US20240018196A1
2024-01-18
18/451,700
2023-08-17
Smart Summary: Chimeric polypeptides are new compounds that combine zinc finger motifs with therapeutic peptides, like botulinum neurotoxins (BoNTs). The zinc finger motifs are attached to the end of the BoNT, and there can be multiple motifs in one polypeptide. These compounds can be delivered effectively through the skin. This method allows for a potentially easier way to administer treatments. Overall, these innovations could improve how certain therapies are given to patients. 🚀 TL;DR
The present disclosure provides chimeric polypeptides that include one or more zinc finger motif fused to a therapeutic peptide such as botulinum neurotoxins (BoNTs). The zinc finger motif may be located at the C-terminal side of the BoNT and the chimeric polypeptide can optionally include two or more such zinc finger motifs. It is shown that the disclosed chimeric polypeptides can be efficiently delivered to a subject transdermally.
Get notified when new applications in this technology area are published.
A61K38/00 » CPC further
Medicinal preparations containing peptides
C07K14/33 » CPC main
Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from bacteria from Clostridium (G)
C07K19/00 » CPC further
Hybrid peptides
This application is continuation of U.S. application Ser. No. 16/632,299, filed Jan. 17, 2020, which is a U.S. National Stage Application under 35 U.S.C. 371 of International Application No. PCT/CN2018/096448, filed Jul. 20, 2018, which claims priority to PCT/CN2017/093810, filed on Jul. 21, 2017, the contents of all of which are incorporated herein by reference in its entirety in the present disclosure.
The contents of the electronic sequence listing (258138.xml; Size: 36,168 bytes; and Date of Creation: Aug. 17, 2023) is herein incorporated by reference in its entirety.
Botulinum neurotoxins (BoNTs) are naturally occurring neurotoxin produced by bacterium Clostridium botulinum and related species. There are seven known serotypes of BoNTs, A, B, C1, D, E, F and G. BoNTs are released from bacteria as a single polypeptide chain and then self-cleaved into a 100 kDa heavy chain and a 50 kDa light chain, which are connected through a single disulfide bond. The heavy chain directs botulinum toxins to presynaptic nerve terminals and mediates internalization of the light chain into the cytoplasm. The light chain of botulinum is a metalloprotease that specifically cleaves SNARE (soluble N-ethylmaleimide-sensitive fusion attachment protein receptor) complex proteins.
SNARE is a large protein superfamily consisting of more than 60 members in mammalian cells. The core SNARE complex is four-α-helical bundle, comprising one helix from each of synaptobrevin (also referred to as vesicle-associated membrane protein, VAMP) and syntaxin-1 and two helices from synaptosomal-associated protein 25 (SNAP-25). The four helices from these SNARE proteins wrap around each other to assemble a coiled-coil quaternary structure. Syntaxin-1 binds to the N-terminal helix of SNAP-25 whereas synaptobrevin helix binds to the C-terminal helix of SNAP-25. The primary role of SNARE complex is to mediate vesicle fusion, for example fusion of synaptic vesicles with presynaptic membrane in neurons.
BoNTs specifically cleave one of the three core SNARE proteins, synaptobrevin, syntaxin-1 or SNAP-25. Inactivation of any of these three proteins will disrupt the formation of core SNARE complex or the interaction of core SNARE complex with other components in the SNARE supercomplex. Blockade of the function of SNARE supercomplex prevents fusion of vesicles with cell membrane and thus prohibits the release of neurotransmitter acetylcholine from axon endings, leading to muscle paralysis.
BoNTs are the most potent naturally occurring toxins in the earth, causing botulism in human with as little as 50 ng substance. In nature, BoNTs mostly infect wild and domesticated animals and are disseminated through invertebrates. According to the origin of toxins, human botulism is categorized into five classes: food-borne botulism, infant botulism, inhalational botulism, iatrogenic botulism (caused by excessive clinical doses of BoNTs) and wound botulism (mostly caused by drug injection). The former two are the most commonly seen human botulism.
The therapeutic use of BoNTs was first proposed during the late 1960s by Alan B. Scott and practiced on children with strabismus in 1977. The extraordinary specificity of BoNTs make them effective agents for human diseases that are characterized by hyperactivity of the nerve terminals. The largest proportion of the therapeutic use of BoNTs is neurological disorders, such as dystonias, sparsticity, hemifacial spasm, hyperhidrosis (excessive sweating) and hypersalivation (excessive saliva). Another important use of BoNTs is to treat urological disorders, such as detrusor sphincter dyssynergia, idiopathic detrusor overactivity, neurogenic detrusor overactivity, urinary retention, anal fissures and benign prostate hyperplasia. Though rarely seen, BoNTs can be used to treat gastroenterological and otolaryngological disorders. BoNTA was approved by United States (US) Food and Drug Administration (FDA) in 2002 for the treatment of moderate-to-severe glabellar rhytids in adult patients of 65 year old or younger. Starting from 2005, BoNTA has become the most widely used noninvasive, physician-assisted cosmetic procedure. While the overall patient satisfaction is above 80%, injectable BoNTA faces many drawbacks such as pain, needle marks, tenderness, bleeding and bruising. In particular, injection of BoNTA in the crow's feet or lateral canthus regions may be associated with high risks of bruising due to thin skin and superficial blood vessels. For some treatments, multiple injections are required to achieve maximum effects.
The present disclosure provides, in one embodiment, a chimeric polypeptide comprising (a) a botulinum toxin (BoNT) light chain and (b) a first zinc finger motif located to the C-terminal of the BoNT light chain or located to the C-terminal to a BoNT heavy chain which is located C-terminal to the BoNT light chain or bound to the BoNT light chain through a disulfide bond. In some embodiments, the chimeric polypeptide does not include more than 2000 amino acid residues.
In some embodiments, the BoNT light chain and the first zinc finger motif are on the same peptide chain. In some embodiments, the BoNT light chain and the first zinc finger motif are on different peptide chains.
In some embodiments, the chimeric polypeptide further comprises a second zinc finger motif located to the N-terminal of the BoNT light chain. In some embodiments, at least one of the first zinc finger motif and the second zinc finger motif is concatenated to at least a further zinc finger motif. In some embodiments, at least one of the zinc finger motifs is a Cyst-Hist zinc finger motif. In some embodiments, the zinc finger motif contains at least an alanine at residues −1, 2, 3 or 6 of the alpha-helical fragment in the zinc finger motif.
In one example embodiment, a two-chain polypeptide is provided, comprising (a) a first chain comprising a botulinum toxin (BoNT) light chain and three zinc finger motifs located to the N-terminal of the BoNT light chain, and (b) a second chain comprising a BoNT heavy chain three zinc finger motifs located to the C-terminal to a BoNT heavy chain, wherein the BoNT light chain is bound to the BoNT light chain through a disulfide bond. Similarly, in an embodiment, a chimeric polypeptide is provided, comprising, from the N-terminus to the C-terminus, three zinc finger motifs, a botulinum toxin (BoNT) light chain, a BoNT heavy chain, and three more zinc finger motifs.
In some embodiments, at least one of the zinc finger motifs comprises an amino acid sequence selected from the group consisting of SEQ ID NO: 1 and 5 to 7. In some embodiments, the zinc finger motif comprises the amino acid sequence of SEQ ID NO: 1. In some embodiments, the first zinc finger is not longer than 200 amino acid residues away from the C-terminus of the BoNT light chain or the BoNT heavy chain.
In some embodiments, the BoNT is selected from BoNT A, B, C, D, E, F, G or variants having at least 90% sequence identity thereto. In some embodiments, the BoNT is selected from subtypes of BoNT A1-A10, B1-B8, E1-E9, and F1-F7. In some embodiments, the BoNT is BoNT A. In some embodiments, the BoNT light chain comprises the amino acid sequence of SEQ ID NO: 8 or an amino sequence having at least 90% sequence identity to SEQ ID NO: 8. In some embodiments, the BoNT heavy chain comprises the amino acid sequence of SEQ ID NO: 9 or an amino sequence having at least 90% sequence identity to SEQ ID NO: 9.
In some embodiments, the chimeric polypeptide comprises a single-chain polypeptide comprising an amino acid sequence selected from the group consisting of SEQ ID NO: 10 to 17, or a two-chain polypeptide processed from the amino acid sequence.
Also provided, in one embodiment, is a chimeric polypeptide comprising a botulinum toxin (BoNT) light chain and at least a zinc finger motif. In some embodiments, the chimeric polypeptide does not include more than 2000 amino acid residues. In some embodiments, the zinc finger motif is located to the C-terminal to and is no more than 200 amino acid resides away from the BoNT light chain.
Another embodiment of the present disclosure provides a chimeric polypeptide comprising a therapeutic peptide and at least a zinc finger motif located to the C-terminal of the therapeutic peptide, wherein the N-terminus of the zinc finger motif is no more than 100 amino acid residues away from the C-terminus of the therapeutic peptide. In some embodiments, the therapeutic peptide is selected from the group consisting of an epidermal growth factor (EGF) and a superoxide dismutase (SOD).
Uses for manufacture of medicaments and treatment methods are also provided. In some embodiments, a method is provided for administering a BoNT light chain to a mammal subject, comprising topically applying a formulation comprising the chimeric BoNT polypeptide of the present disclosure. The administration, in some embodiments, can alternatively be intramuscular.
In some embodiments, the topical application is on a skin or a mucous membrane of an eye, ear, nose, mouth, lip, urethral opening, anus, or tongue. In some embodiments, the topical application is on a stratum corneum of a skin that has been disrupted. In some embodiments, the disruption is carried out with a needle or microneedle used for delivering the formulation. In some embodiments, the topical application is on a skin of the face or neck of the subject. In some embodiments, the formulation comprises a cream, gel, or spray.
In some embodiments, the subject is in need of treatment of facial wrinkle, dystonias, sparsticity, hemifacial spasm, hyperhidrosis, or hypersalivation.
Polynucleotides encoding the chimeric polypeptides of the present disclosure, cells enclosing the polynucleotides and/or the polypeptides and formulations including the polypeptides are also provided in certain embodiments.
FIG. 1 illustrates the structures of various BoNTA fusion proteins tested in the examples including Protein IDs 1-8 which have the sequences of SEQ ID NO:10-17 (Table 4), respectively.
FIG. 2, with panels A and B, shows the results of purification of BoNTA-CPP recombinant fusion protein expressed from E. coli. (A) TAT and Pep-1 did not give good yield of protein expression and purification. (B) BoNTA-ZFP (Protein ID: 6) gave good yield of protein expression and purification.
FIG. 3 shows the results of a SNAPtide assay of the in vitro activity of cell-penetrating BoNTA proteins. Positive control is commercially available recombinant BoNTA light chain (BoNTA-LC, R&D Systems). Mock is the SNAPtide alone reaction. Protein IDs 1-8 have the sequences of SEQ ID NO:10-17 (Table 4), respectively
FIG. 4 shows the results of a SNAPtide assay of the cell lysis of human dermal fibroblasts treated with cell-penetrating BoNTA proteins. Negative control is commercially available recombinant BoNTA-LC (R&D Systems). Protein IDs 5-6 have the sequences of SEQ ID NO:14-15 (Table 4), respectively
FIG. 5 presents representative images of the in vivo effects of cell-penetrating BoNTA proteins.
FIG. 6 presents scatter plots of digit abduction of mice treated with cell-penetrating BoNTA proteins. A, treated with 0.9% NaCl saline solution. B, injected with BOTOX. C, pre-treated with microneedle and then treated with BOTOX. D, pre-treated with microneedle and then treated with cell-penetrating BoNTA-ZFP (Protein ID 6). E, treated with cell-penetrating BoNTA-ZFP (Protein ID 6) without microneedle pre-treatment.
FIG. 7 shows expression of BoNTA-ZFP (Protein ID 6) in insect cells. M, protein marker. T, total cell lysate. S, soluble fraction. +, loading control.
FIG. 8 presents testing results from a treadmill study for analyzing the muscle paralyzing activity of BoNTA-ZFP.
FIG. 9 presents testing results from a beam balance study for analyzing the muscle paralyzing activity of BoNTA-ZFP.
FIG. 10 presents testing results from a footprint study for analyzing the muscle paralyzing activity of BoNTA-ZFP.
It is to be noted that the term “a” or “an” entity refers to one or more of that entity; for example, “an antibody,” is understood to represent one or more antibodies. As such, the terms “a” (or “an”), “one or more,” and “at least one” can be used interchangeably herein.
As used herein, the term “polypeptide” is intended to encompass a singular “polypeptide” as well as plural “polypeptides,” and refers to a molecule composed of monomers (amino acids) linearly linked by amide bonds (also known as peptide bonds). The term “polypeptide” refers to any chain or chains of two or more amino acids, and does not refer to a specific length of the product. Thus, peptides, dipeptides, tripeptides, oligopeptides, “protein,” “amino acid chain,” or any other term used to refer to a chain or chains of two or more amino acids, are included within the definition of “polypeptide,” and the term “polypeptide” may be used instead of, or interchangeably with any of these terms. The term “polypeptide” is also intended to refer to the products of post-expression modifications of the polypeptide, including without limitation glycosylation, acetylation, phosphorylation, amidation, derivatization by known protecting/blocking groups, proteolytic cleavage, or modification by non-naturally occurring amino acids. A polypeptide may be derived from a natural biological source or produced by recombinant technology, but is not necessarily translated from a designated nucleic acid sequence. It may be generated in any manner, including by chemical synthesis.
The term “isolated” as used herein with respect to cells, nucleic acids, such as DNA or RNA, refers to molecules separated from other DNAs or RNAs, respectively, that are present in the natural source of the macromolecule. The term “isolated” as used herein also refers to a nucleic acid or peptide that is substantially free of cellular material, viral material, or culture medium when produced by recombinant DNA techniques, or chemical precursors or other chemicals when chemically synthesized. Moreover, an “isolated nucleic acid” is meant to include nucleic acid fragments which are not naturally occurring as fragments and would not be found in the natural state. The term “isolated” is also used herein to refer to cells or polypeptides which are isolated from other cellular proteins or tissues. Isolated polypeptides is meant to encompass both purified and recombinant polypeptides.
As used herein, the term “recombinant” as it pertains to polypeptides or polynucleotides intends a form of the polypeptide or polynucleotide that does not exist naturally, a non-limiting example of which can be created by combining polynucleotides or polypeptides that would not normally occur together.
“Homology” or “identity” or “similarity” refers to sequence similarity between two peptides or between two nucleic acid molecules. Homology can be determined by comparing a position in each sequence which may be aligned for purposes of comparison. When a position in the compared sequence is occupied by the same base or amino acid, then the molecules are homologous at that position. A degree of homology between sequences is a function of the number of matching or homologous positions shared by the sequences. An “unrelated” or “non-homologous”sequence shares less than 40% identity, though preferably less than 25% identity, with one of the sequences of the present disclosure.
A polynucleotide or polynucleotide region (or a polypeptide or polypeptide region) has a certain percentage (for example, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 98% or 99%) of “sequence identity” to another sequence means that, when aligned, that percentage of bases (or amino acids) are the same in comparing the two sequences.
The term “an equivalent nucleic acid or polynucleotide” refers to a nucleic acid having a nucleotide sequence having a certain degree of homology, or sequence identity, with the nucleotide sequence of the nucleic acid or complement thereof. A homolog of a double stranded nucleic acid is intended to include nucleic acids having a nucleotide sequence which has a certain degree of homology with or with the complement thereof. In one aspect, homologs of nucleic acids are capable of hybridizing to the nucleic acid or complement thereof. Likewise, “an equivalent polypeptide” refers to a polypeptide having a certain degree of homology, or sequence identity, with the amino acid sequence of a reference polypeptide. In some aspects, the sequence identity is at least about 70%, 75%, 80%, 85%, 90%, 95%, 98%, or 99%. In some aspects, the equivalent polypeptide or polynucleotide has one, two, three, four or five addition, deletion, substitution and their combinations thereof as compared to the reference polypeptide or polynucleotide. In some aspects, the equivalent sequence retains the activity (e.g., epitope-binding) or structure (e.g., salt-bridge) of the reference sequence.
Hybridization reactions can be performed under conditions of different “stringency”. In general, a low stringency hybridization reaction is carried out at about 40° C. in about 10×SSC or a solution of equivalent ionic strength/temperature. A moderate stringency hybridization is typically performed at about 50° C. in about 6×SSC, and a high stringency hybridization reaction is generally performed at about 60° C. in about 1×SSC. Hybridization reactions can also be performed under “physiological conditions” which is well known to one of skill in the art. A non-limiting example of a physiological condition is the temperature, ionic strength, pH and concentration of Mg2+ normally found in a cell.
A polynucleotide is composed of a specific sequence of four nucleotide bases: adenine (A); cytosine (C); guanine (G); thymine (T); and uracil (U) for thymine when the polynucleotide is RNA. Thus, the term “polynucleotide sequence” is the alphabetical representation of a polynucleotide molecule. This alphabetical representation can be input into databases in a computer having a central processing unit and used for bioinformatics applications such as functional genomics and homology searching. The term “polymorphism” refers to the coexistence of more than one form of a gene or portion thereof. A portion of a gene of which there are at least two different forms, i.e., two different nucleotide sequences, is referred to as a “polymorphic region of a gene”. A polymorphic region can be a single nucleotide, the identity of which differs in different alleles.
The terms “polynucleotide” and “oligonucleotide” are used interchangeably and refer to a polymeric form of nucleotides of any length, either deoxyribonucleotides or ribonucleotides or analogs thereof. Polynucleotides can have any three-dimensional structure and may perform any function, known or unknown. The following are non-limiting examples of polynucleotides: a gene or gene fragment (for example, a probe, primer, EST or SAGE tag), exons, introns, messenger RNA (mRNA), transfer RNA, ribosomal RNA, ribozymes, cDNA, dsRNA, siRNA, miRNA, recombinant polynucleotides, branched polynucleotides, plasmids, vectors, isolated DNA of any sequence, isolated RNA of any sequence, nucleic acid probes and primers. A polynucleotide can comprise modified nucleotides, such as methylated nucleotides and nucleotide analogs. If present, modifications to the nucleotide structure can be imparted before or after assembly of the polynucleotide. The sequence of nucleotides can be interrupted by non-nucleotide components. A polynucleotide can be further modified after polymerization, such as by conjugation with a labeling component. The term also refers to both double- and single-stranded molecules. Unless otherwise specified or required, any embodiment of this disclosure that is a polynucleotide encompasses both the double-stranded form and each of two complementary single-stranded forms known or predicted to make up the double-stranded form.
The term “encode” as it is applied to polynucleotides refers to a polynucleotide which is said to “encode” a polypeptide if, in its native state or when manipulated by methods well known to those skilled in the art, it can be transcribed and/or translated to produce the mRNA for the polypeptide and/or a fragment thereof. The antisense strand is the complement of such a nucleic acid, and the encoding sequence can be deduced therefrom.
As used herein the term “disulfide bond” includes the covalent bond formed between two sulfur atoms. The amino acid cysteine comprises a thiol group that can form a disulfide bond or bridge with a second thiol group.
As used herein, the terms “treat” or “treatment” refer to both therapeutic treatment and prophylactic or preventative measures, wherein the object is to prevent or slow down (lessen) an undesired physiological change or disorder, such as undesired wrinkles. Beneficial or desired clinical results include, but are not limited to, alleviation of symptoms, diminishment of extent of disease, stabilized (i.e., not worsening) state of disease, delay or slowing of disease progression, amelioration or palliation of the disease state, and remission (whether partial or total), whether detectable or undetectable. “Treatment” can also mean prolonging survival as compared to expected survival if not receiving treatment. Those in need of treatment include those already with the condition or disorder as well as those prone to have the condition or disorder or those in which the condition or disorder is to be prevented.
By “subject” or “individual” or “animal” or “patient” or “mammal,” is meant any subject, particularly a mammalian subject, for whom diagnosis, prognosis, or therapy is desired. Mammalian subjects include humans, domestic animals, farm animals, and zoo, sport, or pet animals such as dogs, cats, guinea pigs, rabbits, rats, mice, horses, cattle, cows, and so on.
As used herein, phrases such as “to a patient in need of treatment” or “a subject in need of treatment” includes subjects, such as mammalian subjects, that would benefit from administration of an antibody or composition of the present disclosure used, e.g., for detection, for a diagnostic procedure and/or for treatment.
Chimeric Polypeptide with Zinc Finger Motifs
There is a need on the market for transdermal delivery of BoNT proteins. Transdermal delivery of proteins is inherently difficult, in particular across the skin. Skin is constituted by two layers of cells, known as epidermis and dermis. Epidermis, the topmost layer of skin, is stratified squamous epithelium composing of basal and differentiated keratinocytes. Keratinocytes are the major cell types in epidermis. Keratinocytes in the basal stratum can proliferate through mitosis and undergo multiple cell differentiation stages to become anucleated cells. Anucleated or differentiated keratinocytes are highly organized tissue structure, secreting keratin proteins and lipids, which provide a protective barrier against invading substances such as pathogens.
There has been no success in developing transdermal BoNT compositions. The present disclosure, however, shows that fusion of a BoNT polypeptide to one or more zinc finger motifs (or zinc finger protein domains, or ZFP) can enable the BoNT to penetrate skins. Zinc finger proteins are naturally occurring transcription factors and can be reprogrammed to recognize targeted genomic loci. Zinc finger nucleases-chimeric proteins containing an N-terminal ZFP domain and C-terminal Fok I endonuclease domain-have been shown to be intrinsically cell-permeable. Some of the ZFP include a Cys2-His2 ZFP domain. Cys2-His2 ZFPs consist of approximately 30 amino acids with a ββα configuration.
This discovery is surprising and unexpected at least for the following reasons. First, the ability to delivering a large protein across animal skin efficiently is itself surprising and unexpected; in particular, it was known that ZFP's cell-penetrating activity is energy-dependent, meaning very limited efficiency, if any at all, would have been expected on stratum corneum, which is the outmost layer of skin that is formed by dead corneocytes which, even if disrupted by physical or chemical means, still constitute an insurmountable barrier to typical biological molecules.
Second, ZFPs are zinc-dependent metalloproteases, and it is also known that the activity of botulinum toxin requires zinc as it can be inhibited by protease inhibitors and zinc chelators. Since both ZFPs and BoNT require the incorporation of zinc ions, it was suspected that the presence of both ZFPs and BoNT in a fusion protein would result in interference between them, leading to decreased activity or even inactivation.
In this context, the instant inventor envisioned that fusing the ZFP at the C-terminal direction of the BoNT could avoid or reduce such interference. In addition or alternatively, the use of a bipartite (tandem) ZFP could ensure that the activity of the ZFP is maintained.
Third, as demonstrated in the experimental examples, the BoNT-ZFP fusion proteins were expressed in high volume from bacterial cells, much higher than when BoNT was fused with TAT or Pep-1, two commonly investigated cell penetration peptides. There was no suggestion to this effect and thus this was unexpected as well.
Finally, not only did the expressed BoNT-ZFP fusion proteins exhibit high enzymatic activities (see, e.g., FIG. 3), they also retained such activities after crossing the cell member into the intracellular space (see, e.g., FIG. 4). Still further, when used in an in vivo setting, the topically applied BoNTA-ZFP fusion proteins, preferably on microneedle-treated animal skin, caused muscle paralysis just like the injected BoNTA. This was also surprising as there was no expectation in the art that such therapeutic effects could be achieved with a topical formulation.
In accordance with one embodiment of the present disclosure, therefore, provided is a chimeric (or fusion) polypeptide comprising (a) a botulinum toxin (BoNT) light chain and (b) a zinc finger motif located to the C-terminal of the BoNT light chain.
Also provided, in one embodiment, is a chimeric (or fusion) polypeptide comprising (a) a botulinum toxin (BoNT) light chain (b) a BoNT heavy chain, and (c) a zinc finger motif located to the C-terminal of the BoNT heavy chain. In some embodiments, the light chain and the heavy chain are on the same peptide chain. In some embodiments, the light chain is at the N-terminal side of the heavy chain. In some embodiments, the light chain is at the C-terminal side of the heavy chain. In some embodiments, the light chain and the heavy chain are on different peptide chains and are connected with a disulfide bond.
Also provided, in some embodiments, are chimeric polypeptides comprising a botulinum toxin (BoNT) light chain and at least a zinc finger motif. In one embodiment, the chimeric polypeptides further include a BoNT heavy chain.
The total size of the chimeric polypeptide, in some embodiments, is not greater than 5000 amino acid residues, or alternatively not greater than 4000 amino acid residues, not greater than 3000 amino acid residues, not greater than 2000 amino acid residues, not greater than 1800 amino acid residues, not greater than 1600 amino acid residues, not greater than 1500 amino acid residues, not greater than 1400 amino acid residues, not greater than 1300 amino acid residues, not greater than 1200 amino acid residues, not greater than 1100 amino acid residues, not greater than 1000 amino acid residues, not greater than 900 amino acid residues, not greater than 800 amino acid residues, not greater than 700 amino acid residues, not greater than 600 amino acid residues, not greater than 500 amino acid residues, not greater than 450 amino acid residues, not greater than 400 amino acid residues, not greater than 350 amino acid residues, not greater than 300 amino acid residues, not greater than 250 amino acid residues, or not greater than 200 amino acid residues.
There are at least seven types of botulinum toxin, named type A-G. Type A and B are capable of causing disease in humans, and are also used commercially and medically. Types C-G are less common. Botulinum toxin types A and B are used in medicine to treat various muscle spasms and diseases characterized by overactive muscle. Each BoNT serotype may also have subtypes. For instance, the following subtypes are known: BoNT A1-A10, B1-B8, E1-E9, and F1-F7.
The term BoNT or a particular type or subtype thereof also encompasses their equivalent polynucleotides as well, such as those having certain level (e.g., at least 85%, 90%, 95%, 98%, or 99%) of sequence identity or modified with one or more amino acid residue addition, deletion or substitutions. In some embodiments, the substitutions are conservative amino acid substitutions.
A “conservative amino acid substitution” is one in which the amino acid residue is replaced with an amino acid residue having a similar side chain. Families of amino acid residues having similar side chains have been defined in the art, including basic side chains (e.g., lysine, arginine, histidine), acidic side chains (e.g., aspartic acid, glutamic acid), uncharged polar side chains (e.g., glycine, asparagine, glutamine, serine, threonine, tyrosine, cysteine), nonpolar side chains (e.g., alanine, valine, leucine, isoleucine, proline, phenylalanine, methionine, tryptophan), beta-branched side chains (e.g., threonine, valine, isoleucine) and aromatic side chains (e.g., tyrosine, phenylalanine, tryptophan, histidine). Thus, a nonessential amino acid residue in a polypeptide is preferably replaced with another amino acid residue from the same side chain family. In another embodiment, a string of amino acids can be replaced with a structurally similar string that differs in order and/or composition of side chain family members.
Non-limiting examples of conservative amino acid substitutions are provided in the table below, where a similarity score of 0 or higher indicates conservative substitution between the two amino acids.
| TABLE 1A |
| Amino Acid Similarity Matrix |
| C | G | P | S | A | T | D | E | N | Q | H | K | R | V | M | I | L | F | Y | W | |
| W | −8 | −7 | −6 | −2 | −6 | −5 | −7 | −7 | −4 | −5 | −3 | −3 | 2 | −6 | −4 | −5 | −2 | 0 | 0 | 17 |
| Y | 0 | −5 | −5 | −3 | −3 | −3 | −4 | −4 | −2 | −4 | 0 | −4 | −5 | −2 | −2 | −1 | −1 | 7 | 10 | |
| F | −4 | −5 | −5 | −3 | −4 | −3 | −6 | −5 | −4 | −5 | −2 | −5 | −4 | −1 | 0 | 1 | 2 | 9 | ||
| L | −6 | −4 | −3 | −3 | −2 | −2 | −4 | −3 | −3 | −2 | −2 | −3 | −3 | 2 | 4 | 2 | 6 | |||
| I | −2 | −3 | −2 | −1 | −1 | 0 | −2 | −2 | −2 | −2 | −2 | −2 | −2 | 4 | 2 | 5 | ||||
| M | −5 | −3 | −2 | −2 | −1 | −1 | −3 | −2 | 0 | −1 | −2 | 0 | 0 | 2 | 6 | |||||
| V | −2 | −1 | −1 | −1 | 0 | 0 | −2 | −2 | −2 | −2 | −2 | −2 | −2 | 4 | ||||||
| R | −4 | −3 | 0 | 0 | −2 | −1 | −1 | −1 | 0 | 1 | 2 | 3 | 6 | |||||||
| K | −5 | −2 | −1 | 0 | −1 | 0 | 0 | 0 | 1 | 1 | 0 | 5 | ||||||||
| H | −3 | −2 | 0 | −1 | −1 | −1 | 1 | 1 | 2 | 3 | 6 | |||||||||
| Q | −5 | −1 | 0 | −1 | 0 | −1 | 2 | 2 | 1 | 4 | ||||||||||
| N | −4 | 0 | −1 | 1 | 10 | 0 | 2 | 1 | 2 | |||||||||||
| E | −5 | 0 | −1 | 0 | 0 | 0 | 3 | 4 | ||||||||||||
| D | −5 | 1 | −1 | 0 | 0 | 0 | 4 | |||||||||||||
| T | −2 | 0 | 0 | 1 | 1 | 3 | ||||||||||||||
| A | −2 | 1 | 1 | 1 | 2 | |||||||||||||||
| S | 0 | 1 | 1 | 1 | ||||||||||||||||
| P | −3 | −1 | 6 | |||||||||||||||||
| G | −3 | 5 | ||||||||||||||||||
| C | 12 | |||||||||||||||||||
| TABLE 1B |
| Conservative Amino Acid Substitutions |
| For Amino Acid | Substitution With |
| Alanine | D-Ala, Gly, Aib, β-Ala, L-Cys, D-Cys |
| Arginine | D-Arg, Lys, D-Lys, Orn D-Orn |
| Asparagine | D-Asn, Asp, D-Asp, Glu, D-Glu Gln, D-Gln |
| Aspartic Acid | D-Asp, D-Asn, Asn, Glu, D-Glu, Gln, D-Gln |
| Cysteine | D-Cys, S-Me-Cys, Met, D-Met, Thr, D-Thr, |
| L-Ser, D-Ser | |
| Glutamine | D-Gln, Asn, D-Asn, Glu, D-Glu, Asp, D-Asp |
| Glutamic Acid | D-Glu, D-Asp, Asp, Asn, D-Asn, Gln, D-Gln |
| Glycine | Ala, D-Ala, Pro, D-Pro, Aib, β-Ala |
| Isoleucine | D-Ile, Val, D-Val, Leu, D-Leu, Met, D-Met |
| Leucine | Val, D-Val, Met, D-Met, D-Ile, D-Leu, Ile |
| Lysine | D-Lys, Arg, D-Arg, Orn, D-Orn |
| Methionine | D-Met, S-Me-Cys, Ile, D-Ile, Leu, D-Leu, |
| Val, D-Val | |
| Phenylalanine | D-Phe, Tyr, D-Tyr, His, D-His, Trp, D-Trp |
| Proline | D-Pro |
| Serine | D-Ser, Thr, D-Thr, allo-Thr, L-Cys, D-Cys |
| Threonine | D-Thr, Ser, D-Ser, allo-Thr, Met, D-Met, |
| Val, D-Val | |
| Tyrosine | D-Tyr, Phe, D-Phe, His, D-His, Trp, D-Trp |
| Valine | D-Val, Leu, D-Leu, Ile, D-Ile, Met, D-Met |
In some embodiments, an BoNT peptide includes no more than one, no more than two, or no more than three of the above substitutions from a natural BoNT peptide.
Non-limiting examples of BoNT light chains include SEQ ID NO: 8 (a BoNT A light chain) and amino sequences having at least 90% (or at least 95%, at least 98% or at least 99%) sequence identity to SEQ ID NO: 8. Non-limiting examples of BoNT heavy chains include SEQ ID NO: 9 (a BoNT A heavy chain) and amino sequences having at least 90% (or at least 95%, at least 98% or at least 99%) sequence identity to SEQ ID NO: 9. The amino acid sequences of SEQ ID NO: 8 and 9 are provided in Table 2 below.
| TABLE 2 |
| Representative BoNT sequences |
| Name | Sequence | SEQ ID NO: |
| BoNTA | MPFVNKQFNYKDPVNGVDIAYIKIPNVGQMQPVKAFKIHNKIWVIPERDT | 8 |
| light | FTNPEEGDLNPPPEAKQVPVSYYDSTYLSTDNEKDNYLKGVTKLFERIYS | |
| chain | TDLGRMLLTSIVRGIPFWGGSTIDTELKVIDTNCINVIQPDGSYRSEELN | |
| LVIIGPSADIIQFECKSFGHEVLNLTRNGYGSTQYIRFSPDFTFGFEESL | ||
| EVDTNPLLGAGKFATDPAVTLAHELIHAGHRLYGIAINPNRVFKVNTNAY | ||
| YEMSGLEVSFEELRTFGGHDAKFIDSLQENEFRLYYYNKFKDIASTLNKA | ||
| KSIVGTTASLQYMKNVFKEKYLLSEDTSGKFSVDKLKFDKLYKMLTEIYT | ||
| EDNFVKFFKVLNRKTYLNFDKAVFKINIVPKVNYTIYDGENLRNTNLAAN | ||
| FNGQNTEINNMNFTKLKNFTGLFEF | ||
| BoNTA | YKLLCVRGIITSKTKSLDKGYNKALNDLCIKVNNWDLFFSPSEDNFINDL | 9 |
| heavy | NKGEEITSDTNIEAAEENISLDLIQQYYLTFNFDNEPENISIENLSSDII | |
| chain | GQLELMPNIERFPNGKKYELDKYTMFHYLRAQEFEHGKSRIALTNSVNEA | |
| LLNPSRVYTFFSSDYVKKVNKATEAAMFLGWVEQLVYDFTDETSEVSTTD | ||
| KIADITIIIPYIGPALNIGNMLYKDDFVGALIFSGAVILLEFIPEIAIPV | ||
| LGTFALVSYIANKVLTVQTIDNALSKRNEKWDEVYKYIVTNWLAKVNTQI | ||
| DLIRKKMKEALENQAEATKAIINYQYNQYTEEEKNNINFNIDDLSSKLNE | ||
| SINKAMININKFLNQCSVSYLMNSMIPYGVKRLEDFDASLKDALLKYIYD | ||
| NRGTLIGQVDRLKDKVNNTLSTDIPFQLSKYVDNQRLLSTFTEYIKNIIN | ||
| TSILNLRYESNHLIDLSRYASKINIGSKVNFDPIDKNQIQLENLESSKIE | ||
| VILKNAIVYNSMYENFSTSFWIRIPKYENSISLNNEYTIINCMENNSGWK | ||
| VSLNYGEIIWTLQDTQEIKQRVVFKYSQMINISDYINRWIFVTITNNRLN | ||
| NSKIYINGRLIDQKPISNLGNIHASNNIMFKLDGCRDTHRYIWIKYFNLF | ||
| DKELNEKEIKDLYDNQSNSGILKDFWGDYLQYDKPYYMLNLYDPNKYVDV | ||
| NNVGIRGYMYLKGPRGSVMTTNIYLNSSLYRGTKFIIKKYASGNKDNIVR | ||
| NNDRVYINVVVKNKEYRLATNASQAGVEKILSALEIPDVGNLSQVVVMKS | ||
| KNDQGITNKCKMNLQDNNGNDIGFIGFHQFNNIAKLVASNWYNRQIERSS | ||
| RTLGCSWEFIPVDDGWGERPL | ||
A “zinc finger motif” is a small protein structural motif that is characterized by the coordination of one or more zinc ions in order to stabilize the fold. In general, zinc fingers coordinate zinc ions with a combination of cysteine and histidine residues. The number and order of these residues can be used to classify different types of zinc fingers (e.g., Cys2His2, Cys4, and Cys6). Yet another method classifies zinc finger proteins into fold groups based on the overall shape of the protein backbone in the folded domain. The most common fold groups of zinc fingers are the Cys2His2 (the classic zinc finger), treble clef, zinc ribbon, gag knuckle, Zn2/Cys6, and TAZ2 domain like.
The Cys2His2 fold group adopts a simple ββα fold and has the amino acid sequence motif:
| X2-Cys-X2,4-Cys-X12-His-X3,4,5-His. |
Individual zinc finger domains can occur as tandem repeats with two, three, or more fingers comprising the DNA-binding domain of the protein.
The zinc finger motifs can be modified to remove or reduce their ability to bind to DNA. For instance, a modified Cys2His2 contains at least an alanine at residues −1, 2, 3 or 6 of the alpha-helical fragment in the zinc finger motif. Non-limiting examples of zinc finger motifs are shown in Table 3 below. Some of the sequences in Table 3, SEQ ID NO: 1 and 5-7, are individual zinc finger motifs, while a few others (tandem of zinc finger motifs), SEQ ID NO: 2-4, contain multiple concatenated zinc finger motifs. When two or more zinc fingers are used in tandem, they can be located right next to each other or linked via a peptide linker, i.e., a short peptide that is from 1, 2, or 3 amino acid resides to 2, 3, 4, 5, 6, 7, 8, 9 or 10 amino acid residues long). The modified alanine residues of SEQ ID NO: 1 are underlined and bolded.
| TABLE 3 |
| Example Zinc finger motifs (ZFP) |
| ZFP | Sequence | SEQ ID NO: |
| C2H2 ZFP | EKPYKCPECGKSFSASAALVAHQRTHTG | 1 |
| C2H2 ZFP2 | EKPYKCPECGKSFSASAALVAHQRTHTGEKPYKCPECGKSFSASAALVAH | 2 |
| QRTHTG | ||
| C2H2 ZFP3 | EKPYKCPECGKSFSASAALVAHQRTHTGEKPYKCPECGKSFSASAALVAH | 3 |
| QRTHTGEKPYKCPECGKSFSASAALVAHQRTHTG | ||
| C2H2 ZFP4 | EKPYKCPECGKSFSASAALVAHQRTHTGEKPYKCPECGKSFSASAALVAH | 4 |
| QRTHTGEKPYKCPECGKSFSASAALVAHQRTHTGEKPYKCPECGKSFSAS | ||
| AALVAHQRTHTG | ||
| Zn2/Cys6 ZFP | RIPLSCTICRKRKVKCDKLRPHCQQCTKTGVAHLCHYM | 5 |
| CCHC ZFP | TCYNCGQTGHLSRECPS | 6 |
| CCHC5 ZFP | RRCNCMATRHPLFEVAPNCLNCGKIICEKEGLQPCSYCGQELLSPKDKQE | 7 |
| II | ||
In some embodiments, the chimeric polypeptide further includes a zinc finger motif located to the N-terminal side of the BoNT light chain. In some embodiments, the chimeric polypeptide further includes a zinc finger motif at the N-terminal side of the BoNT heavy chain. In some embodiments, the chimeric polypeptide is a two-chain polypeptide and includes a zinc finger motif (or a tandem of two zinc fingers or three zinc fingers) at the C-terminal side of the BoNT light chain. In some embodiments, the chimeric polypeptide is a two-chain polypeptide and includes a zinc finger motif (or a tandem of two zinc fingers or three zinc fingers) at the C-terminal side of the BoNT light chain and a zinc finger motif (or a tandem of two zinc fingers or three zinc fingers) at the N-terminal side of the BoNT heavy chain.
In some embodiments, at least one of the zinc finger motifs is concatenated to at least one or two more zinc finger motif to form a bipartite or tripartite zinc finger motif structure (e.g., tandem zinc finger motifs). In some embodiment, the tandem zinc finger motifs have zero, one, two, three, four or five amino acid resides between them.
The distances between the BoNT light chain, heavy and the zinc finger motifs can be adjusted based on preferences and needs. In some embodiments, a zinc finger is not longer than 200 amino acid residues away from the N- or C-terminus of an adjacent BoNT light or heavy chain. In some embodiments, the distance is from 0 to about 150, from 5 to 100, from 10 to 75, from 10 to 50, from 10 to 40, from 10 to 30, from 10 to 20, from 20 to 150, from 20 to 100, from or 50, or from 50 to 100 amino acid resides. In some embodiments, distance is provided by inserting a spacer sequence (e.g., alanine's, glycine's, or the combinations thereof).
Non-limiting examples of chimeric polypeptide sequences are provided in SEQ ID NO: to 17 (Table 3). Some of these sequences include both a BoNT light chain and a BoNT heavy chain and these sequences encompass both the un-cleaved single-chain version and the cleaved two-chain version.
| TABLE 4 |
| Representative Chimeric Polypeptide Sequences |
| Name | Sequence | SEQ ID NO: |
| His- | MHHHHHHGGSGGSGGSMPFVNKQFNYKDPVNGVDIAYIKIPNVGQMQPVK | 10 |
| BoNTAFL | AFKIHNKIWVIPERDTFTNPEEGDLNPPPEAKQVPVSYYDSTYLSTDNEK | |
| DNYLKGVTKLFERIYSTDLGRMLLTSIVRGIPFWGGSTIDTELKVIDTNC | ||
| INVIQPDGSYRSEELNLVIIGPSADIIQFECKSFGHEVLNLTRNGYGSTQ | ||
| YIRFSPDFTFGFEESLEVDTNPLLGAGKFATDPAVTLAHELIHAGHRLYG | ||
| IAINPNRVFKVNTNAYYEMSGLEVSFEELRTFGGHDAKFIDSLQENEFRL | ||
| YYYNKFKDIASTLNKAKSIVGTTASLQYMKNVFKEKYLLSEDTSGKFSVD | ||
| KLKFDKLYKMLTEIYTEDNFVKFFKVLNRKTYLNFDKAVFKINIVPKVNY | ||
| TIYDGFNLRNTNLAANFNGQNTEINNMNFTKLKNFTGLFEFYKLLCVRGI | ||
| ITSKTKSLDKGYNKALNDLCIKVNNWDLFFSPSEDNFINDLNKGEEITSD | ||
| TNIEAAEENISLDLIQQYYLTFNFDNEPENISIENLSSDIIGQLELMPNI | ||
| ERFPNGKKYELDKYTMFHYLRAQEFEHGKSRIALTNSVNEALLNPSRVYT | ||
| FFSSDYVKKVNKATEAAMFLGWVEQLVYDFTDETSEVSTTDKIADITIII | ||
| PYIGPALNIGNMLYKDDFVGALIFSGAVILLEFIPEIAIPVLGTFALVSY | ||
| IANKVLTVQTIDNALSKRNEKWDEVYKYIVTNWLAKVNTQIDLIRKKMKE | ||
| ALENQAEATKAIINYQYNQYTEEEKNNINFNIDDLSSKLNESINKAMINI | ||
| NKFLNQCSVSYLMNSMIPYGVKRLEDFDASLKDALLKYIYDNRGTLIGQV | ||
| DRLKDKVNNTLSTDIPFQLSKYVDNQRLLSTFTEYIKNIINTSILNLRYE | ||
| SNHLIDLSRYASKINIGSKVNFDPIDKNQIQLENLESSKIEVILKNAIVY | ||
| NSMYENFSTSFWIRIPKYFNSISLNNEYTIINCMENNSGWKVSLNYGEII | ||
| WTLQDTQEIKQRVVFKYSQMINISDYINRWIFVTITNNRLNNSKIYINGR | ||
| LIDQKPISNLGNIHASNNIMFKLDGCRDTHRYIWIKYFNLFDKELNEKEI | ||
| KDLYDNQSNSGILKDFWGDYLQYDKPYYMLNLYDPNKYVDVNNVGIRGYM | ||
| YLKGPRGSVMTTNIYLNSSLYRGTKFIIKKYASGNKDNIVRNNDRVYINV | ||
| VVKNKEYRLATNASQAGVEKILSALEIPDVGNLSQVVVMKSKNDQGITNK | ||
| CKMNLQDNNGNDIGFIGFHQFNNIAKLVASNWYNRQIERSSRTLGCSWEF | ||
| IPVDDGWGERPL | ||
| His-ZFP3- | MHHHHHHGGSGGSGGSEKPYKCPECGKSFSASAALVAHQRTHTGEKPYKC | 11 |
| BoNTALC | PECGKSFSASAALVAHQRTHTGEKPYKCPECGKSFSASAALVAHQRTHTG | |
| GGSGGSGGSMPFVNKQFNYKDPVNGVDIAYIKIPNVGQMQPVKAFKIHNK | ||
| IWVIPERDTFTNPEEGDLNPPPEAKQVPVSYYDSTYLSTDNEKDNYLKGV | ||
| TKLFERIYSTDLGRMLLTSIVRGIPFWGGSTIDTELKVIDTNCINVIQPD | ||
| GSYRSEELNLVIIGPSADIIQFECKSFGHEVLNLTRNGYGSTQYIRFSPD | ||
| FTFGFEESLEVDTNPLLGAGKFATDPAVTLAHELIHAGHRLYGIAINPNR | ||
| VFKVNTNAYYEMSGLEVSFEELRTFGGHDAKFIDSLQENEFRLYYYNKFK | ||
| DIASTLNKAKSIVGTTASLQYMKNVFKEKYLLSEDTSGKFSVDKLKFDKL | ||
| YKMLTEIYTEDNFVKFFKVLNRKTYLNFDKAVFKINIVPKVNYTIYDGEN | ||
| LRNTNLAANFNGQNTEINNMNFTKLKNFTGLFEF | ||
| His-ZFP3- | MHHHHHHGGSGGSGGSEKPYKCPECGKSFSASAALVAHQRTHTGEKPYKC | 12 |
| BoNTAFL | PECGKSFSASAALVAHQRTHTGEKPYKCPECGKSFSASAALVAHQRTHTG | |
| GGSGGSGGSMPFVNKQFNYKDPVNGVDIAYIKIPNVGQMQPVKAFKIHNK | ||
| IWVIPERDTFTNPEEGDLNPPPEAKQVPVSYYDSTYLSTDNEKDNYLKGV | ||
| TKLFERIYSTDLGRMLLTSIVRGIPFWGGSTIDTELKVIDINCINVIQPD | ||
| GSYRSEELNLVIIGPSADIIQFECKSFGHEVLNLTRNGYGSTQYIRFSPD | ||
| FTFGFEESLEVDTNPLLGAGKFATDPAVTLAHELIHAGHRLYGIAINPNR | ||
| VFKVNTNAYYEMSGLEVSFEELRTFGGHDAKFIDSLQENEFRLYYYNKFK | ||
| DIASTLNKAKSIVGTTASLQYMKNVFKEKYLLSEDTSGKFSVDKLKFDKL | ||
| YKMLTEIYTEDNFVKFFKVLNRKTYLNFDKAVFKINIVPKVNYTIYDGEN | ||
| LRNTNLAANFNGQNTEINNMNFTKLKNFTGLFEFYKLLCVRGIITSKTKS | ||
| LDKGYNKALNDLCIKVNNWDLFFSPSEDNFTNDLNKGEEITSDTNIEAAE | ||
| ENISLDLIQQYYLTFNFDNEPENISIENLSSDIIGQLELMPNIERFPNGK | ||
| KYELDKYTMFHYLRAQEFEHGKSRIALTNSVNEALLNPSRVYTFFSSDYV | ||
| KKVNKATEAAMFLGWVEQLVYDFTDETSEVSTIDKIADITIIIPYIGPAL | ||
| NIGNMLYKDDFVGALIFSGAVILLEFIPEIAIPVLGTFALVSYIANKVLT | ||
| VQTIDNALSKRNEKWDEVYKYIVTNWLAKVNTQIDLIRKKMKEALENQAE | ||
| ATKAIINYQYNQYTEEEKNNINFNIDDLSSKLNESINKAMININKELNQC | ||
| SVSYLMNSMIPYGVKRLEDFDASLKDALLKYIYDNRGTLIGQVDRLKDKV | ||
| NNTLSTDIPFQLSKYVDNQRLLSTFTEYIKNIINTSILNLRYESNHLIDL | ||
| SRYASKINIGSKVNFDPIDKNQIQLENLESSKIEVILKNAIVYNSMYENF | ||
| STSFWIRIPKYFNSISLNNEYTIINCMENNSGWKVSLNYGEIIWTLQDTQ | ||
| EIKQRVVFKYSQMINISDYINRWIFVTITNNRLNNSKIYINGRLIDQKPI | ||
| SNLGNIHASNNIMFKLDGCRDTHRYIWIKYFNLFDKELNEKEIKDLYDNQ | ||
| SNSGILKDFWGDYLQYDKPYYMLNLYDPNKYVDVNNVGIRGYMYLKGPRG | ||
| SVMTTNIYLNSSLYRGTKFIIKKYASGNKDNIVRNNDRVYINVVVKNKEY | ||
| RLATNASQAGVEKILSALEIPDVGNLSQVVVMKSKNDQGITNKCKMNLQD | ||
| NNGNDIGFIGFHQFNNIAKLVASNWYNRQIERSSRTLGCSWEFIPVDDGW | ||
| GERPL | ||
| BoNTALC- | MPFVNKQFNYKDPVNGVDIAYIKIPNVGQMQPVKAFKIHNKIWVIPERDT | 13 |
| ZFP3-His | FTNPEEGDLNPPPEAKQVPVSYYDSTYLSTDNEKDNYLKGVTKLFERIYS | |
| TDLGRMLLTSIVRGIPFWGGSTIDTELKVIDTNCINVIQPDGSYRSEELN | ||
| LVIIGPSADIIQFECKSFGHEVLNLTRNGYGSTQYIRFSPDFTFGFEESL | ||
| EVDTNPLLGAGKFATDPAVTLAHELIHAGHRLYGIAINPNRVFKVNTNAY | ||
| YEMSGLEVSFEELRTFGGHDAKFIDSLQENEFRLYYYNKFKDIASTLNKA | ||
| KSIVGTTASLQYMKNVFKEKYLLSEDTSGKFSVDKLKFDKLYKMLTEIYT | ||
| EDNFVKFFKVLNRKTYLNFDKAVFKINIVPKVNYTIYDGENLRNTNLAAN | ||
| FNGQNTEINNMNFTKLKNFTGLFEFGGSGGSGGSEKPYKCPECGKSFSAS | ||
| AALVAHQRTHTGEKPYKCPECGKSFSASAALVAHQRTHTGEKPYKCPECG | ||
| KSFSASAALVAHQRTHTGGGSGGSGGSHHHHHH | ||
| BoNTAFL- | MPFVNKQFNYKDPVNGVDIAYIKIPNVGQMQPVKAFKIHNKIWVIPERDT | 14 |
| ZFP3-His | FTNPEEGDLNPPPEAKQVPVSYYDSTYLSTDNEKDNYLKGVTKLFERIYS | |
| TDLGRMLLTSIVRGIPFWGGSTIDTELKVIDTNCINVIQPDGSYRSEELN | ||
| LVIIGPSADIIQFECKSFGHEVLNLTRNGYGSTQYIRFSPDFTFGFEESL | ||
| EVDTNPLLGAGKFATDPAVTLAHELIHAGHRLYGIAINPNRVFKVNTNAY | ||
| YEMSGLEVSFEELRTFGGHDAKFIDSLQENEFRLYYYNKFKDIASTLNKA | ||
| KSIVGTTASLQYMKNVFKEKYLLSEDTSGKFSVDKLKFDKLYKMLTEIYT | ||
| EDNFVKFFKVLNRKTYLNFDKAVFKINIVPKVNYTIYDGENLRNTNLAAN | ||
| FNGQNTEINNMNFTKLKNFTGLFEFYKLLCVRGIITSKTKSLDKGYNKAL | ||
| NDLCIKVNNWDLFFSPSEDNFTNDLNKGEEITSDTNIEAAEENISLDLIQ | ||
| QYYLTFNFDNEPENISIENLSSDIIGQLELMPNIERFPNGKKYELDKYTM | ||
| FHYLRAQEFEHGKSRIALTNSVNEALLNPSRVYTFFSSDYVKKVNKATEA | ||
| AMFLGWVEQLVYDFTDETSEVSTIDKIADITIIIPYIGPALNIGNMLYKD | ||
| DFVGALIFSGAVILLEFIPEIAIPVLGTFALVSYIANKVLTVQTIDNALS | ||
| KRNEKWDEVYKYIVTNWLAKVNTQIDLIRKKMKEALENQAEATKAIINYQ | ||
| YNQYTEEEKNNINFNIDDLSSKLNESINKAMININKFLNQCSVSYLMNSM | ||
| IPYGVKRLEDFDASLKDALLKYIYDNRGTLIGQVDRLKDKVNNTLSTDIP | ||
| FQLSKYVDNQRLLSTFTEYIKNIINTSILNLRYESNHLIDLSRYASKINI | ||
| GSKVNFDPIDKNQIQLENLESSKIEVILKNAIVYNSMYENFSTSFWIRIP | ||
| KYFNSISLNNEYTIINCMENNSGWKVSLNYGEIIWTLQDTQEIKQRVVFK | ||
| YSQMINISDYINRWIFVTITNNRLNNSKIYINGRLIDQKPISNLGNIHAS | ||
| NNIMFKLDGCRDTHRYIWIKYFNLFDKELNEKEIKDLYDNQSNSGILKDF | ||
| WGDYLQYDKPYYMLNLYDPNKYVDVNNVGIRGYMYLKGPRGSVMTTNIYL | ||
| NSSLYRGTKFIIKKYASGNKDNIVRNNDRVYINVVVKNKEYRLATNASQA | ||
| GVEKILSALEIPDVGNLSQVVVMKSKNDQGITNKCKMNLQDNNGNDIGFI | ||
| GFHQFNNIAKLVASNWYNRQIERSSRTLGCSWEFIPVDDGWGERPLGGSG | ||
| GSGGSEKPYKCPECGKSFSASAALVAHQRTHTGEKPYKCPECGKSFSASA | ||
| ALVAHQRTHTGEKPYKCPECGKSFSASAALVAHQRTHTGGGSGGSGGSHH | ||
| HHHH | ||
| His-ZFP3- | MHHHHHHGGSGGSGGSEKPYKCPECGKSFSASAALVAHQRTHTGEKPYKC | 15 |
| BoNTAFL- | PECGKSFSASAALVAHQRTHTGEKPYKCPECGKSFSASAALVAHQRTHTG | |
| ZFP3 | GGSGGSGGSMPFVNKQFNYKDPVNGVDIAYIKIPNVGQMQPVKAFKIHNK | |
| IWVIPERDTFTNPEEGDLNPPPEAKQVPVSYYDSTYLSTDNEKDNYLKGV | ||
| TKLFERIYSTDLGRMLLTSIVRGIPFWGGSTIDTELKVIDTNCINVIQPD | ||
| GSYRSEELNLVIIGPSADIIQFECKSFGHEVLNLTRNGYGSTQYIRFSPD | ||
| FTFGFEESLEVDTNPLLGAGKFATDPAVTLAHELIHAGHRLYGIAINPNR | ||
| VFKVNTNAYYEMSGLEVSFEELRTFGGHDAKFIDSLQENEFRLYYYNKFK | ||
| DIASTLNKAKSIVGTTASLQYMKNVFKEKYLLSEDTSGKFSVDKLKEDKL | ||
| YKMLTEIYTEDNFVKFFKVLNRKTYLNFDKAVFKINIVPKVNYTIYDGEN | ||
| LRNTNLAANFNGQNTEINNMNFTKLKNFTGLFEFYKLLCVRGIITSKTKS | ||
| LDKGYNKALNDLCIKVNNWDLFFSPSEDNFTNDLNKGEEITSDTNIEAAE | ||
| ENISLDLIQQYYLTFNFDNEPENISIENLSSDIIGQLELMPNIERFPNGK | ||
| KYELDKYTMFHYLRAQEFEHGKSRIALTNSVNEALLNPSRVYTFFSSDYV | ||
| KKVNKATEAAMFLGWVEQLVYDFTDETSEVSTTDKIADITIIIPYIGPAL | ||
| NIGNMLYKDDFVGALIFSGAVILLEFIPEIAIPVLGTFALVSYIANKVLT | ||
| VQTIDNALSKRNEKWDEVYKYIVTNWLAKVNTQIDLIRKKMKEALENQAE | ||
| ATKAIINYQYNQYTEEEKNNINFNIDDLSSKLNESINKAMININKFLNQC | ||
| SVSYLMNSMIPYGVKRLEDFDASLKDALLKYIYDNRGTLIGQVDRLKDKV | ||
| NNTLSTDIPFQLSKYVDNQRLLSTFTEYIKNIINTSILNLRYESNHLIDL | ||
| SRYASKINIGSKVNFDPIDKNQIQLENLESSKIEVILKNAIVYNSMYENF | ||
| STSFWIRIPKYENSISLNNEYTIINCMENNSGWKVSLNYGEIIWTLQDTQ | ||
| EIKQRVVFKYSQMINISDYINRWIFVTITNNRLNNSKIYINGRLIDQKPI | ||
| SNLGNIHASNNIMFKLDGCRDTHRYIWIKYENLEDKELNEKEIKDLYDNQ | ||
| SNSGILKDFWGDYLQYDKPYYMLNLYDPNKYVDVNNVGIRGYMYLKGPRG | ||
| SVMTTNIYLNSSLYRGTKFIIKKYASGNKDNIVRNNDRVYINVVVKNKEY | ||
| RLATNASQAGVEKILSALEIPDVGNLSQVVVMKSKNDQGITNKCKMNLQD | ||
| NNGNDIGFIGFHQFNNIAKLVASNWYNRQIERSSRTLGCSWEFIPVDDGW | ||
| GERPLGGSGGSGGSEKPYKCPECGKSFSASAALVAHQRTHTGEKPYKCPE | ||
| CGKSFSASAALVAHQRTHTGEKPYKCPECGKSFSASAALVAHQRTHTG | ||
| His-TAT- | MHHHHHHGGSGGSGGSGRKKRRQRRRPQGGSGGSGGSMPFVNKQFNYKDP | 16 |
| BoNTAFL | VNGVDIAYIKIPNVGQMQPVKAFKIHNKIWVIPERDTFTNPEEGDLNPPP | |
| EAKQVPVSYYDSTYLSTDNEKDNYLKGVTKLFERIYSTDLGRMLLTSIVR | ||
| GIPFWGGSTIDTELKVIDTNCINVIQPDGSYRSEELNLVIIGPSADIIQF | ||
| ECKSFGHEVLNLTRNGYGSTQYIRFSPDFTFGFEESLEVDTNPLLGAGKF | ||
| ATDPAVTLAHELIHAGHRLYGIAINPNRVFKVNTNAYYEMSGLEVSFEEL | ||
| RTFGGHDAKFIDSLQENEFRLYYYNKFKDIASTLNKAKSIVGTTASLQYM | ||
| KNVFKEKYLLSEDTSGKFSVDKLKFDKLYKMLTEIYTEDNFVKFFKVLNR | ||
| KTYLNFDKAVFKINIVPKVNYTIYDGENLRNTNLAANENGQNTEINNMNF | ||
| TKLKNFTGLFEFYKLLCVRGIITSKTKSLDKGYNKALNDLCIKVNNWDLE | ||
| FSPSEDNFINDLNKGEEITSDTNIEAAEENISLDLIQQYYLTFNFDNEPE | ||
| NISIENLSSDIIGQLELMPNIERFPNGKKYELDKYTMFHYLRAQEFEHGK | ||
| SRIALTNSVNEALLNPSRVYTFFSSDYVKKVNKATEAAMFLGWVEQLVYD | ||
| FTDETSEVSTTDKIADITIIIPYIGPALNIGNMLYKDDFVGALIFSGAVI | ||
| LLEFIPEIAIPVLGTFALVSYIANKVLTVQTIDNALSKRNEKWDEVYKYI | ||
| VTNWLAKVNTQIDLIRKKMKEALENQAEATKAIINYQYNQYTEEEKNNIN | ||
| FNIDDLSSKLNESINKAMININKFLNQCSVSYLMNSMIPYGVKRLEDFDA | ||
| SLKDALLKYIYDNRGTLIGQVDRLKDKVNNTLSTDIPFQLSKYVDNQRLL | ||
| STFTEYIKNIINTSILNLRYESNHLIDLSRYASKINIGSKVNEDPIDKNQ | ||
| IQLFNLESSKIEVILKNAIVYNSMYENFSTSFWIRIPKYENSISLNNEYT | ||
| IINCMENNSGWKVSLNYGEIIWTLQDTQEIKQRVVFKYSQMINISDYINR | ||
| WIFVTITNNRLNNSKIYINGRLIDQKPISNLGNIHASNNIMFKLDGCRDT | ||
| HRYIWIKYFNLFDKELNEKEIKDLYDNQSNSGILKDFWGDYLQYDKPYYM | ||
| LNLYDPNKYVDVNNVGIRGYMYLKGPRGSVMTTNIYLNSSLYRGTKFIIK | ||
| KYASGNKDNIVRNNDRVYINVVVKNKEYRLATNASQAGVEKILSALEIPD | ||
| VGNLSQVVVMKSKNDQGITNKCKMNLQDNNGNDIGFIGFHQFNNIAKLVA | ||
| SNWYNRQIERSSRTLGCSWEFIPVDDGWGERPL | ||
| His-Pep1- | MHHHHHHGGSGGSGGSKETWWETWWTEWSQPKKKRKVGGSGGSGGSMPFV | 17 |
| BoNTAFL | NKQFNYKDPVNGVDIAYIKIPNVGQMQPVKAFKIHNKIWVIPERDTFTNP | |
| EEGDLNPPPEAKQVPVSYYDSTYLSTDNEKDNYLKGVTKLFERIYSTDLG | ||
| RMLLTSIVRGIPFWGGSTIDTELKVIDTNCINVIQPDGSYRSEELNLVII | ||
| GPSADIIQFECKSFGHEVLNLTRNGYGSTQYIRFSPDFTFGFEESLEVDT | ||
| NPLLGAGKFATDPAVTLAHELIHAGHRLYGIAINPNRVFKVNTNAYYEMS | ||
| GLEVSFEELRTFGGHDAKFIDSLQENEFRLYYYNKFKDIASTLNKAKSIV | ||
| GTTASLQYMKNVFKEKYLLSEDTSGKFSVDKLKFDKLYKMLTEIYTEDNF | ||
| VKFFKVLNRKTYLNFDKAVFKINIVPKVNYTIYDGENLRNTNLAANENGQ | ||
| NTEINNMNFTKLKNFTGLFEFYKLLCVRGIITSKTKSLDKGYNKALNDLC | ||
| IKVNNWDLFFSPSEDNFINDLNKGEEITSDTNIEAAEENISLDLIQQYYL | ||
| TFNFDNEPENISIENLSSDIIGQLELMPNIERFPNGKKYELDKYTMFHYL | ||
| RAQEFEHGKSRIALTNSVNEALLNPSRVYTFFSSDYVKKVNKATEAAMFL | ||
| GWVEQLVYDFTDETSEVSTTDKIADITIIIPYIGPALNIGNMLYKDDFVG | ||
| ALIFSGAVILLEFIPEIAIPVLGTFALVSYIANKVLTVQTIDNALSKRNE | ||
| KWDEVYKYIVTNWLAKVNTQIDLIRKKMKEALENQAEATKAIINYQYNQY | ||
| TEEEKNNINFNIDDLSSKLNESINKAMININKFLNQCSVSYLMNSMIPYG | ||
| VKRLEDFDASLKDALLKYIYDNRGTLIGQVDRLKDKVNNTLSTDIPFQLS | ||
| KYVDNQRLLSTFTEYIKNIINTSILNLRYESNHLIDLSRYASKINIGSKV | ||
| NFDPIDKNQIQLFNLESSKIEVILKNAIVYNSMYENFSTSFWIRIPKYFN | ||
| SISLNNEYTIINCMENNSGWKVSLNYGEIIWTLQDTQEIKQRVVFKYSQM | ||
| INISDYINRWIFVTITNNRLNNSKIYINGRLIDQKPISNLGNIHASNNIM | ||
| FKLDGCRDTHRYIWIKYFNLFDKELNEKEIKDLYDNQSNSGILKDFWGDY | ||
| LQYDKPYYMLNLYDPNKYVDVNNVGIRGYMYLKGPRGSVMTTNIYLNSSL | ||
| YRGTKFIIKKYASGNKDNIVRNNDRVYINVVVKNKEYRLATNASQAGVEK | ||
| ILSALEIPDVGNLSQVVVMKSKNDQGITNKCKMNLQDNNGNDIGFIGFHQ | ||
| FNNIAKLVASNWYNRQIERSSRTLGCSWEFIPVDDGWGERPL | ||
It is further contemplated that the present technology is also applicable to other therapeutic peptide such as epidermal growth factor (EGF) and superoxide dismutase (SOD), without limitation. Accordingly, in one embodiment, the present disclosure provides a chimeric polypeptide comprising a therapeutic peptide and at least a zinc finger motif. In some embodiments, the zinc finger motif is located to the C-terminal side of the therapeutic peptide. In some embodiments, the zinc finger motif is no more than 100 amino acid residues (or no more than 90, 80, 70, 60, 50, 40, 30, 20, 10 or 5 amino acid residues) away from the therapeutic peptide. In some embodiments, the zinc finger motif is concatenated to another zinc finger motif to form a bipartite zinc finger motif. In some embodiments, the chimeric polypeptide includes a zinc finger motif (or bipartite one) at both the N-terminal side and the C-terminal side of the therapeutic peptide.
In some embodiments, the therapeutic peptide is selected from EGF and SOD, example sequences of which are shown in Table 5. Examples of zinc finger motifs, examples spacer sequences and distances between zinc finger motifs and the therapeutic peptides are also described herein.
| TABLE 5 |
| Representative Therapeutic Peptide Sequences |
| Name | Sequence | SEQ ID NO: |
| EGF | LEEKKVCQGTSNKLTQLGTFEDHFLSLQRMENNCEVVLGNLEITYVQRNY | 18 |
| DLSFLKTIQEVAGYVLIALNTVERIPLENLQIIRGNMYYENSYALAVLSN | ||
| YDANKTGLKELPMRNLQEILHGAVRFSNNPALCNVESIQWRDIVSSDELS | ||
| NMSMDFQNHLGSCQKCDPSCPNGSCWGAGEENCQKLTKIICAQQCSGRCR | ||
| GKSPSDCCHNQCAAGCTGPRESDCLVCRKFRDEATCKDTCPPLMLYNPTT | ||
| YQMDVNPEGKYSFGATCVKKCPRNYVVTDHGSCVRACGADSYEMEEDGVR | ||
| KCKKCEGPCRKVCNGIGIGEFKDSLSINATNIKHFKNCTSISGDLHILPV | ||
| AFRGDSFTHTPPLDPQELDILKTVKEITGELLIQAWPENRTDLHAFENLE | ||
| IIRGRTKQHGQFSLAVVSLNITSLGLRSLKEISDGDVIISGNKNLCYANT | ||
| INWKKLFGTSGQKTKIISNRGENSCKATGQVCHALCSPEGCWGPEPRDCV | ||
| SCRNVSRGRECVDKCNLLEGEPREFVENSECIQCHPECLPQAMNITCTGR | ||
| GPDNCIQCAHYIDGPHCVKTCPAGVMGENNTLVWKYADAGHVCHLCHPNC | ||
| TYGCTGPGLEGCPTNGPKIPSI | ||
| SOD | MKHSLPDLPYDYGALEPHINAQIMQLHHSKHHAAYVNNLNVTEEKYQEAL | 19 |
| AKGDVTAQIALQPALKENGGGHINHSIFWTNLSPNGGGEPKGELLEAIKR | ||
| DFGSFDKFKEKLTAASVGVQGSGWGWLGENKERGHLQIAACPNQDPLQGT | ||
| TGLIPLLGIDVWEHAYYLQYKNVRPDYLKAIWNVINWENVTERYMACKK | ||
In some embodiments, the polypeptides may be conjugated to therapeutic agents, prodrugs, peptides, proteins, enzymes, viruses, lipids, biological response modifiers, pharmaceutical agents, or PEG. The polypeptides may be conjugated or fused to a therapeutic agent, which may include detectable labels such as radioactive labels, an immunomodulator, a hormone, an enzyme, an oligonucleotide, a photoactive therapeutic or diagnostic agent, a cytotoxic agent, which may be a drug or a toxin, an ultrasound enhancing agent, a non-radioactive label, a combination thereof and other such agents known in the art.
The polypeptides can be detectably labeled by coupling it to a chemiluminescent compound. The presence of the chemiluminescent-tagged antigen-binding polypeptide is then determined by detecting the presence of luminescence that arises during the course of a chemical reaction. Examples of particularly useful chemiluminescent labeling compounds are luminol, isoluminol, theromatic acridinium ester, imidazole, acridinium salt and oxalate ester.
The polypeptides can also be detectably labeled using fluorescence emitting metals such as 152Eu, or others of the lanthanide series. These metals can be attached to the antibody using such metal chelating groups as diethylenetriaminepentacetic acid (DTPA) or ethylenediaminetetraacetic acid (EDTA).
The present disclosure also provides isolated polynucleotides or nucleic acid molecules encoding the polypeptides, variants or derivatives thereof of the disclosure. The polynucleotides of the present disclosure may encode the entire heavy and light chain of the polypeptides, variants or derivatives thereof on the same polynucleotide molecule or on separate polynucleotide molecules. Additionally, the polynucleotides of the present disclosure may encode portions of the heavy and light chain of the polypeptides, variants or derivatives thereof on the same polynucleotide molecule or on separate polynucleotide molecules.
Polynucleotides encoding a fusion polypeptide or domains thereof can be inserted into an “expression vector.” The term “expression vector” refers to a genetic construct such as a plasmid, virus or other vehicle known in the art that can be engineered to contain a polynucleotide encoding a polypeptide of the disclosure. Such expression vectors are typically plasmids that contain a promoter sequence that facilitates transcription of the inserted genetic sequence in a host cell. The expression vector typically contains an origin of replication, and a promoter, as well as genes that allow phenotypic selection of the transformed cells (e.g., an antibiotic resistance gene). Various promoters, including inducible and constitutive promoters, can be utilized in the disclosure. Typically, the expression vector contains a replicon site and control sequences that are derived from a species compatible with the host cell.
Transformation or transfection of a host cell with a polynucleotide can be carried out using conventional techniques well known to those skilled in the art. For example, where the host cell is E. coli, competent cells that are capable of DNA uptake can be prepared using the CaCl2, MgCl2 RbCl methods known in the art. Alternatively, physical means, such as electroporation or microinjection can be used. Electroporation allows transfer of a polynucleotide into a cell by high voltage electric impulse. Additionally, polynucleotides can be introduced into host cells by protoplast fusion, using methods well known in the art. Suitable methods for transforming eukaryotic cells, such as electroporation and lipofection, also are known.
“Host cells” encompassed by of the disclosure are any cells in which the polynucleotides of the disclosure can be used to express the fusion polypeptide or functional domains thereof. The term also includes any progeny of a host cell. Host cells, which are useful, include bacterial cells (e.g., Clostridium botulinum), fungal cells (e.g., yeast cells), insect cells (e.g., Spodoptera), plant cells and animal cells. A fusion polypeptide of the disclosure can be produced by expression of polynucleotide encoding a fusion polypeptide in prokaryotes. These include, but are not limited to, microorganisms, such as bacteria transformed with recombinant bacteriophage DNA, plasmid DNA, or cosmid DNA expression vectors encoding a fusion polypeptide of the disclosure. Introduction of the construct into the host cell can be effected by calcium phosphate transfection, DEAE-Dextran mediated transfection, or electroporation.
The constructs can be expressed in Clostridium botulinum, which is where BoNT proteins are naturally produced. It is a surprising discovery of the present disclosure that the chimeric proteins containing a BoNT light chain and/or heavy chain can be efficiently produced in insect cells (e.g., Spodoptera frugiperda Sf9). Accordingly, in one embodiment, the host cell can be an insect cell, such as a Lepidoptera cell, a Noctuidae cell, a Spodoptera cell, and a Spodoptera frugiperda cell.
For long-term, high-yield production of recombinant proteins, stable expression is typically used. Rather than using expression vectors that contain viral origins of replication, host cells can be transformed with the cDNA encoding a fusion polypeptide of the disclosure controlled by appropriate expression control elements (e.g., promoter, enhancer, sequences, transcription terminators, polyadenylation sites, and the like), and a selectable marker. The selectable marker confers resistance to a selective killing agent and upon stable integration of the heterologous polynucleotide, allows growth of resistant cells. Such resistant cells grow to form foci that, in turn, can be cloned and expanded into cell lines.
As described herein, the zinc finger motif-containing chimeric (fusion) polypeptides of the present disclosure can be effectively delivered transdermally. Therefore, depending on the fused therapeutic protein, the chimeric polypeptides have therapeutic uses.
Chimeric polypeptides that include a BoNT light chain, optionally further with a BoNT heavy chain, have broad cosmetic and therapeutic applications. For cosmetic applications, such chimeric polypeptides can be useful for treating wrinkles, adjusting the corners of the mouth or lines from the upper lips. In therapeutics, the chimeric polypeptides can be useful for treating neurological disorders such as dystonias, sparsticity, hemifacial spasm, hyperhidrosis (excessive sweating), hypersalivation (excessive saliva). The chimeric polypeptides may also be used for urological disorders such as detrusor sphincter dyssynergia, idiopathic detrusor overactivity, neurogenic detrusor overactivity, urinary retention, anal fissures, benign prostate hyperplasia. Still further indications gastroenterological, otolaryngological disorders or other medical conditions. In some embodiments, the chimeric polypeptides are used for treating facial wrinkle, dystonias, sparsticity, hemifacial spasm, hyperhidrosis, or hypersalivation.
Chimeric polypeptides that include an EGF, in another example, can be used to treat conditions such as diabetic foot ulcers, or in general wound healing. Still in another example, a chimeric polypeptide that includes a SOD peptide can be used to reduce free radical damage to skin, e.g., to reduce fibrosis following radiation for breast cancer.
The topical application of the chimeric polypeptides can be carried out on a dermal position of a subject, such as on a skin or at a mucous membrane of an eye, ear, nose, mouth, lip, urethral opening, anus, or tongue. Specific examples of locations include, without limitation, face, neck, head, legs, shoulders, back, palms, feet, groin, axilla, elbow, arms, knee, buttocks, torso, and pelvis. Likewise, the chimeric polypeptides can also be administered intramuscularly at this locations.
In some embodiment, therefore, a method is provided administering a therapeutic peptide (e.g., BoNT, EGF or SOD) to a mammal subject, comprising topically or intramuscularly applying a formulation containing a chimeric polypeptide that includes a zinc finger motif and the therapeutic peptide to the mammal subject.
When the topically application is on a stratum corneum of a skin, in some embodiments, the stratum corneum is preferably disrupted. Disruption of the stratum corneum may be carried out with a needle, such as a microneedle as illustrated in the experimental examples. Alternatively, the application can be intramuscular.
A specific dosage and treatment regimen for any particular patient will depend upon a variety of factors, including the particular polypeptides, variant or derivative thereof used, the patient's age, body weight, general health, sex, and diet, and the time of administration, rate of excretion, drug combination, and the severity of the particular disease being treated. Judgment of such factors by medical caregivers is within the ordinary skill in the art. The amount will also depend on the individual patient to be treated, the route of administration, the type of formulation, the characteristics of the compound used, the severity of the disease, and the desired effect. The amount used can be determined by pharmacological and pharmacokinetic principles well known in the art.
The present disclosure also provides pharmaceutical compositions. Such compositions comprise an effective amount of a chimeric polypeptide, and an acceptable carrier.
In a specific embodiment, the term “pharmaceutically acceptable” means approved by a regulatory agency of the Federal or a state government or listed in the U.S. Pharmacopeia or other generally recognized pharmacopeia for use in animals, and more particularly in humans. Further, a “pharmaceutically acceptable carrier” will generally be a non-toxic solid, semisolid or liquid filler, diluent, encapsulating material or formulation auxiliary of any type.
The term “carrier” refers to a diluent, adjuvant, excipient, or vehicle with which the therapeutic is administered. Such pharmaceutical carriers can be sterile liquids, such as water and oils, including those of petroleum, animal, vegetable or synthetic origin, such as peanut oil, soybean oil, mineral oil, sesame oil and the like. Water is a preferred carrier when the pharmaceutical composition is administered intravenously. Saline solutions and aqueous dextrose and glycerol solutions can also be employed as liquid carriers, particularly for injectable solutions. Suitable pharmaceutical excipients include starch, glucose, lactose, sucrose, gelatin, malt, rice, flour, chalk, silica gel, sodium stearate, glycerol monostearate, talc, sodium chloride, dried skim milk, glycerol, propylene, glycol, water, ethanol and the like. The composition, if desired, can also contain minor amounts of wetting or emulsifying agents, or pH buffering agents such as acetates, citrates or phosphates. Antibacterial agents such as benzyl alcohol or methyl parabens; antioxidants such as ascorbic acid or sodium bisulfite; chelating agents such as ethylenediaminetetraacetic acid; and agents for the adjustment of tonicity such as sodium chloride or dextrose are also envisioned. These compositions can take the form of gels, creams, sprays, solutions, suspensions, emulsion, tablets, pills, capsules, powders, sustained-release formulations and the like. The composition can be formulated as a suppository, with traditional binders and carriers such as triglycerides.
Kits and packages are also provided in certain embodiments that includes a chimeric polypeptide, or a composition or formulation thereof, and instructions for using the chimeric polypeptide, composition or formulation. In some embodiments, the kit or package further includes a needle or microneedle for delivering the chimeric polypeptide, composition or formulation. As noted above, the microneedle can be useful for disrupting the stratum corneum of a skin thereby improving delivery.
Presently, the rat Digit Abduction Score (DAS) assay is the primary physiological model for assessing BoNT-induced skeletal muscle paralysis. This assay is not fully objective and is prone to errors. In some embodiments, the present disclosure describes new methods for quantitatively measuring BoNT-induced skeletal muscle paralysis in animals.
In one example, the animal, before or after receiving a testing agent, is placed on a treadmill. When the treadmill is started, the animal is forced to move as long as the animal is physically capable with a maximum running time of 30 min. The duration of the movement, distance or time, can quantitatively reflect the effect of the testing agent (with suitable controls such as animal without being give the testing agent).
In another example, the animal is placed on a balance beam on which the animal is instructed to walk to the other end. Muscle paralysis resulting in reduced capability to keep balance will be reflected by the time it takes for the animal to traverse the balance beam.
In yet another example, the footprint of the animal is measured, while standing or walking (e.g., on a treadmill). Sizes of the footprints can also be quantitative measurement of the degree of paralysis.
This experiment demonstrates that BoNTA-CPP (cell penetration peptide) fusion proteins can be expressed and purified from E. coli cells.
pET28b vectors containing different BoNTA constructs (Protein ID: 1-8; FIG. 1) were transformed into BL21(DE3) E. coli cells. The sequences of these constructs are provided in SEQ ID NO: 10-17. His6: histidine tag; BoNTA-LC: BoNT A light chain; BoNTA-HC: BoNT A heavy chain; ZFP2: tandem zinc finger peptides (SEQ ID NO: 1); TAT: transactivator of transcription peptide; Pep-1: pep-1 peptide. TAT and Pep-1 are known cell penetration peptides (CPP).
A single colony was picked from the agar plate and grown in 10 mL lysogeny broth (LB) medium supplemented with 50 μg/mL kanamycin and 90 μM ZnCl2 at 37° C. overnight. The next day, 10 mL of the starter culture was inoculated into 1 liter LB medium supplemented with 50 μg/mL kanamycin and 90 μM ZnCl2 and grown to an OD600 of 0.8. Protein expression was induced with 0.1 mM isopropyl-β-D-thiogalactopyranoside (IPTG) at 25° C. for 4 h. Cell pellet was harvested by centrifugation at 5,000 rpm for 10 min.
Cell pellet from 2 liter culture (approximately 30 gram) was resuspended in 200 mL BoNTA lysis buffer (20 mM HEPES, pH 7.0, 500 mM NaCl, 0.01% Triton X-100, lx protease cocktail (Roche) and 10% glycerol) and sonicated on ice for three times. Lysed cells were centrifuged at 25,000 g for 1 h at 4° C. and the supernatant was transferred to a new tube. To this supernatant was added 1 mL (settled volume) equilibrated Ni-NTA resins (Qiagen). BoNTA proteins containing His6 tag was allowed to bind with the resins for 30 min with rotation. The resins were transferred to a column and the flow-through was discarded. The resins were washed with 50 mL BoNTA wash buffer (20 mM HEPES, pH 7.0, 500 mM NaCl and 10% glycerol, 20 mM imidazole) and then eluted with 50 mL BoNTA elution buffer (20 mM HEPES, pH 7.0, 500 mM NaCl and 10% glycerol, 300 mM imidazole). The elution fractions were then concentrated and then further purified by ion exchange using start buffer (20 mM TrisHCl, pH 8.5) and end buffer (20 mM TrisHCl, pH 8.5, 1 M NaCl). The fractions with optimum purity were recombined, concentrated by spin concentrated, supplemented with 10% glycerol and then stored at −80° C. for further application.
One-step affinity purification yielded proteins with only modest purity. After the second-step ion exchange, the purity was largely enhanced. The overall yield was estimated to be 0.1 mg per liter culture and the purity of the final products was 90% (FIG. 2 panels A-B). Surprisingly, the fusion proteins with the ZFP had higher protein expression and purification yields than fusion with the cell penetration peptides (TAT and Pep-1, FIG. 2, panel A).
This example shows that BoNTA-CPP fusion proteins can be expressed as a recombinant protein from E. coli and purified by affinity purification followed by ion exchange.
This experiment demonstrates that the expressed BoNTA-CPP fusion proteins were active against BoNT substrate SNAP-25.
SNAPtide (Millipore, Cat. No. 567333-200NMOL) was diluted into 5 μM with reaction buffer (20 mM, pH 7.4, 0.25 mM ZnCl2, 5 mM DTT, 0.05% Tween-20). Each of the recombinant BoNTA-ZFP fusion proteins (200 nM; Protein ID: 1-8) was added into reaction buffer containing SNAPtide. The reaction was incubated at 37° C. for 40 min. The fluorescence was recorded using a plate reader with an excitation wavelength of 320 nm and an emission wavelength of 420 nm. The SNAPtide was a short peptide derived from SNAP-25, the intracellular substrate of BoNTA. SNAPtide contained the cleavage site of BoNTA and both a fluorophore and a quencher groups. Cleavage of the peptide frees the fluorophore and activates fluorescence. Reaction positive control was a commercially available recombinant BoNTA light chain (BoNTA-LC) protein purchased from R&D Systems (Cat. No. 4489-ZN-010). All data were performed in three replicates.
The data in FIG. 3 are shown as mean±standard deviation and analyzed by one-tailed Student's t test. All tested samples, including the commercial BoNTA-LC, have significantly (p<0.05) higher signals than SNAPtide control group. As shown in FIG. 3, both single-end and bipartite fusion of ZFP retained the activity of BoNTA on the peptide substrate derived from SNAP-25.
This experiment demonstrates that selected BoNTA-ZFP fusion proteins can effectively penetrate human dermal fibroblasts (hDF).
Transduction of hDF Cells with Recombinant BoNTA-ZFP Fusion Proteins
hDF cells were seeded on to 6-well plates pre-coated with poly-lysine. At 24 h after seeding, cells were washed with phosphate buffered saline (PBS) for three times. BoNTA-ZFP proteins (Protein ID 5 and 6) and control protein (R&D BoNTA-LC, a commercially available light chain of BoNTA from R&D Systems) were diluted with DMEM serum-free medium. Cells were treated with BoNTA-ZFP proteins (0.15 μM) and BoNTA-LC (0.5 μM) at 37° C. for 2 h. The cells were then washed three times with PBS supplemented with 0.5 mg/mL heparin to remove surface-bound proteins and then harvested by trypsin treatment. The collected cells were lysed by sonication and the BoNTA activity was assayed as described above.
The data as presented in FIG. 4 are shown as mean±standard deviation and analyzed by one-tailed Student's t test. hDF cells treated with BoNTA-ZFP proteins (Protein ID 5 and 6) exhibited evident BoNTA activity, with significantly higher signals than the control group (p<0.05). This demonstrates that BoNTA-ZFP proteins could penetrate cells effectively.
This experiment demonstrates that, when applied to intact or microneedle-treated mouse skin, BoNTA-ZFP fusion proteins can cause muscle paralysis, characterized by abduction of digits.
Fifteen C57 female mice with a weight of approximately 36 g were randomly divided into 5 groups (n=3). In all mice, the left legs were left untreated as a control and the right legs were treated with different drugs. Mice were anaesthetized before treatment. In mock group (A), mice were administrated with storage buffer (20 mM HEPES, pH 7.0, 300 mM NaCl and 10% glycerol). In BOTOX (Allergan) injection group (B), BOTOX was reconstituted with 0.9% NaCl saline as instructed and 5 μL of 45 U/mL solution was injected into the right legs. In group C, mice legs and feet were pre-treated with microneedle roller (RoHS MR20, 0.2 mm, house use) and then 60 μL of 45 U/mL BOTOX was topically applied. In group D, mice legs and feet were pre-treated with microneedle roller (RoHS MR20, 0.2 mm, house use) and then 60 μL of 0.05 mg/mL BoNTA-ZFP protein (Protein ID 6) in storage buffer (20 mM HEPES, pH 7.0, 300 mM NaCl and 10% glycerol) was topically applied. In group E, 60 μL of 0.05 mg/mL BoNTA-ZFP protein in storage buffer (20 mM HEPES, pH 7.0, 300 mM NaCl and 10% glycerol) was topically applied. Microneedle roller treatment was applied by rolling three times on legs and feet. When topically applied, legs and feet were uniformly spread with substances, massaged and then air dried, which was repeated for several times until all solution was administrated. Digit abduction was recorded after mice were awake at Day 0 and then recorded each day for the following four days.
Both injectable BOTOX and BoNTA-ZFP with microneedle pre-treatment exhibited notable digit abduction (FIG. 5), with significantly higher scores than control group A (p<0.05; Student's t test). Direct application of BoNTA-ZFP resulted in minimal effect. The digit abduction score (DAS) was evaluated by three independent researchers in a blinded manner. The DAS reached peak value at Day 2 (FIG. 6). This example therefore shows that when applied on to mouse skin, cell-penetrating BoNTA-ZFP can cause muscle paralysis, indicative of in vivo activity of SNAP-25 cleavage.
This experiment demonstrates that BoNTA-ZFP fusion proteins can be expressed in insect cells with high yield. Considering that the native BoNTs are produced from bacterium Clostridium botulinum (prokaryotes), the high-quantity production of BoNTA from insect cells (eukaryotes) is truly surprising.
pFastBac vectors containing Protein ID 6 (SEQ ID NO:15) was packaged into baculovirus (BV). BV containing recombinant Protein ID 6 protein was used to infect Spodoptera frugiperda Sf9 insect cells. Harvest cells when cell viability became below 60%. Approximately 1 mL of culture was centrifuged to collect cells. These cells were resuspended in 1 mL PBS buffer and sonicated. Approximately 10 μL of cell lysate was resolved on SDS-PAGE. The protein was detected using anti-His antibody and imaged.
The soluble BoNTA-ZF is near 100% of the total protein (FIG. 7). The amount of protein was quantified to be 1 μg as compared to the loading control (5 μg protein) (FIG. 7). Accordingly, the expression yield is calculated to be 100 mg per liter culture.
BoNTA-ZFP of varying dosage was intramuscularly injected into the right gastrocnemius muscle using a Hamilton syringe. The muscle paralysis was monitored as described in Example 4.
Intramuscular injection of 1 or 3 ng of BoNTA-ZFP (Protein ID 6) led to apparent digit abduction. A score of 4 was reached for all mice (n=3 per group).
This example tests a method for measuring the muscle-paralyzing activities of agents. Compared with the voluntary running study, this method can objectively reflect the muscle-paralyzing activity of cell-penetrating BoNTA-ZFP.
BoNTA-ZFP was topically applied on to CJ57 female mice as described in Example 4. Mice were subjected into the following sequence of settings for angle and speed: 0°/5 m/min, 3°/8 m/min, 6°/11 m/min, 9°/14 m/min, 12°/17 m/min, 12°/20 m/min. Mice were maintained at each step for 5 min. The total distance was counted.
Mice treated with Botox injection or topical BoNTA-ZFP exhibited reduced motion ability on treadmill study as compared to buffered saline (FIG. 8).
This example tests another method for measuring the muscle-paralyzing activities of agents.
BoNTA-ZFP was topically applied on to CJ57 female mice as described in Example 4. Mice were subjected into beam balance study. The time for mice to pass the beam was counted.
Mice treated with Botox injection or topical BoNTA-ZFP exhibited reduced motion ability on beam balance study as compared to buffered saline (FIG. 9).
This example tests yet another method for measuring the muscle-paralyzing activities of agents.
BoNTA-ZFP was topically applied on to CJ57 female mice as described in Example 4. Mice were subjected into footprint analysis study. The width for footprint was recorded.
Mice treated with Botox injection or topical BoNTA-ZFP exhibited reduced contact area on footprint analysis as compared to buffered saline (FIG. 10).
Examples 8-10 demonstrate the effectiveness and the quantitative nature of these tests for measuring the muscle-paralyzing activities of test agents.
The present disclosure is not to be limited in scope by the specific embodiments described which are intended as single illustrations of individual aspects of the disclosure, and any compositions or methods which are functionally equivalent are within the scope of this disclosure. It will be apparent to those skilled in the art that various modifications and variations can be made in the methods and compositions of the present disclosure without departing from the spirit or scope of the disclosure. Thus, it is intended that the present disclosure cover the modifications and variations of this disclosure provided they come within the scope of the appended claims and their equivalents.
All publications and patent applications mentioned in this specification are herein incorporated by reference to the same extent as if each individual publication or patent application was specifically and individually indicated to be incorporated by reference.
1. A chimeric polypeptide comprising (a) a botulinum toxin (BoNT) light chain, (b) a BoNT heavy chain, and (c) a cell penetration peptide located to the C-terminal of the BoNT light chain or located to the C-terminal to the BoNT heavy chain which is located C-terminal to the BoNT light chain or bound to the BoNT light chain through a disulfide bond.
2. The chimeric polypeptide of claim 1, wherein the chimeric polypeptide does not include more than 2000 amino acid residues.
3. The chimeric polypeptide of claim 1, wherein the BoNT light chain and the cell penetration peptide are on the same peptide chain.
4. The chimeric polypeptide of claim 1, wherein the BoNT light chain and the cell penetration peptide are on different peptide chains.
5. The chimeric polypeptide of claim 1, wherein the cell penetration peptide is the transactivator of transcription peptide (TAT).
6. The chimeric polypeptide of claim 1, wherein the cell penetration peptide is the pep-1 peptide (Pep-1).
7. The chimeric polypeptide of claim 1, wherein the cell penetration peptide is not longer than 200 amino acid residues away from the C-terminus of the BoNT light chain or the BoNT heavy chain.
8. The chimeric polypeptide of claim 1, wherein the BoNT is selected from BoNT A, B, C, D, E, F, or G or variants having at least 90% sequence identity thereto.
9. The chimeric polypeptide of claim 8, wherein the BoNT is selected from subtypes of BoNT A1-A10, B1-B8, E1-E9, and F1-F7.
10. The chimeric polypeptide of claim 8, wherein the BoNT is BoNT A.
11. The polypeptide of claim 1, wherein the BoNT light chain comprises the amino acid sequence of SEQ ID NO: 8 or an amino sequence having at least 90% sequence identity to SEQ ID NO: 8.
12. The polypeptide of claim 1, wherein the BoNT heavy chain comprises the amino acid sequence of SEQ ID NO: 9 or an amino sequence having at least 90% sequence identity to SEQ ID NO: 9.
13. The polypeptide of claim 1, comprising a single-chain polypeptide comprising the amino acid sequence of SEQ ID NO: 16.
14. The polypeptide of claim 1, comprising a single-chain polypeptide comprising the amino acid sequence of SEQ ID NO: 17.
15. A method for treating a condition in a subject in need thereof, comprising topical or intramuscular administration of the chimeric polypeptide of claim 1.
16. The method of claim 15, wherein the topical use is on a skin or a mucous membrane of an eye, ear, nose, mouth, lip, urethral opening, anus, or tongue.
17. The method of claim 15, wherein the topical use is on a stratum corneum of a skin that has been disrupted.
18. The method of claim 17, wherein the disruption is carried out with a needle or microneedle used for delivering the formulation.
19. The method of claim 15, wherein the condition is facial wrinkle, dystonias, sparsticity, hemifacial spasm, hyperhidrosis, or hypersalivation.
20. A polynucleotide encoding a chimeric polypeptide of claim 1.