acids are introduced into intact cells through electroporation (see, e.g., He et al., 1998, US 2003/0115641 A1, Dobres et al.).
In an alternative embodiment, nucleic acids are delivered into cells of dry embryos by soaking them in a solution with nucleic acids (see, e.g., TĂśpfer et al., 1989, Senaratna et al., 1991) or in other embodiments are introduced by Cellsqueeze (SQZ Biotech),
In various embodiments, plants as disclosed herein can be of any species of dicotyledonous, monocotyledonous or gymnospermous plant, including any woody plant species that grows as a tree or shrub, any herbaceous species, or any species that produces edible fruits, seeds or vegetables, or any species that produces colorful or aromatic flowers. For example, the plant maybe selected from a species of plant from the group consisting of canola, sunflower, corn, tobacco, sugar beet, cotton, maize, wheat, barley, rice, alfalfa, barley, sorghum, tomato, mango, peach, apple, pear, strawberry, banana, melon, cassava, potato, carrot, lettuce, onion, soy bean, soya spp, sugar cane, pea, chickpea, field pea, fava bean, lentils, turnip, rutabaga, brussel sprouts, lupin, cauliflower, kale, field beans, poplar, pine, eucalyptus, grape, citrus, triticale, alfalfa, rye, oats, turf and forage grasses, flax, oilseed rape, mustard, cucumber, morning glory, balsam, pepper, eggplant, marigold, lotus, cabbage, daisy, carnation, tulip, iris, lily, and nut producing plants insofar as they are not already specifically mentioned.
Plants and plant cells can be tested for resistance or tolerance to an herbicide using commonly known methods in the art, e.g., by growing the plant or plant cell in the presence of an herbicide and measuring the rate of growth as compared to the growth rate in the absence of the herbicide.
As used herein, substantially normal growth of a plant, plant organ, plant tissue or plant cell is defined as a growth rate or rate of cell division of the plant, plant organ, plant tissue, or plant cell that is at least 35%, at least 50%, at least 60%, or at least 75% of the growth rate or rate of cell division in a corresponding plant, plant organ, plant tissue or plant cell expressing the wild-type protein of interest.
As used herein, substantially normal development of a plant, plant organ, plant tissue or plant cell is defined as the occurrence of one or more development events in the plant, plant organ, plant tissue or plant cell that are substantially the same as those occurring in a corresponding plant, plant organ, plant tissue or plant cell expressing the wild-type protein.
In certain embodiments plant organs provided herein include, but are not limited to, leaves, stems, roots, vegetative buds, floral buds, meristems, embryos, cotyledons, endosperm, sepals, petals, pistils, carpels, stamens, anthers, microspores, pollen, pollen tubes, ovules, ovaries and fruits, or sections, slices or discs taken therefrom. Plant tissues include, but are not limited to, callus tissues, ground tissues, vascular tissues, storage tissues, meristematic tissues, leaf tissues, shoot tissues, root tissues, gall tissues, plant tumor tissues, and reproductive tissues. Plant cells include, but are not limited to, isolated cells with cell walls, variously sized aggregates thereof, and protoplasts.
Plants are substantially âtolerantâ to a relevant herbicide when they are subjected to it and provide a dose/response curve which is shifted to the right when compared with that provided by similarly subjected non-tolerant like plant. Such dose/response curves have âdoseâ plotted on the X-axis and âpercentage killâ, âherbicidal effectâ, etc., plotted on the y-axis. Tolerant plants will require more herbicide than non-tolerant like plants in order to produce a given herbicidal effect. Plants that are substantially âresistantâ to the herbicide exhibit few, if any, necrotic, lytic, chlorotic or other lesions, when subjected to herbicide at concentrations and rates which are typically employed by the agrochemical community to kill weeds in the field. Plants which are resistant to an herbicide are also tolerant of the herbicide.
Tissue culture of various tissues of plant species and regeneration of plants therefrom is known. For example, the propagation of a canola cultivar by tissue culture is described in any of the following but not limited to any of the following: Chuong et al., âA Simple Culture Method for Brassica hypocotyls Protoplasts,â Plant Cell Reports 4:4-6, 1985; Barsby, T. L., et al., âA Rapid and Efficient Alternative Procedure for the Regeneration of Plants from Hypocotyl Protoplasts of Brassica napus,â Plant Cell Reports (Spring, 1996); Kartha, K., et al., âIn vitro Plant Formation from Stem Explants of Rape,â Physiol. Plant, 31:217-220, 1974; Narasimhulu, S., et al., âSpecies Specific Shoot Regeneration Response of Cotyledonary Explants of Brassicas,â Plant Cell Reports (Spring 1988); Swanson, E., âMicrospore Culture in Brassica,â Methods in Molecular Biology, Vol. 6, Chapter 17, p. 159, 1990.
Further reproduction of the variety can occur by tissue culture and regeneration. Tissue culture of various tissues of soybeans and regeneration of plants therefrom is well known and widely published. For example, reference may be had to Komatsuda, T. et al., âGenotype X Sucrose Interactions for Somatic Embryogenesis in Soybeans,â Crop Sci. 31:333-337, 1991; Stephens, P. A., et al., âAgronomic Evaluation of Tissue-Culture-Derived Soybean Plants,â Theor. Appl. Genet. 82:633-635, 1991; Komatsuda, T. et al., âMaturation and Germination of Somatic Embryos as Affected by Sucrose and Plant Growth Regulators in Soybeans Glycine gracilis Skvortz and Glycine max (L.) Merr.â Plant Cell, Tissue and Organ Culture, 28:103-113, 1992; Dhir, S. et al., âRegeneration of Fertile Plants from Protoplasts of Soybean (Glycine max L. Merr.); Genotypic Differences in Culture Response,â Plant Cell Reports 11:285-289, 1992; Pandey, P. et al., âPlant Regeneration from Leaf and Hypocotyl Explants of Glycine wightii (W. and A.) VERDC. var. longicauda,â Japan J. Breed. 42:1-5, 1992; and Shetty, K., et al., âStimulation of In Vitro Shoot Organogenesis in Glycine max (Merrill.) by Allantoin and Amides,â Plant Science 81:245-251, 1992. The disclosures of U.S. Pat. No. 5,024,944 issued Jun. 18, 1991 to Collins et al., and U.S. Pat. No. 5,008,200 issued Apr. 16, 1991 to Ranch et al., are hereby incorporated herein in their entirety by reference.
In addition to the aspects and embodiments described and provided elsewhere in this disclosure, the following non-limiting list of particular embodiments are specifically contemplated.
1. A method of causing a genetic change in a cell, said method comprising exposing said cell to a DNA cutter and a modified GRON.
2. A cell comprising a DNA cutter and a GRON.
3. The method or cell of any of the preceding embodiments, wherein said cells is one or more species of cell selected from the group consisting of plant, bacteria, yeast, fungi, algae, and mammalian.
4. The method or cell of any of the preceding embodiments, wherein said cells is one or more species of cell selected from the group consisting of Escherichia coli, Mycobacterium smegmatis, Baccillus subtilis, Chlorella, Bacillus thuringiensis, Saccharomyces cerevisiae, Yarrowia lipolytica, Chlamydamonas rhienhardtii, Pichia pastoris, Corynebacterium, Aspergillus niger, and Neurospora crassa. Arabidopsis thaliana, Solanum tuberosum, Solanum phureja, Oryza sativa, Glycine max, Amaranthus tuberculatus, Linum usitatissimum, and Zea mays
5. The method or cell of any of the preceding embodiments, wherein said cell is Yarrowia lipolytica.
6. The method or cell of any of the preceding embodiments, wherein said cell is a yeast cell that is not Saccharomyces cerevisiae.
7. A method of causing a genetic change in a plant cell, said method comprising exposing said cell to a DNA cutter and a modified GRON.
8. A plant cell comprising a DNA cutter and a modified GRON.
9. A method of causing a genetic change in a plant cell, said method comprising exposing said cell to a DNA cutter and a GRON that comprises DNA and/or RNA.
10. A plant cell comprising a DNA cutter that comprises DNA and/or RNA and/or protein.
11. A method of causing a genetic change in a Acetyl-Coenzyme A carboxylase (ACCase) gene in a cell, wherein said genetic change causes a change in the Acetyl-Coenzyme A carboxylase (ACCase) protein at one or more amino acid positions, said positions selected from the group consisting of 1781, 1783, 1786, 2078, 2079, 2080 and 2088 based on the numbering of the blackgrass reference sequence SEQ ID NO:1 or at an analogous amino acid residue in an ACCase paralog said method comprising exposing said cell to a modified GRON.
12. A method of causing a genetic change in a Acetyl-Coenzyme A carboxylase (ACCase) gene in a cell, wherein said genetic change causes a change in the Acetyl-Coenzyme A carboxylase (ACCase) protein at one or more amino acid positions, said positions selected from the group consisting of 1781, 1783, 1786, 2078, 2079, 2080 and 2088 based on the numbering of the blackgrass reference sequence SEQ ID NO:1 or at an analogous amino acid residue in an ACCase paralog said method comprising exposing said cell to a DNA cutter and a modified GRON.
13. A method for producing a plant or plant cell, comprising introducing into a plant cell a gene repair oligonucleobase (GRON) with a targeted mutation in an Acetyl-Coenzyme A carboxylase (ACCase) gene to produce a plant cell with an ACCase gene that expresses an ACCase protein comprising a mutation at one or more amino acid positions corresponding to a position selected from the group consisting of 1781, 1783, 1786, 2078, 2079, 2080 and 2088 based on the numbering of the blackgrass reference sequence SEQ ID NO:1 or at an analogous amino acid residue in an ACCase paralog.
14. A method for producing a plant or plant cell, comprising introducing into a plant cell a DNA cutter and a gene repair oligonucleobase (GRON) with a targeted mutation in an Acetyl-Coenzyme A carboxylase (ACCase) gene to produce a plant cell with an ACCase gene that expresses an ACCase protein comprising a mutation at one or more amino acid positions corresponding to a position selected from the group consisting of 1781, 1783, 1786, 2078, 2079, 2080 and 2088 based on the numbering of the blackgrass reference sequence SEQ ID NO:1 or at an analogous amino acid residue in an ACCase paralog.
15. A fertile plant comprising an Acetyl-Coenzyme A carboxylase (ACCase) gene that encodes a protein comprising a mutation at position 2078 based on the numbering of the blackgrass reference sequence SEQ ID NO:1 or at an analogous amino acid residue in an ACCase paralog.
16. A fertile rice plant comprising an Acetyl-Coenzyme A carboxylase (ACCase) gene that encodes a protein comprising a mutation at position 2078 based on the numbering of the blackgrass reference sequence SEQ ID NO:1 or at an analogous amino acid residue in an ACCase paralog.
17. A plant cell comprising an Acetyl-Coenzyme A carboxylase (ACCase) gene that encodes a protein comprising a mutation at position 2078 based on the numbering of the blackgrass reference sequence SEQ ID NO:1 or at an analogous amino acid residue in an ACCase paralog and that further comprises an Acetyl-Coenzyme A carboxylase (ACCase) gene that encodes a protein comprising a mutation at one or more amino acid positions, said positions selected from the group consisting of 1781, 1783, 1786, 2079, 2080 and 2088 based on the numbering of the blackgrass reference sequence SEQ ID NO:1 or at an analogous amino acid residue in an ACCase paralog.
18. A fertile plant comprising an Acetyl-Coenzyme A carboxylase (ACCase) gene that encodes a protein comprising a mutation at position 2078 based on the numbering of the blackgrass reference sequence SEQ ID NO:1 or at an analogous amino acid residue in an ACCase paralog and that further comprises an Acetyl-Coenzyme A carboxylase (ACCase) gene that encodes a protein comprising a mutation at one or more amino acid positions, said positions selected from the group consisting of 1781, 1783, 1786, 2079, 2080 and 2088 based on the numbering of the blackgrass reference sequence SEQ ID NO:1 or at an analogous amino acid residue in an ACCase paralog.
19. A method of causing a genetic change in a Acetyl-Coenzyme A carboxylase (ACCase) gene in a cell, wherein said genetic change causes a change in the Acetyl-Coenzyme A carboxylase (ACCase) protein at position 2078 based on the numbering of the blackgrass reference sequence SEQ ID NO:1 or at an analogous amino acid residue in an ACCase paralog said method comprising exposing said cell to a modified GRON.
20. A method of causing a genetic change in a Acetyl-Coenzyme A carboxylase (ACCase) gene in a cell, wherein said genetic change causes a change in the Acetyl-Coenzyme A carboxylase (ACCase) protein at position 2078 based on the numbering of the blackgrass reference sequence SEQ ID NO:1 or at an analogous amino acid residue in an ACCase paralog said method comprising exposing said cell to a DNA cutter and a modified GRON.
21. The method, plant or cell of any of the preceding embodiments, wherein said mutation or change in an Acetyl-Coenzyme A carboxylase (ACCase) gene, if present results in an Acetyl-Coenzyme A carboxylase (ACCase) protein comprising one or more selected from the group consisting of an isoleucine to alanine at a position corresponding to position 1781 of SEQ ID NO:1; an isoleucine to leucine at a position corresponding to position 1781 of SEQ ID NO:1; an isoleucine to methionine at a position corresponding to position 1781 of SEQ ID NO:1; an isoleucine to asparagine at a position corresponding to position 1781 of SEQ ID NO:1; an isoleucine to serine at a position corresponding to position 1781 of SEQ ID NO:1; an isoleucine to threonine at a position corresponding to position 1781 of SEQ ID NO:1; an isoleucine to valine at a position corresponding to position 1781 of SEQ ID NO:1; a glycine to cysteine at a position corresponding to position 1783 of SEQ ID NO:1; an alanine to proline at a position corresponding to position 1786 of SEQ ID NO:1; an aspartate to glycine at a position corresponding to position 2078 of SEQ ID NO:1; an aspartate to lysine at a position corresponding to position 2078 of SEQ ID NO:1; an aspartate to threonine at a position corresponding to position 2078 of SEQ ID NO:1; a serine to phenylalanine at a position corresponding to position 2079 of SEQ ID NO:1; a lysine to glutamate at a position corresponding to position 2080 of SEQ ID NO:1; a cysteine to phenylalanine at a position corresponding to position 2088 of SEQ ID NO:1; a cysteine to glycine at a position corresponding to position 2088 of SEQ ID NO:1; a cysteine to histidine at a position corresponding to position 2088 of SEQ ID NO:1; a cysteine to lysine at a position corresponding to position 2088 of SEQ ID NO:1; a cysteine to leucine at a position corresponding to position 2088 of SEQ ID NO:1; a cysteine to asparagine at a position corresponding to position 2088 of SEQ ID NO:1; a cysteine to proline at a position corresponding to position 2088 of SEQ ID NO:1; a cysteine to glutamine at a position corresponding to position 2088 of SEQ ID NO:1; a cysteine to arginine at a position corresponding to position 2088 of SEQ ID NO:1; a cysteine to serine at a position corresponding to position 2088 of SEQ ID NO:1; a cysteine to threonine at a position corresponding to position 2088 of SEQ ID NO:1; a cysteine to valine at a position corresponding to position 2088 of SEQ ID NO:1; and a cysteine to a tryptophan at a position corresponding to position 2088 of SEQ ID NO:1.
22. The plant or cell of any of the preceding embodiments, or a plant or plant cell made by any of the methods of the preceding embodiments, wherein said plant or cell comprises an Acetyl-Coenzyme A carboxylase (ACCase) protein comprising one or more selected from the group consisting of an isoleucine to alanine at a position corresponding to position 1781 of SEQ ID NO:1; an isoleucine to leucine at a position corresponding to position 1781 of SEQ ID NO:1; an isoleucine to methionine at a position corresponding to position 1781 of SEQ ID NO:1; an isoleucine to asparagine at a position corresponding to position 1781 of SEQ ID NO:1; an isoleucine to serine at a position corresponding to position 1781 of SEQ ID NO:1; an isoleucine to threonine at a position corresponding to position 1781 of SEQ ID NO:1; an isoleucine to valine at a position corresponding to position 1781 of SEQ ID NO:1; a glycine to cysteine at a position corresponding to position 1783 of SEQ ID NO:1; an alanine to proline at a position corresponding to position 1786 of SEQ ID NO:1; an aspartate to glycine at a position corresponding to position 2078 of SEQ ID NO:1; an aspartate to lysine at a position corresponding to position 2078 of SEQ ID NO:1; an aspartate to threonine at a position corresponding to position 2078 of SEQ ID NO:1; a serine to phenylalanine at a position corresponding to position 2079 of SEQ ID NO:1; a lysine to glutamate at a position corresponding to position 2080 of SEQ ID NO:1; a cysteine to phenylalanine at a position corresponding to position 2088 of SEQ ID NO:1; a cysteine to glycine at a position corresponding to position 2088 of SEQ ID NO:1; a cysteine to histidine at a position corresponding to position 2088 of SEQ ID NO:1; a cysteine to lysine at a position corresponding to position 2088 of SEQ ID NO:1; a cysteine to leucine at a position corresponding to position 2088 of SEQ ID NO:1; a cysteine to asparagine at a position corresponding to position 2088 of SEQ ID NO:1; a cysteine to proline at a position corresponding to position 2088 of SEQ ID NO:1; a cysteine to glutamine at a position corresponding to position 2088 of SEQ ID NO:1; a cysteine to arginine at a position corresponding to position 2088 of SEQ ID NO:1; a cysteine to serine at a position corresponding to position 2088 of SEQ ID NO:1; a cysteine to threonine at a position corresponding to position 2088 of SEQ ID NO:1; a cysteine to valine at a position corresponding to position 2088 of SEQ ID NO:1; and a cysteine to a tryptophan at a position corresponding to position 2088 of SEQ ID NO:1.
23. The plant or cell of any of the preceding embodiments, or a plant or cell made by any of the methods of the preceding embodiments, wherein said plant or plant cell comprises an Acetyl-Coenzyme A carboxylase (ACCase) gene that encodes a protein comprising a mutation at one or more amino acid positions, said positions selected from the group consisting of 1781, 1783, 1786, 2078, 2079, 2080 and 2088 based on the numbering of the blackgrass reference sequence SEQ ID NO:1 or at an analogous amino acid residue in an ACCase paralog.
24. The plant or cell of any of the preceding embodiments, or a plant or cell made by any of the methods of the preceding embodiments, wherein said plant or cell comprises an Acetyl-Coenzyme A carboxylase (ACCase) gene that encodes a protein comprising a mutation at position 2078 based on the numbering of the blackgrass reference sequence SEQ ID NO:1 or at an analogous amino acid residue in an ACCase paralog and that further comprises an Acetyl-Coenzyme A carboxylase (ACCase) gene that encodes a protein comprising a mutation at one or more amino acid positions, said positions selected from the group consisting of 1781, 1783, 1786, 2079, 2080 and 2088 based on the numbering of the blackgrass reference sequence SEQ ID NO:1 or at an analogous amino acid residue in an ACCase paralog.
In each of the foregoing ACCase embodiments 11-24, whether methods, plants, cells, or otherwise, the following are suitable mutations for use therein:
| Amino | Amino | |||
| Acid | Codon | Acid | Codon | |
| Change | Change | Change | Change | |
| I1781A | ATA > GCT | C2088F | TGC > TTT | |
| ATA > GCC | TGC > TTC | |||
| ATA > GCA | C2088G | TGC > GGT | ||
| ATA > GCG | TGC > GGC | |||
| I1781L | ATA > CTT | TGC > GGA | ||
| ATA > CTC | TGC > GGG | |||
| ATA > CTA | C2088H | TGC > CAT | ||
| ATA > CTG | TGC > CAC | |||
| ATA > TTA | C2088K | TGC > AAA | ||
| ATA > TTG | TGC > AAG | |||
| I1781M | ATA > ATG | C2088L | TGC > CTT | |
| I1781N | ATA > AAT | TGC > CTC | ||
| ATA > AAC | TGC > CTA | |||
| I1781S | ATA > TCT | TGC > CTG | ||
| ATA > TCC | TGC > TTA | |||
| ATA > TCA | TGC > TTG | |||
| ATA > TCG | C2088N | TGC > AAT | ||
| I1781T | ATA > ACT | TGC > AAC | ||
| ATA > ACC | C2088P | TGC > CCT | ||
| ATA > ACA | TGC > CCC | |||
| ATA > ACG | TGC > CCA | |||
| I1781V | ATA > GTT | TGC > CCG | ||
| ATA > GTC | C2088Q | TGC > CAA | ||
| ATA > GTA | TGC > CAG | |||
| ATA > GTG | C2088R | TGC > CGT | ||
| G1783C | GGA > TGT | TGC > CGC | ||
| GGA > TGC | TGC > CGA | |||
| A1786P | GCT > CCT | TGC > CGG | ||
| GCT > CCC | TGC > AGA | |||
| GCT > CCA | TGC > AGG | |||
| GCT > CCG | C2088S | TGC > TCT | ||
| D2078G | GAT > GGT | TGC > TCC | ||
| GAT > GGC | TGC > TCA | |||
| GAT > GGA | TGC > TCG | |||
| GAT > GGG | C2088T | TGC > ACT | ||
| D2078K | GAT > AAA | TGC > ACC | ||
| GAT > AAG | TGC > ACA | |||
| D2078T | GAT > ACT | TGC > ACG | ||
| GAT > ACC | C2088V | TGC > GTT | ||
| GAT > ACA | TGC > GTC | |||
| GAT > ACG | TGC > GTA | |||
| S2079F | AGC > TTT | TGC > GTG | ||
| AGC > TTC | C2088W | TGC > TGG | ||
| K2080E | AAG > GAA | |||
| AAG > GAG | ||||
Alternative mutations include, but are not limited to, the following:
| S2079A | AGC > GCT | |
| AGC > GCC | ||
| AGC > GCA | ||
| AGC > GCG | ||
| G1783A | GGA > GCT | |
| GGA > GCC | ||
| GGA > GCA | ||
| GGA > GCG | ||
| A1786G | GCT > GGT | |
| GCT > GGC | ||
| GCT > GGA | ||
| GCT > GGG | ||
With regard to embodiments 11-24, corresponding positions to 1781m 1783, 1786, 2078, 2079, and 2080 based on the numbering of the blackgrass reference sequence are well known in the art and readily obtainable from appropriate sequence databases. By way of example, the following table shows the corresponding positions in the rice ACCase sequence:
| Am | OsI | OsJ |
| I1781 | I1792 | I1779 |
| G1783 | G1794 | G1781 |
| A1786 | A1797 | A1784 |
| D2078 | D2089 | D2076 |
| S2079 | S2090 | S2077 |
| K2080 | K2091 | K2078 |
| C2088 | C2099 | C2086 |
| Am: Alopecurus myosuroide; | ||
| OsI: Oryza sativa indica variety; | ||
| OsJ: Oryza sativa japonica variety |
25. A method for producing a plant or plant cell with a mutated EPSPS gene, comprising introducing into a plant cell a gene repair oligonucleobase (GRON) with a targeted mutation in an 5-enol pyruvylshikimate-3-phosphate synthase (EPSPS) gene to produce a plant cell with an EPSPS gene that expresses an EPSPS protein comprising a mutation at one or more amino acid positions corresponding to a position selected from the group consisting of 96, 97 and 101 based on the numbering of the amino acid sequence for the Escherichia coli reference sequence SEQ ID NO:2 or at an analogous amino acid residue in an EPSPS paralog.
26. A method for producing a plant or plant cell with a mutated EPSPS gene, comprising introducing into a plant cell a DNA cutter and a gene repair oligonucleobase (GRON) with a targeted mutation in an 5-enol pyruvylshikimate-3-phosphate synthase (EPSPS) gene to produce a plant cell with an EPSPS gene that expresses an EPSPS protein comprising a mutation at one or more amino acid positions corresponding to a position selected from the group consisting of 96, 97 and 101 based on the numbering of the amino acid sequence for the Escherichia coli reference sequence SEQ ID NO:2 or at an analogous amino acid residue in an EPSPS paralog.
27. A plant or cell with a mutated EPSPS gene, wherein said plant or cell is made by a method introducing into a plant cell a DNA cutter and a gene repair oligonucleobase (GRON) with a targeted mutation in an 5-enol pyruvylshikimate-3-phosphate synthase (EPSPS) gene to produce a plant cell with an EPSPS gene that expresses an EPSPS protein comprising a mutation at one or more amino acid positions corresponding to a position selected from the group consisting of 96, 97 and 101 based on the numbering of the amino acid sequence for the Escherichia coli reference sequence SEQ ID NO:2 or at an analogous amino acid residue in an EPSPS paralog.
28. The plant or cell of any of the preceding embodiments, or a plant or cell made by any of the methods of the preceding embodiments, wherein the plant or plant cell expresses an EPSPS protein comprising a mutation at one or more amino acid positions are selected from the group consisting of a glycine to alanine at a position corresponding to position 96 of SEQ ID NO:2; a threonine to isoleucine at a position corresponding to position 97 of SEQ ID NO:2; a proline to alanine at a position corresponding to position 101 of SEQ ID NO:2; a proline to serine at a position corresponding to position 101 of SEQ ID NO:2; and a proline to threonine at a position corresponding to position 101 of SEQ ID NO:2.
29. The plant or cell of any of the preceding embodiments, or a plant or cell made by any of the methods of the preceding embodiments, wherein the plant or plant cell expresses an EPSPS protein comprising mutation combinations selected from the group consisting of a threonine to isoleucine at a position corresponding to position 97 of SEQ ID NO:2 and a proline to alanine at a position corresponding to position 101 of SEQ ID NO:2; a threonine to isoleucine at a position corresponding to position 97 of SEQ ID NO:2 and a proline to alanine at a position corresponding to position 101 of SEQ ID NO:2; a threonine to isoleucine at a position corresponding to position 97 of SEQ ID NO:2 and a proline to serine at a position corresponding to position 101 of SEQ ID NO:2; and a threonine to isoleucine at a position corresponding to position 97 of SEQ ID NO:2 and a proline to threonine at a position corresponding to position 101 of SEQ ID NO:2.
With regard to embodiments 25-30, corresponding positions to 96, 97 and 101 based on the numbering of the Escherichia coli reference sequence SEQ ID NO:2 are well known in the art and readily obtainable from appropriate sequence databases. See e.g., U.S. Pat. No. 8,268,622. By way of example, the following table shows the corresponding positions in the flax EPSPS sequence:
| Flax EPSPS |
| E. coli EPSPS | Gene1 | Gene2 |
| G96 | G176 | G177 |
| T97 | T177 | T178 |
| âP101 | P181 | P182 |
| E.âcoliâEPSPSâsequenceâisâAroAâhavingâtheâsequence |
| (SEQâIDâNO:â10) |
| MESLTLQPIARVDGTINLPGSKTVSNRALLLAALAHGKTVLTNLLDSDDV |
| RHMLNALTALGVSYTLSADRTRCEIIGNGGPLHAEGALELFLGNAGTAMR |
| PLAAALCLGSNDIVLTGEPRMKERPIGHLVDALRLGGAKITYLEQENYPP |
| LRLQGGFTGGNVDVDGSVSSQFLTALLMTAPLAPEDTVIRIKGDLVSKPY |
| IDITLNLMKTFGVEIENQHYQQFVVKGGQSYQSPGTYLVEGDASSASYFL |
| AAAAIKGGTVKVTGIGRNSMQGDIRFADVLEKMGATICWGDDYISCTRGE |
| LNAIDMDMNHIPDAAMTIATAALFAKGTTRLRNIYNWRVKETDRLFAMAT |
| ELRKVGAEVEEGHDYIRITPPEKLNFAEIATYNDHRMAMCFSLVALSDTP |
| VTILDPKCTAKTFPDYFEQLARISQAA |
| Flaxâgeneâ1âsequenceâisâlclâ-âg41452_1333 |
| havingâtheâsequence |
| (SEQâIDâNO:â11) |
| MALVTKICGGANAVALPATFGTRRTKSISSSVSFRSSTSPPSLKQRRRSG |
| NVAAAAAAPLRVSASLTTAAEKASTVPEEVVLQPIKDISGIVTLPGSKSL |
| SNRILLLAALSEGTTVVDNLLNSDDVHYMLGALKTLGLNVEHSSEQKRAI |
| VEGCGGVFPVGKLAKNDIELFLGNAGTAMRPLTAAVTAAGGNSSYILDGV |
| PRMRERPIGDLVVGLKQLGADVTCSSTSCPPVHVNGQGGLPGGKVKLSGS |
| ISSQYLTALLMAAPLALGDVEIEIVDKLISVPYVDMTLKLMERFGVAVEH |
| SGSWDRFFVKGGQKYKSPGNAYVEGDASSASYFLAGAAITGGTITVEGCG |
| TSSLQGDVKFAEVLEKMGAKVIWTENSVTVTGPPRDASGRKHLRAVDVNM |
| NKMPDVAMTLAVVALYADGPTAIRDVASWRVKETERMIAICTELRKLGAT |
| VEEGPDYCIITPPEKLNIAEIDTYDDHRMAMAFSLAACADVPVTIRDPGC |
| TKKTFPDYFEVLERYTKH |
| Flaxâgeneâ2âsequenceâisâlclâ-âg40547_1271 |
| havingâtheâsequence |
| (SEQâIDâNO:â12) |
| MAQVTKICGGANAVALPATFGTRRTKSISSSVSFRSSTSPPSLKQRRLLG |
| NVAAAAAAAPLRISASLATAAEKASTVPEEIVLQPIKDISGIVTLPGSKS |
| LSNRILLLAALSEGKTVVDNLLNSDDVHYMLGALKTLGLNVEHSSEQKRA |
| IVEGRGGVFPVGKLGKNDIELFLGNAGTAMRPLTAAVTAAGGNSSYILDG |
| VPRMRERPIGDLVVGLKQLGADVSCSSTSCPPVHVNAKGGLPGGKVKLSG |
| SISSQYLTALLMAAPLALGDVEIEIVDKLISVPYVDMTLKLMERFGVAVE |
| HSGSWDRFFVKGGQKYKSPGNAYVEGDASSASYFLAGAAITGGTITVEGC |
| GTSSLQGDVKFAEVLEKMGAKVTWTETSVTVTGPPRDASGKKHLRAVDVN |
| MNKMPDVAMTLAVVALYADGPTAIRDVASWRVKETERMIAVCTELRKLGA |
| TVEEGPDYCIITPPEKLSIAEIDTYDDHRMAMAFSLAACADVPVTIRDPG |
| CTKKTFPDYFEVLERYTKH |
30. The method or cell of any of the preceding embodiments, wherein said DNA cutter is one or more selected from a CRISPR, a TALEN, a zinc finger, meganuclease, and a DNA-cutting antibiotic.
31. The method or cell of any of the preceding embodiments, wherein said DNA cutter is a CRISPR or a TALEN.
32. The method or cell of any of the preceding embodiments, wherein said DNA cutter is a CRISPR.
33. The method or cell of any of the preceding embodiments, wherein said DNA cutter is a TALEN.
34. The method or cell of any of the preceding embodiments, wherein said DNA cutter is one or more DNA-cutting antibiotics selected from the group consisting of bleomycin, zeocin, phleomycin, tallysomycin and pepleomycin.
35. The method or cell of any of the preceding embodiments, wherein said DNA cutter is zeocin.
36. The method or cell of any of the preceding embodiments, wherein said GRON is single stranded.
37. The method or cell of any of the preceding embodiments, wherein the GRON is a chemically protected oligonucleotide.
38. The method or cell of any of the preceding embodiments, wherein the GRON comprises a chemically protected oligonucleotide protected at the 5Ⲡend.
39. The method or cell of any of the preceding embodiments, wherein the GRON comprises a chemically protected oligonucleotide protected at the 3Ⲡend.
40. The method or cell of any of the preceding embodiments, wherein the GRON comprises a chemically protected oligonucleotide protected at the 5Ⲡand 3Ⲡends.
41. The method or cell of any of the preceding embodiments, wherein the GRON comprises one or more selected from a Cy3 group, a 3PS group, idC group, and a 2â˛-O-methyl group.
42. The method or cell of any of the preceding embodiments, wherein the GRON comprises a Cy3 group.
43. The method or cell of any of the preceding embodiments, wherein the GRON comprises two or more Cy3 groups.
44. The method or cell of any of the preceding embodiments, wherein the GRON comprises a Cy3 group at the first (ultimate) base on the 5Ⲡend.
45. The method or cell of any of the preceding embodiments, wherein the GRON comprises an idC group at the first (ultimate) base on the 5Ⲡend.
46. The method or cell of any of the preceding embodiments, wherein the GRON comprises a Cy3 group at the first (ultimate) base on the 3Ⲡend.
47. The method or cell of any of the preceding embodiments, wherein the GRON comprises an idC group at the first (ultimate) base on the 3Ⲡend.
48. The method or cell of any of the preceding embodiments, wherein the GRON comprises a 3PS group.
49. The method or cell of any of the preceding embodiments, wherein the GRON comprises two or more 3PS groups.
50. The method or cell of any of the preceding embodiments, wherein the GRON comprises three or more 3PS groups.
51. The method or cell of any of the preceding embodiments, wherein the GRON comprises a 3PS group at the first (ultimate) base on the 5Ⲡend.
52. The method or cell of any of the preceding embodiments, wherein the GRON comprises a 3PS group at the second (penultimate) base on the 5Ⲡend.
53. The method or cell of any of the preceding embodiments, wherein the GRON comprises a 3PS group at the third (antepenultimate) base on the 5Ⲡend.
54. The method or cell of any of the preceding embodiments, wherein the GRON comprises a 3PS group at the first (ultimate) base on the 3Ⲡend.
55. The method or cell of any of the preceding embodiments, wherein the GRON comprises a 3PS group at the second to last (penultimate) base on the 3Ⲡend.
56. The method or cell of any of the preceding embodiments, wherein the GRON comprises a 3PS group at the third to last (antepenultimate) base on the 3Ⲡend.
57. The method or cell of any of the preceding embodiments, wherein the GRON comprises a 3PS group at the first (ultimate) bases on both the 5Ⲡand 3Ⲡend.
58. The method or cell of any of the preceding embodiments, wherein the GRON comprises a 3PS group at the first two bases on both the 5Ⲡand the 3Ⲡend.
59. The method or cell of any of the preceding embodiments, wherein the GRON comprises a 3PS group at the first three bases on both the 5Ⲡand the 3Ⲡend.
60. The method or cell of any of the preceding embodiments, wherein the GRON comprises a 2â˛-O-methyl group.
61. The method or cell of any of the preceding embodiments, wherein the GRON comprises two or more 2â˛-O-methyl groups.
62. The method or cell of any of the preceding embodiments, wherein the GRON comprises a 2â˛-O-methyl group at the first (ultimate) base on the 5Ⲡend.
63. The method or cell of any of the preceding embodiments, wherein the GRON has a 2â˛-O-methyl group at the first base on the 5Ⲡend and does not have any other 2â˛-O-methyl groups.
64. The method or cell of any of the preceding embodiments, wherein the GRON comprises a 2â˛-O-methyl group on each of the first two or more bases at the 5Ⲡend.
65. The method or cell of any of the preceding embodiments, wherein the GRON comprises a 2â˛-O-methyl group on each of the first three or more bases at the 5Ⲡend.
66. The method or cell of any of the preceding embodiments, wherein the GRON comprises a 2â˛-O-methyl group on each of the first four or more bases at the 5Ⲡend.
67. The method or cell of any of the preceding embodiments, wherein the GRON comprises a 2â˛-O-methyl group on each of the first five or more bases at the 5Ⲡend.
68. The method or cell of any of the preceding embodiments, wherein the GRON comprises a 2â˛-O-methyl group on each of the first six or more bases at the 5Ⲡend.
69. The method or cell of any of the preceding embodiments, wherein the GRON comprises a 2â˛-O-methyl group on each of the first seven or more bases at the 5Ⲡend.
70. The method or cell of any of the preceding embodiments, wherein the GRON comprises a 2â˛-O-methyl group on each of the first eight or more bases at the 5Ⲡend.
71. The method or cell of any of the preceding embodiments, wherein the GRON comprises a 2â˛-O-methyl group on each of the first nine or more bases at the 5Ⲡend.
72. The method or cell of any of the preceding embodiments, wherein the GRON comprises a 2â˛-O-methyl group on each of the first ten or more bases at the 5Ⲡend.
73. The method or cell of any of the preceding embodiments, wherein the GRON comprises 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10 RNA bases at the 5Ⲡend.
74. The method or cell of any of the preceding embodiments, wherein the GRON comprises a 2â˛-O-methyl group at the first (ultimate) base on the 3Ⲡend.
75. The method or cell of any of the preceding embodiments, wherein the GRON has a 2â˛-O-methyl group at the first base on the 3Ⲡend and does not have any other 2â˛-O-methyl groups.
76. The method or cell of any of the preceding embodiments, wherein the GRON comprises a 2â˛-O-methyl group on each of the first two (ultimate and penultimate) or more bases at the 3Ⲡend.
77. The method or cell of any of the preceding embodiments, wherein the GRON comprises a 2â˛-O-methyl group on each of the first three (ultimate and penultimate, and antepenultimate) or more bases at the 3Ⲡend.
78. The method or cell of any of the preceding embodiments, wherein the GRON comprises a 2â˛-O-methyl group on each of the first four or more bases at the 3Ⲡend.
79. The method or cell of any of the preceding embodiments, wherein the GRON comprises a 2â˛-O-methyl group on each of the first five or more bases at the 3Ⲡend.
80. The method or cell of any of the preceding embodiments, wherein the GRON comprises a 2â˛-O-methyl group on each of the first six or more bases at the 3Ⲡend.
81. The method or cell of any of the preceding embodiments, wherein the GRON comprises a 2â˛-O-methyl group on each of the first seven or more bases at the 3Ⲡend.
82. The method or cell of any of the preceding embodiments, wherein the GRON comprises a 2â˛-O-methyl group on each of the first eight or more bases at the 3Ⲡend.
83. The method or cell of any of the preceding embodiments, wherein the GRON comprises a 2â˛-O-methyl group on each of the first nine or more bases at the 3Ⲡend.
84. The method or cell of any of the preceding embodiments, wherein the GRON comprises a 2â˛-O-methyl group on each of the first ten or more bases at the 3Ⲡend.
85. The method or cell of any of the preceding embodiments, wherein the GRON comprises 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10 RNA bases at the 3Ⲡend.
86. The method or cell of any of the preceding embodiments, wherein said GRON has a wobble base pair relative to the target sequence for the genetic change.
87. The method or cell of any of the preceding embodiments, wherein said GRON is between 15 and 60 nucleotides in length.
88. The method or cell of any of the preceding embodiments, wherein said GRON is 41 nucleotides in length.
89. The method or cell of any of the preceding embodiments, wherein said GRON is between 50 and 110 nucleotides in length.
90. The method or cell of any of the preceding embodiments, wherein said GRON is 101 nucleotides in length.
91. The method or cell of any of the preceding embodiments, wherein said GRON is between 150 and 210 nucleotides in length.
92. The method or cell of any of the preceding embodiments, wherein said GRON is 201 nucleotides in length.
93. The method or cell of any of the preceding embodiments, wherein said GRON is between 70 and 210 nucleotides in length.
94. The method or cell of any of the preceding emodiments, wherein said GRON is longer than 70 nucleotides in length.
95. The method or cell of any of the preceding emodiments, wherein said GRON is longer than 100 nucleotides in length.
96. The method or cell of any of the preceding embodiments, wherein said GRON is longer than 165 nucleotides in length.
97. The method or cell of any of the preceding embodiments, wherein said GRON is longer than 175 nucleotides in length.
98. The method or cell of any of the preceding embodiments, wherein said GRON is longer than 185 nucleotides in length.
99. The method or cell of any of the preceding embodiments, wherein said GRON is longer than 195 nucleotides in length.
100. The method or cell of any of the preceding embodiments, wherein said GRON is longer than 200 nucleotides in length.
101. The method or cell of any of the preceding embodiments, wherein said GRON is longer than 210 nucleotides in length.
102. The method or cell of any of the preceding embodiments, wherein said GRON is longer than 220 nucleotides in length.
103. The method or cell of any of the preceding embodiments, wherein said GRON is longer than 230 nucleotides in length.
104. The method or cell of any of the preceding embodiments, wherein said GRON is longer than 240 nucleotides in length.
105. The method or cell of any of the preceding embodiments, wherein said GRON is longer than 250 nucleotides in length.
106. The method or cell of any of the preceding embodiments, wherein said GRON is longer than 260 nucleotides in length.
107. The method or cell of any of the preceding embodiments, wherein said GRON is longer than 270 nucleotides in length.
108. The method or cell of any of the preceding embodiments, wherein said GRON is longer than 280 nucleotides in length.
109. The method or cell of any of the preceding embodiments, wherein said GRON is longer than 290 nucleotides in length.
110. The method or cell of any of the preceding embodiments, wherein said GRON is longer than 300 nucleotides in length.
111. The method or cell of any of the preceding embodiments, wherein said GRON is longer than 400 nucleotides in length.
112. The method or cell of any of the preceding embodiments, wherein said GRON is longer than 500 nucleotides in length.
113. The method or cell of any of the preceding embodiments, wherein said GRON is longer than 600 nucleotides in length.
114. The method or cell of any of the preceding embodiments, wherein said GRON is longer than 700 nucleotides in length.
115. The method or cell of any of the preceding embodiments, wherein said GRON is longer than 800 nucleotides in length.
116. The method or cell of any of the preceding embodiments, wherein said GRON is longer than 900 nucleotides in length.
117. The method or cell of any of the preceding embodiments, wherein said GRON is longer than 1000 nucleotides in length.
118. The method or cell of any of the preceding embodiments wherein said plant is selected from the group consisting of canola, sunflower, corn, tobacco, sugar beet, cotton, maize, wheat, barley, rice, alfalfa, barley, sorghum, tomato, mango, peach, apple, pear, strawberry, banana, melon, cassava, potato, carrot, lettuce, onion, soy bean, soya spp, sugar cane, pea, chickpea, field pea, fava bean, lentils, turnip, rutabaga, brussel sprouts, lupin, cauliflower, kale, field beans, poplar, pine, eucalyptus, grape, citrus, triticale, alfalfa, rye, oats, turf and forage grasses, flax, oilseed rape, mustard, cucumber, morning glory, balsam, pepper, eggplant, marigold, lotus, cabbage, daisy, carnation, tulip, iris, and lily.
119. The method or cell of any of the preceding embodiments wherein said plant is canola.
120. The method or cell of any of the preceding embodiments wherein said plant is corn
121. The method or cell of any of the preceding embodiments wherein said plant is maize.
122. The method or cell of any of the preceding embodiments wherein said plant is rice.
123. The method or cell of any of the preceding embodiments wherein said plant is sorghum.
124. The method or cell of any of the preceding embodiments wherein said plant is potato.
125. The method or cell of any of the preceding embodiments wherein said plant is soy bean.
126. The method or cell of any of the preceding embodiments wherein said plant is flax.
127. The method or cell of any of the preceding embodiments wherein said plant is oilseed rape.
128. The method or cell of any of the preceding embodiments wherein said plant is cassava.
129. The method or cell of any of the preceding embodiments wherein said plant is sunflower.
130. A method of causing a genetic change in a plant cell, said method comprising exposing said cell to a CRISPR and a modified GRON.
131. The method or cell of any of the preceding embodiments wherein multiple genetic changes are made.
132. The method or cell of any of the preceding embodiments wherein two or more guide RNAs are used.
133. The method or cell of any of the preceding embodiments wherein each of the more than one guide RNAs is complimentary to a different target for genetic change.
134. The method or cell of any of the preceding embodiments wherein the CRISPR includes a nickase.
135. The method or cell of any of the preceding embodiments wherein the DNA cutter includes two or more nickases.
136. The method or cell of any of the preceding embodiments wherein two or more nickases cuts on opposite strands of the target nucleic acid sequence.
137. The method or cell of any of the preceding embodiments wherein two or more nickases cuts on the same strand of the target nucleic acid sequence.
138. The method or cell of any of the preceding embodiments, wherein the GRON comprises a 2â˛-O-methyl group at the first (ultimate) base on the 3Ⲡend.
139. The method or cell of any of the preceding embodiments, wherein the GRON comprises a 2â˛-O-methyl group at the first (ultimate) base on the 3Ⲡend and does not have any other 2â˛-O-methyl groups.
140. The method or cell of any of the preceding embodiments, wherein the GRON comprises a 2â˛-O-methyl group on each of the first two or more bases at the 3Ⲡend.
141. The method or cell of any of the preceding embodiments, wherein the GRON comprises a 2â˛-O-methyl group on each of the first three or more bases at the 3Ⲡend.
142. The method or cell of any of the preceding embodiments, wherein the GRON comprises a 2â˛-O-methyl group on each of the first four or more bases at the 3Ⲡend.
143. The method or cell of any of the preceding embodiments, wherein the GRON comprises a 2â˛-O-methyl group on each of the first five or more bases at the 3Ⲡend.
144. The method or cell of any of the preceding embodiments, wherein the GRON comprises a 2â˛-O-methyl group on each of the first six or more bases at the 3Ⲡend.
145. The method or cell of any of the preceding embodiments, wherein the GRON comprises a 2â˛-O-methyl group on each of the first seven or more bases at the 3Ⲡend.
146. The method or cell of any of the preceding embodiments, wherein the GRON comprises a 2â˛-O-methyl group on each of the first eight or more bases at the 3Ⲡend.
147. The method or cell of any of the preceding embodiments, wherein the GRON comprises a 2â˛-O-methyl group on each of the first nine or more bases at the 3Ⲡend.
148. The method or cell of any of the preceding embodiments, wherein the GRON comprises a 2â˛-O-methyl group on each of the first ten or more bases at the 3Ⲡend.
149. The method or cell of any of the preceding embodiments, wherein the GRON comprises 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10 RNA bases at the 3Ⲡend.
150. The method or cell of any of the preceding embodiments, wherein the GRON does not comprise a 2â˛-O-methyl group at the first (ultimate) base on the 3Ⲡend.
151. The method or cell of any of the preceding embodiments, wherein the GRON does not comprise a 2â˛-O-methyl group on any of the first two or more bases at the 3Ⲡend.
152. The method or cell of any of the preceding embodiments, wherein the GRON does not comprise a 2â˛-O-methyl group on any of the first three or more bases at the 3Ⲡend.
153. The method or cell of any of the preceding embodiments, wherein the GRON does not comprise a 2â˛-O-methyl group on any of the first four or more bases at the 3Ⲡend.
154. The method or cell of any of the preceding embodiments, wherein the GRON does not comprise a 2â˛-O-methyl group on any of the first five or more bases at the 3Ⲡend.
155. The method or cell of any of the preceding embodiments, wherein the GRON does not comprise a 2â˛-O-methyl group on any of the first six or more bases at the 3Ⲡend.
156. The method or cell of any of the preceding embodiments, wherein the GRON does not comprise a 2â˛-O-methyl group on any of the first seven or more bases at the 3Ⲡend.
157. The method or cell of any of the preceding embodiments, wherein the GRON does not comprise a 2â˛-O-methyl group on any of the first eight or more bases at the 3Ⲡend.
158. The method or cell of any of the preceding embodiments, wherein the GRON does not comprise a 2â˛-O-methyl group on any of the first nine or more bases at the 3Ⲡend.
159. The method or cell of any of the preceding embodiments, wherein the GRON does not comprise a 2â˛-O-methyl group on any of the first ten or more bases at the 3Ⲡend.
160. The method or cell of any of the preceding embodiments, wherein the GRON does not comprise 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10 RNA bases at the 3Ⲡend.
161. A non-transgenic herbicide resistant or tolerant plant made by the method or from the cell of one any of the preceding embodiments.
162. The method or cell or plant of any of the preceding embodiments, wherein said plant cell has a genetic change or mutation in Acetyl-Coenzyme A carboxylase (ACCase) and is selected from the group consisting of barley, maize, millet, oats, rye, rice, sorghum, sugarcane, turf grasses, and wheat.
163. The method or cell or plant of any of the preceding embodiments, wherein said plant cell has a genetic change or mutation in Acetyl-Coenzyme A carboxylase (ACCase) and is resistant or tolerant to one or more herbicides.
164. The method or cell or plant of any of the preceding embodiments, wherein said plant cell has a genetic change or mutation in Acetyl-Coenzyme A carboxylase (ACCase), is resistant to one or more ACCase-inhibiting herbicides.
165. The method or cell or plant of any of the preceding embodiments, wherein said plant cell has a genetic change or mutation in Acetyl-Coenzyme A carboxylase (ACCase), is resistant to one or more herbicides selected from the group consisting of alloxydim, butroxydim, clethodim, cloproxydim, cycloxydim, sethoxydim, tepraloxydim, tralkoxydim, chlorazifop, clodinafop, clofop, diclofop, fenoxaprop, fenoxaprop-P, fenthiaprop, fluazifop, fluazifop-P, haloxyfop, haloxyfop-P, isoxapyrifop, propaquizafop, quizalofop, quizalofop-P, trifop, pinoxaden, agronomically acceptable salts and esters of any of these herbicides, and combinations thereof.
166. The method or cell or plant of any of the preceding embodiments, wherein said plant cell has a genetic change or mutation in 5-enolpyruvylshikimate-3-phosphate synthase (EPSPS), and wherein said plant cell is selected from the group consisting of corn, wheat, rice, barley, sorghum, oats, rye, sugarcane, soybean, cotton, sugarbeet, oilseed rape, canola, flax, cassava, sunflower, potato, tobacco, tomato, alfalfa, poplar, pine, eucalyptus, apple, lettuce, peas, lentils, grape and turf grasses.
167. The method or cell or plant of any of the preceding embodiments, wherein said plant or plant cell has a genetic change or mutation in 5-enolpyruvylshikimate-3-phosphate synthase (EPSPS), and wherein plant or plant cell is resistant to at least one herbicide.
168. The method or cell or plant of any of the preceding embodiments, wherein said plant or plant cell has a genetic change or mutation in 5-enolpyruvylshikimate-3-phosphate synthase (EPSPS), and wherein plant or plant cell is resistant to a herbicide of the phosphonomethylglycine family.
169. The method or cell or plant of any of the preceding embodiments, wherein said plant or plant cell has a genetic change or mutation in 5-enolpyruvylshikimate-3-phosphate synthase (EPSPS), and wherein plant or plant cell is resistant to glyphosate.
170. The method or cell or plant of any of the preceding embodiments, wherein said plant or plant cell has a genetic change or mutation in 5-enolpyruvylshikimate-3-phosphate synthase (EPSPS), and wherein plant or plant cell is selected from the group consisting of corn, wheat, rice, barley, sorghum, oats, rye, sugarcane, soybean, cotton, sugarbeet, oilseed rape, canola, flax, cassava, sunflower, potato, tobacco, tomato, alfalfa, poplar, pine, eucalyptus, apple, lettuce, peas, lentils, grape and turf grasses.
171. The method or cell or plant of any of the preceding embodiments, wherein the genetic change or mutation in the cell occurs at one allele of the gene.
172. The method or cell or plant of any of the preceding embodiments, wherein the genetic change or mutation in the cell occurs at two alleles of the gene.
173. The method or cell or plant of any of the preceding embodiments, wherein the genetic change or mutation in the cell occurs at three alleles of the gene.
174. The method or cell or plant of any of the preceding embodiments, wherein the genetic change or mutation in the cell occurs at four alleles of the gene.
175. The method or cell or plant of any of the preceding embodiments, wherein the genetic change or mutation in the cell occurs at one, two, three, four, five, six, seven, eight, nine, ten, eleven, or twelve alleles of the gene.
176. The method or cell or plant of any of the preceding embodiments, wherein the genetic change or mutation in the cell comprises a deletion or insertion resulting in a knockout of one allele of the gene.
177. The method or cell or plant of any of the preceding embodiments, wherein the genetic change or mutation in the cell comprises a deletion or insertion resulting in a knockout of two alleles of the gene.
178. The method or cell or plant of any of the preceding embodiments, wherein the genetic change or mutation in the cell comprises a deletion or insertion resulting in a knockout of three alleles of the gene.
179. The method or cell or plant of any of the preceding embodiments, wherein the genetic change or mutation in the cell comprises a deletion or insertion resulting in a knockout of four alleles of the gene.
180. The method or cell or plant of any of the preceding embodiments, wherein the genetic change or mutation in the cell comprises a deletion or insertion resulting in a knockout of one, two, three, four, five, six, seven, eight, nine, ten, eleven, or twelve alleles of the gene.
181. The method or cell or plant of any of the preceding embodiments, wherein the genetic change or mutation in the cell occurs at one allele of the gene and a second allele of the gene comprises a deletion or insertion resulting in a knockout of said second allele.
182. The method or cell or plant of any of the preceding embodiments, wherein the genetic change or mutation in the cell occurs at one allele of the gene and a second allele and third allele of the gene comprises a deletion or insertion resulting in a knockout of said second allele and said third allele.
183. The method or cell or plant of any of the preceding embodiments, wherein the genetic change or mutation in the cell occurs at one allele of the gene and a second allele, third allele, and fourth allele of the gene comprises a deletion or insertion resulting in a knockout of said second allele, said third allele and said fourth allele.
184. The method or cell or plant of any of the preceding embodiments, wherein the genetic change in the cell comprises at least one mutation at one allele and at least one knockout in another allele.
185. The method or cell or plant of any of the preceding embodiments, wherein the genetic change in the cell comprises at least one mutation at one allele and at least one knockout in at least one other allele.
186. The method or cell or plant of any of the preceding embodiments, wherein the genetic change in the cell comprises at least one mutation at one allele and at least one knockout in at least two other alleles.
187. The method or cell or plant of any of the preceding embodiments, wherein the genetic change in the cell comprises at least one mutation at one allele and at least one knockout in at least three other alleles.
188. The method or cell or plant of any of the preceding embodiments, wherein the genetic change in the cell comprises at least one mutation at one allele and a knockout in all other alleles.
The following are examples, which illustrate procedures for practicing the methods and compositions described herein. These examples should not be construed as limiting.
Sommer et al., (Mol Biotechnol. 33:115-22, 2006) describes a reporter system for the detection of in vivo gene conversion that relies upon a single nucleotide change to convert between blue and green fluorescence in green fluorescent protein (GFP) variants. This reporter system was adapted for use in the following experiments using Arabidopsis thaliana as a model species in order to assess efficiency of GRON mediated conversion.
In short, for this and the subsequent examples an Arabidopsis thaliana line with multiple copies of a blue fluorescent protein gene was created by methods known to those skilled in the art (see, e.g., Clough and Brent, 1998). Root-derived meristematic tissue cultures were established with this line, which was used for protoplast isolation and culture (see, e.g., Mathur et al., 1995). GRON delivery into protoplasts was achieved through polyethylene glycol (PEG) mediated GRON uptake into protoplasts. A method consisting of a 96-well dish format, similar to that described by Fujiwara and Kato (2007) was used. In the following the protocol is briefly described. The volumes given are those applied to individual wells of a 96-well dish.
In general, samples were analyzed by flow cytometry 48 h after GRON delivery in order to detect protoplasts whose green and yellow fluorescence is different from that of control protoplasts that are treated with non-targeting GRONs that does not change the BFP target DNA In samples treated with targeting GRONs, there is a single C to T nucleotide difference (coding strand) or G to A nucleotide difference (non-coding strand) that when introduced into the BFP gene by gene editing, results in the synthesis of GFP.
Table 1 shows the sequences of exemplary 101-mer and 201-mer BFP4/NC 5â˛-3PS/3â˛-3PS GRONs designed for the conversion of a blue fluorescent protein (BFP) gene to green fluorescence. â3PSâ denotes 3 phosphothioate linkages at each of the 5Ⲡand 3Ⲡoligo ends.
| TABLEâ1 |
| ExemplaryâGRONâNucleotideâSequencesâforâBFPâtoâGFPâconversion |
| GRON | |
| Name | GRONâNucleotideâSequence |
| BFP4/NC | G*âT*C*GâTGCâTGCâTTCâATGâTGGâTCGâGGGâTAGâCGGâCTGâAAGâCAC |
| 101-mer | TGCâACGâCCGâTAGâGTGâAAGâGTGâGTCâACGâAGGâGTGâGGCâCAG |
| GGCâACGâGGCâAGCâTTGâCCGâG*T*G*âGâ(SEQâIDâNO:â13) | |
| BFPO/NC | G*âT*C*GâTGCâTGCâTTCâATGâTGGâTCGâGGGâTAGâCGGâCTGâAAGâCAC |
| 101-mer | TGCâACGâCCGâTGGâGTGâAAGâGTGâGTCâACGâAGGâGTGâGGCâCAG |
| GGCâACGâGGCâAGCâTTGâCCGâG*T*Gâ*Gâ(SEQâIDâNO:â14) | |
| BFP4/C | Câ*C*A*CâCGGâCAAâGCTâGCCâCGTâGCCâCTGâGCCâCACâCCTâCGTâGAC |
| 101-mer | CACâCTTâCACâCTAâCGGâCGTâGCAâGTGâCTTâCAGâCCGâCTAâCCCâCGA |
| CCAâCATâGAAâGCAâGCAâC*G*Aâ*Câ(SEQâIDâNO:â15) | |
| BFP0/C | C*C*A*CCGGCAAGCTGCCCGTGCCCTGGCCCACCCTCGTGACCAC |
| 101-mer | CTTCACCCACGGCGTGCAGTGCTTCAGCCGCTACCCCGACCACATG |
| AAGCAGCAC*G*A*âCâ(SEQâIDâNO:â16) | |
| BFP4/NC | A*A*G*ATGGTGCGCTCCTGGACGTAGCCTTCGGGCATGGCGGACT |
| 201-mer | TGAAGAAGTCGTGCTGCTTCATGTGGTCTGGGTAGCGGCTGAAGC |
| ACTGCACGCCGTAGGTGAAGGTGGTCACGAGGGTGGGCCAGGGCA | |
| CGGGCAGCTTGCCGGTGGTGCAGATGAACTTCAGGGTCAGCTTGC | |
| CGâTAGGTGGCATCGCCCTCGâ*C*C*Câ(SEQâIDâNO:â17) | |
| BFP0/NC | A*A*G*TGGTGCGCTCCTGGACGTAGCCTTCGGGCATGGCGGACTT |
| 201-mer | GAAGAAGTCGTGCTGCTTCATGTGGTCGGGGTAGCGGCTGAAGCA |
| CTGCACGCCGTGGGTGAAGGTGGTCACGAGGGTGGGCCAGGGCAC | |
| GGGCAGCTTGCCGGTGGTGCAGATGAACTTCAGGGTCAGCTTGCC | |
| GâTAGGTGGCATCGCCCTCGâ*C*C*Câ(SEQâIDâNO:â18) | |
| BFP4/C | G*G*G*CGAGGGCGATGCCACCTACGGCAAGCTGACCCTGAAGTTC |
| 201-mer | ATCTGCACCACCGGCAAGCTGCCCGTGCCCTGGCCCACCCTCGTGA |
| CCACCTTCACCTACGGCGTGCAGTGCTTCAGCCGCTACCCCGACCA | |
| CATGAAGCAGCACGACTTCTTCAAGTCCGCCATGCCCGAAGGCTA | |
| CGTCCAGGAâGCGCACCATâ*C*T*Tâ(SEQâlDâNO:â19) | |
| BFP0/C | G*G*G*CGAGGGCGATGCCACCTACGGCAAGCTGACCCTGAAGTTC |
| 201-mer | ATCTGCACCACCGGCAAGCTGCCCGTGCCCTGGCCCACCCTCGTGA |
| CCACCTTCACCCACGGCGTGCAGTGCTTCAGCCGCTACCCCGACCA | |
| CATGAAGCAGCACGACTTCTTCAAGTCCGCCATGCCCGAAGGCTA | |
| CGTCCAGGAâGCGCACCAT*C*T*Tâ(SEQâIDâNO:â20) | |
| *=âPS linkage (phosphothioate) |
The purpose of this series of experiments is to compare the efficiencies of phosphothioate (PS) labeled GRONs (having 3 PS moieties at each end of the GRON) to the 5â˛Cy3/3ⲠidC labeled GRONs. The 5â˛Cy3/3ⲠidC labeled GRONs have a 5ⲠCy3 fluorophore (amidite) and a 3ⲠidC reverse base. Efficiency was assessed using conversion of blue fluorescent protein (BFP) to green fluorescence protein (GFP).
In all three experiments, done either by PEG delivery of GRONs into protoplasts in individual Falcon tubes (labeled âTubesâ) or in 96-well plates (labeled â96-well dishâ), there was generally no significant difference between the different GRON chemistries in BFP to GFP conversion efficiency, especially using the 96-well plate method, as determined by cytometry (FIG. 1).
The purpose of this series of experiments is to compare the conversion efficiencies of the phosphothioate (PS) labeled GRONs with 3PS moieties at each end of the GRON to 2â˛-O-Me or â2OMeâ in the presence and absence of a member of the bleomycin family, Zeocin⢠to induce DNA breaks. The designs of these GRONs are depicted in FIG. 2. GRONs were delivered into Arabidopsis thaliana BFP protoplasts by PEG treatment and BFP to GFP conversion was determined at 24 h post treatment by cytometry. Samples treated with zeocin (1 mg/ml) were incubated with zeocin for 90 min on ice prior to PEG treatment.
In general, the presence of zeocin (1 mg/ml) increased BFP to GFP conversion as determined by cytometry (Table 3). In both the presence and absence of zeocin, the NC 2OMe GRON containing one 2â˛-O Me group on the first RNA base at the 5Ⲡend of the GRON was more efficacious at converting BFP to GFP when compared to the NC 2OMe GRON containing one 2â˛-O Me group on each of the first nine 5ⲠRNA bases (FIG. 2 and Table 3).
In all experiments, there was no significant difference between the 41-mer BFP4/NC 5â˛3PS/3â˛3PS and the 71-mer 2OMe BFP4/NC GRON that contains one 5Ⲡ2â˛-O Me group on the first 5ⲠRNA base (denoted as BFP4 71-mer (1) NC) in BFP to GFP conversion in both the presence or absence of 1 mg/ml of zeocin as determined by cytometry (FIG. 2 and Table 3). It is important to note that in the presence of zeocin (and expected for bleomycin, phleomycin, tallysomycin, pepleomycin and other members of this family of antibiotics) that conversion becomes strand independent (i.e., both coding (C) and non-coding (NC) GRONs with the designs tested in these examples display approximately equal activity).
| TABLE 3 |
| Comparison of a standard GRON design with Okazaki fragment GRON designs |
| in the presence and absence of a glycopeptide antibiotic zeocin. |
| Exp. | BFP4 41-mer | BFP4 71-mer (0) | BFP4 71-mer (1) | BFP4 71-mer (9) |
| Name | NC | C | NC | C | NC | C | NC | C |
| Zeocin (+) |
| APT043 | 0.13 | 0.0875 | 0.2275 | 0.2075 | 0.355 | 0.2275 | 0.2325 | 0.195 |
| APT066 | 1.9 | 0.713 | 0.762 | 0.683 | 1.318 | 0.7103 | 0.769 | 0.883 |
| Mean | 1.015 | 0.40025 | 0.49475 | 0.44525 | 0.8365 | 0.4689 | 0.50075 | 0.539 |
| Std Dev | 1.251579 | 0.442295 | 0.377949 | 0.336229 | 0.680944 | 0.341391 | 0.379363 | 0.486489 |
| SE | 0.885134 | 0.312797 | 0.26729 | 0.237786 | 0.481573 | 0.241436 | 0.268291 | 0.344052 |
| Zeocin (â) |
| APT043 | nd | nd | 0.1875 | 0.0175 | 0.21 | 0.025 | 0.1 | 0.0225 |
| APT066 | 0.109 | 0.007 | 0.112 | 0.005 | 0.141 | 0.023 | 0.065 | 0.021 |
| Mean | 0.109 | 0.007 | 0.14975 | 0.01125 | 0.1755 | 0.024 | 0.0825 | 0.02175 |
| Std Dev | na | na | 0.053387 | 0.008839 | 0.04879 | 0.001414 | 0.024749 | 0.001061 |
| SE | na | na | 0.037756 | 0.006251 | 0.034505 | 0.001 | 0.017503 | 0.00075 |
| BFP4 71-mer (0) |
| NC | C | 5Ⲡfirst 10 bp are RNA and GRON has no protection |
| BFP4 71-mer (1) |
| NC | C | 5Ⲡfirst 10 bp are RNA and first bp on the 5Ⲡend has a 2ⲠOâMe |
| BFP4 71-mer (9) |
| NC | C | 5Ⲡfirst 10 bp are RNA and first nine bp on the 5Ⲡend has a 2ⲠOâMe |
The purpose of this series of experiments was to compare the conversion efficiencies (in the presence and absence of zeocin) of the phosphothioate (PS) labeled GRONs with 3PS moieties at each end of the GRON of different lengths: 41-mer, 101-mer and 201-mer shown in Table 2. Again, the presence of zeocin (1 mg/ml) increased BFP to GFP conversion rates as determined by cytometry (Table 4). The overall trend in all three experiments was linear with increasing NC GRON length in both the presence and absence of zeocin. Except for the BFP-4/NC/101 and BFP-4/C/101 in the presence of zeocin, this had conversion rates that were close to equal but lower than the 41-mer NC GRON.
| TABLE 4 | |||
| Exp. | BFP4 41-mer | BFP4 101-mer | BFP4 201-mer |
| Name | NC | C | NC | C | NC | C |
| Zeocin (+) |
| APT038 | 0.2425 | 0.1275 | 0.3025 | 0.2575 | 0.97 | 0.245 |
| APT043 | 0.13 | 0.0875 | 0.185 | 0.2275 | 0.66 | 0.1875 |
| APT047 | 0.3975 | 0.145 | 0.19 | 0.125 | 0.235 | 0.085 |
| APT052 | 0.3275 | nd | 0.17 | 0.21 | 0.585 | 0.225 |
| APT052 | nd | nd | 0.3225 | 0.3175 | 0.5075 | 0.3125 |
| APT058 | 1.4275 | nd | 1.2 | nd | 1.9 | nd |
| APT066 | 1.9 | 0.713 | 0.992 | 1.05 | 1.7 | 0.916 |
| Mean | 0.7375 | 0.26825 | 0.480286 | 0.364583 | 0.936786 | 0.3285 |
| Std Dev | 0.7382801 | 0.297475 | 0.428968 | 0.341634 | 0.630943 | 0.297412 |
| SE | 0.30146186 | 0.148738 | 0.162119 | 0.139499 | 0.238452 | 0.121442 |
| Zeocin (â) |
| APT038 | 0.05 | 0.01 | 0.1025 | 0.025 | 0.5725 | 0.025 |
| APT066 | 0.109 | 0.007 | 0.214 | 0.047 | 0.566 | 0.035 |
| Mean | 0.0795 | 0.0085 | 0.15825 | 0.036 | 0.56925 | 0.03 |
| Std Dev | 0.0417193 | 0.002121 | 0.078842 | 0.015556 | 0.004596 | 0.007071 |
| SE | 0.02950446 | 0.0015 | 0.055758 | 0.011002 | 0.00325 | 0.005001 |
This example makes use of direct delivery of recombinant Cas9 protein to plant cells as an alternative to delivery of CRISPR-Cas expression plasmids. This method employs carriers such as cell penetrating peptides (CPP), transfection liposome reagents, poly(ethylene glycol) (PEG), electroporation either alone or in combination to allow for delivery of active recombinant Cas9 protein to cells.
BFP transgenic Arabidopsis thaliana protoplasts derived from induced root tissue are seeded on a flat-bottom 96-well plate at 250,000 cells per well at a cell density of 1Ă107 cells/ml. Fluorescently-tagged recombinant Cas9 protein (1 Îźg) pre-coated with CPPs at 20:1, 10: or 5:1 and other CPP to cargo ratio (TAT, Penetratin, Chariotâ˘, PEP-1 or others for example) or encapsulated with liposome reagents are then mixed with the seeded protoplasts and incubated at 23° C. for 2-6 h to allow for Cas9/carrier complexes to penetrate the cells. In another series of treatments fluorescently-tagged recombinant Cas9 protein (1 Îźg) either pre-coated with CPPs as described above or not coated are introduced to protoplasts using PEG or electorporation methodology. Protoplasts were then analyzed by flow cytometry 24-72 h after treatment in order to determine the percentage of Cas9 positive protoplasts within a given treatment.
The purpose of this series of experiments is to demonstrate BFP to GFP conversion in our Arabidopsis thaliana BFP transgenic model system using CRISPRs to create targeted double-stranded breaks in the bfp gene and the 201-mer GRONs to mediate conversion. The BFP CRISPR targets the coding strand of the bfp gene and the conversion site is 27 bp upstream of the PAM sequence (FIG. 3). The GRON is used as a template to repair the double-stranded break in the bfp gene created by the CRISPR and along with converting the targeted gene from BFP to GFP, it introduces a wobble base in the bfp gene that corresponds to the PAM sequence of the BFP CRISPR as well. A wobble base in the PAM sequence of the BFP CRISPR minimizes re-cutting of the bfp gene by the CRISPRs once conversion has occured. This series of experiments will help to address whether or not introducing a wobble base into the PAM sequence of the BFP CRISPR in converted bfp genes will increase conversion efficiencies.
BFP transgenic Arabidopsis thaliana protoplasts derived from induced root tissue were seeded on a flat-bottom 96-well plate, at 250,000 cells per well at a cell density of 1Ă107 cells/ml. The CRISPR encoded plasmids contain the mannopine synthase (MAS) promoter driving the Cas9 coding sequence with an rbcSE9 terminator and the Arabidopsis U6 promoter driving the sgRNA with a poly-T10 terminator. The CRISPR plasmids along with GRON were introduced into protoplasts by PEG mediated delivery at a final concentration of 0.05 Îźg/Îźl and 0.16 ÎźM respectively. Protoplasts were incubated in the dark at 23° C. for 72 hours, and then they were analyzed by flow cytometer in order to determine the percentage of GFP positive protoplasts within a given treatment.
The CRISPR consists of two components: the plant codon-optimized Streptococcus pyogenes Cas9 (SpCas9) and sgRNA both of which were expressed from the same plasmid. The sgRNA is a fusion of CRISPR RNA (crRNA) and trans-activating crRNA (tracrRNA). The crRNA region contains the spacer sequence used to guide the Cas9 nuclease to the BFP target gene (FIG. 3). 201-mer GRONs targeting BFP with or without wobble bases were used to determine their effect on the rate of BFP to GFP conversion. Table 5 gives a list of the GRONs and their corresponding sequences.
| TABLEâ5 |
| ListâofâGRONsâusedâinâtheseâexamples |
| GRON | ||
| GRONâName | Chemistry | GRONâSequence |
| BFP4/NCâ201-mer | 3PS | 5â˛AAGATGGTGCGCTCCTGGACGTAGCCTTCGGGCATGGCGGACTTGAAGAAGTCGTGCTGCTT |
| CATGTGGTCTGGGTAGCGGCTGAAGCACTGCACGCCGTAGGTGAAGGTGGTCACGAGGGTGGG | ||
| CCAGGGCACGGGCAGCTTGCCGGTGGTGCAGATGAACTTCAGGGTCAGCTTGCCGTAGGTGGC | ||
| ATCGCCCTCGCCC3â˛â(SEQâIDâNO:â21) | ||
| BFP4/Câ201-mer | 3PS | 5â˛GGGCGAGGGCGATGCCACCTACGGCAAGCTGACCCTGAAGTTCATCTGCACCACCGGCAAGC |
| TGCCCGTGCCCTGGCCCACCCTCGTGACCACCTTCACCTACGGCGTGCAGTGCTTCAGCCGCTA | ||
| CCCCGACCACATGAAGCAGCACGACTTCTTCAAGTCCGCCATGCCCGAAGGCTACGTCCAGGA | ||
| GCGCACCATCTT3â˛â(SEQâIDâNO:â22) | ||
| BFP4/NCâ201-mer | 3PS | 5â˛âAAGATGGTGCGCTCCTGGACGTAGCCTTCGGGCATGGCGGACTTGAAGAAGTCG |
| (1âwobble) | TGCTGCTTCATGTGGTCTGGGTAGCGGCTGAAGCACTGCACGCCGTAGGTGAAGGTGGTCACG | |
| AGGGTGGGCCAGGGCACGGGCAGCTTGCCGGTGGTGCAGATGAACTTCAGGGTCAGCTTGCCG | ||
| TAGGTGGCATCGCCCTCGCCCâ3â˛â(SEQâIDâNO:â23) | ||
| BFP4/Câ201-mer | 3PS | 5â˛GGGCGAGGGCGATGCCACCTACGGCAAGCTGACCCTGAAGTTCATCTGCACCACCG |
| (1âwobble) | GCAAGCTGCCCGTGCCCTGGCCCACCCTCGTGACCACCTTCACCTACGGCGTGCAGTGCTTCAG | |
| CCGCTACCCAGACCACATGAAGCAGCACGACTTCTTCAAGTCCGCCATGCCCGAAGGCTACGTC | ||
| CAGGAâGCGCACCATCTTâ3â˛â(SEQâIDâNO:â24) | ||
Using the BFP CRISPR, the BFP4/C GRON with the wobble bases is up to a 3.5-fold more efficacious in BFP to GFP conversion when compared to the BFP4/C GRON without the woble bases (Table 6). There is up to a 5.9-fold increase in BFP to GFP conversion when the BFP4/C GRON with the wobble base is used instead of the BFP4/NC GRON with the wobble base (Table 6). Therefore, the BFP4/C GRON with the wobble base is most efficacious in BFP to GFP conversion when used with the BFP CRISPR.
Including a wobble base in the GRON that changes the PAM sequence of the BFP CRISPR in the converted target gene increases BFP to GFP conversion. BFP to GFP conversion by the BFP CRISPR along with the wobble-based GRON was confirmed by Next Generation Sequencing (data not shown). Additionally, the ability of the BFP CRISPR to cleave the DNA and produce indels in the bfp gene was confirmed by Next Generation Sequencing (data not shown).
| TABLE 6 |
| The percentage of BFP to GFP conversion as determine by |
| cytometry at 72 h post PEG delivery of the BFP CRISPR |
| and GRON into protoplasts derived from the |
| Arabidopsis thaliana BFP transgenic line 21-15-09. |
| Percentage of GFP Positive Cells (std dev) | |
| CRISPR: BFP5 |
| Exp. | BFP4/C GRON | BFP4/NC GRON |
| Name | (â) Wobbles | (+) 1 wobbles | (â) Wobbles | (+) 1 wobbles |
| Exp 1 | 0.46 (0.07) | 1.59 (0.06) | 0.08 (0.02) | 0.27 (0.04) |
| Exp 2 | 0.24 (0.03) | 0.61 (0.05) | 0.04 (0.01) | 0.16 (0.04) |
The purpose of this series of examples is to demonstrate BFP to GFP conversion in our Arabidopsis thaliana BFP transgenic model system using CRISPRs to create targeted double-stranded breaks in the bfp gene and GRONs to mediate conversion. The BFP6 CRISPR (CR:BFP6) used in these examples targets the bfp gene and causes a double-stranded break in the DNA near the site of conversion. The GRONs used with the BFP6 CRISPR, contains the coding sequence of the bfp gene around the site of conversion and are labeled at the 5Ⲡend with Cy3 and at the 3Ⲡend with an idC reverse base and are herein referred to as Cy3 GRONs. These GRONs are tested at three different lengths of 41-mers, 101-mers and 201-mers and they are directly compared to the 3PS GRONs that only differ from the Cy3 GRONs in that they have 3 phosphothioate linkages on both the 5Ⲡand 3Ⲡends of the GRON. These GRONs are herein referred to as 3PS GRONs. See Table 7 for the list of GRONs used in these experiments.
BFP transgenic Arabidopsis thaliana protoplasts derived from induced root tissue were seeded on a flat-bottom 96-well plate, at 250,000 cells per well at a cell density of 1Ă107 cells/ml. The CRISPR encoded plasmids contain the MAS promoter driving the Cas9 coding sequence with an rbcSE9 terminator and the Arabidopsis thaliana U6 promoter driving the sgRNA with a poly-T10 terminator. The CRISPR plasmids along with GRON were introduced into protoplasts by PEG mediated delivery at a final concentration of 0.05 Îźg/Îźl for the CRISPR and 8.0 ÎźM for the 41-mer, 0.32 ÎźM for the 101-mer and 0.16 ÎźM 201-mer GRONs. GRON treatments alone received a final GRON concentration after PEG delivery of 8.0 ÎźM for the 41-mer, 5.0 ÎźM for the 101-mer and 2.5 ÎźM for the 201-mer. Protoplasts were incubated in the dark at 23° C. for 72 hours, and then they were analyzed by flow cytometer in order to determine the percentage of GFP positive protoplasts within a given treatment.
The CRISPR consists of two components: the plant codon-optimized Streptococcus pyogenes Cas9 (SpCas9) and sgRNA both of which were expressed from the same plasmid. The sgRNA is a fusion of CRISPR RNA (crRNA) and trans-activating crRNA (tracrRNA). The crRNA region contains the spacer sequence used to guide the Cas9 nuclease to the BFP target gene. In this experiment the BFP6 CRISPR (5â˛GGTGCCGCACGTCACGAAGTCGG 3â˛)(SEQ ID NO: 25) was used which targets the bfp gene. The GRONs contain the coding sequence of the bfp gene near the site of conversion. Table 7 gives a list of the GRONs used.
| TABLEâ7 |
| ListâofâGRONsâusedâinâtheseâexamples |
| GRON | |||
| GRONâName | Chemistry | GRONâSequence | CRISPR |
| BFP4/Câ41-mer | Cy3âorâ3PS | 5â˛âCCCTCGTGACCACCTTCACCTACGGCGTGCAGTGCTTCAGC | BFP6 |
| 3â(SEQâIDâNO:â26)Ⲡ| |||
| BFP4/Câ101-mer | Cy3âorâ3PS | 5â˛CCACCGGCAAGCTGCCCGTGCCCTGGCCCACCCTCGTGACCACCTTCACCTACGGCGTG | BFP6 |
| CAGTGCTTCAGCCGCTACCCCGACCACATGAAGCAGCACGACâ3â˛â(SEQâIDâNO:â27) | |||
| BFP4/Câ201-mer | Cy3âorâ3PS | 5â˛GGGCGAGGGCGATGCCACCTACGGCAAGCTGACCCTGAAGTTCATCTGCACCACCGGCA | BFP6 |
| AGCTGCCCGTGCCCTGGCCCACCCTCGTGACCACCTTCACCTACGGCGTGCAGTGCTTCAG | |||
| CCGCTACCCCGACCACATGAAGCAGCACGACTTCTTCAAGTCCGCCATGCCCGAAGGCTA | |||
| CGTCCAGGAGCGCACCATCTT3â˛â(SEQâIDâNO:â28) | |||
Using the BFP6 CRISPR, the Cy3 GRONs at all lengths tested are able to mediate BFP to GFP conversion generally as efficiently as the 3PS GRONs (FIG. 4). Overall, the samples containing the BFP6 CRISPR and GRON have higher levels of BFP to GFP conversion when compared to the GRON only samples (FIG. 4), demonstrating the positive impact CRISPRs have on increasing conversion rates.
The purpose of this series of experiments is to demonstrate BFP to GFP conversion in an Arabidopsis thaliana BFP transgenic model system using CRISPRs to create targeted double-stranded breaks in the bfp gene and GRONs of varying lengths to mediate conversion. The BFP CRISPR used in these examples targets the bfp gene and causes a double-stranded break in the DNA near the site of conversion. The GRONs used with the BFP CRISPR, contains the coding sequence of the bfp gene around the site of conversion and are labeled at both the 5Ⲡend and the 3Ⲡend with 3 phosphothioate linkages and are herein referred to as 3PS GRONs. These GRONs are tested at three different lengths of 60-mers, 101-mers and 201-mers and they are directly compared to the GRON only treatments. See Table 8 for the list of GRONs used in these examples.
BFP transgenic Arabidopsis thaliana protoplasts derived from induced root tissue were seeded on a flat-bottom 96-well plate, at 250,000 cells per well at a cell density of 1Ă107 cells/ml. The CRISPR encoded plasmids contain the MAS promoter driving the Cas9 coding sequence with an rbcSE9 terminator and the Arabidopsis thaliana U6 promoter driving the sgRNA with a poly-T10 terminator. The CRISPR plasmids along with GRON were introduced into protoplasts by PEG mediated delivery at a final concentration of 0.05 Îźg/Îźl for the CRISPR and 0.547 ÎźM for the 60-mer, 0.32 ÎźM for the 101-mer and 0.16 ÎźM 201-mer GRONs. GRON treatments alone received a final GRON concentration after PEG delivery of 7.5 ÎźM for the 60-mer, 5.0 ÎźM for the 101-mer and 2.5 ÎźM for the 201-mer. Protoplasts were incubated in the dark at 23° C. for 72 hours, and then they were analyzed by flow cytometry in order to determine the percentage of GFP positive protoplasts within a given treatment.
The CRISPR consists of two components: the plant codon-optimized Streptococcus pyogenes Cas9 (SpCas9) and sgRNA both of which were expressed from the same plasmid. The sgRNA is a fusion of CRISPR RNA (crRNA) and trans-activating crRNA (tracrRNA). The crRNA region contains the spacer sequence used to guide the Cas9 nuclease to the BFP target gene. The BFP CRISPR spacer sequence is 5â˛GTCGTGCTGCTTCATGTGGT3Ⲡ(SEQ ID NO: 29). In this example the BFP CRISPR was used which targets the bfp gene. The GRONs contain the coding sequence of the bfp gene near the site of conversion. Table 8 gives a list of the GRONs used.
| TABLEâ8 |
| ListâofâGRONsâusedâinâtheseâexamples.â(SEQâIDâNOS:â30,â31âandâ24,ârespectively) |
| GRON | ||
| GRONâName | Chemistry | GRONâSequence |
| BFP4/Câ60-mer | 3PS | 5â˛GTGACCACCTTCACCTACGGCGTGCAGTGCTTCAGCCGCTACCCAGACCACATGAAGCAGâ3Ⲡ|
| (1âwobble) | ||
| BFP4/Câ101-mer | 3PS | 5â˛CCACCGGCAAGCTGCCCGTGCCCTGGCCCACCCTCGTGACCACCTTCACCTACGGCGTGCAG |
| (1âwobble) | TGCTTCAGCCGCTACCCAGACCACATGAAGCAGCACGACâ3Ⲡ| |
| 3FP4/Câ201-mer | 3PS | 5â˛âGGGCGAGGGCGATGCCACCTACGGCAAGCTGACCCTGAAGTTCATCTGCACCACCG |
| (1âwobble) | GCAAGCTGCCCGTGCCCTGGCCCACCCTCGTGACCACCTTCACCTACGGCGTGCAGTGCTTCAG | |
| CCGCTACCCAGACCACATGAAGCAGCACGACTTCTTCAAGTCCGCCATGCCCGAAGGCTACGTC | ||
| CAGGAâGCGCACCATCTTâ3Ⲡ| ||
Using the BFP CRISPR, GRONs at lengths âĽ101 nt are better at mediating BFP to GFP conversion when directly compared to the 60 nt long GRONs (FIG. 5). Overall, the samples containing the BFP CRISPR and GRON have higher levels of BFP to GFP conversion when compared to the GRON only samples (FIG. 5), demonstrating the positive impact CRISPRs have on increasing conversion rates. This data further demonstrates that the length of the GRON that is most efficacious in mediating BFP to GFP conversion, when used along with the CRISPR, needs to be âĽ101 nt in length.
The purpose of these experiments is to demonstrate BFP to GFP conversion in our Arabidopsis thaliana BFP transgenic model system using CRISPRs to create targeted double-stranded breaks in the bfp gene and GRONs to mediate conversion. The BFP CRISPR used in this example targets the bfp gene and causes a double-stranded break in the DNA near the site of conversion. The GRONs used with the BFP CRISPR, contain either the coding or non-coding sequence of the bfp gene around the site of conversion with the first ten 5Ⲡbases of the GRON being RNA bases instead of DNA bases. These RNA bases are labeled with 2â˛-O-Me group(s) at either the first 5ⲠRNA base or the first nine 5ⲠRNA bases as depicted in FIG. 6. These GRONs are herein referred to as 2â˛-O-Me GRONs and are directly compared to the 3PS GRONs of similar lengths that contain DNA bases with 3 phosphothioate linkages on both the 5Ⲡand 3Ⲡends of the GRON. These GRONs are herein referred to as 3PS GRONs. See Table 9 for the list of GRONs used in these examples.
BFP transgenic Arabidopsis thaliana protoplasts derived from induced root tissue were seeded on a flat-bottom 96-well plate, at 250,000 cells per well at a cell density of 1Ă107 cells/ml. The CRISPR encoded plasmids contain the MAS promoter driving the Cas9 coding sequence with a rbcSE9 terminator and the Arabidopsis U6 promoter driving the sgRNA with a poly-T10 terminator. The sgRNA is a fusion of CRISPR RNA (crRNA) and trans-activating crRNA (tracrRNA). The CRISPR plasmids along with GRON were introduced into protoplasts by PEG mediated delivery at a final concentration of 0.05 Îźg/Îźl for the CRISPR, 0.5 ÎźM for the 71-mer and 0.16 ÎźM for the 201-mer GRONs. GRON treatments alone received a final GRON concentration after PEG delivery of 5.0 ÎźM for the 71-mer and 2.5 ÎźM for the 201-mer. Protoplasts were incubated in the dark at 23° C. for 72 hours, and then they were analyzed by flow cytometer in order to determine the percentage of GFP positive protoplasts within a given treatment.
The CRISPR consists of two components: the plant codon-optimized Streptococcus pyogenes Cas9 (SpCas9) and sgRNA both of which were expressed from the same plasmid. The sgRNA is a fusion of CRISPR RNA (crRNA) and trans-activating crRNA (tracrRNA). The crRNA region contains the spacer sequence used to guide the Cas9 nuclease to the BFP target gene. The BFP CRISPR spacer sequence is 5â˛CTCGTGACCACCTTCACCCA 3Ⲡ(SEQ ID NO: 32). In this example the BFP CRISPR was used which targets the bfp gene. The GRONs contain either the coding or non-coding sequence of the bfp gene near the site of conversion. Table 9 shows a list of the GRONs used.
| TABLEâ9 |
| ListâofâGRONsâusedâinâtheseâexamples |
| GRON | ||
| GRONâName | Chemistry | GRONâSequence |
| BFP4/Câ71-mer | 3PS | 5â˛GCUGCCCGUGCCCTGGCCCACCCTCGTGACCACCTTCACCTACGGCGTGCAGTGCTTCAGCC |
| GCTACCCCG3â˛â(SEQâIDâNO:â33) | ||
| BFP4/NCâ71-mer | 3PS | 5â˛TTCATGTGGTCGGGGTAGCGGCTGAAGCACTGCACGCCGTAGGTGAAGGTGGTCACGAGGGT |
| GGGCCAGGG3â˛â(SEQâIDâNO:â34) | ||
| BFP4/Câ201-mer | 3PS | 5â˛GGGCGAGGGCGATGCCACCTACGGCAAGCTGACCCTGAAGTTCATCTGCACCACCGGCAAGC |
| TGCCCGTGCCCTGGCCCACCCTCGTGACCACCTTCACCTACGGCGTGCAGTGCTTCAGCCGCTA | ||
| CCCCGACCACATGAAGCAGCACGACTTCTTCAAGTCCGCCATGCCCGAAGGCTACGTCCAGGAG | ||
| CGCACCATCTT3â˛â(SEQâIDâNO:â35) | ||
| BFP4/NCâ201-mer | 3PS | 5â˛AAGATGGTGCGCTCCTGGACGTAGCCTTCGGGCATGGCGGACTTGAAGAAGTCGTGCTGCTT |
| CATGTGGTCTGGGTAGCGGCTGAAGCACTGCACGCCGTAGGTGAAGGTGGTCACGAGGGTGGG | ||
| CCAGGGCACGGGCAGCTTGCCGGTGGTGCAGATGAACTTCAGGGTCAGCTTGCCGTAGGTGGC | ||
| ATCGCCCTCGCCC3â˛â(SEQâIDâNO:â36) | ||
| BFP4/Câ71-mer | 2â˛-O-Me | 5â˛gcugcccgugCCCTGGCCCACCCTCGTGACCACCTTCACCTACGGCGTGCAGTGCTTCAGCCGC |
| TACCCCGâ3â˛â(SEQâIDâNO:â37) | ||
| BFP4/NCâ71-mer | 5â˛uucaugugguCGGGGTAGCGGCTGAAGCACTGCACGCCGTAGGTGAAGGTGGTCACGAGGGT | |
| GGGCCAGGG3â˛(SEQâIDâNO:â38) | ||
| BFP4/Câ201-mer | 2â˛-O-Me | 5â˛gggcgagggcGATGCCACCTACGGCAAGCTGACCCTGAAGTTCATCTGCACCACCGGCAAGCTG |
| CCCGTGCCCTGGCCCACCCTCGTGACCACCTTCACCTACGGCGTGCAGTGCTTCAGCCGCTACC | ||
| CCGACCACATGAAGCAGCACGACTTCTTCAAGTCCGCCATGCCCGAAGGCTACGTCCAGGAGCG | ||
| CACCATCTT3â˛â(SEQâIDâNO:â39) | ||
| BFP4/NCâ201-mer | 2â˛-O-Me | 5â˛aagauggugcGCTCCTGGACGTAGCCTTCGGGCATGGCGGACTTGAAGAAGTCGTGCTGCTTCA |
| TGTGGTCGGGGTAGCGGCTGAAGCACTGCACGCCGTAGGTGAAGGTGGTCACGAGGGTGGGC | ||
| CAGGGCACGGGCAGCTTGCCGGTGGTGCAGATGAACTTCAGGGTCAGCTTGCCGTAGGTGGCA | ||
| TCGCCCTCGCCC3â˛â(SEQâIDâNO:â40) | ||
The 71-mer and 201-mer 2â˛-O-Me GRONs had similar BFP to GFP conversion when compared to the various different types of GRON protections of (0), (1) or (9) using the BFP CRISPRs (FIGS. 7 and 8). The 2â˛-O-Me GRONs are more efficacious than their 3PS GRON counterparts at mediating BFP to GFP conversion using the BFP CRISPRs (FIGS. 7 and 8).
The purpose of this example is to demonstrate BFP to GFP conversion in our Arabidopsis thaliana BFP transgenic model system using CRISPRs to create targeted single-stranded nicks in the bfp gene and GRONs to mediate conversion. The BFP1 CRISPR (CR:BFP1) used in this example targets the bfp gene and contains mutations in the catalytic residues (D10A in RuvC and H840A in HNH) that causes single-stranded nicks in the DNA of the bfp gene near the site of conversion on either the DNA strands complementary or non-complementary to the guide RNA respectively. These CRISPRs are herein referred to as BFP1 CRISPR nickase D10A and BFP1 CRISPR nickase H840A and are used either alone or with BFP5 sgRNA on a separate plasmid. When multiple CRISPR nickases are used together in this example, they can either nick the same DNA strand or opposite DNA strands. When both Cas9 proteins that contain the same mutations, either D10A or H840A, are used together, they nick the same strand of DNA. Conversely, when two Cas9 proteins are used together and one of them contains the D10A mutation and the other one contains the H840A mutation, they nick opposite strands of the DNA. The GRONs used with the nickase CRISPRs, contains either the coding or the non-coding sequence of the bfp gene around the site of conversion with one wobble base located in the PAM sequence of BFP5 CRISPR. These GRONs have 3 phosphothioate linkages on both the 5Ⲡand 3Ⲡends and are herein referred to as 3PS GRONs. See Table 10 for the list of GRONs used in these experiments. The nickase CRISPRs are directly compared to their CRISPR counterparts that are able to cause targeted double-stranded breaks in the DNA of the bfp gene.
BFP transgenic Arabidopsis thaliana protoplasts derived from induced root tissue are seeded on a flat-bottom 96-well plate, at 250,000 cells per well at a cell density of 1Ă107 cells/ml. The CRISPR encoded plasmids contain the MAS promoter driving the Cas9 coding sequence with an rbcSE9 terminator and the Arabidopsis thaliana U6 promoter driving the sgRNA with a poly-T10 terminator. The sgRNA is a fusion of CRISPR RNA (crRNA) and trans-activating crRNA (tracrRNA). The Cas9 gene contains mutations in the catalytic residues, either D10A in RuvC or H840A in HNH. The CRISPR plasmids along with GRON are introduced into protoplasts by PEG mediated delivery at a final concentration of 0.05 Îźg/Îźl for the CRISPR and 0.16 ÎźM for the 201-mer. GRON treatments alone received a final GRON concentration after PEG delivery of 2.5 ÎźM for the 201-mer. Protoplasts were incubated in the dark at 23° C. for 72 hours, and then they were analyzed by flow cytometer in order to determine the percentage of GFP positive protoplasts within a given treatment.
The CRISPR consists of two components: the plant codon-optimized Streptococcus pyogenes Cas9 (SpCas9) and sgRNA both of which were expressed from the same plasmid. The sgRNA is a fusion of CRISPR RNA (crRNA) and trans-activating crRNA (tracrRNA). The crRNA region contains the spacer sequence used to guide the Cas9 nuclease to the BFP target gene. In this example, the BFP1 and BFP5 sgRNA was used that targets different regions the bfp gene near the site of conversion. The BFP1 spacer (5â˛CTCGTGACCACCTTCACCCA 3â˛)(SEQ ID NO: 32) targets the coding-strand while the BFP5 spacer (5â˛GTCGTGCTGCTTCATGTGGT3â˛)(SEQ ID NO: 29) targets the non-coding strand of the bfp gene. The GRONs contain either the coding or non-coding sequence of the bfp gene near the site of conversion. Table 10 shows a list of the GRONs used.
| TABLEâ10 |
| ListâofâGRONsâusedâinâtheseâexamplesâ(SEQâIDâNOS:â41âandâ42,ârespectively) |
| GRON | |||
| GRONâName | Chemistry | GRONâSequence | CRISPR |
| BFP4/NCâ201-mer | 3PS | 5â˛âAAGATGGTGCGCTCCTGGACGTAGCCTTCGGGCATGGCGGACTTGAAGAAGTCG | BFP1âandâBFP5 |
| (1âwobble;âBFP5) | TGCTGCTTCATGTGGTCTGGGTAGCGGCTGAAGCACTGCACGCCGTAGGTGAAGGTGGTCAC | ||
| GAGGGTGGGCCAGGGCACGGGCAGCTTGCCGGTGGTGCAGATGAACTTCAGGGTCAGCTT | |||
| GCCGTAGGTGGCATCGCCCTCGCCCâ3Ⲡ| |||
| BFP4/Câ201-mer | 3PS | 5â˛âGGGCGAGGGCGATGCCACCTACGGCAAGCTGACCCTGAAGTTCATCTGCACCACCG | BFP1âandâBFP6 |
| (1âwobble;âBFP5) | GCAAGCTGCCCGTGCCCTGGCCCACCCTCGTGACCACCTTCACCTACGGCGTGCAGTGCTT | ||
| CAGCCGCTACCCAGACCACATGAAGCAGCACGACTTCTTCAAGTCCGCCATGCCCGAAGGC | |||
| TACGTCCAGGAGCGCACCATCTTâ3Ⲡ| |||
Both of the CRISPR nickases (D10A and H840A) are more efficient at mediating BFP to GFP conversion when the BFP1 CRISPR and the BFP5 CRISPR were used together instead of separately (FIG. 9). In addition, when the BFP1 and BFP5 D10A CRISPR nickases are used together with the C/201 1W GRON, the BFP to GFP conversion is significantly higher when compared to treatments where these CRISPR nickases are used with the NC/201 1W GRON (FIG. 9). When the BFP1 and BFP5 H840A CRISPR nickases are used together roughly the same level of BFP to GFP conversion is observed with either the C/201 or NC/201 1W GRONs (FIG. 9). These levels of BFP to GFP conversion are slightly higher than when the BFP5 CRISPR is used alone and slightly lower than when the BFP1 CRISPR is used alone (FIG. 9).
The purpose of this example is to demonstrate conversion of multiple genes simultaneously in a given population of protoplasts derived from the Arabidopsis thaliana model system using CRISPRs to create double-stranded breaks in targeted genes and GRONs to mediate conversion. The CRISPRs used in this example target both the BFP and acetohydroxy acid synthase (AHAS) genes in the Arabidopsis thaliana genome by introducing into protoplasts plasmid(s) encoding the Cas9 gene and multiple sgRNA targeting these two different genes. The sgRNA is a fusion of CRISPR RNA (crRNA) and trans-activating crRNA (tracrRNA). This will allow Cas9 to cause double-stranded breaks in both the BFP and AHAS genes in the presence of GRONs that will mediate their conversion.
Arabidopsis thaliana protoplasts derived from induced root tissue are seeded on a flat-bottom 96-well plate, at 250,000 cells per well at a cell density of 1Ă107 cells/ml. The CRISPR encoded plasmids contain the MAS promoter driving the Cas9 coding sequence with a rbcSE9 terminator and Arabidopsis thaliana U6 promoter driving multiple different sgRNAs with a poly-T10 terminator. The sgRNA is a fusion of CRISPR RNA (crRNA) and trans-activating crRNA (tracrRNA). The CRISPR plasmids along with GRON are introduced into protoplasts by PEG mediated delivery at a final concentration of 0.05 Îźg/Îźl for the CRISPR and 0.16 ÎźM for the 201-mer. GRON treatments alone receive a final GRON concentration after PEG delivery of 2.5 ÎźM for the 201-mer. Protoplasts will be incubated in the dark at 23° C. for 72 hours, and then they are analyzed by flow cytometer and an allele specific PCR assay in order to determine the percentage of both BFP to GFP and AHAS converted protoplasts respectively within a given treatment.
In the an allele specific PCR assay 10-16 replicates of 5,000 genome equivalents of genomic DNA were used in the primary PCR reactions.
The CRISPR consists of two components: the plant codon-optimized Streptococcus pyogenes Cas9 (SpCas9) and sgRNA both of which were expressed from the same or multiple plasmids. The sgRNA is a fusion of CRISPR RNA (crRNA) and trans-activating crRNA (tracrRNA). The crRNA region contains the spacer sequence used to guide the Cas9 nuclease to the targeted genes. In this example, different sgRNAs and GRONs are used to target multiple genes near their sites of conversion; BFP spacer (5â˛CTCGTGACCACCTTCACCCA 3â˛) (SEQ ID NO: 32) and AHAS spacer (5ⲠTGGTTATGCAATTGGAAGATCGC 3â˛)(SEQ ID NO: 43). Table 11 describes the GRONs used.
| TABLEâ11 |
| ListâofâGRONsâusedâinâthisâexampleâ(SEQâIDâNOS:â44âandâ45,ârespectively) |
| Target | GRON | ||
| GRONâName | Gene | Chemistry | GRONâSequence |
| BFP/Câ201-mer | BFP | 3PS | 5â˛GGGCGAGGGCGATGCCACCTACGGCAAGCTGACCCTGAAGTTCATCTGCACCA |
| CCGGCAAGCTGCCCGTGCCCTGGCCCACCCTCGTGACCACCTTCACCTACGGCGT | |||
| GCAGTGCTTCAGCCGCTACCCCGACCACATGAAGCAGCACGACTTCTTCAAGTCC | |||
| GCCATGCCCGAAGGCTACGTCCAGGAGCGCACCATCTT3Ⲡ| |||
| AHAS(W) | AHAS | 3PS | 5â˛AGCTGCTGCAAACAGCAACATGTTCGGGAATATCTCGTCCTCCTGAGCCGGATC |
| 574/NCâ201-mer | CCCGAGAAATGTGTGAGCTCGGTTAGCTTTGTAGAAGCGATCTTCCAATTGCATA | ||
| ACCATGCCAAGATGCTGGTTGTTTAATAAAAGTACCTTCACTGGAAGATTCTCTAC | |||
| ACGAATAGTGGCTAGCTCTTGCACATTCATTATAAA3Ⲡ| |||
BFP to GFP and AHAS conversion was determined at 144 h post PEG delivery of the BFP and AHAS CRISPR plasmids and the BFP/C 201-mer and AHAS(W)574/NC 201-mer GRONs into the Arabidopsis thaliana BFP transgenic line. Flow cytometry data revealed that Treatment 1 resulted in 0.20% BFP to GFP conversion (Table 12). Allele specific PCR assay revealed that Treatment 1 resulted in 0.01% AHAS converted protoplasts (Table 12). GRON only treatments had minimal conversion using both assays (Table 12). This example demonstrates the successful simultaneous conversion of two independent target genes (BFP and AHAS) within a given population of protoplasts derived from the Arabidopsis thaliana BFP model system.
| TABLE 12 |
| Measurement of conversion of both the BFP and AHAS genes at |
| 144 h post PEG delivery of CRISPR plasmids and GRONs into a |
| given population of protoplasts derived from the Arabidopsis |
| thaliana BFP model system either by: (1) flow cytometry which |
| determines the percentage of GFP positive protoplasts or (2) allele |
| specific PCR which determines the percentage of AHAS |
| converted protoplasts. |
| AHAS- | ||||
| BFP | W574L | |||
| to GFP | Conversion | |||
| conversion | Allele | |||
| Flow | Specific | |||
| Treatment | CRISPR | GRONs | Cytometry | PCR |
| 1 | CR-BFP | BFP/C | 0.20% | â~0.01% |
| and CR- | 201-mer and | |||
| AHAS | AHAS(W)574/NC | |||
| 201-mer | ||||
| 2 | None | BFP/C | 0.01% | ~0.001% |
| 201-mer and | ||||
| AHAS(W)574/NC | ||||
| 201-mer | ||||
| 3 | None | None | 0.01% | ~0.001% |
This example makes use of direct delivery of recombinant Cas9 mRNA into plant cells as an alternative to delivery of CRISPR-Cas expression plasmids. This method includes (1) in vitro synthesis of modified mRNA and (2) Delivery of this modified mRNA into plant cells.
A Cas9 mRNA will be transcribed in vitro using an RNA polymerase such as T7, T3 or SP6 from a linearized plasmid template including components of a 5â˛UTR, the coding sequence (CDS) for the protein and a 3â˛UTR. One RNA polymerase may incorporate a particular modified nucleoside better than another. The 5ⲠUTR may contain elements that improve its stability such as the MiR-122 of hepatitis C virus (Shimakami et al., 2012). In vitro synthesis will incorporate nucleosides that are protective and ensure good translation in the target plant cells. Recombinant Cas9 mRNA will be capped and contain a polyA tail.
BFP transgenic Arabidopsis thaliana protoplasts derived from induced root tissue are seeded on a flat-bottom 96-well plate at 250,000 cells per well at a cell density of 1Ă107 cells/ml. Recombinant Cas9 mRNA will be delivered into plant cells in one of the following means (list not inclusive): cell penetrating peptides (CPP), transfection liposome reagents, poly(ethylene glycol) (PEG) or electroporation either alone or in combination to allow for delivery of active recombinant Cas9 mRNA into cells.
This example makes use of a modified single guide RNA (sgRNA) cassette wherein a linker sequence (may also be referred to as a tethering sequence) is included at the 3Ⲡend of the tracrRNA but 5Ⲡof the RNA polymerase III termination signal as shown in the example below (FIG. 10). The sgRNA is a fusion of CRISPR RNA (crRNA) and trans-activating crRNA (tracrRNA). Though preferred, the placement of the linker is not limited to the 3Ⲡend of the tracerRNA but will be investigated at several positions within the sgRNA cassette. The linker sequence may vary in nucleotide length or contain secondary structure that would improve tethering or increase the number of molecules tethered through triplex interactions.
The linker will allow for Watson-Crick base pairing with a DNA, RNA or proteins that contains the complementary sequence (FIG. 10). Additionally, linker sequence in sgRNA cassettes will be designed to contain advanced secondary and tertiary structure allowing for more complex multifaceted interaction regions that would tether multiple DNA, RNA or protein molecules.
The overall concept is that a CRISPR-Cas complex will tether biological molecules to the site of nuclease activity thereby increasing the likelihood of gene editing. These biological molecules include the GRON which will mediate conversion of targeted gene(s). Tethering linkers can be added to sgRNA by simply using, for example, Gene Strings or annealed oligos.
BFP transgenic Arabidopsis thaliana protoplasts derived from induced root tissue are seeded on a flat-bottom 96-well plate, at 250,000 cells per well at a cell density of 1Ă107 cells/ml. The CRISPR-Cas tethering plasmids contains the MAS promoter driving the Cas9 coding sequence with a rbcSE9 terminator and
Arabidopsis thaliana U6 promoter driving sgRNAs with a linker sequence that is complementary to a polynucleotide tract of 15-30 bp located on a 201-mer editing GRON targeting bfp (as shown in FIG. 10). The sgRNA tethering cassette is terminated by a poly-T10 terminator. The CRISPR-Cas plasmids along with GRON are introduced into protoplasts by PEG mediated delivery at a final concentration of 0.05 Οg/Οl for the CRISPR and 0.16 ΟM of the 201-mer GRON. GRON treatments alone received a final GRON concentration after PEG delivery of 2.5 ΟM for the 201-mer. Protoplasts were incubated in the dark at 23° C. for 72 hours, and then they were analyzed by flow cytometer in order to determine the percentage of GFP positive protoplasts within a given treatment.
The CRISPR consists of two components: the plant codon-optimized Streptococcus pyogenes Cas9 (SpCas9) and sgRNA both of which are expressed from the same or different plasmids. The sgRNA is a fusion of CRISPR RNA (crRNA) and trans-activating crRNA (tracrRNA) and linker. The crRNA region contains the spacer sequence used to guide the Cas9 nuclease to the BFP target gene. In this example CRISPR is used which targets the bfp gene. The GRONs contain either the coding or non-coding sequence of the bfp gene near the site of conversion.
The purpose of this example is to demonstrate conversion of BFP to GFP in protoplasts derived from the Arabidopsis thaliana BFP model system using CRISPRs to create double-stranded breaks in targeted genes and GRONs to mediate conversion. The CRISPRs used in this example targets the bfp gene in the Arabidopsis thaliana genome by introducing into protoplasts plasmid(s) encoding the Cas9 gene and one sgRNAs that is two different lengths. The sgRNA is a fusion of CRISPR RNA (crRNA) and trans-activating crRNA (tracrRNA). The crRNA which guides the Cas9 to the target genes is called the spacer and it is typically 20-nt in length (CR:BFP1 20-nt), however, in these examples we tested the effectiveness of using a smaller length spacer of 17-nt (CR:BFP1 17-nt) in mediating BFP to GFP conversion.
Arabidopsis thaliana protoplasts derived from induced root tissue are seeded on a flat-bottom 96-well plate, at 250,000 cells per well at a cell density of 1Ă107 cells/ml. The CRISPR encoded plasmids contain the MAS promoter driving the Cas9 coding sequence with a rbcSE9 terminator and Arabidopsis thaliana U6 promoter driving multiple different sgRNAs with a poly-T10 terminator. The sgRNA is a fusion of CRISPR RNA (crRNA) and trans-activating crRNA (tracrRNA). The CRISPR plasmids along with GRON are introduced into protoplasts by PEG mediated delivery at a final concentration of 0.05 Îźg/Îźl for the CRISPR and 0.16 ÎźM for the 201-mer. GRON treatments alone receive a final GRON concentration after PEG delivery of 2.5 ÎźM for the 201-mer. Protoplasts will be incubated in the dark at 23° C. for 72 hours, and then they are analyzed by flow cytometer in order to determine the percentage of BFP to GFP within a given treatment.
The CRISPR consists of two components: the plant codon-optimized Streptococcus pyogenes Cas9 (SpCas9) and sgRNA both of which were expressed from the same or multiple plasmids. The sgRNA is a fusion of CRISPR RNA (crRNA) and trans-activating crRNA (tracrRNA). The crRNA region contains the spacer sequence used to guide the Cas9 nuclease to the targeted genes. In these examples, two different length BFP1 spacers of 20-nt (5â˛CTCGTGACCACCTTCACCCA 3â˛) (SEQ ID NO: 32) vs. 17-nt (5â˛GTGACCACCTTCACCCA 3â˛)(SEQ ID NO: 46) were tested. Table 13 describes the GRON used
| TABLEâ13 |
| ListâofâGRONâusedâinâthisâexampleâ(SEQâIDâNO:â47) |
| GRONâName | GRONâChemistry | GRONâSequence |
| BFP4/NC | 3PS | 5â˛AAGATGGTGCGCTCCTGGACGTAGCCTTCGGGCATGGCGGACTTGAAGAAGTCG |
| 201-merâ3W | TGCTGCTTCATGTGGTCGGGGTAGCGGCTGAAGCACTGCACGCCGTACGTAAACGTGGTCACG | |
| AGGGTGGGCCAGGGCACGGGCAGCTTGCCGGTGGTGCAGATGAACTTCAGGGTCAGCTTGCCG | ||
| TAGGTGGCATCGCCCTCGCCCâ3Ⲡ| ||
Reducing the length of the BFP1 protospacer from 20 bp to 17 bp had similar levels of BFP to GFP conversion of 0.163% vs. 0.177% respectively at 72 h post PEG delivery of plasmids and GRONs into the Arabidopsis thaliana BFP model system (FIG. 11).
The purpose of this example is to demonstrate conversion of BFP to GFP in protoplasts derived from the Arabidopsis thaliana BFP model system using CRISPRs to create double-stranded breaks in targeted genes and GRONs to mediate conversion. The CRISPRs used in this example targets the bfp gene in the Arabidopsis thaliana genome by introducing into protoplasts plasmid(s) encoding the Cas9 gene and one sgRNAs that is either encoded on a plasmid or introduced into protoplasts as an amplicon. The sgRNA is a fusion of CRISPR RNA (crRNA) and trans-activating crRNA (tracrRNA). The crRNA guides the Cas9 to the target genes, where Cas9 creates a double-stranded break and the GRON is used as a template to convert BFP to GFP in a site-directed manner.
Arabidopsis thaliana protoplasts derived from induced root tissue are seeded on a flat-bottom 96-well plate, at 250,000 cells per well at a cell density of 1Ă107 cells/ml. The CRISPR encoded plasmids contain the MAS promoter driving the Cas9 coding sequence with a rbcSE9 terminator and Arabidopsis U6 promoter driving multiple different sgRNAs with a poly-T10 terminator. The sgRNA is a fusion of CRISPR RNA (crRNA) and trans-activating crRNA (tracrRNA). The CRISPR plasmids along with GRON are introduced into protoplasts by PEG mediated delivery at a final concentration of 0.05 Îźg/Îźl for the CRISPR and 0.16 ÎźM for the 201-mer. GRON treatments alone receive a final GRON concentration after PEG delivery of 2.5 ÎźM for the 201-mer. Protoplasts will be incubated in the dark at 23° C. for 72 hours, and then they are analyzed by flow cytometer in order to determine the percentage of BFP to GFP within a given treatment.
The CRISPR consists of two components: the plant codon-optimized Streptococcus pyogenes Cas9 (SpCas9) and sgRNA both of which were expressed from the same or multiple plasmids. The sgRNA is a fusion of CRISPR RNA (crRNA) and trans-activating crRNA (tracrRNA). The crRNA region contains the spacer sequence used to guide the Cas9 nuclease to the targeted genes. In these examples, the same BFP6 gRNA (5â˛GGTGCCGCACGTCACGAAGTCGG 3â˛)(SEQ ID NO: 25) was delivered into protoplasts either as an amplicon or encoded on a plasmid. Table 14 describes the GRONs used.
| TABLEâ14 |
| ListâofâGRONsâusedâinâthisâexampleâ(SEQâIDâNOS:â48âandâ49,ârespectively) |
| GRON | ||
| GRONâName | Chemistry | GRONâSequence |
| BFP4/NCâ201-mer | 3PS | 5â˛AAGATGGTGCGCTCCTGGACGTAGCCTTCGGGCATGGCGGACTTGAAGAAGTCGTGCTGCTT |
| CATGTGGTCTGGGTAGCGGCTGAAGCACTGCACGCCGTAGGTGAAGGTGGTCACGAGGGTGGG | ||
| CCAGGGCACGGGCAGCTTGCCGGTGGTGCAGATGAACTTCAGGGTCAGCTTGCCGTAGGTGGC | ||
| ATCGCCCTCGCCC3Ⲡ| ||
| BFP4/Câ201-mer | 3PS | 5â˛GGGCGAGGGCGATGCCACCTACGGCAAGCTGACCCTGAAGTTCATCTGCACCACCGGCAAGC |
| TGCCCGTGCCCTGGCCCACCCTCGTGACCACCTTCACCTACGGCGTGCAGTGCTTCAGCCGCTA | ||
| CCCCGACCACATGAAGCAGCACGACTTCTTCAAGTCCGCCATGCCCGAAGGCTACGTCCAGGA | ||
| GCGCACCATCTT3Ⲡ| ||
Delivery of the BFP6 gRNA as an amplicon (CR:BFP6 (gRNA amplicon)) along with a plasmid containing only Cas9 had similar rates of BFP to GFP conversion when compared to treatments with both the gRNA (gRNA plasmid) and Cas9 being encoded on separate plasmids at 72 h post PEG delivery of plasmids and GRONs into the Arabidopsis thaliana BFP model system (FIG. 12).
The purpose of this example is to demonstrate BFP to GFP conversion in our Arabidopsis thaliana BFP transgenic model system using CRISPRs to create targeted double-stranded breaks in the bfp gene and GRONs to mediate conversion. The BFP CRISPR used in this example targets the bfp gene and causes a double-stranded break in the DNA near the site of conversion. The 3PS GRONs contain DNA bases with 3 phosphothioate linkages on both the 5Ⲡand 3Ⲡends of the GRON and are herein referred to as 3PS GRONs. The 3PS GRONs were directly compared to their unmodified GRON counterparts in mediated BFP to GFP conversion using the BFP CRISPRs in our BFP transgenic Arabidopsis thaliana model system. See Table 15 for the list of GRONs used in these examples
| TABLEâ15 |
| ListâofâGRONsâusedâinâthisâexampleâ(SEQâIDâNOS:â50âandâ51,ârespectively) |
| GRONâName | GRONâChemistry | GRONâSequence |
| BFP4/Câ41-mer | 3PS | 5â˛CCCTCGTGACCACCTTCACCTACGGCGTGCAGTGCTTCAGCâ3Ⲡ|
| BFP4/NCâ41-mer | None | 5â˛GCTGAAGCACTGCACGCCGTAGGTGAAGGTGGTCACGAGGG3Ⲡ|
Methods
BFP transgenic Arabidopsis thaliana protoplasts derived from induced root tissue were seeded on a flat-bottom 96-well plate, at 250,000 cells per well at a cell density of 1Ă107 cells/ml. The CRISPR encoded plasmids contain the MAS promoter driving the Cas9 coding sequence with a rbcSE9 terminator and the Arabidopsis U6 promoter driving the sgRNA with a poly-T10 terminator. The sgRNA is a fusion of CRISPR RNA (crRNA) and trans-activating crRNA (tracrRNA). The CRISPR plasmids along with GRON were introduced into protoplasts by PEG mediated delivery at a final concentration of 0.05 Îźg/Îźl for the CRISPR, 0.16 ÎźM for the 41-mer GRONs. GRON treatments alone received a final GRON concentration after PEG delivery of 0.8 ÎźM for the 41-mer. Protoplasts were incubated in the dark at 23° C. for 72 hours, and then they were analyzed by flow cytometer in order to determine the percentage of GFP positive protoplasts within a given treatment.
The CRISPR consists of two components: the plant codon-optimized Streptococcus pyogenes Cas9 (SpCas9) and sgRNA both of which were expressed from the same plasmid. The sgRNA is a fusion of CRISPR RNA (crRNA) and trans-activating crRNA (tracrRNA). The crRNA region contains the spacer sequence used to guide the Cas9 nuclease to the BFP target gene. The BFP CRISPR spacer sequence is 5â˛CTCGTGACCACCTTCACCCA 3â˛(SEQ ID NO: 32). In this example the BFP CRISPR was used which targets the bfp gene. The GRONs contain the non-coding sequence of the bfp gene near the site of conversion. Table 16 shows a list of the GRONs used.
| TABLEâ16 |
| ListâofâGRONsâusedâinâthisâexample.â(SEQâIDâNOS:â50âandâ51,ârespectively) |
| GRONâName | GRONâChemistry | GRONâSequence |
| BFP4/Câ41-mer | 3PS | 5â˛CCCTCGTGACCACCTTCACCTACGGCGTGCAGTGCTTCAGCâ3Ⲡ|
| BFP4/NCâ41-mer | None | 5â˛GCTGAAGCACTGCACGCCGTAGGTGAAGGTGGTCACGAGGG3Ⲡ|
The 41-mer 3PS GRONs are more efficacious than their unmodified GRON counterparts at mediating BFP to GFP conversion using the BFP CRISPRs (FIG. 13).
The purpose of this example is to demonstrate EPSPS conversion in flax at both 24 hours in protoplasts and 3-weeks in microcalli after delivery of TALEN plasmids and GRONs. The TALENs used in this example targets the epsps gene in the Linum usitatissimum genome by introducing into shoot tip derived protoplasts plasmid(s) encoding TALENs creates a double-stranded break and the GRON is used as a template to convert the epsps gene in a site-directed manner.
Flax protoplasts were isolated from shoot tips obtained from in vitro germinated seedlings. The TALEN plasmids along with GRONs were introduced into protoplasts by PEG mediated delivery at a final concentration of 0.05 Îźg/Îźl and 0.5 ÎźM respectively. Protoplasts were incubated in the dark at 25° C. for up to 48 h in liquid medium, or embedded in alginate beads (5Ă105 cells/ml), and cultured in liquid medium to induce cell division and the formation of microcalli. Protoplasts or microcalli samples obtained 24 h or 3 weeks after DNA delivery were analyzed by NGS to determine the percentage of cells (DNA reads) carrying out the target mutation within a given treatment. The percent of indels generated by imperfect NHEJ-mediated DNA repair was also estimated.
TALEN constructs include two arms (left and right), each consisting of a TAL effector-like DNA binding domain linked to a catalytic DNA cleavage domain of FokI. The TAL effector-like DNA binding domain guides the TALEN arms to specific sites of DNA which allows the FokI endonucleases of each arm to dimerize together and cleave double-stranded DNA. The TALEN encoded plasmids contains MasP::LuEPSPS_(Left arm)-T2A-LuEPSPS_(right arm) with a rbcSE9 terminator. LuEPSPS_(left arm) sequence is 5â˛TGGAACAGCTATGCGTCCG 3Ⲡ(SEQ ID NO: 52) and the LuEPSPS_(right arm) sequence is 5â˛TGAGTTGCCTCCAGCGGCT 3Ⲡ(SEQ ID NO: 53). GRONs (144-mers) targeting LuEPSPS with or without wobble bases were used to determine their effect on rate of conversion.
24 hour protoplasts and 3-week old microcalli have 0.067% and 0.051% EPSPS conversion respectively as determined by Next Generation Sequencing (FIG. 14). Additionally, these data show that the TALEN is active and able to cleave the epsps target gene in Linum usitatissimum and form indels of 2.60% and 1.84% respectively at 24 hours in protoplasts and up to 3-week in microcalli. Moreover, EPSPS conversion and indels are maintained up to 3 weeks after the TALEN plasmid and GRON are introduced.
The purpose of this example is to demonstrate activity of Cas9 in flax microcalli three and six weeks after delivery of a Cas9 plasmid. The CRISPRs used in this example targets the epsps gene in the Linum usitatissimum genome by introducing into shoot tip derived protoplasts plasmid(s) encoding the Cas9 gene and a sgRNAs. The sgRNA is a fusion of CRISPR RNA (crRNA) and trans-activating crRNA (tracrRNA). The crRNA guides the Cas9 to the target genes, where Cas9 creates a double-stranded break in the epsps gene in a site-directed manner. The double-stranded breaks in the epsps gene when repaired by the ubiquitous NHEJ pathway will cause indels to form around the cleavage site.
Flax protoplasts were isolated from shoot tips obtained from in vitro germinated seedlings. The CRISPR encoded plasmids contains the MAS promoter driving the Cas9 coding sequence with an rbcSE9 terminator and the Arabidopsis thaliana U6 promoter driving the sgRNA with a poly-T10 terminator. The CRISPR plasmids were introduced into protoplasts by PEG mediated delivery at a final concentration of 0.05 Îźg/Îźl. Protoplasts were embedded in alginate beads (5Ă105 cells/ml), cultured in liquid medium, and incubated in a rotatory shaker (30 rpm) in the dark at 25° C. Microcalli developed from individual cells were analyzed by NGS, 3 and 6 weeks after CRISPR plasmid delivery, to determine the percentage of cells (DNA reads) carrying out indels generated by the error-prone NHEJ-mediated DNA repair pathway.
The CRISPR consists of two components: the plant codon-optimized Streptococcus pyogenes Cas9 (SpCas9) and sgRNA both of which were expressed from the same plasmid. The sgRNA is a fusion of CRISPR RNA (crRNA) and trans-activating crRNA (tracrRNA). The crRNA region contains the spacer sequence used to guide the Cas9 nuclease to the target gene. In this example, the CRISPR targets the epsps gene.
3- and 6-week old microcalli have 46.5% and 54.7% indel formation respectively as determined by Next Generation Sequencing (FIG. 15). These data shows that Cas9 is active and able to cleave the EPSPS target gene in Linum usitatissimum and form indels. Moreover, these indels are maintained up to 6 weeks after the CRISPR plasmid was introduced.
For construction of transient CRISPR-Cas9 expression plasmids, a higher plant codon-optimized SpCas9 gene containing a SV40 NLS at both the N- and C-terminal and a 2ĂFLAG tag on the N-terminal was synthesized as a series of GeneArtÂŽ Strings⢠(Life Technology, Carlsbad, CA), then cloned downstream of the mannopine synthase (MAS) promoter and upstream of the pea ribulose bisphosphate carboxylase (rbcsE9) terminator by Gibson's method. Next, an sgRNA cassette consisting of a chimeric gRNA whose expression is driven by the Arabidopsis U6 promoter, was synthesized as GeneArtÂŽ Stringsâ˘, then shuttled into the Cas9 containing construct using Gibson's method forming pBCRISPR. To specify the chimeric gRNA for the respective target sequence, pairs of DNA oligonucleotides encoding the variable 20-nt sgRNA targeting sequences were annealed to generate short double strand fragments with 4-bp overhangs. The fragments were ligated into BbsI digested pBCrispr to yield CRISPR-Cas constructs BC-1, BC-2 and BC-3.
Design and construction of TALEN expression constructs BT-1 and LuET-1 was based on rules as described in Cermak et al., Nucleic Acids Res. 39, e82 (2011). The target sequence was selected based on the gene editing site and the repeat variable i-residue (RVD) following the rules that NG, HD, NI, and NN recognize T, C, A, and G, respectively. The assembly of TAL effector domain linked to the heterodimeric FokI domains was completed through a commercial service (GeneArt; Life Technologies). TALEN monomers were cloned downstream of the MAS promoter and upstream of the rbcE9 terminator using Gibson's method and expressed as a 2A coupled unit.
Surface-sterilized Arabidopsis seeds were germinated on solid ½ MS medium (MS medium containing half the concentration of minerals and vitamins; 87.7 mM sucrose; Murashige and Skoog, 1962) at 25° C. under a 12 h light/dark cycle. Root material from 2 to 3-week-old seedlings were collected and maintained in ½ MS liquid medium under low light conditions at 28° C. Root cultures were transferred and maintained in MSAR [0.22% ½ MS, 87.7 mM sucrose, 11.4 ÎźM IAA, 2.3 ÎźM 2,4-D, 1.5 ÎźM 2iP, pH 5.8] three weeks prior to protoplast isolation. Roots were cut into approximately 6 mm segments and incubated in MSAP solution [0.22% ½ MS, 87.7 mM sucrose, 11.4 ÎźM IAA, 2.3 ÎźM 2,4-D, 1.5 ÎźM 2iP, and 400 mM mannitol, pH 5.8] containing cell wall digesting enzymes [1.25% Cellulase RS, 0.25% Macerozyme R-10, 0.6 M mannitol, 5 mM MES, 0.1% BSA] for 3-4 h in the dark with gentle shaking. The released protoplasts were collected and passed through a sterile 100 Îźm filter and 35 Îźm filter. The protoplast filtrate was mixed with 0.8 times the volume of Optiprep⢠Density Gradient Medium (Sigma) and mixed gently. A 60% W5 [154 mM NaCl, 5 mM KCl, 125 mM CaCl2)2H2O, 5 mM glucose, 10 mM MES, (pH 5.8)]/40% Optiprep solution followed by 90% W5/10% Optiprep solution were slowly layered onto the filtrate/Optiprep solution to make a gradient, which was centrifuged at 198 RCF for 10 min. The white protoplast layer was collected and mixed with 2 times the volume of W5. Protoplasts were centrifuged at 44 RCF for 10 min and re-suspended in TM solution [14.8 mM MgCl2¡6H2O, 5 mM MES, 572 mM mannitol, (pH 5.8)] at a density of 1Ă107 cells/ml. For experiments with Zeocin⢠(Life Technologies, Carlsbad, CA) and phleomycin (InvivoGen, San Diego, CA), protoplasts were kept in TM adjusted to pH 7.0 for 90 min on ice before transfection.
Flax protoplasts were isolated from shoot tips obtained from 3-week-old seedlings germinated in vitro. Shoot tips were finely chopped with a scalpel, pre-plasmolyzed for 1 h at room temperature in B-medium [B5 salts and vitamins (Gamborg et al., 1968), 4 mM CaCl2), 0.1 M glucose, 0.3 M mannitol, 0.1 M glycine, 250 mg/l casein hydrolysate, 10 mg/l L-cystein-HCL, 0.5% polyvinylpyrrolidone (MW 10,000), 0.1% BSA, 1 mg/l BAP, 0.2 mg/l NAA, and 0.5 mg/l 2,4-D], and incubated in a cell wall digesting enzyme solution containing B-medium supplemented with 0.66% Cellulase YC and 0.16% Macerozyme R-10 over a rotatory shaker (50 rpm) at 25° C. for 5 h. Released protoplasts were sieved and purified by density gradient centrifugation using Optiprep (Sigma) layers, counted with a hemocytometer, and kept stationary overnight in the dark at a density of 0.5Ă106 protoplasts/ml in B medium.
In a 96-well flat bottom plate, 2.5Ă105 cells per well were transfected with 10 pmol GRON, 10 pmol GRON plus 3.25 Îźg CRISPR-Cas or TALEN expression construct or mock using PEG [270 mM mannitol, 67.5 mM Ca(NO3)2, 38.4% PEG 1500, (pH 5.8)]. Cells and DNA were incubated with PEG on ice for 30 minutes followed by a wash with 200 Îźl of W5 solution. Finally, 85 Îźl of MSAP++ [MSAP containing 50 nM phytosulfokine-Îą and 20 ÎźM n-propyl gallate] was added and the cells cultured in low light conditions at 28° C.
After about 18 h of culture, protoplasts were transfected with TALEN plasmid along with GRONs (20 Îźg plasmid and 0.2 nmol GRON/106 protoplasts) using PEG mediated delivery. Treated protoplasts were incubated in the dark at 25° C. for up to 48 h in B medium, or embedded in alginate beads 24 h after transfection, and cultured in V-KM liquid medium to induce cell division and the formation of microcalli. For the antibiotic experiments, 1.25Ă105 cells per well were transfected with 8 ÎźM GRON CG13 using the PEG solution described above.
Seventy-two h after transfection, cells were analyzed by cytometry using the AttuneÂŽ Acoustic Focusing cytometer (Applied BiosystemsÂŽ) with excitation and detection of emission as appropriate for GFP. Background level was based on PEG-treated protoplasts without DNA delivery. For antibiotic experiments, protoplasts treated with Zeocin or phleomycin prior to transfection were analyzed by cytometry 48 h after transfection.
Genomic DNA was extracted from CRISPR-Cas or TALEN-treated protoplasts using the NucleoSpinÂŽ Plant II kit as per the manufacturer's recommendations (Machery-Nagel, Bethlehem, PA). Amplicons flanking the TALEN or CRISPR target region were generated using PhusionÂŽ polymerase with 100 ng of genomic DNA and primers BFPF-1 (5â˛-GGACGACGGCAACTACAAGACC-3â˛)(SEQ ID NO: 54)/BFPR-1 (5â˛-TAAACGGCCACAAGTTCAGC-3â˛) (SEQ ID NO: 55) for Arabidopsis CRISPR and TALEN; or LuEPF-1 (5â˛-GCATAGCAGTGAGCAGAAGC-3â˛) (SEQ ID NO: 56)/LuEPR-1 5â˛-AGAAGCTGAAAGGCTGGAAG-3Ⲡ(SEQ ID NO: 57) for L. usitatissimum TALEN. The amplicons were purified and concentrated using Qiaquick MinElute columns (Qiagen, Valencia, CA). Deep sequencing of the amplicons was performed by GeneWiz (South Plainfield, NJ) using a 2Ă250 bp MiSeq run (Illumina, San Diego, CA). For data analysis fastq files for read 1 and read 2 were imported into CLC Genomics Workbench 7.0.4 (CLCBio, Boston, MA). Paired reads were merged into a single sequence if their sequences overlapped. A sequence for an amplicon was identified if it or its reverse and complemented sequence contained both forward and reverse primer sequences. Occurrence of a unique sequence in a sample was recorded as its abundance. Percent indel or gene edit was calculated by dividing the number of reads with the edit or indel by the total number of sequenced reads, and then multiplying by 100.
| SequenceâofâCRISPR-Casâphotospacersâ(SEQâIDâNOS:â58-60,ârespectively) |
| Name | Sequenceâ(5â˛âtoâ3â˛) | FigureâReference |
| BC-1 | CTCGTGACCACCTTCACCCA | 1a;â1b;â2a;â2c |
| BC-2 | GTCGTGCTGCTTCATGTGG | 2b |
| BC-3 | GGCTGAAGCACTGCACGCCG | 2d |
| TALENâbindingâdomainâsequencesâ(SEQâIDâNOS:â61-64,ârespectively) |
| PaperâName | Sequenceâ(5â˛âtoâ3â˛) | FigureâReference |
| BT-1 | Leftâarm:âTGGTCGGGGTAGCGGCTGA | 3a;â3b |
| Rightâarm:âTCGTGACCACCTTCACCCA | ||
| LuET-1 | Leftâarm:âTGGAACAGCTATGCGTCCG | 3c;â3d |
| Rightâarm:âTGAGTTGCCTCCAGCGGCT | ||
| GRONâsequencesâusedâ(SEQâIDâNOS:â65-78,ârespectively) |
| Name | Sequenceâ(5â˛âtoâ3â˛) | Chemistry | FigureâReference |
| CG1 | GCTGAAGCACTGCACGCCGTAGGTGAAGGTGGTCACGAGGG | Unmodified | 2a |
| CG2 | G*C*T*GAAGCACTGCACGCCGTAGGTGAAGGTGGTCACGA*G*G*G | (*)â=â3PS | 2a |
| CG3 | C*G*C*TCGTGACCACCTTCACCTACGGCGTGCAGTGCTTC*A*G*C | (*)â=â3PS | 2d;â3a |
| CG4 | VCCCTCGTGACCACCTTCACCTACGGCGTGCAGTGCTTCAGCH | Vâ=âCY3;âHâ=â3â˛DMTâdC | 2d |
| CG5 | G*T*G*ACCACCTTCACCTACGGCGTGCAGTGCTTCAGCCGCTAC | (*)â=â3PS | 2b |
| CCAGACCACATGAAG*C*A*G | |||
| CG6 | A*A*G*ATGGTGCGCTCCTGGACGTAGCCTTCGGGCATGGCGGACT | (*)â=â3PS | 1b;â2c |
| TGAAGAAGTCGTGCTGCTTCATGTGGTCGGGGTAGCGGCTGAAGCA | |||
| CTGCACGCCGTAGGTGAAGGTGGTCACGAGGGTGGGCCAGGGCACG | |||
| GGCAGCTTGCCGGTGGTGCAGATGAACTTCAGGGTCAGCTTGCCGT | |||
| AGGTGGCATCGCCCTCG*C*C*C | |||
| CG7 | G*G*G*CGAGGGCGATGCCACCTACGGGCAAGCTGACCCTGAAGTT | (*)â=â3PS | 3b |
| CATCTGCACCACCGGCAAGCTGCCCGTGCCCTGGCCCACCCTCGTG | |||
| ACCACCTTCACCTACGGCGTGCAGTGCTTCAGCCGCTACCCCGACC | |||
| ACATGAAGCAGCACGACTTCTTCAAGTCCGCCATGCCCGAAGGCTA | |||
| CGTCCAGGAâGCGCACCAT*C*T*T | |||
| CG8 | G*G*G*CGAGGGCGATGCCACCTACGGGCAAGCTGACCCTGAAGTT | (*)â=â3PS | 2b |
| CATCTGCACCACCGGCAAGCTGCCCGTGCCCTGGCCCACCCTCGTG | |||
| ACCACCTTCACCTACGGCGTGCAGTGCTTCAGCCGCTACCCAGACC | |||
| ACATGAAGCAGCACGACTTCTTCAAGTCCGCCATGCCCGAAGGCTA | |||
| CGTCCAGGAâGCGCACCAT*C*T*T | |||
| CG9 | A*A*G*ATGGTGCGCTCCTGGACGTAGCCTTCGGGCATGGCGGACT | (*)â=â3PS | 1a |
| TGAAGAAGTCGTGCTGCTTCATGTGGTCGGGGTAGCGGCTGAAGCA | |||
| CTGCACGCCGTACGTAAACGTGGTCACGAGGGTGGGCCAGGGCACG | |||
| GGCAGCTTGCCGGTGGTGCAGATGAACTTCAGGGTCAGCTTGCCGâ | |||
| TAGGTGGCATCGCCCTCG*C*C*C | |||
| CG10 | (a)agauggugcGCTCCTGGACGTAGCCTTCGGGCATGGCGGACTT | LowerâCaseâ=âRNA | 2c |
| GAAGAAGTCGTGCTGCTTCATGTGGTCGGGGTAGCGGCTGAAGCAC | bases;â(base)â=â2â˛-O-Me; | ||
| TGCACGCCGTAGGTGAAGGTGGTCACGAGGGTGGGCCAGGGCACGG | UpperâCaseâ=âDNAâbases | ||
| GGCAGCTTGCCGGTGGTGCAGATGAACTTCAGGGTCAGCTTGCCGT | |||
| AGGTGGCATCGCCCTCGCCC | |||
| CG11 | (a)(a)(g)(a)(u)(g)(g)(u)(g)cGCTCCTGGACGTAGCCTT | LowerâCaseâ=âRNA | 2c |
| CGGGCATGGCGGACTTGAAGAAGTCGTGCTGCTTCATGTGGTCGGG | bases;â(base)â=â2â˛-O-Me; | ||
| GTAGCGGCTGAAGCACTGCACGCCGTAGGTGAAGGTGGTCACGAGG | UpperâCaseâ=âDNAâbases | ||
| GTGGGCCAGGGCACGGGCAGCTTGCCGGTGGTGCAGATGAACTTCA | |||
| GGGTCAGCTTGCCGTAGGTGGCATCGCCCTCGCCC | |||
| CG12 | VCGGTCGGTAAACTGGCGAAGAACGATATTGAACTTTTCCTTGGAA | Vâ=âCY3;âHâ=ââ˛DMTâdC | 3c;â3d |
| ATGCTGGAATAGCTATGCGTGCGCTGACAGCTGCTGTAACAGCCGC | CPG | ||
| TGGAGGGCAACTCAAGGTCCCTTCCCTCAACTCCTTCCAGCCTTTC | |||
| AGCTTCTTH | |||
| and | |||
| VCGGTCGGTAAACTGGCGAAGAACGATATTGAACTTTTCCTTGGAA | |||
| ATGCTGGAATAGCTATGCGTGCGCTGACAGCTGCTGTAACAGCCGC | |||
| TGGAGGGCAACTCAAGGTCCCTTCCCTCAACTCCTTCCAGCCTTTC | |||
| AGCTTCTTH | |||
| CG13 | G*C*T*GAAGCACTGCACGCCGTGGGTGAAGGTGGTCACGA*G*G*G | (*)â=â3PS | ExtendedâData |
| FIG.â1 | |||
Statistical significance was determined using a Student's t-test with two-tailed distribution. P-values <0.05 were considered as significant. Data are shown as mean and SEM.
CRISPR-Cas nuclease activity and gene editing in A. thaliana protoplasts.
Engineered nucleases such as TAL effector nucleases (TALENs) and clustered regularly interspaced short palindromic repeats (CRISPR)-associated endonuclease Cas9 (CRISPR-Cas9) can be programmed to target and cleave double-stranded DNA with high specificity. TALENs consist of two arms, both having a TAL effector-like DNA binding domain (TALE) linked to a catalytic DNA nuclease domain of FokI. The TALE domains guide the TALEN arms to specific sites of DNA allowing for dimerization of the FokI endonucleases and subsequent generation of a double strand break (DSB). The CRISPR-Cas9 system consists of a two components; a Streptococcus pyogenes Cas9 nuclease (SpCas9) and a chimeric fusion of two RNAs (crRNA and tracrRNA) referred to as an engineered single guide (sgRNA). The sgRNA supports targeted nucleic acid specificity for Cas9 through base pairing of its first twenty 5Ⲡbases with the DNA target, subsequently resulting in a site-specific DSB.
In plants, DSBs are typically repaired by the error prone non-homologous end joining (NHEJ) DNA repair pathway resulting in random deletions and/or insertions (indels) at the site of repair. In contrast precision genome editing, relies on nuclease induced DSBs near the targeted change to be repaired by homology directed repair (HDR), a repair pathway that is more precise than NHEJ due to the requirement of a homologous template DNAâin most cases sister chromatid. By harnessing the HDR pathway, it is possible to use an engineered oligonucleotide as the repair template to edit DNA specifically, when cleaved by nucleases or non-specifically when used in combination with double strand break inducing antibiotics.
FIG. 16 depicts CRISPR-Cas9 nuclease activity in Arabidopsis thaliana protoplasts derived from the BFP transgenic model system in which a stably integrated BFP gene can be converted to GFP by editing the codon encoding H66 (CACâTAC H66Y). When cells were treated with CRISPR-Cas9 (BC-1), NHEJ induced indels were produced at a frequency of 0.79% near the H66 locus of the BFP gene by deep sequencing (FIG. 16a). The majority of indels were single bp and none longer than 9 bp. Conversely, cells treated with GRON only or mock-treated did not exhibit indels (data not shown). These results show that CRISPR-Cas9 nuclease can actively target the BFP gene in this transgenic model system.
With regard to the effectiveness of CRISPR-Cas9 in combination with GRON to mediate BFP to GFP gene editing in protoplasts derived from our transgenic model system, a 7.4-fold improvement in BFP to GFP editing was observed when both CRISPR-Cas9 and phosphorothioate (PS) modified GRONs (CG6) are introduced concurrently when compared to GRON alone or CRISPR-Cas9 alone treatments (FIG. 16b). These results demonstrate that introducing CRISPR-Cas9 with PS modified GRONs into Arabidopsis protoplasts significantly increase the frequency of BFP to GFP gene editing.
GRONs containing three adjacent PS modifications (herein refer to as 3PS) at both the 5Ⲡand 3Ⲡends positively effect BFP to GFP editing when compared to an unmodified GRON. The 3PS modified GRON (CG2), when combined with CRISPR-Cas9 (BC-1), is more efficacious at BFP to GFP editing when compared to an unmodified GRON template (CG1; FIG. 17a). In addition, a positive correlation between editing and GRON length (FIG. 17b) was observed. Taken together, these results show that both GRON modification and length can greatly improve the frequency of gene editing in plants such as Arabidopsis in the presence of CRISPR-Cas9.
When either the 201 nucleobase (nb) 3PS modified GRON (CG6), or the 201 nb 2â˛-O-methyl modified GRONs (CG9) or (CG10), consisting of the first ten 5Ⲡbases as RNA with either the first RNA base or the first 9 RNA bases modified with 2â˛-O-methyl are introduced along with CRISPR-Cas9 (BC-1) into Arabidopsis protoplasts, no statistical difference in BFP to GFP editing between them was observed (FIG. 17c). Similarly, when either the 201 nb 3PS modified GRON (CG3) or the 201 nb Cy3 modified GRON (CG4), comprising of a 5ⲠCy3 and an 3ⲠidC reverse base, were introduced along with CRISPR-Cas9 (BC-3) into Arabidopsis protoplasts, no statistical difference in editing frequencies was observed (FIG. 17d). Overall, these data show that diverse GRON modifications can greatly improve the frequency of gene editing in Arabidopsis in the presence of CRISPR-Cas9.
Based on these results with CRISPR-Cas9 and modified GRONs, it was determined if modified GRONs coupled with TALEN pairs targeting the BFP gene result in improved BFP to GFP gene editing as well. To first show effective nuclease activity at the BFP locus Arabidopsis protoplasts were treated with TALENs (BT-1) and found 0.51% indels at or near the expected cleavage site by deep sequencing-indicating that TALENs are as active as CRISPR-Cas9 in this model system (FIG. 18a). The majority of deletions were >10 bp but less than 50 bp, while insertions, significantly less abundant than deletions were three bp or less. Next we examined the effectiveness of TALENs coupled with modified GRON to edit BFP to GFP. A 9.2-fold improvement in the frequency of BFP to GFP editing was observed when both the BFP TALEN (BT-1) and 3PS GRON (CG7) are introduced when compared to 3PS GRON alone (FIG. 18b). Similar to the CRISPR-Cas experiments described above, these results demonstrate that introducing TALENs with 3PS modified GRONs into Arabidopsis protoplasts also significantly increases the frequency of BFP to GFP gene editing.
The EPSPS (5â˛-enolpyruvylshikimate-3-phosphate synthase) loci in Linum usitatissimum (Common flax) was also used as a target in this system. The EPSPS genes encode an enzyme in the shikimate pathway that participates in the biosynthesis of the aromatic amino acids phenylalanine, tyrosine and tryptophan. In plants, EPSPS is a target for the herbicide, glyphosate, where it acts as a competitive inhibitor of the binding site for phosphoenolpyruvate.
TALENs targeting a site near two loci (T97I and P101A) in L. usitatissimum that when edited will render EPSPS tolerant to glyphosate were selected. Delivering TALEN (LuET-1) together with a 144 nb 5ⲠCy3 modified GRON (CG11) containing the targeted changes at T97I and P101A into protoplasts, gene editing frequencies of 0.19% at both loci and indel frequency at 0.5% seven days after introduction were observed (FIG. 18c, 18d). The majority of indels were 10 bp or less (FIG. 18c). These results demonstrate that introducing TALENs with Cy3 modified GRONs into L. usitatissimum protoplasts significantly increase the frequency of EPSPS gene editing and further that multiple nucleotide edits can be realized with a single GRON.
The purpose of this series of examples was to evaluate the effect of antibiotics on conversion efficiencies.
Protoplasts from an Arabidopsis thaliana line with multiple copies of a blue fluorescent protein gene were treated with GRON as described in Example 1, with the following modification: before the addition of GRON, the protoplasts were kept for 90 minutes on ice in a solution of TM (14.8 mM MgCl2Ă6H2O, 5 mM 2-(N-morpholino)ethanesulfonic acid, 572 mM mannitol), supplemented with 0, 250, or 1000 Îźg/ml Zeocin⢠or phleomycin. The pH of the solutions was adjusted to 7.0. The percentage of green-fluorescing cells resulting from BFP to GFP conversion was evaluated by flow cytometry as described in Example 1.
Zeocin and phleomycin at both concentrations used (250 and 1000 Îźg/ml) resulted in an increase in BFP to GFP gene editing (see FIG. 19). Green-fluorescing cells resulting from BFP to GFP gene editing were observed five days after GRON delivery (FIG. 20).
The purpose of this experiment is to demonstrate ACCase conversion in Oryza sativa at 120 hours after PEG delivery of CRISPR-Cas plasmids and GRONs into protoplasts. The CRISPR-Cas used in this experiment targets the accase gene in the rice genome by introducing into protoplasts plasmid(s) encoding the Cas9 gene and a sgRNAs. The sgRNA is a fusion of CRISPR RNA (crRNA) and trans-activating crRNA (tracrRNA). The crRNA guides the Cas9 to the target genes, where Cas9 creates a double-stranded break in the accase gene and the GRON is used as a template to convert the accase gene in a site-directed manner.
Rice protoplasts were isolated from calli. The CRISPR-Cas encoded plasmids contains the corn ubiquitin promoter driving the Cas9 coding sequence with an rbcSE9 terminator and a rice U6 promoter promoter driving the sgRNA with a poly-T10 terminator. The CRISPR-Cas plasmids were introduced into protoplasts by PEG mediated delivery at a final concentration of 0.05 Îźg/Îźl. GRONs with the following sequence, 5ⲠV C TGA CCT GAA CTT GAT CTC AAT TAA CCC TTG CGG TTC CAG AAC ATT GCC TTT TGC AGT CCT CTC AGC ATA GCA CTC AAT GCG GTC TGG GTT TAT CTT GCT TCC AAC GAC AAC CCA AGC CCC TCC TCG TAG CTC TGC AGC CAT GGG AAT GTA GAC AAA GGC AGG CTG ATT GTA TGT CCT AAG GTT CTC AAC AAT AGT CGA GCC H 3Ⲡ(SEQ ID NO: 79), were used at a final concentration of 0.8 ÎźM. Protoplasts were embedded in agarose (2.5Ă106 cells/ml), cultured in liquid medium, and incubated in a rotatory shaker (60 rpm) in the dark at 28° C. Individual samples were analyzed by NGS, 120 hours after CRISPR-Cas plasmid and/or GRON delivery, to determine the percentage of cells (DNA reads) carrying the ACCase conversion and having indels in the accase gene.
The CRISPR consists of two components: the plant codon-optimized Streptococcus pyogenes Cas9 (SpCas9) and sgRNA both of which were expressed from the same plasmid. The sgRNA is a fusion of CRISPR RNA (crRNA) and trans-activating crRNA (tracrRNA). The crRNA region contains the spacer sequence (5â˛-ACGAGGAGGGGCTTGGGTTGTGG-3)(SEQ ID NO: 80) used to guide the Cas9 nuclease to the target gene. In this experiment the CRISPR targets the accase gene.
At 120 h, rice protoplasts have 0.026% ACCase conversion as determined by Next Generation Sequencing. GRON only controls with no CRISPR-Cas showed minimal Accase conversion of 0.002% at 120 hours and the untreated controls showed no conversion. Additionally, these data show that the CRISPR-Cas is active and able to cleave the ACCase target gene and form indels of 8.0%.
Summary: Targeted ACCase mutations have been identified in nineteen week-old calli by PCR and DNA sequencing analyses.
The purpose of this experiment is to demonstrate ACCase conversion in Oryza sativa calli after PEG delivery of CRISPR-Cas plasmids and GRONs into protoplasts. The CRISPR-Cas used in this experiment targets the ACCase gene in the rice genome by introducing into protoplasts plasmid(s) encoding the Cas9 gene and a sgRNAs. The sgRNA is a fusion of CRISPR RNA (crRNA) and trans-activating crRNA (tracrRNA). The crRNA guides the Cas9 to the target gene, where Cas9 creates a either a double-stranded break or a nick at a targeted location in the ACCase gene and the GRONs are used as a template to convert the ACCase gene in a site-directed manner.
Targeted OsACCase mutations described in the tables below, have been identified in nineteen week-old calli by PCR and DNA sequencing analyses.
Rice protoplasts were isolated from suspension cultures initiated from mature seed-derived embryogenic calli. The CRISPR-Cas plasmids with GRONs at a final concentration of 0.05 Îźg/Îźl and 0.8 ÎźM, respectively, were introduced into protoplasts by PEG mediated delivery method. An exemplary range for CRISPR-Cas plasmids at a final concentration include, but is not limited to 0.01 to 0.2 Îźg/Îźl. An exemplary range for GRON at a final concentration include, but is not limited to 0.01 to 4 ÎźM. The CRISPR-Cas encoded plasmids contains the corn ubiquitin promoter driving the Cas9 coding sequence with an rbcSE9 terminator and a rice U6 promoter promoter driving the sgRNA with a poly-T10 terminator. Sequence information of the GRONs are described in Table 3. Following the PEG treatment, protoplasts were embedded in agarose (1.25Ă106 cells/ml), cultured in liquid medium, and incubated in a rotatory shaker (60 rpm) in the dark at 28° C. An exemplary range for embedding protoplasts in agarose include, but is not limited to 0.625Ă106 to 2.5Ă106 cells/ml. Samples from each treatment were analyzed by Next Generation Sequencing after 4 weeks post CRISPR-Cas plasmid and/or GRON treatment to determine the proportion of cells (DNA reads) carrying the ACCase conversion. Microcalli from converted treatments were released onto solid selection medium containing clethodim (0.25-0.5 ÎźM) or sethoxydim (2.5 ÎźM). Individual callus lines growing on this selection medium after 19 weeks of culture were analyzed by in-house screening methods as well as DNA sequencing in order to identify individual calli containing the targeted ACCase conversions.
The CRISPR consists of two components: the Cas9, such as a plant codon-optimized Streptococcus pyogenes Cas9 (SpCas9) and sgRNA both of which were expressed from plasmid(s). Cas9 and sgRNA can also be delivered by mRNA/RNA or protein/RNA respectively. The sgRNA is a fusion of CRISPR RNA (crRNA) and trans-activating crRNA (tracrRNA). The crRNA region contains the spacer with sequences described in Table 2, which were used to guide the Cas9 nuclease to the target gene. In this experiment the CRISPR targets the rice ACCase gene.
List of conversions in OsACCase at two different locations within the gene, Site 1 and Site 2. For each site, all combinations of conversion events are possible.
| OsACCase |
| Site1 | Site 2 | |
| I1781A | D2078G | |
| I1781L | D2078K | |
| I1781M | D2078T | |
| I1781N | S2079F | |
| I1781S | K2080E | |
| I1781T | C2088F | |
| I1781V | C2088G | |
| G1783C | C2088H | |
| A1786P | C2088K | |
| C2088L | ||
| C2088N | ||
| C2088P | ||
| C2088Q | ||
| C2088R | ||
| C2088S | ||
| C2088T | ||
| C2088V | ||
| C2088W | ||
List of CRISPR-Cas gRNA spacer sequences used in this experiment. Spacer length may vary up to Âą20 bp. Mismatched within the spacer sequence can be tolerated up to 10 bp.
| OsACCase |
| SEQâID | SampleâID | SpacerâRNAâSequenceâ(5â˛âtoâ3â˛) | Siteâ1 | Siteâ2 |
| 81 | 1 | CAUAAGAUGCAGCUAGACAG | X | |
| 82 | 2 | AGCUAGACAGUGGUGAAAUU | X | |
| 83 | 3 | UAGACAGUGGUGAAAUUAGG | X | |
| 84 | 4 | AGACAGUGGUGAAAUUAGGU | X | |
| 85 | 5 | GUGGGUUAUUGAUUCUGUUG | X | |
| 86 | 6 | UGGGUUAUUGAUUCUGUUGU | X | |
| 87 | 7 | UAUUGAUUCUGUUGUGGGCA | X | |
| 88 | 8 | UCUGUUGUGGGCAAGGAAGA | X | |
| 89 | 9 | GUGGGCAAGGAAGAUGGACU | X | |
| 90 | 10 | CAAGGAAGAUGGACUUGGUG | X | |
| 91 | 11 | CUUGGUGUGGAGAAUAUACA | X | |
| 92 | 12 | CUAUUGCCAGUGCUUAUUCU | X | |
| 93 | 13 | UGCUUAUUCUAGGGCAUAUA | X | |
| 94 | 14 | UUUACACUUACAUUUGUGAC | X | |
| 95 | 15 | UUUGUGACUGGAAGAACUGU | X | |
| 96 | 16 | ACUGGAAGAACUGUUGGAAU | X | |
| 97 | 17 | GGAGCUUAUCUUGCUCGACU | X | |
| 98 | 18 | AUAUGCCCUAGAAUAAGCAC | X | |
| 99 | 19 | GAUAAGAUGCAGCUAGACAG | X | |
| 100 | 20 | GGCUAGACAGUGGUGAAAUU | X | |
| 101 | 21 | GAGACAGUGGUGAAAUUAGG | X | |
| 102 | 22 | GGACAGUGGUGAAAUUAGGU | X | |
| 103 | 24 | GGGGUUAUUGAUUCUGUUGU | X | |
| 104 | 25 | GAUUGAUUCUGUUGUGGGCA | X | |
| 105 | 26 | GCUGUUGUGGGCAAGGAAGA | X | |
| 106 | 28 | GAAGGAAGAUGGACUUGGUG | X | |
| 107 | 29 | GUUGGUGUGGAGAAUAUACA | X | |
| 108 | 30 | GUAUUGCCAGUGCUUAUUCU | X | |
| 109 | 31 | GGCUUAUUCUAGGGCAUAUA | X | |
| 110 | 32 | GUUACACUUACAUUUGUGAC | X | |
| 111 | 33 | GUUGUGACUGGAAGAACUGU | X | |
| 112 | 34 | GCUGGAAGAACUGUUGGAAU | X | |
| 113 | 36 | GUAUGCCCUAGAAUAAGCAC | X | |
| 114 | 37 | CGACUAUUGUUGAGAACCUU | X | |
| 115 | 38 | UGCCUUUGUCUACAUUCCCA | X | |
| 116 | 39 | CCCAUGGCUGCAGAGCUACG | X | |
| 117 | 40 | AUGGCUGCAGAGCUACGAGG | X | |
| 118 | 41 | UGGCUGCAGAGCUACGAGGA | X | |
| 119 | 42 | GGCUGCAGAGCUACGAGGAG | X | |
| 120 | 43 | CAGAGCUACGAGGAGGGGCU | X | |
| 121 | 44 | AGAGCUACGAGGAGGGGCUU | X | |
| 122 | 45 | ACGAGGAGGGGCUUGGGUUG | X | |
| 123 | 46 | GCAUUGAGUGCUAUGCUGAG | X | |
| 124 | 47 | UAUGCUGAGAGGACUGCAAA | X | |
| 125 | 48 | GACUGCAAAAGGCAAUGUUC | X | |
| 126 | 49 | GGCAAUGUUCUGGAACCGCA | X | |
| 127 | 50 | GCAAUGUUCUGGAACCGCAA | X | |
| 128 | 51 | GGUUAAUUGAGAUCAAGUUC | X | |
| 129 | 52 | UGAGAUCAAGUUCAGGUCAG | X | |
| 130 | 53 | GUUCAGGUCAGAGGAACUCC | X | |
| 131 | 54 | AACUCCAGGAUUGCAUGAGU | X | |
| 132 | 55 | CAAGCCGACUCAUGCAAUCC | X | |
| 133 | 56 | UUGAUCUCAAUUAACCCUUG | X | |
| 134 | 57 | UCUCAGCAUAGCACUCAAUG | X | |
| 135 | 58 | GCAUAGCACUCAAUGCGGUC | X | |
| 136 | 59 | CAUAGCACUCAAUGCGGUCU | X | |
| 137 | 60 | UCCUCGUAGCUCUGCAGCCA | X | |
| 138 | 61 | AGCCAUGGGAAUGUAGACAA | X | |
| 139 | 62 | AUGGGAAUGUAGACAAAGGC | X | |
| 140 | 63 | CAGGCUGAUUGUAUGUCCUA | X | |
| 141 | 64 | GGACUAUUGUUGAGAACCUU | X | |
| 142 | 65 | GGCCUUUGUCUACAUUCCCA | X | |
| 143 | 66 | GCCAUGGCUGCAGAGCUACG | X | |
| 144 | 67 | GUGGCUGCAGAGCUACGAGG | X | |
| 145 | 68 | GGGCUGCAGAGCUACGAGGA | X | |
| 146 | 69 | GAGAGCUACGAGGAGGGGCU | X | |
| 147 | 70 | GGAGCUACGAGGAGGGGCUU | X | |
| 148 | 71 | GCGAGGAGGGGCUUGGGUUG | X | |
| 149 | 72 | GAUGCUGAGAGGACUGCAAA | X | |
| 150 | 73 | GGAGAUCAAGUUCAGGUCAG | X | |
| 151 | 74 | GACUCCAGGAUUGCAUGAGU | X | |
| 152 | 75 | GAAGCCGACUCAUGCAAUCC | X | |
| 153 | 76 | GUGAUCUCAAUUAACCCUUG | X | |
| 154 | 77 | GCUCAGCAUAGCACUCAAUG | X | |
| 155 | 78 | GAUAGCACUCAAUGCGGUCU | X | |
| 156 | 79 | GCCUCGUAGCUCUGCAGCCA | X | |
| 157 | 80 | GGCCAUGGGAAUGUAGACAA | X | |
| 158 | 81 | GUGGGAAUGUAGACAAAGGC | X | |
| 159 | 82 | GAGGCUGAUUGUAUGUCCUA | X | |
A list of GRON sequences suitable for use in this experiment are provided in the table below (V=CY3; H=3â˛DMT dC CPG).
| SEQâID | |
| 160 | 1 | VGTCATAGCACATAAGATGCAGCTAGACAGTGGTGAAATTAGGTGGGTTAT |
| TGATTCTGTTGTGGGCAAGGAAGATGGACTTGGTGTGGAGAATGCTCATGG | ||
| AAGTGCTGCTATTGCCAGTGCTTATTCTAGGGCATATAAGGAGACATTTAC | ||
| ACTTACATTTGTGACTGGAAGAACTGTTGGAATAGGAGCTTATCTTGCTCH | ||
| 161 | 2 | VGAGCAAGATAAGCTCCTATTCCAACAGTTCTTCCAGTCACAAATGTAAGT |
| GTAAATGTCTCCTTATATGCCCTAGAATAAGCACTGGCAATAGCAGCACTT | ||
| CCATGCAGATTCTCCACACCAAGTCCATCTTCCTTGCCCACAACAGAATCA | ||
| ATAACCCACCTAATTTCACCACTGTCTAGCTGCATCTTATGTGCTATGACH | ||
| 162 | 3 | VGTCATAGCACATAAGATGCAGCTAGACAGTGGTGAAATTAGGTGGGTTATTGATT |
| CTGTTGTGGGCAAGGAAGATGGACTTGGTGTGGAGAATATACATTGCAGTGCTGCT | ||
| ATTGCCAGTGCTTATTCTAGGGCATATAAGGAGACATTTACACTTACATTTGTGAC | ||
| TGGAAGAACTGTTGGAATAGGAGCTTATCTTGCTCH | ||
| 163 | 4 | VGAGCAAGATAAGCTCCTATTCCAACAGTTCTTCCAGTCACAAATGTAAGTGTAAA |
| TGTCTCCTTATATGCCCTAGAATAAGCACTGGCAATAGCAGCACTGCAATGTATAT | ||
| TCTCCACACCAAGTCCATCTTCCTTGCCCACAACAGAATCAATAACCCACCTAATT | ||
| TCACCACTGTCTAGCTGCATCTTATGTGCTATGACH | ||
| 164 | 5 | VGTCATAGCACATAAGATGCAGCTAGACAGTGGTGAAATTAGGTGGGTTAT |
| TGATTCTGTTGTGGGCAAGGAAGATGGACTTGGTGTGGAGAATATACATGG | ||
| AAGTGCTCCAATTGCCAGTGCTTATTCTAGGGCATATAAGGAGACATTTAC | ||
| ACTTACATTTGTGACTGGAAGAACTGTTGGAATAGGAGCTTATCTTGCTCH | ||
| 165 | 6 | VGAGCAAGATAAGCTCCTATTCCAACAGTTCTTCCAGTCACAAATGTAAGT |
| GTAAATGTCTCCTTATATGCCCTAGAATAAGCACTGGCAATGGTAGCACTT | ||
| CCATGTATATTCTCCACACCAAGTCCATCTTCCTTGCCCACAACAGAATCAA | ||
| TAACCCACCTAATTTCACCACTGTCTAGCTGCATCTTATGTGCTATGACH | ||
| 166 | 7 | VCTGACCTGAACTTGATCTCAATTAACCCTTGCGGTTCCAGAACATTGCCTT |
| TTGCAGTCCTCTCAGCATAGCACTCAATGCGGTCTGGGTTTATCTTGCTTCC | ||
| AACGACAACCCAAGCCCCTCCTCGTAGCTCTGCAGCCATGGGAATGTAGAC | ||
| AAAGGCAGGCTGATTGTATGTCCTAAGGTTCTCAACAATAGTCGAGCCH | ||
| 167 | 8 | VGGCTCGACTATTGTTGAGAACCTTAGGACATACAATCAGCCTGCCTTTGTC |
| TACATTCCCATGGCTGCAGAGCTACGAGGAGGGGCTTGGGTTGTGGTTGGT | ||
| AGCAAGATAAACCCAGACCGCATTGAGTGCTATGCTGAGAGGACTGCAAA | ||
| AGGCAATGTTCTGGAACCGCAAGGGTTAATTGAGATCAAGTTCAGGTCAGH | ||
| 168 | 9 | VCTGACCTGAACTTGATCTCAATTAACCCTTGCGGTTCCAGAACATTGCCTT |
| TTGCAGTCCTCTCAGCATAGCACTCAATGCGGTCTGGGTTTATCTTAAAATC | ||
| AACGACAACCCAAGCCCCTCCTCGTAGCTCTGCAGCCATGGGAATGTAGAC | ||
| AAAGGCAGGCTGATTGTATGTCCTAAGGTTCTCAACAATAGTCGAGCCH | ||
| 169 | 10 | VGGCTCGACTATTGTTGAGAACCTTAGGACATACAATCAGCCTGCCTTTGTC |
| TACATTCCCATGGCTGCAGAGCTACGAGGAGGCGCTTGGGTTGTGGTTGAT | ||
| AGCAAGATAAACCCAGACCGCATTGAGAGGTATGCTGAGAGGACTGCAAA | ||
| AGGCAATGTTCTGGAACCGCAAGGGTTAATTGAGATCAAGTTCAGGTCAGH | ||
| 170 | 11 | VGGCTCGACTATTGTTGAGAACCTTAGGACATACAATCAGCCTGCCTTTGTC |
| TACATTCCCATGGCTGCAGAGCTACGAGGAGGGGCTTGGGTTGTGGTTGAT | ||
| AGCGAAATAAACCCAGACCGCATTGAGTGCTATGCTGAGAGGACTGCAAA | ||
| AGGCAATGTTCTGGAACCGCAAGGGTTAATTGAGATCAAGTTCAGGTCAGH | ||
| 171 | 12 | VCTGACCTGAACTTGATCTCAATTAACCCTTGCGGTTCCAGAACATTGCCTT |
| TTGCAGTCCTCTCAGCATAGCACTCAATGCGGTCTGGGTTTATTTCGCTATC | ||
| AACCACAACCCAAGCGCCTCCTCGTAGCTCTGCAGCCATGGGAATGTAGAC | ||
| AAAGGCAGGCTGATTGTATGTCCTAAGGTTCTCAACAATAGTCGAGCCH | ||
| 172 | 13 | VGGCTCGACTATTGTTGAGAACCTTAGGACATACAATCAGCCTGCCTTTGTC |
| TACATTCCCATGGCTGCAGAGCTACGAGGAGGGGCTTGGGTTGTGGTTGAT | ||
| AGCAAGATAAACCCAGACCGCATTGAGCGTTATGCTGAGAGGACTGCAAA | ||
| AGGCAATGTTCTGGAACCGCAAGGGTTAATTGAGATCAAGTTCAGGTCAGH | ||
| 173 | 14 | VCTGACCTGAACTTGATCTCAATTAACCCTTGCGGTTCCAGAACATTGCCTT |
| TTGCAGTCCTCTCAGCATATTGCTCAATGCGGTCTGGGTTTATCTTGCTATC | ||
| AACGACAACCCAAGCCCCTCCTCGTAGCTCTGCAGCCATGGGAATGTAGAC | ||
| AAAGGCAGGCTGATTGTATGTCCTAAGGTTCTCAACAATAGTCGAGCCH | ||
Summary: Targeted LuEPSPS mutations have been identified in four week-old calli by PCR and DNA sequencing analyses.
The purpose of this experiment is to demonstrate conversion of the EPSPS genes in the Linum usitatissimum genome in shoot tip derived protoplasts by PEG mediated delivery of CRISPR-Cas plasmids and GRONs. The CRISPR-Cas and GRONs used in this experiment target the EPSPS genes in the flax genome. The CRISPR consists of two components: a Cas9, such as a plant codon-optimized Streptococcus pyogenes Cas9 (SpCas9) and sgRNA both of which are expressed from plasmid(s). Cas9 and sgRNA can also be delivered by mRNA/RNA or protein/RNA respectively. The sgRNA is a fusion of CRISPR RNA (crRNA) and trans-activating crRNA (tracrRNA). The crRNA guides the Cas9 to the targeted genes, where Cas9 creates a either a double-stranded break or nick in the EPSPS genes and the GRONs are used as a template to convert the EPSPS genes in a site-directed manner.
Targeted LuEPSPS (T97I and/or the P101A, P101T or P101S and/or the G96A) mutations have been identified in four week-old calli by PCR and DNA sequencing analyses. Shoots have been regenerated from these converted calli.
Flax protoplasts were isolated from shoot tips obtained from in vitro germinated seedlings. The CRISPR-Cas encoded plasmids contain the MAS promoter driving the Cas9 coding sequence with an rbcSE9 terminator and the Arabidopsis thaliana U6 promoter driving the sgRNA with a poly-T10 terminator. The CRISPR-Cas plasmids were introduced into protoplasts by PEG mediated delivery at a final concentration of 0.05 Îźg/Îźl. GRONs targeting each of the two flax LuEPSPS genes (Table 2) were used at a final concentration of 4.0 ÎźM. An exemplary range for CRISPR-Cas plasmids at a final concentration include, but is not limited to 0.01 to 0.2 Îźg/Îźl. An exemplary range for GRON at a final concentration include, but is not limited to 0.01 to 4 ÎźM. Protoplasts were embedded in alginate beads (5Ă105 cells/ml), cultured in liquid medium, and incubated in a rotatory shaker (30 rpm) in the dark at 25° C. An exemplary range for embedding protoplasts in alginate beads include, but is not limited to 3.0Ă105 to 7.5Ă105 cells/ml. Microcalli developed from individual cells were analyzed by Next Generation Sequencing, 3 and 7 weeks after CRISPR-Cas plasmid and GRON delivery, to determine the proportion of cells (DNA reads) carrying the targeted mutations in the LuEPSPS genes. Larger calli were grown from 8-week-old converted microcalli plated over solid regeneration medium, and shoots started differentiating from regenerated calli after about 4-8 weeks. Converted calli and shoots with the targeted EPSPS gene mutations were identified by PCR and DNA sequencing analyses.
The CRISPR consists of two components: the plant codon-optimized Streptococcus pyogenes Cas9 (SpCas9) and sgRNA both of which were expressed from plasmid(s). The sgRNA is a fusion of CRISPR RNA (crRNA) and trans-activating crRNA (tracrRNA). The crRNA region contains the spacer with sequences described in the table below, which were used to guide the Cas9 nuclease to the EPSPS targeted genes.
List of CRISPR-Cas gRNA spacer sequences used in this experiment. Spacer length may vary up to Âą20 bp. Mismatched within the spacer sequence can be tolerated up to 10 bp.
| LuEPSPS | ||
| SpacerâRNA | Genes |
| SEQâID | SampleâID | Sequenceâ(5â˛âtoâ3â˛) | 1 | 2 |
| 174 | 1 | CAGAAGCGCGCCAUUGUUGA | X | X |
| 175 | 2 | CGCGCCAUUGUUGAAGGUUG | X | |
| 176 | 3 | CGCGCCAUUGUUGAAGGUCG | X | |
| 177 | 4 | GCCAUUGUUGAAGGUUGUGG | X | |
| 178 | 5 | GCCAUUGUUGAAGGUCGUGG | X | |
| 179 | 6 | AGGUUGUGGUGGUGUGUUUC | X | |
| 180 | 7 | AGGUCGUGGUGGUGUGUUUC | X | |
| 181 | 8 | UGUGGUGGUGUGUUUCCGGU | X | |
| 182 | 9 | CGUGGUGGUGUGUUUCCGGU | X | |
| 183 | 10 | UGUGUUUCCGGUCGGUAAAC | X | X |
| 184 | 11 | UGUUUCCGGUCGGUAAACUG | X | |
| 185 | 12 | AACGAUAUUGAACUUUUCCU | X | |
| 186 | 13 | AACGAUAUCGAACUUUUCCU | X | |
| 187 | 14 | GAACUUUUCCUUGGAAAUGC | X | X |
| 188 | 15 | ACAGCUGCUGUAACAGCCGC | X | X |
| 189 | 16 | GCUGCUGUAACAGCCGCUGG | X | X |
| 190 | 17 | AACUCAAGCUACAUACUCGA | X | |
| 191 | 18 | AACUCAAGCUACAUACUCGA | X | |
| 192 | 19 | CGAAUGAGAGAGAGACCAAU | X | |
| 193 | 20 | CGAAUGAGAGAGAGACCGAU | X | |
| 194 | 21 | AGAGAGACCAAUUGGAGAUU | X | |
| 195 | 22 | CCAAUUGGAGAUUUGGUUGU | X | |
| 196 | 23 | CCGAUUGGAGAUUUAGUUGU | X | |
| 197 | 24 | CCAACAACCAAAUCUCCAAU | X | |
| 198 | 25 | CCAACAACUAAAUCUCCAAU | X | |
| 199 | 26 | AUUGGUCUCUCUCUCAUUCG | X | |
| 200 | 27 | AUCGGUCUCUCUCUCAUUCG | X | |
| 201 | 28 | GUAGCUUGAGUUGCCUCCAG | X | X |
| 202 | 29 | GCUGUUACAGCAGCUGUCAG | X | X |
| 203 | 30 | UAGCUGUUCCAGCAUUUCCA | X | X |
| 204 | 31 | UUCUUCGCCAGUUUACCGAC | X | |
| 205 | 32 | UUCUUCCCCAGUUUACCGAC | X | |
| 206 | 33 | ACCACCACAACCUUCAACAA | X | |
| 207 | 34 | ACCACCACGACCUUCAACAA | X | |
| 208 | 35 | GAGAAGCGCGCCAUUGUUGA | X | X |
| 209 | 36 | GGCGCCAUUGUUGAAGGUUG | X | |
| 210 | 37 | GGCGCCAUUGUUGAAGGUCG | X | |
| 211 | 38 | GGGUUGUGGUGGUGUGUUUC | X | |
| 212 | 39 | GGGUCGUGGUGGUGUGUUUC | X | |
| 213 | 40 | GGUGGUGGUGUGUUUCCGGU | X | |
| 214 | 41 | GGUGGUGGUGUGUUUCCGGU | X | |
| 215 | 42 | GGUGUUUCCGGUCGGUAAAC | X | X |
| 216 | 43 | GGUUUCCGGUCGGUAAACUG | X | |
| 217 | 44 | GACGAUAUUGAACUUUUCCU | X | |
| 218 | 45 | GACGAUAUCGAACUUUUCCU | X | |
| 219 | 46 | GCAGCUGCUGUAACAGCCGC | X | X |
| 220 | 47 | GACUCAAGCUACAUACUCGA | X | |
| 221 | 48 | GACUCAAGCUACAUACUCGA | X | |
| 222 | 49 | GGAAUGAGAGAGAGACCAAU | X | |
| 223 | 50 | GGAAUGAGAGAGAGACCGAU | X | |
| 224 | 51 | GGAGAGACCAAUUGGAGAUU | X | |
| 225 | 52 | GCAAUUGGAGAUUUGGUUGU | X | |
| 226 | 53 | GCGAUUGGAGAUUUAGUUGU | X | |
| 227 | 54 | GCAACAACCAAAUCUCCAAU | X | |
| 228 | 55 | GCAACAACUAAAUCUCCAAU | X | |
| 229 | 56 | GUUGGUCUCUCUCUCAUUCG | X | |
| 230 | 57 | GUCGGUCUCUCUCUCAUUCG | X | |
| 231 | 58 | GAGCUGUUCCAGCAUUUCCA | X | X |
| 232 | 59 | GUCUUCGCCAGUUUACCGAC | X | |
| 233 | 60 | GUCUUCCCCAGUUUACCGAC | X | |
| 234 | 61 | GCCACCACAACCUUCAACAA | X | |
| 235 | 62 | GCCACCACGACCUUCAACAA | X | |
A list of GRON sequences suitable for use in this experiment are provided in the table below (V=CY3; H=3â˛DMT dC CPG).
| SEQâID | ||
| 236 | 1 | VCGGTCGGTAAACTGGCGAAGAACGATATTGAACTTTTCCTTGG |
| AAATGCTGCTATAGCTATGCGTGCGCTGACAGCTGCTGTAACAG | ||
| CCGCTGGAGGCAACTCAAGGTCCCTTCCCTCAACTCCTTCCAGC | ||
| CTTTCAGCTTCTTH | ||
| 237 | 2 | VAAGAAGCTGAAAGGCTGGAAGGAGTTGAGGGAAGGGACCTTG |
| AGTTGCCTCCAGCGGCTGTTACAGCAGCTGTCAGCGGACGCATA | ||
| GCTGTGGCAGCATTTCCAAGGAAAAGTTCAATATCGTTCTTCGC | ||
| CAGTTTACCGACCGH | ||
| 238 | 3 | VCGGTCGGTAAACTGGCGAAGAACGATATTGAACTTTTCCTTGGAAAT |
| GCTGGAATAGCTATGCGTGCGCTGACAGCTGCTGTAACAGCCGCTGGA | ||
| GGCAACTCAAGGTCCCTTCCCTCAACTCCTTCCAGCCTTTCAGCTTCTTH | ||
| 239 | 4 | VAAGAAGCTGAAAGGCTGGAAGGAGTTGAGGGAAGGGACCTTG |
| AGTTGCCTCCAGCGGCTGTTACAGCAGCTGTCAGCGCACGCATA | ||
| GCTATTCCAGCATTTCCAAGGAAAAGTTCAATATCGTTCTTCGC | ||
| CAGTTTACCGACCGH | ||
| 240 | 5 | VCGGTCGGTAAACTGGCGAAGAACGATATTGAACTTTTCCTTGG |
| AAATGCTGGAATTGCTATGCGTTCTCTGACAGCTGCTGTAACAG | ||
| CCGCTGGAGGCAACTCAAGGTCCCTTCCCTCAACTCCTTCCAGC | ||
| CTTTCAGCTTCTTH | ||
| 241 | 6 | VAAGAAGCTGAAAGGCTGGAAGGAGTTGAGGGAAGGGACCTTG |
| AGTTGCCTCCAGCGGCTGTTACAGCAGCTGTCAGTGAACGCATA | ||
| GCAATTCCAGCATTTCCAAGGAAAAGTTCAATATCGTTCTTCGC | ||
| CAGTTTACCGACCGH | ||
| 242 | 7 | VCGGTCGGTAAACTGGCGAAGAACGATATTGAACTTTTCCTTGG |
| AAATGCTGGAATCGCTATGCGTACTCTGACAGCTGCTGTAACAG | ||
| CCGCTGGAGGCAACTCAAGGTCCCTTCCCTCAACTCCTTCCAGC | ||
| CTTTCAGCTTCTTH | ||
| 243 | 8 | VAAGAAGCTGAAAGGCTGGAAGGAGTTGAGGGAAGGGACCTTG |
| AGTTGCCTCCAGCGGCTGTTACAGCAGCTGTCAGTGTACGCATA | ||
| GCAATTCCAGCATTTCCAAGGAAAAGTTCAATATCGTTCTTCGC | ||
| CAGTTTACCGACCGH | ||
| 244 | 9 | VCGGTCGGTAAACTGGCGAAGAACGATATTGAACTTTTCCTTGG |
| AAATGCTGGAATTGCTATGCGTGCGCTGACAGCTGCTGTAACAG | ||
| CCGCTGGAGGCAACTCAAGGTCCCTTCCCTCAACTCCTTCCAGC | ||
| CTTTCAGCTTCTTH | ||
| 245 | 10 | VAAGAAGCTGAAAGGCTGGAAGGAGTTGAGGGAAGGAACCTTG |
| AGTTGCCTCCAGCGGCTGTTACAGCAGCTGTCAGCGCACGCATA | ||
| GCTATTCCAGCATTTCCAAGGAAAAGTTCGATATCGTTCTTCCC | ||
| CAGTTTACCGACCGH | ||
| 246 | 11 | VCGGTCGGTAAACTGGCGAAGAACGATATTGAACTTTTCCTTGG |
| AAATGCTGGAATAGCTATGCGTGCTCTGACAGCTGCTGTAACAG | ||
| CCGCTGGAGGCAACTCAAGGTCCCTTCCCTCAACTCCTTCCAGC | ||
| CTTTCAGCTTCTTH | ||
| 247 | 12 | VAAGAAGCTGAAAGGCTGGAAGGAGTTGAGGGAAGGGACCTTG |
| AGTTGCCTCCAGCGGCTGTTACAGCAGCTGTCAGCGCACGCATA | ||
| GCTGTTCCAGCATTTCCAAGGAAAAGTTCAATATCGTTCTTCGC | ||
| CAGTTTACCGACCGH | ||
| 248 | 13 | VCGGTCGGTAAACTGGGGAAGAACGATATCGAACTTTTCCTTGG |
| AAATGCTGCTATAGCTATGCGTGCGCTGACAGCTGCTGTAACAG | ||
| CCGCTGGAGGCAACTCAAGGTTCCTTCCCTCAACTCCTTCCAGC | ||
| CTTTCAGCTTCTTH | ||
| 249 | 14 | VAAGAAGCTGAAAGGCTGGAAGGAGTTGAGGGAAGGAACCTTG |
| AGTTGCCTCCAGCGGCTGTTACAGCAGCTGTCAGCGGACGCATA | ||
| GCTGTTGCAGCATTTCCAAGGAAAAGTTCGATATCGTTCTTCCC | ||
| CAGTTTACCGACCGH | ||
| 250 | 15 | VCGGTCGGTAAACTGGGGAAGAACGATATCGAACTTTTCCTTGG |
| AAATGCTGGAATAGCTATGCGTGCGCTGACAGCTGCTGTAACAG | ||
| CCGCTGGAGGCAACTCAAGGTTCCTTCCCTCAACTCCTTCCAGC | ||
| CTTTCAGCTTCTTH | ||
| 251 | 16 | VAAGAAGCTGAAAGGCTGGAAGGAGTTGAGGGAAGGAACCTTG |
| AGTTGCCTCCAGCGGCTGTTACAGCAGCTGTCAGCGCACGCATA | ||
| GCTATTCCAGCATTTCCAAGGAAAAGTTCGATATCGTTCTTCCC | ||
| CAGTTTACCGACCGH | ||
| 252 | 17 | VCGGTCGGTAAACTGGGGAAGAACGATATCGAACTTTTCCTTGG |
| AAATGCTGGAATTGCTATGCGTTCTCTGACAGCTGCTGTAACAG | ||
| CCGCTGGAGGCAACTCAAGGTTCCTTCCCTCAACTCCTTCCAGC | ||
| CTTTCAGCTTCTTH | ||
| 253 | 18 | VAAGAAGCTGAAAGGCTGGAAGGAGTTGAGGGAAGGAACCTTG |
| AGTTGCCTCCAGCGGCTGTTACAGCAGCTGTCAGTGAACGCATA | ||
| GCGATTCCAGCATTTCCAAGGAAAAGTTCGATATCGTTCTTCCC | ||
| CAGTTTACCGACCGH | ||
| 254 | 19 | VCGGTCGGTAAACTGGGGAAGAACGATATCGAACTTTTCCTTGG |
| AAATGCTGGAATCGCTATGCGTACTCTGACAGCTGCTGTAACAG | ||
| CCGCTGGAGGCAACTCAAGGTTCCTTCCCTCAACTCCTTCCAGC | ||
| CTTTCAGCTTCTTH | ||
| 255 | 20 | VAAGAAGCTGAAAGGCTGGAAGGAGTTGAGGGAAGGAACCTTG |
| AGTTGCCTCCAGCGGCTGTTACAGCAGCTGTCAGTGTACGCATA | ||
| GCTATTCCAGCATTTCCAAGGAAAAGTTCGATATCGTTCTTCCC | ||
| CAGTTTACCGACCGH | ||
| 256 | 21 | VCGGTCGGTAAACTGGGGAAGAACGATATCGAACTTTTCCTTGG |
| AAATGCTGGAATCGCTATGCGTGCGCTGACAGCTGCTGTAACAG | ||
| CCGCTGGAGGCAACTCAAGGTTCCTTCCCTCAACTCCTTCCAGC | ||
| CTTTCAGCTTCTTH | ||
| 257 | 22 | VAAGAAGCTGAAAGGCTGGAAGGAGTTGAGGGAAGGAACCTTG |
| AGTTGCCTCCAGCGGCTGTTACAGCAGCTGTCAGCGGACGCATA | ||
| GCTATTCCAGCATTTCCAAGGAAAAGTTCGATATCGTTCTTCCC | ||
| CAGTTTACCGACCGH | ||
| 258 | 23 | VCGGTCGGTAAACTGGGGAAGAACGATATCGAACTTTTCCTTGG |
| AAATGCTGGAATAGCTATGCGTGCTCTGACAGCTGCTGTAACAG | ||
| CCGCTGGAGGCAACTCAAGGTTCCTTCCCTCAACTCCTTCCAGC | ||
| CTTTCAGCTTCTTH | ||
| 259 | 24 | VAAGAAGCTGAAAGGCTGGAAGGAGTTGAGGGAAGGAACCTTG |
| AGTTGCCTCCAGCGGCTGTTACAGCAGCTGTCAGGGAACGCATA | ||
| GCTGTTCCAGCATTTCCAAGGAAAAGTTCGATATCGTTCTTCCC | ||
| CAGTTTACCGACCGH | ||
The following example demonstrates efficient and precise gene edits in Arabidopsis thaliana protoplasts with exogenously introduced GRON along with an engineered nuclease, crispr-cas9. This genome editing technology is also applied to agriculturally important crops such as Linum usitatissimum (flax) where, in protoplasts, precise edits in the EPSPS genes provide a glyphosate tolerance trait; and subsequently regenerated shoots exhibit those precise edits and the accompanying trait without the need for selection.
For construction of transient CRISPR-Cas9 expression plasmids, a higher plant codon-optimized SpCas9 gene containing a SV40 NLS at both the N- and C-terminal and a 3ĂFLAG tag on the N-terminal was synthesized as a series of GeneArtÂŽ Strings⢠(Life Technology, Carlsbad, CA), then cloned downstream of the mannopine synthase (MAS) promoter and upstream of the pea ribulose bisphosphate carboxylase (rbcsE9) terminator by Gibson's method23 (FIG. 27a). Next, a sgRNA cassette consisting of a chimeric gRNA, whose expression is driven by the Arabidopsis U6 promoter, was synthesized as GeneArtÂŽ Strings⢠then shuttled into the Cas9 containing construct using Gibson's method forming pBCRISPR. To specify the chimeric sgRNA for the respective target sequence, pairs of DNA oligonucleotides encoding the protospacers for BFP_sgRNA-1 and EPSPS_sgRNA-2 9 as shown in the following table were annealed to generate short double stranded fragments with 4-bp overhangs).
| ID | 5â˛-3Ⲡ| |
| Off-1F | GGAAGCAAACAGGTGACAGC | |
| Off-1R | CGTATTTAGCCTCATCCAATGC | |
| Off-2F | AAGGCTCCTCCAACTTCACC | |
| Off-2R | TTCTCTGACTCTGATGGAGACC | |
| Off-3F | CCCTTGGTGCAACATAAACC | |
| Off-3R | GCGATGAATTTGAATTTTGACC | |
| Off-4F | TTCGGGTTTAACGGGACAG | |
| Off-4R | CGATTCCGGTAATTCACATTG | |
| Off-5F | AAACCCTAGTGGCAGTTTCG | |
| Off-5R | CGGTGGAAGCCCTGTTTAT | |
| BFPF-1 | TAAACGGCCACAAGTTCAGC | |
| BFPR-1 | GGACGACGGCAACTACAAGACC | |
| LuEPF-1 | GCATAGCAGTGAGCAGAAGC | |
| LuEPR-1 | AGAAGCTGAAAGGCTGGAAG | |
| CR-LuEPSPS2a | GATTGCTGTTACAGCAGCTGTCAG | |
| CR-LuEPSPS2b | AAACCTGACAGCTGCTGTAACAGC | |
| CR-BFP1a | GATTGTCGTGACCACCTTCACCCA | |
| CR-BFP1b | AAACTGGGTGAAGGTGGTCACGAC | |
| (SEQ ID NOS: 260-277, respectively) |
Figure references for these sequences are as follows: Off-1F through BFPR-1âFIG. 27d; LuEPF-1 and LuEPR-1âFIG. 29d; CR-LuEPSPS2a and CR-LuEPSPS2bâFIG. 29a; CR-BFPa1 and CR-BFP1bâFIG. 27a.
The fragments were ligated into BbsI digested pBCrispr to yield CRISPR-Cas9 constructs sgRNA (BFP)-1 and sgRNA (EPSPS)-2. Protospacer sequences of sgRNA used are shown in the following table: (SEQ ID NOS: 283 and 284)
| FIG. | ||
| ID | Sequenceâ5â˛-3Ⲡ| reference |
| BFP_sgRNA-1 | GTCGTGACCACCTTCACCCA | FIG.â1 |
| EPSPS_sgRNA-2 | GCTGTTACAGCAGCTGTCAG | FIG.â3 |
| G in red font altered in the sgRNA sequence to accommodate Pol III promoter |
All GRONs were purchased from Trilink Biotechnologies (San Diego, CA). A list of GRONS used are in the following table (SEQ ID NOS: 285-289):
| ID | Target | Sequenceâ5â˛-3Ⲡ| Modificationa |
| BFP/41 | BFP | GCTGAAGCACTGCACGCCGTAGGTAAACGTGGTCACGAGGGTGGG | None |
| BFP/41/3PS | BFP | G*C*T*GAAGCACTGCACGCCGTAGGTAAACGTGGTCACGAGGGT*G*G*G | (*)â=âPS |
| BFP/101 | BFP | GTCGTGCTGCTTCATGTGGTCGGGGTAGCGGCTGAAGCACTGCACGCCGTACGTA | None |
| AACGTGGTCACGAGGGTGGGCCAGGGCACGGGCAGCTTGCCGGTGG | |||
| BFP/101/3PS | BFP | G*T*C*GTGCTGCTTCATGTGGTCGGGGTAGCGGCTGAAGCACTGCACGCCGTAC | (*)â=âPS |
| GTAAACGTGGTCACGAGGGTGGGCCAGGGCACGGGCAGCTTGCCGG*T*G*G | |||
| EPSPS/144/Cy3 | EPSPS | VGCCAGCCATTTGACCSCTTCTTGCTATARCTTGAAAAGGAACCTTTACGACCTTAT | Vâ=âCy3;âHâ=âidC |
| CGATACGCACGCGACTGTCGACGACATTGTCGGCGACCTCCGTTGAGTTCCARGG | |||
| AAGGGAGTTGAGGAAGGTCGCAAAGTCGAAGAAH | |||
| aPS-phosphorothioate bond; idC-reverse base; Cy3-cyanine dye |
Figure references for these sequences are as follows: BFP/41: FIGS. 27e, 28a, 28b; BFP/41/3PS: FIG. 28b; BFP/101: FIG. 28b; BFP/101/3PF: FIG. 28b; EPSPS/144/Cy3: FIG. 29.
Surface-sterilized Arabidopsis seeds were germinated on solid ½ MS medium (MS minerals and vitamins 24; concentrated; 87.7 mM sucrose) at 25° C. under a 12 h light/dark cycle. Roots from 2 to 3-week-old seedlings were collected and maintained in ½ MS liquid medium under low light at 25° C. Cultures were transferred to and maintained in MSAR1.125 (½ĂMS salts with vitamins, Sucrose 87.7 mM, IAA, 11.4 ÎźM, 2,4-D 4.6 ÎźM) three weeks prior to protoplast isolation to induce root-meristematic-tissue (RMT). RMT was cut into small segments and incubated in MSAR1.2 enzyme solution (MSAR1.1 containing 400 mM mannitol, 1.25% Cellulase RS, 0.25% Macerozyme R-10, 5 mM MES, 0.1% BSA) for 16 h in the dark with gentle shaking. The released protoplasts were collected and passed consecutively through a sterile 100 Îźm and 35 Îźm filter. The protoplast filtrate was added to 0.8 times the volume of Optiprep⢠Density Gradient Medium (Sigma) and mixed gently. A 60% W5 (154 mM NaCl, 5 mM KCl, 125 mM CaCl2¡2H2O, 5 mM glucose, 10 mM MES, pH 5.8)/40% Optiprep solution followed by a 90% W5/10% Optiprep solution was slowly layered onto the filtrate/Optiprep solution to make a gradient, which was centrifuged at 198 RCF for 10 min. The white protoplast layer was collected and mixed with 2 times the volume of W5. Protoplasts were centrifuged at 44 RCF for 10 min and re-suspended in TM solution (14.8 mM MgCl2¡6H2O, 5 mM MES, 572 mM mannitol, pH 5.8) at a density of 1Ă107 cells/ml.
L. usitatissimum
Flax protoplasts were isolated from 3-week-old seedlings germinated in vitro. Plant tissue was finely chopped with a scalpel, pre-plasmolyzed for 1 h at room temperature in B-medium [B5 salts and vitamins26, 4 mM CaCl2), 0.1 M glucose, 0.3 M mannitol, 0.1 M glycine, 250 mg/l casein hydrolysate, 10 mg/l L-cystein-HCL, 0.5% polyvinylpyrrolidone (MW 10,000), 0.1% BSA, 1 mg/l BAP, 0.2 mg/l NAA, and 0.5 mg/l 2,4-D], and incubated in a cell wall digesting enzyme solution containing B-medium supplemented with 0.66% Cellulase YC and 0.16% Macerozyme R-10 on a rotatory shaker (50 rpm) at 25° C. for 5 h. Released protoplasts were sieved and purified by density gradient centrifugation using Optiprep layers, counted with a hemocytometer, and kept stationary overnight in the dark at a density of 0.5Ă106 protoplasts/ml in B medium.
In a 96-well flat bottom plate, 2.5Ă105 Arabidopsis protoplasts per well were transfected with either 2.5 pmol GRON alone, 2.5 pmol GRON plus 5 Îźg CRISPR-Cas9 plasmid (BFP_sgRNA-1), or mock-treated using PEG mediated delivery [270 mM mannitol, 67.5 mM Ca(NO3)2, 38.4% PEG 1500]. Transfection occurred on ice for 10 minutes followed by a wash with 200 Îźl of W5 solution. Finally, 85 Îźl of MSAP (MSAR1.1 containing 0.4 M mannitol) was added and the cells cultured in low light conditions at 25° C.
L. usitatissimum
After 18 h of culture, 1Ă106 flax protoplasts were transfected with 200 pmol of GRON along with 20 Îźg of CRISPR-Cas9 plasmid (EPSPS_sgRNA-2) using PEG mediated delivery. Treated protoplasts were incubated in the dark at 25° C. for up to 24 h in B medium, embedded in alginate beads27 at a density of 0.5Ă106 protoplasts/ml alginate, and cultured in basal V-KM liquid medium28 supplemented with 0.02 mg/l thidiazuron (TDZ) and 0.002 mg/l NAA. EPSPS gene targeted sequence edits were assessed by NGS in gDNA extracted from pools of approximately 10,000 microcolonies obtained from protoplasts 3 and 7 weeks after transfection. Microcalli were then released from the alginate in 50 mM citrate buffer for 30 min, rinsed twice with V-KM medium, and plated on solidified regeneration medium [MS salts25, Morel and Wetmore vitamins29 [0.001 mg/l biotin, 0.01 mg/l nicotinic acid, 1 mg/l calcium pantothenate, 1 mg/l pyridoxine, 1 mg/l thiamine, 100 mg/l inositol), 3% sucrose, 0.02 mg/l thidiazuron (TDZ), 0.002 mg/l NAA, pH 5.8] at a density of 0.5 ml of settled cell volume/plate. Plated microcalli were incubated under a 16 h photoperiod (270 mol¡mâ2¡sâ1), at 25° C. After about 3 weeks, small individual calli (Ë0.5 cm diameter) were split in two. One half was used for molecular screening, and the other half was kept in a 24-well plate, one callus per well, under the same conditions as for shoot regeneration. Shoots began to develop from calli after about 6 weeks. Elongated shoots were micropropagated and rooted in MS medium (4.33 g/L MS salts mixture, 3% sucrose and 0.1% Morel and Wetmore vitamins, 0.3% Phytagel), and rooted plants were transferred to soil and hardened in a growth chamber (Conviron, Winnipeg, MB) for 2-4 weeks until the plants were well established.
Seventy-two hours after transfection, Arabidopsis protoplasts were analyzed by cytometry using the AttuneÂŽ Acoustic Focusing cytometer (Applied BiosystemsÂŽ) with excitation and detection of emission settings as appropriate for GFP. Background level was based on PEG-treated protoplasts without DNA delivery.
Genomic DNA was extracted from treated protoplasts using the NucleoSpinÂŽ Plant II kit as per the manufacturer's recommendations (Machery-Nagel, Bethlehem, PA). Amplicons were generated with primers flanking the BFP_sgRNA-1 target region (BFPF-1 and BFPR-1) using PhusionÂŽ polymerase and 100 ng of genomic DNA. The amplicons were purified and concentrated using Qiaquick MinElute columns (Qiagen, Valencia, CA), then deep sequenced using a 2Ă250 bp MiSeq run (Illumina, San Diego, CA). For data analysis, fastq files for read 1 and read 2 were imported into CLC Genomics Workbench 7.0.4 (CLCBio, Boston, MA). Paired reads were merged into a single sequence if their sequences overlapped. A sequence for an amplicon was identified if it or its reverse and complemented sequence contained both forward and reverse primer sequences. Occurrence of a unique sequence in a sample was recorded as its abundance. Percent indel or targeted edit was calculated by dividing the number of sequences with the edit or indel by the total number of sequences, and then multiplying by 100.
For flax samples, genomic DNA from microcolony or callus samples was extracted using the EvoPURE plant DNA kit (Aline Biosciences, Woburn, MA) and screened by deep sequencing and allele-specific qPCR. Positive scoring PCR fragments were then TOPO-TA cloned into the pCR2.1 vector (Invitrogen) per the manufacturer's protocol. Typically, cloned PCR fragments from 10-15 transformants were then TempliPhi sequenced (GE Healthcare Life Sciences) to confirm DNA sequence for each EPSPS allele from a single isolated callus. A similar PCR cloning and sequencing procedure was used for DNA sequence confirmation in leaf samples of regenerated shoots.
Potential off-target loci for BFP_sgRNA-1 in the Arabidopsis genome were determined using Cas-OFFinder. Five off-target sites based on sequence identities to bases 1-12 of the protospacer (seed sequence) were screened for mutations. Arabidopsis protoplasts were transfected with CRISPR-Cas9 plasmid BFP_sgRNA-1 as described previously. After 72 h, gDNA was extracted and amplicons generated with Phusion polymerase (NEB) using primers that flank the potential off-target site (FIG. 27d). The amplicons were then deep sequenced using a 2Ă250 bp MiSeq run. The percentage of indels was calculated by dividing the number of sequences with the edit or indel by the total number of sequences, and then multiplying by 100.
Molecular Screening of L. usitatissimum Plant Material
Genomic DNA from microcolony or microcallus samples was extracted using the EvoPURE plant DNA kit (Aline Biosciences, Woburn, MA) and screened using allele-specific qPCR. Positively scoring PCR fragments were then TOPO-TA cloned into the pCR2.1 vector (Invitrogen) per the manufacturer's protocol. Typically, cloned PCR fragments from 10-15 transformants were then TempliPhi sequenced (GE Healthcare Life Sciences) to confirm DNA sequence for each EPSPS allele from a single isolated callus. A similar PCR cloning and sequencing procedure was used for DNA sequence confirmation of obtained shoots.
Glyphosate tolerance of calli and regenerated plants was assessed in vitro and in the greenhouse, respectively. Individual calli were cloned by cutting and culturing smaller pieces in fresh regeneration medium to increase callus mass. Calli derived from wild type leaf protoplasts were used as negative control. Calli derived from subcultures of individual callus lines were then pooled and broken up into 0.5-1 mm pieces by blending in liquid MS medium (4.33 g/L MS salts, 3% sucrose and 0.1% Morel and Wetmore vitamins) and 0.25 ml of settled callus pieces was inoculated on regeneration medium containing 0, 0.125, 0.25, 0.5, 1.0 or 2.0 mM glyphosate. Treatments were performed in triplicate, and the experiments were repeated three times. Prior to spray tests, regenerated plants were subjected to a hardening period in a growth chamber (Conviron, Winnipeg, MB) under a 16-h photoperiod with day and night temperatures 21° C. and 18° C. respectively. Hardened plants were transferred to the greenhouse for glyphosate treatment. Wild type control and EPSPS edited plants were sprayed with 10.5 mM or 21.0 mM glyphosate (Roundup Pro, Monsanto). Treatment rates were normalized to a 75.7 ai/A (active ingredient per acre) spray volume to replicate field conditions. A mock treatment of surfactant only was included as a control. Plants were evaluated and photographed 6 days after the glyphosate treatment to determine herbicide tolerance. Statistical analysis
Statistical significance was determined using a Student's t-test with two-tailed distribution. P-values <0.05 were considered as significant. Data are shown as meanÂąSEM.
In order to enhance GRON-mediated gene editing, the CRISPR-Cas9 system was used in this example. While exemplified in terms of the CRISPR-Cas9 system, engineered nucleases can be programmed to target and cleave double-stranded DNA, and so would be expected to function equivalently in enhancing GRON-mediated editing. This would include nucleases such as meganucleases, zinc finger nuclease (ZFN), and TAL effector nucleases (TALENs). In plants, DNA double-strand breaks (DSBs) are typically repaired by the error-prone non-homologous end joining (NHEJ) DNA repair pathway, resulting in random deletions, insertions (indels) and/or substitutions at the site of repair. Precision genome editing relies on nuclease induced DSBs near the targeted locus to be repaired by homology directed repair (HDR), a repair pathway that is more precise than NHEJ due to the requirement of a homologous DNA templateâin most cases sister chromatid. By harnessing the HDR pathway, it is possible to use GRONs in conjunction with engineered nucleases, to make scarless, precise custom edits to targeted DNA.
The CRISPR-Cas9 system consists of two components: a Streptococcus pyogenes Cas9 nuclease (SpCas9) and a chimeric fusion of two RNAs (crRNA and tracrRNA) referred to as an engineered single guide RNA (sgRNA). The sgRNA supports targeted nucleic acid specificity for Cas9 through base pairing of its first twenty 5Ⲡbases with the DNA target, subsequently resulting in a site-specific DSB.
The efficacy of the CRISPR-Cas9 editing system in A. thaliana protoplasts derived from a BFP transgenic model was used to demonstrate the efficacy of this system. In this model, aa stably integrated BFP gene can be converted to GFP by editing the codon encoding H66 (CAC) to Y66 (TAC) (FIG. 27a, b). Activity of CRISPR-Cas9 plasmid, BFP_sgRNA-1 targeting the BFP H66 locus was demonstrated by identifying indel scars left by NHEJ repair events. When protoplasts were treated with BFP_sgRNA-1, indels were detected at a frequency of 14.5% by deep sequencing, indicating a high efficiency of targeting (FIG. 27c). Notably, deletions outnumbered insertions with the majority of indels for either type being a single base pair (FIG. 27c). In protoplasts treated with Cas9 alone or mock-treated, indels were not detected neighboring the H66 target site (data not shown).
Having established activity of BFP_sgRNA-1 in protoplasts from this model system, potential off-target activity of BFP_sgRNA-1 was examined by searching the Arabidopsis genome using Cas-OFFinder for candidate off-target sequences with high similarity to the BFP_sgRNA-1 target sequence17. Using deep sequencing, five sites that, based on searches, contained the most homology to the BFP_sgRNA-1 target sequence were examined18, 19. Of the five sites tested, indel events were detected at a very low frequency for only one locus, Off-1 (FIG. 27d). While detectable, this level was 24-fold weaker when compared to the On-target control. It uis suspected that the activity observed at the Off-1 locus is based on homology of the sequence proximal to the PAM site where only one mismatch is present.
Next the effectiveness of GRON in combination with BFP_sgRNA-1 to facilitate BFP to GFP precision gene editing was examined in the model system. A marked improvement in BFP to GFP editing, as analyzed by flow cytometry, was identified after both GRON and BFP_sgRNA-1 (BFP/41) are introduced concurrently when compared to GRON alone treatments (FIG. 27e). Collectively, these results demonstrate that CRISPR-Cas9 plasmid BFP sgRNA-1 can actively disrupt the H66 locus of the BFP gene, and leave negligible off-target footprints. Further, when GRON is introduced with BFP_sgRNA-1, the frequency of precise and scarless BFP to GFP edits increases significantly.
When a GRON containing three adjacent PS modifications (BFP/41/3PS) combined with BFP_sgRNA-1 was used, more BFP to GFP precise scarless edits were identified as compared to an unmodified GRON (BFP/41; FIG. 28a). A similar result was found when testing a second GRON modification containing a 5Ⲡcyanine dye Cy3 and a 3ⲠiDc reverse base (data not shown). GRON lengths of 41 and 101 nucleobases (nb) with and without 3PS modification were also tested in conjunction with BFP_sgRNA-1. In multiple experiments, the 101 nb GRON consistently exhibited increased editing efficiency that was independent of 3PS modification when compared to the shorter 41 nb GRON (FIG. 28b). Notably, for both GRON lengths tested, 3PS modification was superior to unmodified with respect to BFP to GFP editing. 201 nb length GRONs exhibit similar editing efficiencies to 101-nb GRONs (data not shown). Collectively, these data demonstrate that 3PS modification as well as GRON length can greatly improve the frequency of gene editing in A. thaliana protoplasts when combined with the engineered nuclease, CRISPR-Cas9.
To extend the application of GRON and engineered nuclease mediated gene editing to other plant systems, two EPSPS (5â˛-enolpyruvylshikimate-3-phosphate synthase) loci in L. usitatissimum were also targeted. The EPSPS genes encode an enzyme in the shikimate pathway that participates in the biosynthesis of the aromatic amino acids phenylalanine, tyrosine and tryptophan. In plants, EPSPS is a target for the herbicide, glyphosate, where it acts as a competitive inhibitor of the binding site for phosphoenolpyruvate.
In an effort to improve targeting efficiency, a 144 nb Cy3 modified GRON (EPSPS/144/Cy3) and a CRISPR-Cas9 plasmid (EPSPS_sgRNA-2) was designed to target a conserved sequence in both EPSPS genes near two loci (T97I and P101A) that, when edited, will render the EPSPS enzyme tolerant to glyphosate (FIG. 29). The 144 nb Cy3 modified GRON containing the targeted changes together with EPSPS_sgRNA-2 was delivered into protoplasts, followed by measurement of gene editing and indel formation in 21-day-old microcolonies derived from the treated protoplasts by deep sequencing. Precise, scarless gene editing frequencies ranged between 0.09 and 0.19%, and indels ranged between 19.2 and 19.8% in three independent experiments (Table 1). In all experiments, both EPSPS genes showed a proportional number of edits and indels (data not shown), suggesting that GRON and EPSPS_sgRNA-2 are effective at editing both genes.
| TABLE 1 |
| Summary of L. usitatissimum CRISPR-cas9 experiments targeting EPSPS |
| Deep sequencing of | ||
| microcoloniesa | Calli genotyping resultsc |
| Experiment | Precise | Calli | Calli with | |
| ID | edits (%)b | Indels (%) | screened | precise edits |
| FC-1 | 0.19 | 19.8 | 5,167 | 8 (0.15%) |
| FC-2 | 0.1 | 19.2 | N/A | |
| FC-3 | 0.09 | 19.6 | N/A | |
| agDNA was isolated from pools of ~10,000 microcolonies, then used as template to amplify the target region | ||||
| bSequences with T97I (ACA > ATA) and P101A (CCG > GCG) changes only; data combined for gene 1 & gene 2 | ||||
| cIndividual callus was screened first by allele-specific PCR, then confirmed by Sanger sequencing |
Out of 5167 calli, 8 (0.15%) were found to harbor both T97I and P101A changes in at least one of the EPSPS genes (Table 1). This result, as well as the frequency of indels, correlated well with the initial deep sequencing data obtained from 21-day-old microcolonies. Shoots were regenerated under non-selective conditions from the positive callus material and successively confirmed the presence of the T97I and P101A edits through DNA cloning and Sanger sequencing (FIG. 29c). These data show that precise, targeted edits in the two endogenous EPSPS genes as well as indel scars can be generated in L. usitatissimum protoplasts and subsequently can be identified and maintained non-selectively in the process of shoot regeneration.
Calli that screened positive for precise edits were used to regenerate whole plants under non-selective conditions 100% of which screened positive for the presence of the T97I and P101A edits in at least one EPSPS gene through DNA cloning and Sanger sequencing (FIG. 29b-6). To identify potential off-target mutations arising from treatment with by EPSPS_gRNA-2 in regenerated plants (Y23), we PCR amplified regions containing sequence similarity to the EPSPS_sgRNA-2 protospacer and measured for NHEJ scars by deep sequencing. No mutations were identified in any of these potential off-target sites (SEQ ID NOS: 290-298):
| Off-Target | #âof | Mutations | |||
| ID | ScaffoldâorâLocusâIDa | Positionb | OffâTargetâSequencec | Mismatches | detectedd |
| Off-1 | C7813595 | 197-219 | ccgGTTACAGCAGCaGTCgGCGG | 5 | â |
| Off-2 | Lus10030959.g | 243476-243460 | ccgGTTACAGCAGCaGTCgGCGG | 5 | â |
| Off-3 | Scaffoldâ155 | 681644-681624 | tcaaaagCtGCAGCTaTCAGTGG | 9 | â |
| Off-4 | Lus10036882.g | 1067934-1067911 | tcaaaatCtGCAGCTGTCAGTGG | 8 | â |
| Off-5 | Scaffoldâ107 | 1077588-1077568 | tcaaaatCtGCgGCTGTCAGTGG | 9 | â |
| Off-6 | Scaffoldâ743 | 195079-195059 | tcaaaatCtGCgGCTGTCAGTGG | 9 | â |
| Off-7 | Scaffoldâ208 | 238604-238626 | aaggacACAGCAGCTGTCgGTGG | 7 | â |
| Off-8 | Scaffoldâ2252 | 38795-38773 | accaaacgAGCAGCTGTCAGAGG | 8 | â |
| On | Lus10000788.g | 19227-19249 | GCTGTTACAGCAGCTGTCAGCGG | 0 | + |
| aScaffold or locus ID from Phytozyme 10.2 | |||||
| bProtospacer position within scaffold | |||||
| cRed lowercase bases are mismatches to the EPSPS_sgRNA protospacer | |||||
| dMutations determined by sequencing, On-target mutations are T97I and P101A |
To determine the glyphosate tolerance afforded by the T97I and P101A mutations, we challenged callus line (Y23) that was identified as being heterozygous for the T97I and P101A edits in EPSPS gene 2, as well as whole plants regenerated from these calli with glyphosate. The fresh weight of calli harboring the T97I and P101A edits was significantly higher (p<0.01) than that of wild type calli at all glyphosate concentrations tested (FIG. 30 a, b). Wild type and edited whole plants were grown in soil under greenhouse conditions, sprayed with a solution containing either 10.5 or 21.0 mM glyphosate and evaluated 6 days after treatment. Wild type plants exhibited a wilted and necrotic phenotype typical of glyphosate toxicity at both application rates, whereas plants harboring the edited EPSPS gene exhibited minimal phenotypic change (FIG. 30c). This result implies that a single edited EPSPS gene provides a level of tolerance much greater than that observed in the control plants at two rates of glyphosate. Taken together, these data demonstrate that RTDS combined with CRISPR-Cas9 can result in precise, targeted edits at sufficient frequency such that these edits as well as indel scars can be detected by molecular screening and maintained under non-selective culture conditions and efficiently regenerated into plants.
Subsequent to this analysis, Oryza sativa calli with precise edits in a gene imparting herbicide resistance have also been obtained using GRON in combination with CRISPR-Cas9. Further, reproducible edits in a BFP to GFP transgene using GRON combined with TALENs in A. thaliana and GRON combined with CRISPR-Cas9 in Brassica napus have been obtained.
23, 1233-6 (2013).
Design and construction of TALEN expression constructs BT-1 and LuET-1 was based on rules as described in Cermek et al. (2011). The target sequence was selected based on the gene editing site and the repeat variable i-residue (RVD) following the rules that NG, HD, NI, and NN recognize T, C, A, and G, respectively. The assembly of TAL effector domain linked to the heterodimeric FokI domains was completed through a commercial service (GeneArt; Life Technologies). TALEN monomers were cloned between the MAS promoter and the rbcE9 terminator using Gibson's method (Gibson et al., 2009) and expressed as a coupled unit (FIGS. 33a and 36a). All GRONs were purchased from Trilink BioTechnologies (San Diego, CA).
GRONs used in this study (SEQ ID NOS: 299-304):
| Name | Sequence(5â˛âtoâ3â˛) | Chemistry |
| BFP/41 | G*C*T*GAAGCACTGCACGCCGTAGGTGAAGGTGGTCACGA*G*G*G | (*)â=â3PS |
| BFP/41/NT | G*C*T*GAAGCACTGCACGCCGTGGGTGAAGGTGGTCACGA*G*G*G | (*)â=â3PS |
| BFP/101 | G*T*C*GTGCTGCTTCATGTGGTCGGGGTAGCGGCTGAAGCACTGCACGCCGTAGGTGAAGGTGGTCACGAGGGTGGGCCA | (*)â=â3PS |
| GGGCACGGGCAGCTTGCCGG*T*G*G | ||
| BFP/201 | A*A*G*ATGGTGCGCTCCTGGACGTAGCCTTCGGGCATGGCGGACTTGAAGAAGTCGTGCTGCTTCATGTGGTCGGGGTAGC | (*)â=â3PS |
| GGCTGAAGCACTGCACGCCGTAGGTGAAGGTGGTCACGAGGGTGGGCCAGGGCACGGGCAGCTTGCCGGTGGTGCAGATG | ||
| AACTTCAGGGTCAGCTTGCCGTAGGTGGCATCGCCCTCG*C*C | ||
| EPSPS/144* | VCGGTCGGTAAACTGGCGAAGAACGATATTGAACTTTTCCTTGGAAATGCTGGAATAGCTATGCGTGCGCTGACAGCTGCTG | Vâ=âCY3; |
| TAACAGCCGCTGGAGGCAACTCAAGGTCCCTTCCCTCAACTCCTTCCAGCCTTTCAGCTTCTTH | Mâ=â3â˛DMT | |
| and | dCâCPG | |
| VCGGTCGGTAAACTGGCGAAGAACGATATTGAACTTTTCCTTGGAAATGCTGGAATAGCTATGCGTGCGCTGACAGCTGCTG | ||
| TAACAGCCGCTGGAGGCAACTCAAGGTTCCTTCCCTCAACTCCTTCCAGCCTTTCAGCTTCTTH | ||
| *EPSPS/144 consists of an equimolar mixture of two oligos, each containing sequences specific for SNPs for EPSPS gene 1 and 2. Both contain the T97I and P101A edits. |
Figure references for these sequences are as follows: BFP/41: FIGS. 31b, 32a, 35b; BFP/41/NT: FIG. 32a; BFP/101: FIGS. 31b, 35b; BFP/201: FIGS. 31b, 35b; EPSPS/144: FIG. 36b.
TALE binding doiman sequence (SEQ ID NOS: 305-308):
| TALENâID | Sequenceâ(5â˛âtoâ3â˛) | |
| BT-1 | Leftâarm:âTGGTCGGGGTAGCGGCTGA | |
| Rightâarm:âTCGTGACCACCTTCACCCA | ||
| LuET-1 | Leftâarm:âTGGAACAGCTATGCGTCCG | |
| Rightâarm:âTGAGTTGCCTCCAGCGGCT | ||
Figure references for these sequences are as follows: BT-1: FIGS. 33 a and b; LuET-1: FIGS. 36 a and b.
Primers used in this study (SEQ ID NOS: 309-312):
| ID | Sequenceâ5â˛-3Ⲡ| |
| BFPF-1 | TAAACGGCCACAAGTTCAGC | |
| BFPR-1 | GGACGACGGCAACTACAAGACC | |
| LuEPF-1 | GCATAGCAGTGAGCAGAAGC | |
| LuEPR-1 | AGAAGCTGAAAGGCTGGAAG | |
Figure references for these sequences are as follows: BFPF-1: FIGS. 33 d and e, 34a and b; BFPR-1: Figs. FIGS. 33 d and e, 34a and b; LuEPF-1: FIGS. 37a, b, c, and d, 38a; LuEPR-1: FIGS. 37a, b, c, and d, 38b.
Arabidopsis: Surface-sterilized Arabidopsis seeds were germinated on solid ½ MS medium (MS medium containing half the concentration of minerals and vitamins; 87.7 mM sucrose; Murashige and Skoog, 1962) at 25° C. under a 12 h light/dark cycle. Roots from 2 to 3-week-old seedlings were collected and maintained in ½ MS liquid medium in the dark at 25° C. Cultures were transferred to and maintained in MSAR1.1 (MSAR with 11.4 ÎźM IAA, 4.6 ÎźM 2,4-D; Mathur and Koncz, 1995) three weeks prior to protoplast isolation to induce root-meristematic-tissue (RMT). RMT was cut into small segments and incubated in MSAR1.2 enzyme solution (MSAR1.1 containing 0.4 M mannitol, 1.25% cellulase RS, 0.25% macerozyme R-10, 5 mM MES, 0.1% BSA) for 16 h in the dark with gentle shaking. The released protoplasts were collected and passed consecutively through a sterile 100 Îźm and 35 Îźm filter. The protoplast filtrate was purified by density centrifugation. The protoplast layer was collected and mixed with 2 times the volume of W5 (154 mM NaCl, 5 mM KCl, 125 mM CaCl2¡2H2O, 5 mM glucose, 10 mM MES, pH 5.8; Menczel et al., 1981). Protoplasts were centrifuged at 44 RCF for 10 min and re-suspended in TM solution (14.8 mM MgCl2¡6H2O, 5 mM MES, 572 mM mannitol, pH 5.8) at a density of 1Ă106 cells/ml. For experiments with phleomycin (InvivoGen, San Diego, CA), protoplasts were kept in TM adjusted to pH 7.0 for 90 min on ice before transfection. For antibiotic concentrations see FIG. 31a.
In a 96-well flat bottom plate, 2.5Ă105 Arabidopsis protoplasts per well were transfected using PEG mediated delivery [270 mM mannitol, 67.5 mM Ca(NO3)2, 38.4% PEG 1500] with either 1.2 nmol GRON alone, 93 pmol GRON plus 7.5 Îźg BFP TALEN plasmid (BT-1), or without DNA. Transfection occurred on ice for 10 minutes followed by a wash with 200 Îźl of W5 solution. Finally, 85 Îźl of MSAP (MSAR1.1 containing 0.4 M mannitol) was added and the cells cultured in dark conditions at 25° C.
L. usitatissimum: Flax protoplasts were isolated from 3-week-old seedlings germinated in vitro. Plant tissue was chopped with a scalpel, pre-plasmolyzed for 1 h at room temperature in B-medium [B5 salts and vitamins, 4 mM CaCl2, 0.1 M glucose, 0.3 M mannitol, 0.1 M glycine, 250 mg/l casein hydrolysate, 10 mg/l L-cysteine-HCl, 0.5% polyvinylpyrrolidone (MW 10,000), 0.1% BSA, 1 mg/l BAP, 0.2 mg/l NAA, and 0.5 mg/l 2,4-D; Gamborg et al., 1968], and incubated in a cell wall digesting enzyme solution containing B-medium supplemented with 0.66% cellulase YC and 0.16% macerozyme R-10 on a rotatory shaker (50 rpm) at 25° C. for 5 h. Released protoplasts were sieved and purified by density gradient centrifugation and kept stationary overnight in the dark at a density of 0.5Ă106 protoplasts/ml in B medium.
After 18 h of culture, 1Ă106 flax protoplasts were transfected with 200 pmol of GRON along with 20 Îźg of EPSPS TALEN plasmid (LuET-1) using PEG-mediated delivery. Treated protoplasts were incubated in the dark at 25° C. for up to 24 h in B medium, embedded in alginate beads (Roger et al., 1996) at a density of 0.5Ă106 protoplasts/ml alginate, and cultured in basal V-KM liquid medium (Binding and Nehls, 1977) supplemented with 0.02 mg/l thidiazuron (TDZ), and 0.002 mg/l NAA. EPSPS gene targeted sequence edits were assessed by NGS in gDNA extracted from approximately 50,000 cells one week after transfection.
Detection of Arabidopsis BFP to GFP edits: Seventy-two hours after transfection, Arabidopsis protoplasts were analyzed by cytometry using the AttuneÂŽ Acoustic Focusing cytometer (Life Technologies, Carlsbad, CA) with excitation and detection of emission settings as appropriate for GFP. Background level was based on PEG-treated protoplasts without DNA delivery. For antibiotic experiments, protoplasts treated with phleomycin prior to transfection were analyzed by cytometry 24 h after transfection.
Indel analysis: Genomic DNA was extracted from either Arabidopsis or flax treated protoplasts using the NucleoSpinÂŽ Plant II kit as per the manufacturer's recommendations (Machery-Nagel, Bethlehem, PA). Amplicons were generated with primers flanking the BT-1 or LuET-1 TALEN target region (FIG. 38) using PhusionÂŽ polymerase and 100 ng of genomic DNA. The amplicons were purified and concentrated using Qiaquick MinElute columns (Qiagen, Valencia, CA), then deep sequenced using a 2Ă250 bp MiSeq run (Illumina, San Diego, CA). For data analysis FASTQ files for read 1 and read 2 were imported into CLC Genomics Workbench 7.0.4 (CLCBio, Boston, MA). Paired reads were merged into a single sequence if their sequences overlapped. A sequence for an amplicon was identified if it or its reverse and complemented sequence contained both forward and reverse primer sequences. Occurrence of a unique sequence in a sample was recorded as its abundance. Percent indel or targeted edit was calculated by dividing the number of sequences with the edit or indel by the total number of sequences, and then multiplying by 100.
Statistical significance was determined using a Student's t-test with two-tailed distribution. P-values <0.05 were considered as significant. Data are shown as mean and SEM.
Rapid Trait Development System (RTDSâ˘) is an advanced Oligo-Directed Mutagenesis (ODM) technology that uses the natural or inherent DNA repair system to enable editing of genes in a target specific manner. In eukaryotic cells, the GRON enters the cell by crossing the cell membrane and subsequently traverses to the nucleus, where it locates and binds selectively and specifically to the target sequence, resulting in sequence specific change(s) in the target gene. Nucleases and other degrading enzymes in the cells break down the GRON after the target gene has been edited (FIG. 31a). To demonstrate the effectiveness of RTDS in Arabidopsis, protoplasts derived from BFP transgenic lines (in which a stably integrated BFP gene can be converted to GFP by editing the codon encoding H66 (CAC) to Y66 (TAC) (FIG. 31b)) were used. Using this system, gene editing may be determined based on a cells' green fluorescence by flow cytometry. Protoplasts from this line were treated for 90 min with 0, 250 or 1000 Îźg/mL of the glycopeptide antibiotic phleomycin. We then introduced either ssODN BFP/41 or BFP/41/NT (BFP/41/NT serves as a negative control and does not contain the CâT edit to convert BFP to GFP, and monitored GFP fluorescence by cytometry 24 h after delivery. BFP/41 along with phleomycin pre-treatment resulted in a dose-dependent increase in the number of GFP positive cells (FIG. 32). These results provide evidence that ssODNs can enhance the frequency and precision of non-specific DSB reagents, such as phleomycin-based genome editing in Arabidopsis protoplasts.
RTDS Technology Combined with a Glycopeptide Antibiotic to Convert BFP to GFP in Arabidopsis
It was previously reported that mammalian cells exposed to a low dose of glycopeptide antibiotic exhibited enhanced targeted gene editing when combined with oligonucleotides harboring the desired base change (Suzuki et al., 2003). These reagents bind and intercalate DNA, destroying the integrity of the double helix and resulting in a DNA double strand break. It is hypothesized that these antibiotics enhance ODM by elevating the expression/activity of DNA repair genes, causing double strand breaks near the target site or a combination of both. To test the effect of low-dose glycopeptide antibiotic treatment in combination with GRON, Arabidopsis protoplasts were incubated for 90 min with 10, 250 and 1000 Îźg/mL of the glycopeptide antibiotic phleomycin, then either GRON BFP/41 or the negative control GRON BFP/41/NT that does not contain the C>T edit was introduced and the protoplasts monitored GFP fluorescence after 24 h by cytometry. In treating protoplasts with lowest concentration of phleomycin (10 Îźg/mL), no improvement in the number of GFP positive cells when compared to the BFP/41/NT control was detected, despite using a concentration of antibiotic that is significantly higher than that used by Suzuki et al. (2003; data not shown). However at the higher 250 and 1000 Îźg/mL concentration, phleomycin pre-treatment resulted in a dose-dependent increase in GFP positive cells, reaching a conversion frequency of 0.14% at 1000 Îźg/mL (FIG. 32a). FIG. 32b shows edited Arabidopsis protoplasts 5 d after GRON delivery and treatment with glycopeptide antibiotics.
It is possible that these higher levels of phleomycin treatment are required in Arabidopsis as compared with mammalian cells due to lower permeability of the plant cell membrane to the antibiotic. For example in human fibroblasts, Sidik and Smerdon, (1990) found that pre-treatment with the membrane permeabilizer, lysophosphatidylcholine, prior to treating with bleomycin, significantly increased the amount of DNA repair synthesis when compared to cells not treated with the permeabilizer. The authors attributed this effect to lower amounts of bleomycin entering the cells. While it is unclear whether Arabidopsis cell membranes have a lower permeability to phleomycin, these results do demonstrate that pre-treatment with high levels of phleomycin significantly increased GRON-mediated gene editing. It is uncertain whether this positive effect on gene editing is based on increased double strand DNA breaks near the target site, up-regulation of DNA repair pathways or a combination of both. There is potential for phleomycin to introduce other non-targeted changes in the DNA as a result of imprecise NHEJ repair events due to its non-discriminate nature, however; such random mutations could be eliminated through follow-on plant breeding. These mutations are similar to the mutations induced using chemical mutagenesis as part of traditional breeding programs. As such, the use of phleomycin as a method for improving RTDS-based precise gene edits is notable and implies that generation of DNA double strand breaks can be an important factor for improving conversion efficiencies in plants.
RTDS Technology Combined with TALENs to Convert BFP to GFP in Arabidopsis
A TALEN (BT-1) that will target and cleave just downstream of the C>T edit required to convert BFP to GFP in our Arabidopsis BFP transgenic line (FIGS. 32a and b) was used in the following experiment. The BT-1 TALEN pair recognizes two 17 bp sequences separated by a 12 bp spacer region and was designed according to the architecture specifications outlined in Cermek et al. (2011). The target site (C>T) is within the left TALEN arm and thus will be upstream from the predicted cleavage site. Transient BT-1 protein expression was established in Arabidopsis protoplasts by using a Western blot (FIG. 33c). Next, to evaluate the cleavage efficiency of BT-1, a genomic DNA from BT-1 transfected protoplasts was isolated 72 h after TALEN introduction and then the region surrounding the TALEN binding sites was PCR amplified (FIG. 38) using the primers listed above. The resulting amplicons were assessed for indel scars or substitutions resulting from imprecise NHEJ events near the TALEN cleavage site by deep sequencing. Protoplasts treated with BT-1 showed indel mutations at a frequency of 2.9%, and substitutions at 5.1% (FIG. 34a). Deletions were mostly â¤20 bp and significantly outnumbered insertions (FIG. 34b). The distribution of indels â¤20 bp with respect to length in bp is shown in FIGS. 34c and d.
After establishing the activity of BT-1 in targeting our BFP transgene, the combinatorial effect of GRON combined with BT-1 TALEN to mediate BFP to GFP conversion was tested. BT-1 TALEN was introduced, along with GRONs BFP/41, BFP/101 or BFP/201, that contain the nucleotide change encoding a H66Y amino acid substitution, into Arabidopsis protoplasts. BFP/101 and BFP/201 also contain 5 silent mutations that would deter unwanted TALEN activity on a corrected GFP gene (FIG. 35a). GFP fluorescence was measured by flow cytometry 72 h after delivery of GRONs and TALENs. Protoplasts treated with both GRON and TALEN showed significantly more GFP fluorescing cells (25 to 45-fold) compared to treatments with either GRON alone (FIG. 31c) or mock treatments (FIG. 35b). This finding is similar to that of Strouse et al. (2014), where it was reported that single stranded oligos combined with TALENs significantly increased gene editing rates in mammalian cells. A comparable GRON length dependent positive effect was observed with respect to gene editing in the combined GRON and TALEN treatments (FIG. 35b). Taken together, these results demonstrate that employing RTDS-mediated gene editing with a targeted DNA double strand breaker (TALEN) in a combinatorial approach significantly improves the frequency of BFP to GFP editing in a GRON length dependent manner in Arabidopsis protoplasts.
Next, to determine if ssODNs can also positively influence genome editing outcomes induced by DSB reagents that make more target-specific cuts, a TALEN expression construct (BT-1) that will target and make a DSB just downstream of the CâT edit required to convert BFP to GFP in our Arabidopsis transgenic line (FIG. 33C) was employed. The BT-1 TALEN construct consists of two arms, both having a TAL effector-like DNA binding domain (TALE) linked to a catalytic DNA nuclease domain of FokI. The TALE domains guide the TALEN arms to specific sites of DNA allowing for dimerization of the FokI endonucleases and subsequent generation of a targeted DNA double strand break in the spacer region between the two binding sites (Cermak et al., 2011). Each BT-1 TALE recognizes a 19 bp sequence separated by a 14 bp spacer and is comprised of the truncated N152/C+63 architecture (Miller et al., 2011).
BT-1 activity at the targeted site on the BFP transgene by measuring imprecise NHEJ repair events occurring in the spacer region was examined as follows. Total genomic DNA was extracted from treated protoplasts 72 h after introduction of BT-1 and the target region amplified by PCR. PCR amplicons were then deep sequenced to a depth of >500,000 reads (Supplemental FIG. S1A and Table S3). Analysis showed the frequency of deletions and insertions averaged 2.6 and 0.3%, respectively (FIG. 37A). Deletions were primarily â¤20 bp while insertions were more equally distributed with respect to size (FIG. 37B). After establishing the targeting activity of BT-1 on the BFP transgene, we next tested the effect of combining ssODNs with BT-1 TALEN to convert BFP to GFP. For these experiments, we examined three different length ssODNs (BFP/41, BFP/101 or BFP/201, each independently delivered with or without BT-1 plasmid into Arabidopsis protoplasts. The resulting BFP to GFP editing was then quantified by cytometry 72 h after delivery. Protoplasts treated with both ssODNs and BT-1 TALEN exhibited 25- to 45-fold more green fluorescing cells than treatment with ssODN alone and more than 125-fold when TALENs are used alone (FIG. 37C). Notably, ssODN length had a positive effect on the frequency of BFP to GFP edits, whether combined with BT-1 TALEN or used alone. Taken together, these data show that when ssODNs are combined with a target-specific DSB reagent, the frequency of precise genome edits is increased by Ë10-fold over that observed with a non-specific DSB reagent.
ssODNs Combined with CRISPR/Cas9
Combining ssODNs with TALENs resulted in a significant improvement in the frequency of genome edits over using TALENs or ssODNs alone. However, considering the complexity of re-engineering TALEN proteins for each new DNA target, we asked if the more easily designed and constructed engineered nuclease CRISPR/Cas9 could also show enhanced genome edit frequency when supplied with ssODNs. The CRISPR/Cas9 system consists of a Streptococcus pyogenes Cas9 nuclease and a chimeric fusion of two RNAs (crRNA and tracrRNA) referred to as an engineered single guide RNA (sgRNA). The sgRNA supports targeted nucleic acid specificity for Cas9 through base pairing of its first twenty 5Ⲡbases with the DNA target, resulting in a site-specific DSB (Cong et al., 2013). In contrast with TALENs, changing the target specificity of the CRISPR/Cas9 protein complex does not require extensive protein engineering but only minimal manipulation of the sgRNA. The CRISPR/Cas9 expression plasmid, BC-1 (FIG. 34A), was designed to target near locus H66 of the BFP gene in our transgenic model (FIG. 34B) as shown in the following table (SEQ ID NOS: 313 and 314):
| CRISPR/Cas9âID | Sequenceâ5â˛-3Ⲡ| |
| BC-1 | GTCGTGACCACCTTCACCCA | |
| EC-2 | GCTGTTACAGCAGCTGTCAG | |
| G in undelined font altered in the sgRNA sequence to accommodate Pol III promoter |
Following a similar experimental methodology as in our TALENs work, the ability of BC-1 to target and cleave the BFP gene was determined by measuring the frequency of imprecise NHEJ repair events found upstream of the PAM sequence. In protoplasts treated with BC-1, we detected deletions and insertions at a frequency of 3.7 and 2.4%, respectively using deep amplicon sequencing (FIG. 35A). The most represented indel for either insertions or deletions was a single base pair (Data not shown). Notably, when compared to similar experiments with BT-1 (TALEN), the BFP transgene targeting efficiency of BC-1 (CRISPR/Cas9) was nearly three times higher (FIG. 35B). Having established the on-target activity of BC-1, potential off-target cleavage eas tested by searching the Arabidopsis genome for sequences with high similarity to the BC-1 target sequence using Cas-OFFinder (Bae et al., 2014). Five potential off-target sites that, based on searches, exhibited the most homology to the BC-1 target sequence (Hsu et al., 2013) were examined. Arabidopsis protoplasts were treated with BC-1 for 72 h, after which amplicons were generated using primers that flank each of the five potential off-target sites:
| Primersâusedâinâthisâstudy |
| ID | Sequenceâ5â˛-3Ⲡ| Species | SEQâIDâNO |
| BFPF-1 | TAAACGGCCACAAGTTCAGC | Arabidopsis | 55 |
| BFPR-1 | GGACGACGGCAACTACAAGACC | Arabidopsis | 54 |
| LuEPF-1 | GCATAGCAGTGAGCAGAAGC | Flax | 56 |
| LuEPR-1 | AGAAGCTGAAAGGCTGGAAG | Flax | 57 |
| Off-1FA | GGAAGCAAACAGGTGACAGC | Arabidopsis | 260 |
| Off-1RA | CGTATTTAGCCTCATCCAATGC | Arabidopsis | 261 |
| Off-2FA | AAGGCTCCTCCAACTTCACC | Arabidopsis | 262 |
| Off-2RA | TTCTCTGACTCTGATGGAGACC | Arabidopsis | 263 |
| Off-3FA | CCCTTGGTGCAACATAAACC | Arabidopsis | 264 |
| Off-3RA | GCGATGAATTTGAATTTTGACC | Arabidopsis | 265 |
| Off-4FA | TTCGGGTTTAACGGGACAG | Arabidopsis | 266 |
| Off-4RA | CGATTCCGGTAATTCACATTG | Arabidopsis | 267 |
| Off-5FA | AAACCCTAGTGGCAGTTTCG | Arabidopsis | 268 |
| Off-5RA | CGGTGGAAGCCCTGTTTAT | Arabidopsis | 269 |
| Off-1FF | CAAGGCTAATTAGACTTAGATGATGTGG | Flax | 315 |
| Off-1RF | GGTGCACCGCC | Flax | 316 |
| Off-2FF | CAAGGCTAATTAGACTTAGATGATGTGG | Flax | 315 |
| Off-2RF | GGTGCACCGCC | Flax | 316 |
| Off-3FF | GCCATCATCGCCCTTTAAGC | Flax | 317 |
| Off-3RF | TGGTGTTTTGCTCTGTGAACG | Flax | 318 |
| Off-4FF | GCCATCATCGCCCTTTAAGC | Flax | 317 |
| Off-4RF | TGGTGTTTTGCTCTGTGAACG | Flax | 318 |
| Off-5FF | GCCATCATCGCCCTTTAAGC | Flax | 317 |
| Off-5RF | TGGTGTTTTGCTCTGTGAACG | Flax | 318 |
| Off-6FF | GCCATCATCGCCCTTTAAGC | Flax | 317 |
| Off-6RF | TGGTGTTTTGCTCTGTGAACG | Flax | 318 |
| Off-7FF | GAAAGAAGGCACTCTCAGAACATAC | Flax | 319 |
| Off-7RF | TGAATTTTGCTATCCTCTTCCCAATTTG | Flax | 320 |
| Off-8FF | CGTACGTTGTCAAGAAGTGACC | Flax | 321 |
| Off-8RF | ACCAAGACGGTAGTGGATGTC | Flax | 322 |
These amplicons were then analyzed for NHEJ mutations by amplicon deep sequencing:
| BC-1âoff-targetsâ(SEQâIDâNOS:â323-328,ârespectively) |
| Off-target | Arabidopsis | #âof | |||
| ID | Chromâ# | Position | Off-targetâsequence | mismatches | Gene |
| Off-1 | chr1 | 13067189 | gTtGTtgCCACCTTCAaCCAAGG | 5 | intergenic |
| Off-2 | chr2 | 19145890 | CaCGTccCCACCaTCtCCCAAGG | 5 | uncharacterizedâprotein |
| Off-3 | chr5 | 17191806 | tTCaTcACCAgCTTCACCaATGG | 5 | uncharacterizedâprotein |
| Off-4 | chr4 | â4803635 | tTCGTGctCACCTTCACggATGG | 5 | Cellulose-synthaseâlike |
| Off-5 | chr4 | 14554739 | CTCGaacCCACCTTCAgCaAAGG | 5 | polyamineâoxidaseâ5 |
| On | NA | NA | CTCGTGACCACCTTCACCCACGG | NA | BFPâtransgene |
Of the five sites tested, only Off-1 showed mutations near the predicted cleavage site (FIG. 35C). While detectable, this level is Ë13-fold less than the On-target control. This weak activity at Off-1 is likely based on homology of the sequence proximal to the PAM site where only one mismatch is present (FIG. 35C) (Hsu et al., 2013). Collectively, these results demonstrate that BC-1 can actively target and disrupt the BFP transgene, and leave negligible off-target footprints. Moreover, when precise cuts made by BC-1 are corrected using ssODNs the frequency of precise and scarless BFP to GFP edits in Arabidopsis protoplasts is greater compared to when BC-1 or ssODNs are used alone.
Establishing Precise EPSPS Gene Edits in Flax Using ssODNs and CRISPR/Cas9
To extend the application of genome editing using ssODNs combined with an engineered nuclease to a commercially relevant agricultural crop, a series of experiments targeting the two highly homologous EPSPS (5â˛-enolpyruvylshikimate-3-phosphate synthase) loci in flax (Linum usitatissimum) were performed. The EPSPS genes code for a protein in the shikimate pathway that participates in the biosynthesis of aromatic amino acids. In plants, EPSPS is a target for glyphosate, an herbicide that acts as a competitive inhibitor of the binding site for phosphoenolpyruvate (SchĂśnbrunn et al., 2001). Precise edits in the flax EPSPS genes were made using ssODNs combined with CRISPR/Cas9 components. A CRISPR/Cas9 expression plasmid (EC-2) that targets a conserved sequence in both EPSPS genes near two loci, T178 and P182, that when edited to 1178 and A182, will render the EPSPS enzyme tolerant to glyphosate (Gocal et al., 2007). The ssODN EPSPS/144 containing the two targeted changes, one of which will disrupt the PAM sequence was introduced together with EC-2 into flax protoplasts. The treated protoplasts were then allowed to divide to form microcolonies without using selection for 21 days (FIG. 7B).
Precise edits and indel scars in both EPSPS loci were identified by PCR amplifying the region surrounding the target site and subjecting the amplicons to deep sequencing. The frequency of precise EPSPS edits ranged between 0.09 and 0.23%, and indels between 19.2 and 19.8% in three independent experiments with these edits and indels being equally distributed between the two loci:
| Summary of flax CRISPR/Cas9 experiments targeting EPSPS |
| Deep sequencing | Calli | |
| of microcoloniesa | genotyping resultsc |
| Experiment | Precise | Calli | Calli with | |
| ID | edits (%)b | Indels (%) | screened | precise edits |
| FC-1 | 0.23 | 19.8 | 5,167 | 8 (0.15%) |
| FC-2 | 0.10 | 19.2 | 4,601 | 4 (0.08%) |
| FC-3 | 0.09 | 19.6 | NS | |
| agDNA was isolated from pools of ~10,000 microcolonies, then used as template to amplify the target region | ||||
| bSequences with T97I (ACA â ATA) and P101A (CCG â GCG); data combined for gene 1 & gene 2 | ||||
| cIndividual callus was screened first by allele-specific PCR, then confirmed by Sanger sequencing | ||||
| NSâExperiment was not screened |
After establishing the presence of T178I and P182A edits in microcolonies, calli were regenerated, again without employing any selective agent, then molecularly screened for the targeted edits and indel scars using allele-specific PCR (Morlan et al., 2009). Of 5167 calli screened from experiment 1 and 4601 from experiment 2, 8 (0.15%) and 4 (0.08%) contained both T178I and P182A changes in at least one of the EPSPS loci respectively. This edit frequency correlated with the initial sequencing of 21-day-old microcolonies. Calli that screened positive for precise edits from this were used to regenerate whole plants under non-selective conditions 100% of which screened positive for the presence of the T178I and P182A edits in at least one EPSPS gene through DNA cloning and Sanger sequencing. All regenerated plants transferred to soil were fertile and genotyped as heterozygous for the T178I and P182A edits at either the gene 1 or gene 2 locus. No plants were biallelic or heterozygous for both genes. C1 (conversion generation-1) progeny from several A23 line plants derived from a single callus event were then evaluated for inheritance of the edited EPSPS allele. Sequence analysis showed sexual transmission of the edited EPSPS allele with the expected Mendelian segregation ratio of 1:2:1:
| C0 Plant | Heterozygous for | Homozygous for | ||
| number | wt | I178 and A182 | I178 and A182 | |
| 1 | 19 | 31 | 21 | |
| 2 | 15 | 29 | 20 | |
| 3 | 4 | 11 | 2 | |
To identify potential off-target mutations arising from treatment with EC-2 in regenerated plant A23, we amplified 8 different regions of the flax genome bearing sequence similarity to the EC-2 protospacer. NHEJ mutations made through imprecise NHEJ events were identified by amplicon deep sequencing. Mutations indicative of EC-2 activity were not detected in any of the 8 potential off-target sites tested for plant A23:
| Off-targetâanalysisâofâflaxâplantâA23 |
| Off-Target | Scaffoldâor | Off-TargetâSequencecc | #âof | Mutations | |
| ID | LocusâIDa | Positionb | (SEQâIDâNO) | Mismatches | detectedd |
| Off-1 | C7813595 | 197-219 | CcgGTTACAGCAGCaGTCgGCGG | 5 | â |
| (329) | |||||
| Off-2 | Lus10030959.g | 243476-243460 | CcgGTTACAGCAGCaGTCgGCGG | 5 | â |
| (329) | |||||
| Off-3 | Scaffoldâ155 | 681644-681624 | TcaaaagCtGCAGCTaTCAGTGG | 9 | â |
| (330) | |||||
| Off-4 | Lus10036882.g | 1067934-1067911 | TcaaaatCtGCAGCTGTCAGTGG | 8 | â |
| (331) | |||||
| Off-5 | Scaffoldâ107 | 1077588-1077568 | TcaaaatCtGCgGCTGTCAGTGG | 9 | â |
| (332) | |||||
| Off-6 | Scaffoldâ743 | 195079-195059 | TcaaaatCtGCgGCTGTCAGTGG | 9 | â |
| (332) | |||||
| Off-7 | Scaffoldâ208 | 238604-238626 | AaggacACAGCAGCTGTCgGTGG | 7 | â |
| (333) | |||||
| Off-8 | Scaffoldâ2252 | 38795-38773 | AccaaacgAGCAGCTGTCAGAGG | 8 | â |
| (334) | |||||
| On | Lus10000788.g | 19227-19249 | GCTGTTACAGCAGCTGTCAGCGG | 0 | + |
| (335) | |||||
| aScaffold or locus ID from Phytozyme 10.2 | |||||
| bProtospacer position within scaffold | |||||
| cLowercase bases are mismatches to the EC-2 protospacer | |||||
| dMutations determined by sequencing; On-target mutations are T178I and P182A |
To determine the glyphosate tolerance afforded by the T178I and P182A mutations, we challenged callus line A23, a line that was identified as being heterozygous for the T178I and P182A edits in EPSPS gene 2, as well as the whole C0 plants regenerated from this callus line with glyphosate. A23 callus and control wild type callus was plated on solid regeneration medium containing a range of glyphosate concentrations. After 21 days, the fresh weight of calli with T178I and P182A edits was significantly higher (p<0.01) than that of wild type calli at all glyphosate concentrations tested (FIGS. 9A and B). For regenerated whole plants, both wild type and EPSPS edited plants were maintained in soil under greenhouse conditions, then sprayed with either 10.5 or 21.0 mM glyphosate. Six days post treatment, wild type plants exhibited a wilted and necrotic phenotype typical of glyphosate toxicity for both application rates, whereas A23 plants with the edited EPSPS gene exhibited minimal phenotypic change (FIG. 9C). This result is notable as it implies that a single T178I and P182A edited EPSPS gene provides a level of tolerance much greater than that observed in the control plants.
Taken together, these data demonstrate that in flax, ssODNs combined with CRISPR/Cas9 can result in precise EPSPS edits at sufficient frequency to be detected by molecular screening without the need for selective culture conditions and that these edits are properly transmitted to subsequent generations.
RTDS Technology Combined with TALENs to Edit the EPSPS Genes in Flax
To extend the application of RTDS with engineered nuclease mediated precision gene editing to other plant systems, a similar study was performed targeting the two EPSPS (5â˛-enolpyruvylshikimate-3-phosphate synthase) loci in flax. The EPSPS loci encode an enzyme in the shikimate pathway that contributes to the biosynthesis of the aromatic amino acids phenylalanine, tyrosine and tryptophan. In plants, EPSPS is a target for the herbicide glyphosate, where it acts as a competitive inhibitor of the binding site for phosphoenolpyruvate (SchĂśnbrunn et al., 2001). Based on mutational studies on an E. coli EPSPS homolog, it is expected that editing the amino acid positions T97 and P101 to 197 and A101 of the flax EPSPS loci will render this enzyme tolerant to glyphosate (Gocal et al., 2007).
In an effort to improve GRON-mediated targeting efficiency for these EPSPS loci, TALEN LuET-1 (FIG. 38a that targets conserved sequence for both EPSPS genes near the T97 and P101 loci (FIG. 38b) was designed using the same architectural guidelines used for BT-1. Transient expression of LuET-1 protein in flax protoplasts was established using a Western blot. TALEN protein was detectable 24 h after introduction and remained at a similar level through 48 h (FIG. 38c). To apply RTDS technology in flax, a combination of the TALEN LuET-1 and a 144 nb GRON (EPSPS/144) containing the targeted changes C>T and C>G (ACA>ATA T97I; CCG>GCG P101A) was used. Following these transfections into flax protoplasts, precise gene edits as well NHEJ-induced mutations, 7-day post transfection were analyzed by deep sequencing. Repair events using NHEJ totaled 1.41%, with deletions and substitutions being most common and significantly outnumbering insertions (FIG. 39a). The majority of deletions in the flax EPSPS genes were â¤20 bp (FIG. 39b). Using SNP differences between the two EPSPS loci (FIG. 40), NHEJ events for each of the two EPSPS loci were found to be comparable, suggesting that LuET-1 TALEN is effective at cleaving both genes. When examined for precise, scarless gene edits, 0.19% contained the C>T and C>G targeted double change as shown in the following table.
| Percentage of total reads |
| Treatment | EPSPS gene 1 edits* | EPSPS gene 2 edits* | |
| TALEN + GROWâ | 0.1 | 0.09 | |
| TALEN alone | 0 | 0 | |
| GRON alone | 0.02 | 0.02 | |
| Mock | 0 | 0 | |
| gDNA from treated cells was analyzed by NGS 7 days after introduction | |||
| â EPSPS/144 GRON | |||
| *represeats both T97I and P101A mutations in the same read |
Similar to the NHEJ repair events, these precise edits had comparable frequencies for each EPSPS locus indicating that the GRON dependent repair events are unbiased. These results correlate well with our Arabidopsis BFP to GFP editing data and demonstrate that the combinatorial approach of GRONs with TALENs in flax protoplasts significantly increases the frequency of scareless editing of the EPSPS gene targets. Multiple nucleotide edits can be realized with a single GRON.
Many studies in a variety of different genera, including human, animal, yeast, plant have demonstrated the effectiveness of oligo-directed gene repair (Alexeev and Yoon, 1998; Beetham et al., 1999; Kren at al., (1998); Kuwayama et al., 2008; Li et al., 2001; Rando et al., 1999; Rice et al., 2001; Xiang et al., 1997); Zhu et al., 1999), suggesting that a large number of genes in a wide variety of organisms are amenable to RTDS.
RTDS-based gene editing in plants can be enhanced when combined with a variety of reagents that create DNA double strand breaks. These data show in two distinct plant systems, A. thaliana and L. usitatissimum, that by combining GRONs with phleomycin or TALENs the frequency of gene editing is increased markedly when compared to GRONs alone. This enhancement can be further increased by altering a GRON's length allowing for the added flexibility of targeting several loci with a single GRON while at the same time increasing the frequency of total edits. Using an approach that combines TALENs and longer GRONs allowed us to obtain robust precision gene editing frequencies in the flax EPSPS loci to develop glyphosate tolerant traits.
Using RTDS, new non-transgenic breeding traits can be developed in plants with only very minor changes to the target genes and their resulting proteins. Results presented above show nucleotide substitutions in both the BFP transgene in Arabidopsis and the EPSPS genes in flax. Additionally, this gene editing technology can be applied rapidly and precisely to improve traits in all commercially relevant crop plants.
This study investigates the effect of delivering Cas9 protein complexed to gRNA (BFP1) along with GRON to mediate BFP to GFP gene editing in protoplasts derived from a BFP transgenic Arabidopsis thaliana line. The GRONs used with the Cas9 RNP contain the coding sequence of the bfp gene around the site of conversion and are labeled with a 2â˛-O-Me group at the first 5Ⲡbase of the GRON which is a RNA base instead of DNA base. This GRON is herein referred to as 2OMe GRON. Please see Table 1 for a description of GRON used in these experiments.
BFP transgenic Arabidopsis thaliana protoplasts derived from induced root tissue were seeded on a flat-bottom 96-well plate, at 250,000 cells per well and at a cell density of 1Ă107 cells/ml. CRISPR-Cas9 was delivered as an RNP complex along with GRON by PEG mediated delivery or by alternative delivery methods such as by electroporation, cell-penetrating peptides and/or lipid based delivery techniques. Protoplasts were incubated in the dark at 23° C. for 72 hours, and then analyzed by flow cytometry in order to determine the percentage of GFP positive protoplasts within a given treatment.
The CRISPR-Cas9 consists of two components: Recombinant Streptococcus pyogenes Cas9 (SpCas9) protein and in vitro transcribed sgRNA. The sgRNA is a fusion of CRISPR RNA (crRNA) and trans-activating crRNA (tracrRNA). The crRNA region contains the spacer sequence used to guide the Cas9 nuclease to the BFP target gene. In these experiments the BFP1 CRISPR-Cas9 which targets the bfp gene was used. The GRON contains the coding sequence of the bfp gene near the site of conversion. Table 1 describes the GRON and Table 2 describes the BFP gRNA used in these experiments.
Delivery of Cas9 protein complexed with gRNA (BFP1), when used in combination with GRON (2OMe; BFP4/NC 101-mer), resulted in 2.20-3.10% BFP to GFP gene editing from three independent experiments. Control treatments without GRON resulted in no detectable BFP to GFP gene editing. These data demonstrate the advantages in using the GRON for precision gene editing.
This study investigates the effect of delivering Cas9 protein complexed to gRNA (BnEPSPS gRNA-1) along with GRON to mediate EPSPS gene editing in protoplasts derived from Brassica napus leaf material. The GRONs used with the Cas9 RNP contains the coding sequence of the targeted epsps gene around the site of conversion and are labeled with a 2â˛-O-Me group at the first 5Ⲡbase of the GRON which is a RNA base instead of DNA base. These GRONs are herein referred to as 2OMe GRONs.
Brassica napus protoplasts derived from leaves of in vitro propagated nodal cuttings were seeded in a 50 ml centrifuge tube at 2,000,000 cells per tube and at a cell density of 5Ă106 cells/ml. CRISPR-Cas9 targeting the EPSPS 2-25 gene along with GRON was delivered as a ribonucleoprotein complex using the PEG method or by alternative delivery methods such as by electroporation, cell-penetrating peptides and/or lipid based delivery techniques. Protoplasts were incubated in the dark at 25° C. for three weeks, and then analyzed deep sequencing in order to determine the percentage of precise EPSPS edits and frequency of indels within a given treatment.
The CRISPR-Cas9 consists of two components: the Streptococcus pyogenes Cas9 (SpCas9) and sgRNA which form the RNP CRISPR-Cas9 complex when mixed. The sgRNA is a fusion of CRISPR RNA (crRNA) and trans-activating crRNA (tracrRNA). The crRNA region contains the spacer sequence used to guide the Cas9 nuclease to the EPSPS target gene. In these experiments RNP CRISPR-Cas9 is used to target the EPSPS 2-25 gene. The GRON contains the coding sequence of the EPSPS gene near the site of conversion as well as nucleotide alterations to produce the desired changes to the EPSPS gene.
| BnEPSPS-2-25â101-mer | |
| 2OMe |
| (SEQâIDâNO:â336) |
| 5â˛(U)TACCTTGCGTTGCCACCTGCAGCAGTAACTGC | |
| AGCGGTAAGTGTACGCATCGCTATTCCAGCATTCCC | |
| AAGGTACAACTCGATATCACTCTTGGAATCTA3Ⲡ| |
| BnEPSPSâgRNA-1 |
| (SEQâIDâNO:â337) |
| 5â˛GCAGCGGTAAGTGGACGCAâ3Ⲡ|
Delivery of Cas9 protein complexed with gRNA (BnEPSPS gRNA-1) when used in combination with GRON (2â˛OMe; BnEPSPS-2-25/NC 101-mer) resulted in 0.07-0.125% gene editing and 27.1-39.4% indel formation in the targeted epsps gene(s) from three independent experiments. Control treatments without GRON resulted in no detectable EPSPS gene editing demonstrating the advantages in using the GRON for precision gene editing.
This study investigates the effect of delivering Cas9 protein complexed to gRNA (CR-OsACCase-4) to mediate targeted indel formation around the Cas9 DNA cleavage site in the accase gene in protoplasts derived from rice cell suspensions. Please see Table 1 for a description of gRNAs used in these experiments.
Oryza sativa protoplasts derived from cell suspensions were treated in a 0.4 cm cuvette at 1Ă106 cells per cuvette and at a cell density of 1Ă106 cells/ml. Ribonucleoprotein complexes consisting of Cas9 protein and in vitro synthesized gRNA along with GRON was introduced into protoplasts by electroporation. Protoplasts were incubated in the dark at 23° C. for 72 h, and then analyzed by T7E1 assay in order to determine the percentage of indels derived from the activity of the CRISPR-Cas9 protein.
| CR-OsACCase-4 |
| (SEQâIDâNO:â338) |
| 5â˛-AGAGCTACGAGGAGGGGCTT-3Ⲡ|
Delivery of Cas9 protein complexed with gRNA (CR-OsACCase-4) resulted in 15.9-23.3% indel formation respectively around the site of Cas9 cleavage of the accase gene from three independent experiments. These data demonstrate the functionality of Cas9 for targeted DNA activity when delivered into protoplasts as a protein.
This study investigates the effect of delivering Cas9 protein complexed to gRNA (BFP1) along with GRON to mediate BFP to GFP gene editing in protoplasts derived from cassava cell suspension cultures. The GRONs used with the Cas9 RNP contain the coding sequence of the targeted bfp gene around the site of conversion and are labeled with a 2â˛-O-Me group at the first 5Ⲡbase of the GRON which is a RNA base instead of DNA base. These GRONs are herein referred to as 2â˛OMe GRONs. Please see Table 1 for a description of GRONs used in these experiments.
Cassava protoplasts derived from BFP transgenic FEC (friable embryogenic callus) suspension cultures were seeded in 14 ml centrifuge tubes, at 4Ă106 cells per tube at a cell density of 5Ă106 cells/ml. The CRISPR-Cas9 RNP was added at 25 Îźg/million cells. The GRON (along with the CRISPR-Cas9 RNP) was introduced into protoplasts by PEG mediated delivery of 0.5 ÎźM of the BFP4/NC 201-mer GRON. Protoplasts were incubated in the dark at 25° C. for 72 hours, and then they were analyzed by flow cytometry in order to determine the percentage of GFP positive protoplasts within a given treatment.
Delivery of Cas9 protein complexed with gRNA (BFP1), when used in combination with GRON (2â˛OMe; BFP4/NC 201-mer), resulted in 0.008-0.009% BFP to GFP gene editing. Control treatments without GRON resulted in no detectable BFP to GFP gene editing. These data demonstrate the advantages in using the GRON for precision gene editing.
This study investigates the effect of delivering Cas9 protein complexed to gRNA (PPX2 or PPX4) to mediate targeted indel formation around the Cas9 DNA cleavage site in the ppx gene in protoplasts derived from potato leaf material. Please see Table 1 for a description of gRNAs used in these experiments.
Protoplasts of the Solanum tuberosum ST-01 plants were mixed with Cas9 protein complexed with guide RNAs designed for the 144 (PPX2) or the 220 (PPX4) position of the potato protoporphyrinogen gene. Protoplasts were incubated with the Cas9/gRNA complex for 15 minutes on ice prior to the treatment with the transfection reagent, Polyethylene glycol. Upon mixing all components, the tubes were incubated on ice for 30 minutes prior to dilution with a salt solution osmotically adjusted to maintain the stability of the protoplasts. The protoplasts were centrifuged at 44.16Ăg for 10 minutes and suspended in 1 ml of culture medium and were incubated at 22° C. At 24 hours post transfection, genomic DNA was isolated from the samples and submitted for NGS (Next Generation Sequencing) analysis.
| PPX2 |
| (SEQâIDâNO:â280) |
| 5â˛-GCCTTCCACAAGACAAAGCG-3Ⲡ| |
| PPX4 |
| (SEQâIDâNOS:â281) |
| 5â˛-GCTCAATTTTGAGGGGTCAC-3Ⲡ|
Delivery of Cas9 protein complexed with gRNA (PPX2 or PPX4) resulted in up to 24.4 and 35.7% indel formation respectively around the site of Cas9 cleavage of the ppx gene. These data demonstrate the functionality of Cas9 for targeted DNA activity when it is delivered into protoplasts as a protein.
This study investigates the effect of delivering Cas9 mRNA and gRNA (BFP1) along with GRON to mediate BFP to GFP gene editing in protoplasts derived from a BFP transgenic Arabidopsis thaliana line. The GRONs used with the Cas9 RNP contain the coding sequence of the bfp gene around the site of conversion and are labeled with a 2â˛-O-Me group at the first 5Ⲡbase of the GRON which is an RNA base instead of DNA base. This GRON is herein referred to as 2OMe GRON.
The CRISPR-Cas9 consisted of two components: Streptococcus pyogenes Cas9 (SpCas9) mRNA and in vitro transcribed sgRNA. The sgRNA is a fusion of CRISPR RNA (crRNA) and trans-activating crRNA (tracrRNA). The crRNA region contains the spacer sequence used to guide the Cas9 nuclease to the BFP target gene. In these experiments the BFP1 CRISPR-Cas9 is used which targets the bfp gene. The GRON contains the coding sequence of the bfp gene near the site of conversion.
BFP transgenic Arabidopsis thaliana protoplasts derived from induced root tissue were seeded on a flat-bottom 96-well plate, at 250,000 cells per well and at a cell density of 1Ă107 cells/ml. CRISPR-Cas9 was delivered as RNA species (Cas9 mRNA and sgRNA) along with GRON by PEG mediated delivery or by alternative delivery methods such as by electroporation, cell-penetrating peptides and/or lipid based delivery techniques. Protoplasts were incubated in the dark at 23° C. for 72 hours, and then analyzed by flow cytometry in order to determine the percentage of GFP positive protoplasts within a given treatment.
Delivery of Cas9 mRNA and gRNA (BFP1) when used in combination with GRON (2OMe; BFP4/NC 101-mer) resulted in 0.24-1.51% BFP to GFP gene editing from three independent experiments. Control treatments without GRON resulted in no detectable BFP to GFP gene editing. These data demonstrate the advantages in using the GRON for precision gene editing.
One skilled in the art readily appreciates that the present disclosure is well adapted to carry out the objects and obtain the ends and advantages mentioned, as well as those inherent therein. The examples provided herein are representative of preferred embodiments, are exemplary, and are not intended as limitations on the scope of the disclosure.
It will be readily apparent to a person skilled in the art that varying substitutions and modifications may be made to the disclosure disclosed herein without departing from the scope and spirit of the disclosure.
The disclosure illustratively described herein suitably may be practiced in the absence of any element or elements, limitation or limitations which is not specifically disclosed herein. Thus, for example, in each instance herein any of the terms âcomprisingâ, âconsisting essentially ofâ and âconsisting ofâ may be replaced with either of the other two terms. The terms and expressions which have been employed are used as terms of description and not of limitation, and there is no intention that in the use of such terms and expressions of excluding any equivalents of the features shown and described or portions thereof, but it is recognized that various modifications are possible within the scope of the disclosure claimed. Thus, it should be understood that although the present disclosure has been specifically disclosed by preferred embodiments and optional features, modification and variation of the concepts herein disclosed may be resorted to by those skilled in the art, and that such modifications and variations are considered to be within the scope of this disclosure as defined by the appended claims.
Thus, it should be understood that although the present disclosure has been specifically disclosed by preferred embodiments and optional features, modification, improvement, and variation of the disclosures disclosed may be resorted to by those skilled in the art, and that such modifications, improvements and variations are considered to be within the scope of this disclosure. The materials, methods, and examples provided here are representative of preferred embodiments, are exemplary, and are not intended as limitations on the scope of the disclosure.
The disclosure has been described broadly and generically herein. Each of the narrower species and subgeneric groupings falling within the generic disclosure also form part of the disclosure. This includes the generic description of the disclosure with a proviso or negative limitation removing any subject matter from the genus, regardless of whether or not the excised material is specifically recited herein.
In addition, where features or aspects of the disclosure are described in terms of Markush groups, those skilled in the art will recognize that the disclosure is also thereby described in terms of any individual member or subgroup of members of the Markush group.
All publications, patent applications, patents, and other references mentioned herein are expressly incorporated by reference in their entirety, to the same extent as if each were incorporated by reference individually. In case of conflict, the present specification, including definitions, will control.
Other embodiments are set forth within the following claims.
1. A method of causing a genetic change in a plant cell, said method comprising exposing said cell to a DNA cutter and a modified GRON.
2. A method according to claim 1, wherein the GRON comprises DNA and/or RNA.
3. The method of claim 2, wherein said DNA cutter is one or more DNA-cutting antibiotics selected from the group consisting of bleomycin, zeocin, phleomycin, tallysomycin and pepleomycin, a CRISPR, a TALEN, a zinc finger nuclease, or a meganuclease.
4. The method of claim 3, wherein said GRON is single stranded, and is optionally a chemically protected oligonucleotide.
5. The method of claim 4, wherein the GRON comprises a chemically protected oligonucleotide protected at the 5Ⲡend, a chemically protected oligonucleotide protected at the 3Ⲡend, or a chemically protected oligonucleotide protected at the 5Ⲡand 3Ⲡends.
6. The method of claim 5, wherein the GRON comprises one or more moieties selected from an idC group, a Cy3 group, a 3PS group, and a 2â˛-O-methyl group.
7. The method of claim 5, wherein the GRON comprises 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10 RNA base at the 5Ⲡend.
8. The method of claim 1, wherein said GRON has a wobble base pair relative to the target sequence for the genetic change.
9. The method of claim 1, wherein said GRON is between 15 and 60 nucleotides in length, between 50 and 110 nucleotides in length, betreen 150 and 210 nucleotides in length, or longer than 201 nucleotides in length.
10. The method of claim 1, wherein said plant is selected from the group consisting of canola, sunflower, corn, tobacco, sugar beet, cotton, maize, wheat, barley, rice, alfalfa, barley, sorghum, tomato, mango, peach, apple, pear, strawberry, banana, melon, cassava, potato, carrot, lettuce, onion, soy bean, soya spp, sugar cane, pea, chickpea, field pea, fava bean, lentils, turnip, rutabaga, brussel sprouts, lupin, cauliflower, kale, field beans, poplar, pine, eucalyptus, grape, citrus, triticale, alfalfa, rye, oats, turf and forage grasses, flax, oilseed rape, mustard, cucumber, morning glory, balsam, pepper, eggplant, marigold, lotus, cabbage, daisy, carnation, tulip, iris, cassava, and lily.
11. The method of claim 3, wherein the CRISPR includes a nickase.
12. A non-transgenic herbicide resistant or tolerant plant cell or plant made by the method of claim 1.
13. The cell or plant of claim 12, wherein said cell or plant has a genetic change or mutation in Acetyl-Coenzyme A carboxylase (ACCase) a genetic change or mutation in 5-enolpyruvylshikimate-3-phosphate synthase (EPSPS), and wherein said plant cell is selected from the group consisting of corn, wheat, rice, barley, sorghum, oats, rye, sugarcane, soybean, cotton, sugarbeet, oilseed rape, canola, flax, cassava, sunflower, potato, tobacco, tomato, alfalfa, poplar, pine, eucalyptus, apple, lettuce, peas, lentils, grape and turf grasses; or a genetic change or mutation in 5-enolpyruvylshikimate-3-phosphate synthase (EPSPS) and wherein cell or plant is selected from the group consisting of corn, wheat, rice, barley, sorghum, oats, rye, sugarcane, soybean, cotton, sugarbeet, oilseed rape, canola, flax, cassava, sunflower, potato, tobacco, tomato, alfalfa, poplar, pine, eucalyptus, apple, lettuce, peas, lentils, grape and turf grasses.