SARS-COV-2 MULTI-EPITOPE VACCINES

Description

FIELD OF THE INVENTION

This invention pertains generally to vaccines and, more particularly multi-epitope vaccines for viral pathogens including SARS-COV-2, the causative agent of COVID-19.

BACKGROUND OF THE INVENTION

An outbreak of pneumonia like disease termed COVID-19 caused by a novel coronavirus, SARS-COV-2, has spread across the world and become a global pandemic. First generation vaccines targeting SARS-COV-2 have been developed by BioNTech/Pfizer, Moderna, Oxford/Astra Zeneca and others. These first generation vaccines all target spike protein: the Oxford/Astra Zeneca vaccine uses an adenoviral vector; the vaccines by Moderna and Pfizer are RNA based; the vaccine by Imperial College London relies upon self-amplifying RNA.

The spike protein is a poor candidate choice for a vaccine. Spike is hypervariable and prone to mutations. A number of SARS-COV-2 variants have been identified, and most of the sequence variant characterising them are usually located within Spike. Moreover, a low number of antibodies from survivors (10-30%) target spike protein. In addition, vaccines targeting spike protein will not immunise all individuals due to HLA variability.

To work, a vaccine must contain pathogen-derived molecules (typically proteins or glycans) processed first by the host cell into peptides and then presented (antigen presentation) at the host cell surface on its Human Leukocyte Antigens (HLA). HLAs are encoded within the highly polymorphic major histocompatibility complex (MHC) on Chromosome 6. This process leads to presentation of peptides originating from self and pathogen. HLA-peptide complexes are then specifically recognized by T-cells via the T-cell receptor (TCR); while self-peptide ligands do not typically elicit a response from the immune system, an immunogenic foreign peptide ligand-HLA complex will bind a TCR and trigger an immune response that leads to the development of cytotoxic and memory T- and B-cells. There are many components in the host immune system, but HLA molecules are the chief determinants of antigen presentation to the T-cells for subsequent activation of the immune response.

The classical HLA genes are the most polymorphic genes in the human genome, with some having more than a thousand known alleles. Alleles are distributed unevenly around the world but typically clustered according to ethnicity. These genes are divided into two subgroups, mainly based on the source of the peptides they tend to present: HLA I genes are expressed on all cells except red blood cells, and present peptides of intracellular origin (e.g. from self or viruses), whereas HLA-II genes are expressed only on professional antigen presenting cells and present peptides that originate extracellularly (e.g. from bacteria). Thus, the response to a viral pathogen such as SARS-COV-2 is mediated by HLA-I.

The HLA genes are co-dominantly expressed and encode HLA proteins that are referred to as HLA Class I (HLA-A, -B, -C) and HLA Class II (HLA-D). They are critical in priming adaptive immune responses. CD4+T helper/inducer cells recognize viral peptides bound to HLA-II encoded proteins and CD8+ Cytotoxic T cells recognize viral peptides bound to HLA-A, -B, -C, encoded proteins. The vast polymorphism in their extracellular peptide binding domains leads to the diversity of peptide antigens that can be bound and subsequently recognized by T-cell receptors. HLA class I molecules generally present short (8-12 amino acids) intracellularly-derived peptides, such as viral antigens. HLA class II molecules are capable of presenting longer (i.e., generally more than 13 amino acids) extracellularly derived peptides, such as antigenic fragments generated from viral proteins. The HLA allele polymorphism renders each variant protein a distinct product with the main difference focused on the peptide-binding groove and the conformation of adjacent regions directly engaged with peptide binding and interaction with the TCR. A T-cell will recognize bound antigen as a complex with a restricted allelic variant of HLA molecule. Depending on the combinations of HLA-I and II alleles expressed, an individual may be differently equipped to resist certain viruses, including coronaviruses. Thus, individual genetic variation across HLA genes aids in understanding how variation in HLA may affect the course of COVID-19, and could help identify individuals at higher risk of succumbing to the disease.

Previous research on related virus strains (SARS-COV-1 and MERS-Cov) demonstrated that viral antigen presentation of SARS-COV-1 mainly depends on HLA-I and HLA-II molecules. Numerous HLA-I polymorphisms correlate to susceptibility of SARS-COV-1, such as HLA-B*46:01 5, HLA-B*07:03, HLA-DR B1*12:02, and HLA-Cw*08:01, whereas the HLA-DR*03:01, HLA-Cw15:02 and HLA-A*02:01 alleles are related to the protection from SARS-COV-1 infection HLA-II molecules, such as HLA-DRB1*11:01 and HLA-DQB1*02, are associated with the susceptibility to MERS-COV infection. These data suggest that individual HLA genotypes may differentially control susceptibility or protection in T-cell mediated anti-SARS-COV-2 responses. Thus, HLA polymorphism could potentially alter disease outcomes and SARS-COV-2 transmission. The enormous diversity in HLA genes means that some individuals can present an antigen and mount a strong immune response against it, while others cannot present it at all. This is especially relevant for vaccination strategies involving subunit vaccines, since the number of available antigens can be very small. In fact, HLA polymorphism is a likely basis for the observed variations in vaccine efficacy.

Epitope-based or string of beads vaccines use concatemers of short immunogenic peptide sequences derived from antigens that are recognised by either CD4 or CD8 T-cells in the context of HLA-II or HLA-I respectively. They have several advantages over whole attenuated or subunit vaccines because they do not contain potentially infectious material. Furthermore, peptides can be chosen to take the genetic variation of pathogens and HLA-binding specificities into account. Development of such vaccines requires bioinformatics for prediction of HLA epitopes. Machine-learning methods, such as probabilistic models, neural networks, and support vectors machines, are routinely used with high accuracy for epitope prediction. Different algorithms have been used to create string of bead vaccines that generally concentrate on binding peptides for a small number of HLA-I epitopes.

A variety of platforms, including but not limited to nucleic acid, viral vectors, attenuated viruses and recombinant protein, are being examined for the development of the SARS-COV-2 vaccine. The use of nucleic acid-based vaccines allow for vaccines to be obtained in a short timeframe. Furthermore, nucleic acid-based vaccine manufacturing is safe and time-saving, and bypasses the need to grow highly pathogenic organisms at a large scale, resulting in a lower risk of contamination with live infectious reagents and release of dangerous pathogens.

The SAM vaccine platform is composed of one or more non-viral, typically virus-derived, engineered replicons that drive high levels of expression of encoding antigens. Very low doses are required (mgs) as tens of thousands of copies are made by transfected cells. They may be delivered via intramuscular (i.m.), in the same manner as earlier mRNA vaccines, and can be encapsulated within a lipid nanoparticle to further boost performance. This manufacturing process makes GMP grade SAM a promising vaccine approach for filling the gap between emerging infectious disease and the desperate need for effective COVID-19 vaccines. SAMs are an innovative platform for vaccine development. Within an alphavirus backbone, the mRNA replicates through a double stranded RNA intermediate, and the antigen of interest replaces structural proteins, so no infectious virus is made. Very low doses are required (ugs) as tens of thousands of copies are made by transfected cells. They are delivered via intramuscular (i.m.), in the same manner as earlier mRNA vaccines, and may be delivered as naked RNA or encapsulated within a lipid nanoparticle. Comparatively, mRNA vaccines confer several advantages over vaccines introduced by virus vectors and DNA vaccines: the production procedure to generate mRNA vaccines is cell-free, simple and rapid if compared to production of whole microbe, or live attenuated or subunit vaccines.

This background information is provided for the purpose of making known information believed by the applicant to be of possible relevance to the present invention. No admission is necessarily intended, nor should be construed, that any of the preceding information constitutes prior art against the present invention.

SUMMARY OF THE INVENTION

An object of the present invention is to provide a vaccine for viral pathogens conferring universal protection irrespective of viral mutations.

In accordance with an aspect of the present invention, there is provided a vaccine comprising or capable of expressing one or more concatemers of epitopes from a viral pathogen. In certain embodiments, the vaccine comprises or expresses epitopes for all MHC I and MHC II alleles with a frequency >1% in the target population. In certain embodiments, the target population is geographically restricted. In certain embodiments, the epitopes that bind MHC I or MHC II alleles associated with autoimmune disease are excluded. In certain embodiments, at least a portion of said epitopes are from conserved proteins from said viral pathogen. In certain embodiments, the epitopes are universal (common) epitopes of said viral pathogen. In certain embodiments, the epitopes are variant specific epitopes.

In certain embodiments, the viral pathogen is a sarbecovirus, including but not limited to SARS-CoV-2. In specific embodiments, the vaccine comprises or is capable of expressing expressing one or more concatemers of epitopes from one or more strains of sarbecovirus (e.g. SARS-CoV-2). Each concatemer of epitopes may include epitopes from a single strain or from multiple strains. For vaccines capable of expressing expressing one or more concatemers of epitopes from one or more strains, the one or more concatemers may be expressed by one or more expression vectors. In certain embodiments, each concatemer is expressed by a separate expression vector. In certain embodiments, one or more concatemers are expressed by a single expression vector.

In certain embodiments, a linker separates each of said epitopes. Exemplary linkers include RY, KRY, RYP, PRRARSV, PRRARSVKRY, PRRARSVRYP, ATLQA, QEAGAG and LALAA. The linkers may be the same or different between epitopes in a concatemer.

In certain embodiments, at least one of the one or more epitopes is as set forth in any one of the tables set forth below and/or as set forth in SEQ ID NOs 1-789.

In accordance with an aspect of the present invention, there is provided a vaccine comprising or capable of expressing one or more concatemers of epitopes set forth in any one of the tables set forth below and/or as set forth in SEQ ID NOs 1-789.

In accordance with an aspect of the present invention, there is provided a vaccine comprising or capable of expressing one or more concatemers set forth in SEQ ID NOs 798-851.

In certain embodiments, the vaccine is a viral vector-based vaccine, including but not limited to an adenoviral vector, a vesicular stomatitis virus vector or a vaccinia vector.

In certain embodiments, the vaccine is a nucleic acid-based vaccine.

In certain embodiments, the vaccine is a SAM RNA-based vaccine. In more specific embodiments, the SAM RNA-based vaccine is encapsulated in a lipid nanoparticle (LNP). In more specific embodiments, the LNP comprises a cationic lipid. In more specific embodiments, the LNP comprises phosphatidylcholine/cholesterol/PEG-lipid, C12-200, dimethyldioctadecylammonium (DDA), 1,2-dioleoyl-3-trimethylammonium propane (DOTAP) or 1,2-dilinoleyloxy-3-dimethylaminopropane (DLinDMA). In certain embodiments, the LNP comprises GEN-7036 (Lipid composition (ratio)=DOTAP:Chol:DOPE (1:0.75:0.5)).

In certain embodiments, the vaccine further comprises an adjuvant.

In certain embodiments, the vaccine further comprises a buffer.

In specific embodiments, the vaccine is a SAM RNA-based vaccine and comprises one or more SAM RNA vectors of the invention, cholesterol, 1,2-distearoyl-sn-glycero-3-phosphocholine (DSPC), ((4-hydroxybutyl)azanediyl)bis(hexane-6,1-diyl)bis(2-hexyldecanoate) (ALC-3015), 2-[(polyethylene glycol)-2000]-N,N-ditetradecylacetamide (ALC-0159), potassium chloride, monobasic potassium phosphate, sodium chloride, dibasic sodium phosphate dihydrate, water and sucrose.

In specific embodiments, the vaccine is a SAM RNA-based vaccine and comprises one or more SAM RNA vectors of the invention, cholesterol, 1,2-distearoyl-sn-glycero-3-phosphocholine (DSPC), Lipid SM-102, 1,2-dimyristoyl-rac-glycero-3-methoxypolyethylene glycol-2000 (PEG2000-DMG), tromethamine tris(hydroxymethyl)aminomethane), tromethamine hydrochloride, acetic acid, sodium acetate, water, and sucrose.

In accordance with an aspect of the present invention, there is provided a method of treating, protecting against, and/or preventing infection by a target viral pathogen, including but not limited to a sarbecovirus such as SARS-COV-2, in a subject in need thereof, the method comprising administering one or more of the vaccines of the invention to the subject.

In accordance with an aspect of the present invention, there is provided a method of generating an immune response against a target viral pathogen, including but not limited to sarbecovirus such as SARS-COV-2, the method comprising administering one or more of the vaccines of the invention to the subject.

In certain embodiments, the one or more vaccines is administered more than once. In certain embodiments, a prime and boost strategy of vaccination is used. In more specific embodiments, a heterologous prime and boost strategy is utilized. Exemplary prime and boost strategies are known in the art (see for example Sapkota et al. J Travel Med. 2021 Dec. 16; taab191. Doi: 10.1093/jtm/taab191; He et al, Emerg Microbes Infect. 2021; 10(1): 629-637; Kardani et al. Vaccine 2016, 34(4): 413-423).

In certain embodiments, wherein the subject is a mammal including but not limited to human, cat, dog, horse, sheep, goat, camel or cow.

In certain embodiments, the vaccines are formulated for parenteral administration, e.g., subcutaneous, intraperitoneal, intravenous, intradermal, and intramuscular. In certain embodiments, the vaccines are formulated for mucosal administration, e.g. oral administration, intranasal, and intravaginal routes.

BRIEF DESCRIPTION OF THE DRAWINGS

These and other features of the invention will become more apparent in the following detailed description in which reference is made to the appended drawings.

FIG. 1 provides a map of a SAM based SARS-COV-2 vaccine of an embodiment of the present invention.

FIG. 2 provides the nucleic acid sequence of the vaccine from FIG. 1. Sequence represented as DNA for corresponding RNA sequence T is replaced with U.

FIG. 3 provides a map of a SAM based SARS-COV-2 vaccine of an embodiment of the present invention.

FIG. 4 provides the nucleic acid sequence of the vaccine from FIG. 3. Sequence represented as DNA for corresponding RNA sequence T is replaced with U.

FIG. 5 provides a map of a SAM based SARS-COV-2 vaccine of an embodiment of the present invention.

FIG. 6 provides the nucleic acid sequence of the vaccine from FIG. 5. Sequence represented as DNA for corresponding RNA sequence T is replaced with U.

FIG. 7 provides a map of a SAM based SARS-COV-2 vaccine of an embodiment of the present invention.

FIG. 8 provides the nucleic acid sequence of vaccine from FIG. 7. Sequence represented as DNA for corresponding RNA sequence T is replaced with U.

FIG. 9 provides a map of a SAM based SARS-COV-2 vaccine of an embodiment of the present invention.

FIG. 10 provides the nucleic acid sequence of vaccine from FIG. 9. Sequence represented as DNA for corresponding RNA sequence T is replaced with U.

FIG. 11 provides a map of a SAM based SARS-COV-2 vaccine of an embodiment of the present invention.

FIG. 12 provides the nucleic acid sequence of the vaccine from FIG. 11. Sequence represented as DNA for corresponding RNA sequence T is replaced with U.

FIG. 13 provides the sequence of concatemers 1 to 4 of SARS-COV-2 epitopes separated by linking sequences expressed by an embodiment of the SARS-COV-2 vaccine of the present invention.

FIG. 14 provides the sequence of concatemers 1 to 6 of SARS-COV-2 epitopes separated by linking sequences expressed by an embodiment of the SARS-COV-2 vaccine of the present invention.

FIG. 15 provides the sequence of concatemers 1 to 6 of SARS-COV-2 epitopes separated by linking sequences expressed by an embodiment of the SARS-COV-2 vaccine of the present invention.

FIG. 16 provides the sequence of concatemers 1 to 6 of SARS-COV-2 epitopes separated by linking sequences expressed by an embodiment of the SARS-COV-2 vaccine of the present invention.

FIG. 17 provides the sequence of concatemers 1 to 6 of SARS-COV-2 epitopes separated by linking sequences expressed by an embodiment of the SARS-COV-2 vaccine of the present invention.

FIG. 18 provides the sequence of concatemers 1 to 6 of SARS-COV-2 epitopes separated by linking sequences expressed by an embodiment of the SARS-COV-2 vaccine of the present invention.

FIG. 19 provides the sequence of concatemers 1 to 4 of SARS-COV-2 epitopes separated by linking sequences expressed by an embodiment of the SARS-COV-2 vaccine of the present invention.

FIG. 20 provides the sequence of concatemers 1 to 4 of SARS-COV-2 epitopes separated by linking sequences expressed by an embodiment of the SARS-COV-2 vaccine of the present invention.

FIG. 21 provides the sequence of concatemers 1 to 4 of SARS-COV-2 epitopes separated by linking sequences expressed by an embodiment of the SARS-COV-2 vaccine of the present invention.

FIG. 22 provides the sequence of concatemers 1 to 4 of SARS-COV-2 epitopes separated by linking sequences expressed by an embodiment of the SARS-COV-2 vaccine of the present invention.

FIG. 23 provides the sequence of concatemers 1 to 4 of SARS-COV-2 epitopes separated by linking sequences expressed by an embodiment of the SARS-COV-2 vaccine of the present invention.

DETAILED DESCRIPTION OF THE INVENTION

The present invention provides vaccines for viral pathogens which confer protection against a wide spectrum of strains of the target viral pathogen, including but not limited to a sarbecovirus. For example, in certain embodiments, by comprising or expressing multiple epitopes from a number of highly conserved genes of SARS-COV-2, the vaccines confer protection against a wide spectrum of strains of SARS-COV-2, therein including mutated strains arising in the future in the population and escape mutants generated in the future by other vaccines that only target a subset of the viral proteins (for instance, the spike protein alone). In addition, in certain embodiments, the vaccines are tailored to a majority of immunotypes present in the target population, the vaccines confer protection to a wide spectrum of individuals, irrespective of the make-up of their immune system in terms of MHC genes.

In certain embodiments, the invention provides vaccines against coronaviruses, including but not limited to a Sarbecovirus. In certain embodiments, the invention provides vaccines against SARS-associated coronaviruses (SARS-COV). In specific embodiments, the invention provides vaccines against SARS-COV-2. Also provided are pharmaceutical compositions comprising the vaccines and methods of generating a protective immune response against RNA viruses. In specific embodiments, there is provided pharmaceutical compositions comprising the vaccines and methods of generating a protective immune response against the SARS-COV viral pathogens.

The vaccines may trigger a humoral (B-cell) and/or cellular (T-cell response). In certain embodiments, the vaccine comprises or expresses T-cell MHC-I (e.g. HLA-I) and/or MHC-II (e.g. HLA-II) epitopes of one or more RNA viral pathogens. In certain embodiments, the vaccine comprises or expresses T-cell MHC-I (e.g. HLA-I) and/or MHC-II (e.g. HLA-II) epitopes of one or more specific SARS-COV pathogens. In certain embodiments, the epitopes are T-cell MHC-I (e.g. HLA-I) and/or MHC-II (e.g. HLA-II) epitopes of one or more SARS-COV-2 proteins.

In principle, a vaccine needs to comprise or express one epitope that binds an individual's MHC alleles for the vaccine to have activity in the individual. Accordingly, in certain embodiments, the vaccine comprises or expresses epitopes for all MHC I and MHC II alleles with a frequency >1% (or another suitably selected frequency) in the target population, so as to achieve a vaccine capable of conferring protection to a wide spectrum of individuals irrespective of their MHC type. HLA types are distributed geographically, accordingly, in certain embodiments the target population is geographically limited.

In addition, it is known in the certain HLA types are associated with autoimmunity such as ankylosing spondylitis (HLA B27) or arthritis (HLA DR4). Accordingly toxicity related to autoimmunity may be reduced by omitting peptides that bind to these HLA types.

Vaccine Platforms

A variety of platforms may be used to generate the vaccines of the present invention. Exemplary vaccine platforms which may be used include but are not limited to protein-based platforms, virus-like particle-based vaccines, viral vector-based platforms and nucleic acid-based vaccine platforms.

In certain embodiments, the vaccine platform is a viral vector-based platform. The viral vectors may be attenuated viruses, may be replicating or non-replicating. Exemplary viral vectors include not are not limited to adenovirus, vaccinia or adeno associated virus, lentivirus or vesicular stomatitis virus (VSV). Accordingly, in certain embodiments the vaccine platform is an adenovirus, vaccinia or adeno associated virus, lentivirus or Vesicular stomatitis virus based vaccine.

In specific embodiments, the viral vector platform is an adenovirus vector platform. Various serotypes of adenoviruses have been used in vaccine development including Ad5, Ad26 and Ad35. In certain embodiments, the adenovirus vector is based on a simian adenovirus. Use of simian adenovirus vaccine vectors circumvent pre-existing human adenovirus immunity.

Exemplary, simian adenovirus serotypes used in vaccine development include simian adenovirus type 23.

In certain embodiments, the vaccine platform is a nucleic acid-based platform. Nucleic acid-based vaccine platforms may be DNA or RNA-based. Optionally, the nucleic acids include one or more modified nucleosides.

In certain embodiments, the nucleic acid-based vaccine platform is a DNA-based vaccine platform. Appropriate DNA expression vectors for use as a DNA-based vaccine platform are known in the art. A worker skilled in the art would readily appreciate that such expression vectors include the necessary elements to allow for expression of the one or more immunogens. Such elements include a promoter, such as the CMV promoter which directs transcription of the mRNA encoded by the transgene, a polyadenylation signal which mediates mRNA cleavage and polyadenylation, and Kozak sequence which directs efficient transgene translation. In specific embodiments, the DNA-based vaccine is a plasmid-based vaccine. In certain embodiments the vaccine has been optimized for expression of the assembled epitopes. In certain embodiments, the vaccines comprise nucleic acid sequence expressing said concatemer of epitopes which is less than 20 kb in length.

In certain embodiments, the vaccine comprises a sequence which has been codon optimized or deoptimized.

In certain embodiments, the nucleic acid-based vaccine is a RNA-based vaccine platform. In specific embodiments, a mRNA platform. The mRNA-based vaccine platform may be non-replicating or self-amplifying. In certain embodiments, the nucleic acid-based vaccine platform is a self-amplifying (SAM) RNA platform. A variety of RNA based expression systems are known in the art, including but not limited to expression systems based on either positive-sense and negative-sense RNA viruses. Positive-strand RNA viruses used in the development expression system include but are not limited to alphaviruses and flaviviruses. Exemplary alphaviruses used for expression systems include but are not limited to Semliki Forest virus, Venezuelan equine encephalitis virus and Sindbis virus and poliovirus. Alphavirus replicon particle-based vaccine vectors derived from Sindbis virus (SIN), Semliki Forest virus (SFV), and Venezuelan equine encephalitis virus (VEE) have been shown to induce robust antigen-specific cellular, humoral, and mucosal immune responses in many animal models of infectious disease and cancer (Perri et al.; Journal of Virology September 2003, 77 (19) 10394-10403; DOI: 10.1128/JVI.77.19.10394-10403.2003; Karl Ljungberg & Peter Liljeström (2015) Self-replicating alphavirus RNA vaccines, Expert Review of Vaccines, 14:2, 177-194, DOI: 10.1586/14760584.2015.965690). Exemplary flavivirus used for expression systems include Kunjin flavivirus. Negative sense RNA virus systems include measles and rhabdoviruses.

In specific embodiments, the SAM RNA vaccine platform is derived from an alphavirus. In such embodiments, the mRNA replicates through a double stranded RNA intermediate, and the antigen of interest replaces structural proteins, so no infectious virus is made.

Epitopes

The multi-epitope vaccines of the present invention comprise or expresses epitopes of one or more viral proteins.

In certain embodiments, the vaccine comprises or expresses one or more epitopes from conserved (such as structural proteins) viral proteins and one or more variable (hypervariable) viral proteins (such as spike protein from SARS-COV2). By comprising or expressing both types of epitopes, the vaccine is likely to be much less prone to generate escape mutants and is more likely to confer sterilizing immunity while targeting a number of circulating variants. In addition, in certain embodiments, by comprising or expressing epitopes for all MHC I and MHC II alleles with a frequency >1% in the general human population are chosen, so as to be effective in a large portion of the population.

The vaccine may comprise or express MHC I epitopes and/or MHC II epitopes of one or more viral proteins. In certain embodiments, the epitopes are T-cell MHC-I (e.g. HLA-I) and/or MHC-II (e.g. HLA-II) epitopes of one or more RNA viral proteins. In certain embodiments, the epitopes are T-cell MHC-I (e.g. HLA-I) and/or MHC-II (e.g. HLA-II) epitopes of one or more coronavirus proteins. In certain embodiments, the epitopes are T-cell MHC-I (e.g. HLA-I) and/or MHC-II (e.g. HLA-II) epitopes of one or more sarbecovirus proteins. In certain embodiments, the epitopes are T-cell MHC-I (e.g. HLA-I) and/or MHC-II (e.g. HLA-II) epitopes of one or more SARS-COV proteins. In certain embodiments, the epitopes are T-cell MHC-I (e.g. HLA-I) and/or MHC-II (e.g. HLA-II) epitopes of one or more SARS-COV-2 proteins. In certain embodiments, the epitopes are T-cell MHC-I (e.g. HLA-I) and/or MHC-II (e.g. HLA-II) epitopes of one or more SARS-COV-2 proteins. In specific embodiments, the vaccine comprises or expresses MHC-I and MHC-II epitopes.

In certain embodiments, the vaccine comprises or expresses multiple epitopes from conserved (such as structural proteins) and variable (hypervariable) proteins (such as spike protein from SARS-COV2).

In certain embodiments, each epitope comprises an amino acid sequence between 5 and 60 amino acids. In certain embodiments, the epitopes comprise a sequence comprising 8 to 44 amino acids. In certain embodiments, the epitopes comprise a sequence comprising 8 to 30 amino acids. In certain embodiments, the epitopes comprise a sequence comprising 8 to 22 amino acids. In certain embodiments, the vaccine comprises or expresses MHC I epitopes comprising a sequence comprising 8 to 15 amino acids. In certain embodiments, the vaccine comprises or expresses MHC II epitopes comprising a sequence comprising 9 to 22 amino acids. In certain embodiments, the vaccine comprises or expresses MHC II epitopes comprising a sequence comprising more than 13 amino acids.

In certain embodiments, the sequence of the epitope(s) the vaccine comprises or expresses is 100% identical to the sequence of the corresponding epitope(s) in the wild-type viral protein. In certain embodiments, the sequence of the epitope(s) the vaccine comprises or expresses comprises one or more substitutions, insertions and/or deletions of one or more amino acid residues as compared to the sequence of the epitope in the wild-type viral protein. In certain embodiments, the epitope(s) the vaccine comprises at least 50%, at least 60%, at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 98%, at least 99% sequence identity as compared to a reference epitope sequence. The reference sequence may be any of the viral epitope sequences disclosed herein or known in the art.

In certain embodiments, the sequence of the epitope(s) of the vaccine is derived from the consensus sequence of more than one viral sequence. In certain embodiments, such sequence is obtained by considering the consensus of the most frequent variants appearing in different viral strains or in any number of sequenced viruses that have been detected while circulating in the population. In certain embodiments, such a sequence is obtained by removing from the original sequence the positions at which variants occur with a frequency larger than a specified frequency threshold (i.e., hypervariable positions in the sequence are removed, and only the positions in the sequence that are sufficiently constant are kept). In certain embodiments, additional sequences, encompassing the positions at which variants appear more frequently than some specified threshold, are added to the original sequence of the virus (i.e., one adds to the pool of potential peptides the ones generated by non-synonymous variants that occur with sufficient frequency). In certain embodiments, the variants which appear more frequently than some specific threshold are computed based on the strains circulating at some given time in some specific geographical region. In certain embodiments. In certain embodiments, the variants which appear more frequently than some specific threshold are computed based on viral lineages as defined by WHO, other public bodies, or research groups.

In certain embodiments, one or more epitopes are derived from one or more sarbecovirus proteins, including but not limited to SARS-COV proteins including but not limited to SARS-COV-2 proteins.

The complete genome of SARs-COV-2 is known in the art and is published under GenBank Accession NC_045512.2 (Nature 579 (7798), 265-269 (2020)). Variants of SARS-COV-2 are known in the art. The targets of T cell responses to SARS-COV-2 have been examined in exposed individuals. The targets were found to include but are not limited to M, Spike, N, nsp3, nsp4, ORF3a and ORF8 (Grifoni et al., Cell 181:1489-1501, 2020). Accordingly, in certain embodiments, the selection of epitopes is based on the clinical profile of convalescent COVD-19 patients. In specific embodiments, the selection of epitopes is based on the frequency of antigen specific T cell responses that convalescent patients make for both T helper (MHC II) and CTL (MHC I). In certain embodiments, eptiopes were selected based on antigenic score of the epitopes. In specific embodiments, the vaccine comprises MHC I and MHC II binding epitopes for different HLA Alleles. In specific embodiments, the vaccine comprises MHC I and MHC II binding epitopes for all MHC I and MHC II alleles with a frequency >1% in the general human population are chosen.

In certain embodiments, the vaccine comprises or expresses one or more epitopes from one or more of the following SARS-COV-2 proteins: spike, NSP1, NSP2, Proteinase 3CL-Pro, NSP7, NSP8, NSP9, NSP10, helicase, exonuclease, endonuclease, methyltransferase, ORF6, N protein, and ORF10.

In certain embodiments, the vaccine comprises or expresses one or more epitopes from one or more of the following SARS-COV-2 proteins: spike, papain-like protease, NSP4, RNA dependent RNA polymerase, M protein, ORF7a, and ORF8.

In certain embodiments, the vaccine comprises or expresses one or more epitopes from one or more of the following SARS-COV-2 proteins: 2′-O-ribose methyltransferase, 3C-like proteinase, 3′-to-5′ exonuclease, endoRNAse, envelope protein, helicase, leader protein, membrane glycoprotein, nsp10, nsp2, nsp3, nsp4, nsp6, nsp7, nsp8, nsp9, nucleocapsid phosphoprotein, ORF10 protein, ORF3a protein, ORF6 protein, ORF7a protein, ORF8 protein, RNA-dependent RNA polymerase, and surface glycoprotein.

In certain embodiments, the vaccine comprises or expresses one or more epitopes as set forth in any one of Tables below. In certain embodiments, the vaccine comprises or expresses one or more of the concatemer of epitopes (optionally the epitopes are separated by a linker sequence) as set forth in any one of Tables below.

In certain embodiments, the vaccine comprises or expresses one or more epitopes as set forth in any one of SEQ ID NOs 1-789. In certain embodiments, the vaccine comprises or expresses one or more of the concatemer of epitopes (optionally the epitopes are separated by a linker sequence) as set forth in any one of SEQ ID NOs 1-789. In specific embodiments, the linkers comprise the sequence as set forth in 790 or 791.

In certain embodiments, the vaccine comprises one or more nucleic acids capable of expressing one or more of the epitopes or concatemers of epitopes optionally separated by linker sequences described above. The one or more nucleic acids may be DNA or RNA. The vaccine comprising or capable of expressing the one or more epitopes may be virus-like particle-based vaccines, viral vector-based vaccines or nucleic acid-based vaccines. In nucleic acid-based vaccines, the nucleic acids may optionally include modifications including for example one or more modified nucleosides. In certain embodiments, the nucleic acid sequences are codon optimized. In certain embodiments, the nucleic acid sequences are codon optimized for expression in mammalian cells, optionally human cells. In certain embodiments, the nucleic acid sequences are deoptimized.

Linkers Between Epitopes

In certain embodiments, the vaccines comprise or express one or more concatemer(s) of epitopes with intervening linker peptides. In certain embodiments, the linker peptides comprise a protease cleavage site(s). In certain embodiments, the insertion of protease cleavage sites enhances antigen processing. Exemplary cleavage sites include chymotryptic, tryptic and furin cleavage sties. In specific embodiments, the linker consists of other viral and cellular protease sites. In specific embodiments, the linker peptides comprise the following sequence: RY, KRY, RYP, PRRARSV, PRRARSVKRY or PRRARSVRYP. In certain embodiments, the linker can be any peptide consistent with the motif [AVTP][TKRV]LQ[AS]. In specific embodiments, the linker consists of the following sequence: ATLQA. In specific embodiments, the linker consists of the following sequence: QEAGAG. In specific embodiments, the linker consists of the following sequence: LALAA.

Exemplary Concatemers of Epitopes

In certain embodiments, the vaccine comprises or expresses at least one of concatemers of epitopes from SARS-COV-2 with intervening linker sequences set forth in Table 1 below. In certain embodiments, the vaccine comprises or expresses at least two of the concatemers of epitopes from SARS-COV-2 with intervening linker sequences set forth in Table 1 below. In certain embodiments, the vaccine comprises or expresses three of the concatemers set forth below. In certain embodiments, the vaccine comprises or expresses all the concatemers set forth below in Table 1.

TABLE 1
	pos_in_			pos_
concatemer	concatemer	epitope	gene	in_gene
1	1-12	LNVPLHGTILTR	membrane_glycoprotein(26523-27191	120-131
1	13-22	PRRARSVRYP linker 1-10
1	23-35	TVLKKCKSAFYIL	nsp3(2720-8554	526-538
1	36-45	PRRARSVRYP linker 1-10
1	46-53	IETISLAG	nsp3(2720-8554)	684-691
1	54-63	PRRARSVRYP linker 1-10
1	64-73	NWNCVNCDTF	nsp3*2720-8554)	1631-1640
1	74-83	PRRARSVRYP linker 1-10
1	84-97	DYDCVSFCYMHHME	3C-like proteinase (10055-10972)	153-166
1	98-107	PRRARSVRYP linker 1-10
1	108-117	TPLIQPIGAL	nsp4(8555-10054)	269-278
1	118-127	PRRARSVRYP linker 1-10
1	128-154	VTGLFKDCSKVITGLHPTQAPTHLSVD	3′-to-5′_exonuclease(18040-19620)	4-30
1	155-164	PRRARSVRYP linker 1-10
1	165-179	SDVLYQPPQTSITSA	nsp4(8555-10054)	483-497
1	180-189	PRRARSVRYP linker 1-10
1	190-200	TKVDGVDVELF	endoRNAse(19621-20658)	33-43
1	201-210	PRRARSVRYP linker 1-10
1	211-221	ETICAPLTVFF	endoRNAse(19621-20658)	113-123
1	222-231	PRRARSVRYP linker 1-10
1	232-246	KETLYCIDGALLTKS	nsp3(2720-8554)	1024-1038
1	247-256	PRRARSVRYP linker 1-10
1	257-270	QIELKFNPPALQDA	nsp3(2720-8554)	867-880
1	271-280	PRRARSVRYP linker 1-10
1	281-298	HVQLSLPVLQVRDVLVRG	leader_protein(266-805)	13-30
1	299-308	PRRARSVRYP linker 1-10
1	309-316	DHVISTSH	helicase(16237-18039)	32-39
1	317-326	PRRARSVRYP linker 1-10
1	327-339	ANFCALILAYCNK	nsp3(2720-8554)	890-902
1	340-349	PRRARSVRYP linker 1-10
1	350-357	LPINVIVF	nsp3(2720-8554)	1718-1725
1	358-367	PRRARSVRYP linker 1-10
1	368-381	CATTRQVVNVVTTK	nsp3(2720-8554)	1926-1939
1	382-391	PRRARSVRYP linker 1-10
1	392-399	YDKLVSSF	nsp3(2720-8554)	365-372
1	400-409	PRRARSVRYP linker 1-10
1	410-418	KFPLKLRGT	2′-O-ribose_methyltransferase	249-257
			(20659-21552)
1	419-428	PRRARSVRYP linker 1-10
1	429-438	KSASVYYSQL	nsp3(2720-8554)	1737-1746
1	439-448	PRRARSVRYP linker 1-10
1	449-463	TYACWHHSIGFDYVY	3′-to-5′_exonuclease(10840-19620)	223-237
1	464-473	PRRARSVRYP linker 1-10
1	474-486	AIKCVPQADVEWK	3′-to-5′_exonuclease(10840-19620)	337-349
1	487-496	PRRARSVRYP linker 1-10
1	497-510	SDRVVFVLWAHGFE	3′-to-5′_exonuclease(10840-19620)	178-191
1	511-520	PRRARSVRYP linker 1-10
1	521-544	TYASALWEIQQVVDADSKIVQLSE	nsp8(12092-12685)	148-171
1	545-554	PRRARSVRYP linker 1-10
1	555-562	YLKLRSDV	nsp4(8555-10054)	427-434
1	563-572	PRRARSVRYP linker 1-10
1	573-586	DGCVPLNIIPLTTA	nsp8(12092-12685)	112-125
1	587-596	PRRARSVRYP linker 1-10
1	597-609	KEILVTYNCCDDD	RNA-dependent_RNA_polymerase	143-155
			(13442-13468 + 13468-16236)
1	610-619	PRRARSVRYP linker 1-10
1	620-627	SDFVRATA	ORF3a protein(25393-26220)	26-33
1	628-637	PRRARSVRYP linker 1-10
1	638-650	GVVDYGARFYFYT	nsp3(2720-8554)	596-608
1	651-660	PRRARSVRYP linker 1-10
1	661-674	QEHYVRITGLYPTL	helicase(16237-18039)	243-256
1	675-684	PRRARSVRYP linker 1-10
1	685-707	TFKVSIWLNLDYIINLIIKNLSKS	ORF6_protein(27202-27387)	21-43
1	708-717	PRRARSVRYP linker 1-10
1	718-730	FVVEVVDKYFDCY	RNA-dependent_RNA_polymerase	471-483
			(13442-13468 + 13468-16236)
1	731-740	PRRARSVRYP linker 1-10
1	741-753	YTVSCLPFTINCQ	ORF8_protein(27894-28259)	79-91
1	754-763	PRRARSVRYP linker 1-10
1	764-778	EILDITPCSFGGVSV	surface_glycoprotein(21563-25384)	583-597
1	779-788	PRRARSVRYP linker 1-10
1	789-798	MPLGYVTHGL	nsp3(2720-8554)	630-639
1	799-808	PRRARSVRYP linker 1-10
1	809-816	MADLVYAL	RNA-dependent_RNA_polymerase	124-131
			(13442-13468 + 13468-16236)
1	817-826	PRRARSVRYP linker 1-10
1	827-840	TSACVLAAECTIFK	nsp4(8555-10054)	147-160
1	841-850	PRRARSVRYP linker 1-10
1	851-866	SAEVAVKMFDAYVNTF	nsp3(2720-8554)	1765-1780
1	867-876	PRRARSVRYP linker 1-10
1	877-886	NEFYAYLRKH	RNA-dependent_RNA_polymerase	743-752
			(13442-13468 + 13468-16236)
1	887-896	PRRARSVRYP linker 1-10
1	897-906	LQYGSFCTQL	surface_glycoprotein(21563-25384)	754-763
1	907-916	PRRARSVRYP linker 1-10
1	917-925	IQLSSYSLF	2′-O-ribose_methyltransferase	237-245
			(20659-21552)
1	926-935	PRRARSVRYP linker 1-10
1	936-946	CTLKSFTVEKG	surface_glycoprotein(21563-25384)	301-311
1	947-956	PRRARSVRYP linker 1-10
1	957-964	PSFLGRYM	nsp3(2720-8554)	822-829
1	964-974	PRRARSVRYP linker 1-10
1	975-989	ISNCVADYSVLYNSA	surface_glycoprotein(21563-25384)	358-372
1	990-999	PRRARSVRYP linker 1-10
1	1000-1011	ESVTTEILPVSM	surface_glycoprotein(21563-25384)	720-731
1	1012-1021	PRRARSVRYP linker 1-10
1	1022-1041	SEAVEAPLVGTPVCINGLML	nsp2(806-2719)	591-610
1	1042-1051	PRRARSVRYP linker 1-10
1	1052-1061	FDVEGCHATR	3′-to-5′_exonuclease(10840-19620)	89-98
1	1062-1071	PRRARSVRYP linker 1-10
1	1072-1086	ERFVSLAIDAYPLTK	RNA-dependent_RNA_polymerase	857-871
			(13442-13468 + 13468-16236)
1	1087-1096
1	1097-1113	PRRARSVRYP linker 1-10	RNA-dependent_RNA_polymerase	717-733
			(13442-13468 + 13468-16236)
1	1114-1123	PRRARSVRYP linker 1-10
1	1124-1160	FHQECSLQSCTQHQPYVVDDPCPIHFY	ORF8_protein(27894-28259)	16-52
		SKWYIRVGAR
1	1161-1170	PRRARSVRYP linker 1-10
1	1171-1189	KLNVGDYFVLTSHTVMPLS	helicase(16237-18039)	218-236
1	1190-1199	PRRARSVRYP linker 1-10
1	1200-1207	TSCCSCLK	surface_glycoprotein	1238-1245
			(21563-25384)
1	1208-1217	PRRARSVRYP linker 1-10
1	1218-1225	AALQIPFA	surface_glycoprotein	892-899
			(21563-25384)
1	1226-1235	PRRARSVRYP linker 1-10
1	1236-1243	NQMCLSTL	nsp2(806-2719)	133-140
1	1244-1253	PRRARSVRYP linker 1-10
1	1254-1265	GSNVFQTRAGCL	surface_glycoprotein	639-650
			(21563-25384)
1	1266-1275	PRRARSVRYP linker 1-10
1	1276-1285	KASCTLSEQL	NSP2(806-2719)	30-39
1	1286-1295	PRRARSVRYP linker 1-10
1	1296-1323	IKDLPKEITVATSRTLSYYKLGASQRV	membrane_glycoprotein	161-188
		A	(26523-27191)
1	1324-1333	PRRARSVRYP linker 1-10
1	1334-1343	ARDLICAQKF	surface_glycoprotein	846-855
			(21563-25384)
1	1344-1353	PRRARSVRYP linker 1-10
1	1354-1361	SQDLSVVS	endoRNAse(19621-20658)	308-315
1	1362-1371	PRRARSVRYP linker 1-10
1	1372-1379	DVVECLKL	nsp3(2720-8554)	1832-1839
1	1380-1389	PRRARSVRYP linker 1-10
1	1390-1407	INVFAFPFTIYSLLLCRM	ORF10_protein(29558-29674)	4-21
2	1-10	DKLQFTSLEI	helicase(16237-18039)	583-592
2	11-20	PRRARSVRYP linker 1-10
2	21-33	SYELQTPFEIKLA	nsp2(806-2719)	68-80
2	34-43	PRRARSVRYP linker 1-10
2	44-51	GYVMHANY	2′-O-ribose_methyltransferase	221-228
			(20659-21552)
2	52-61	PRRARSVRYP linker 1-10
2	62-94	YEPLTQDHVDILGPLSAQTGAIVLDM	3C-like_proteinase	239-271
		CASLKEL
2	95-104	PRRARSVRYP linker 1-10
2	105-112	RVEAFEYY	nsp3(2720-8554)	810-817
2	113-122	PRRARSVRYP linker 1-10
2	123-132	EGSVRVVTTF	nsp4(8555-10054)	207-216
2	133-142	PRRARSVRYP linker 1-10
2	143-155	QCVQLHNDILLAK	nsp7(11843-12091)	31-43
2	156-165	PRRARSVRYP linker 1-10
2	166-180	GETFVTHSKGLYRKC	nsp2(806-2719)	526-540
2	181-190	PRRARSVRYP linker 1-10
2	191-205	FSGYLKLTDNVYIKN	nsp3(2720-8554)	210-224
2	206-215	PRRARSVRYP linker 1-10
2	216-225	GEVPVSIINN	endoRNAse(19621-20658)	20-29
2	226-235	PRRARSVRYP linker 1-10
2	236-260	KVKPTVVVNAANVYLKHGGGVAGAL	nsp3(2720-8554)	233-257
2	261-270	PRRARSVRYP linker 1-10
2	271-285	TKYLVQQESPFVMMS	nsp3(2720-8554)	976-990
2	286-295	PRRARSVRYP linker 1-10
2	286-307	GDVVAIDYKHYT	nsp3(2720-8554)	1147-1158
2	308-317	PRRARSVRYP linker 1-10
2	318-325	LMVVIPDY	nsp8(12092-12685)	128-135
2	326-335	PRRARSVRYP linker 1-10
2	336-352	KHWPQIAQFAPSASAFF	nucleocapsid_phosphoprotein	299-315
			(28274-29533)
2	353-362	PRRARSVRYP linker 1-10
2	363-376	SVGKFCLEASFNYL	nsp3(2720-8554)	1387-1400
2	377-386	PRRARSVRYP linker 1-10
2	377-397	ITNCVNKLCTH	nsp10(13025-13441)	38-48
2	398-407	PRRARSVRYP linker 1-10
2	408-518	ASCCLYCRCHI	nsp10(13025-13441)	71-81
2	419-428	PRRARSVRYP linker 1-10
2	429-451	FGGCVFSYVGCHNKCAYWVPRAS	nsp2(806-2719)	226-248
2	452-461	PRRARSVRYP linker 1-10
2	462-496	HEFCSQHTMLVKQGDDYVYLPYPDPSR	RNA-dependent_RNA_polymerase	810-844
		ILGAGCFV	(13442-13468 + 13468-16236)
2	497-506	PRRARSVRYP linker 1-10
2	507-520	FGTVYEKLKPVLDW	nsp2(806-2719)	437-450
2	521-530	PRRARSVRYP linker 1-10
2	531-538	EHIVYGDF	endoRNAse(19621-20658)	233-240
2	539-548	PRRARSVRYP linker 1-10
2	549-566	KILNNLGVDIAANTVIWD	endoRNAse(19621-20658)	70-87
2	567-579	PRRARSVRYP linker 1-10
2	577-586	LAWPLIVTAL	nsp8(12092-12685)	180-189
2	587-596	PRRARSVRYP linker 1-10
2	597-610	LSPVALRQMSCAAG	nsp9(12092-12685)	4-17
2	611-620	PRRARSVRYP linker 1-10
2	621-632	YAKPFLNKVVST	nsp3(2720-8554)	1323-1334
2	633-642	PRRARSVRYP linker 1-10
2	643-650	TFSVLACY	3C-like_protinase(10055-10972)	111-118
2	651-660	PRRARSVRYP linker 1-10
2	661-668	VAFNVVNK	endoRNAse(19621-20658)	5-12
2	669-678	PRRARSVRYP linker 1-10
2	679-715	ARKHTTCCSLCHRFYRLANECAQVLSE	RNA-dependent_RNA_polymerase	639-675
		MVMCGGSLYV	(13442-13468 + 13468-16236)
2	716-725	PRRARSVRYP linker 1-10
2	726-741	LVDFQVTIAEILLIIM	ORF6_protein(27202-27387)	4-19
2	742-751	PRRARSVRYP linker 1-10
2	752-761	CPRHVICTSE	3C-like_protinase(10055-10972)	38-47
2	762-771	PRRARSVRYP linker 1-10
2	772-787	LLKDCPAVAKHDFFKF	RNA-dependent_RNA_polymerase	89-104
			(13442-13468 + 13468-16236)
2	788-797	PRRARSVRYP linker 1-10
2	798-813	RKIFVDGVPFVVSTGY	RNA-dependent_RNA_polymerase	331-346
			(13442-13468 + 13468-16236)
2	814-823	PRRARSVRYP linker 1-10
2	824-843	RAKHYVYIGDPAQLPAPRTL	helicase(16237-18039)	392-411
2	844-853	PRRARSVRYP linker 1-10
2	854-863	TLPVNVAFEL	endoRNAse(19621-20658)	48-57
2	864-873	PRRARSVRYP linker 1-10
2	874-888	FSVAALTNNVAFQTV	RNA-dependent_RNA_polymerase	396-410
			(13442-13468 + 13468-16236)
2	889-898	PRRARSVRYP linker 1-10
2	899-906	SVELKHFF	RNA-dependent_RNA_polymerase	434-411
			(13442-13468 + 13468-16236)
2	907-916	PRRARSVRYP linker 1-10
2	917-928	FNVYFPLQSYGF	surface_glycoprotein(21563-25384)	486-497
2	929-938	PRRARSVRYP linker 1-10
2	939-952	FFSNVTWFHAIHVS	surface_glycoprotein(21563-25384)	58-71
2	953-962	PRRARSVRYP linker 1-10
2	963-974	EVFAQVKQIYKT	surface_glycoprotein(21563-25384)	780-791
2	975-984	PRRARSVRYP linker 1-10
2	985-994	YIAQVDVVNF	ORF10_protein(29558-29674)	26-36
2	995-1004	PRRARSVRYP linker 1-10
2	1005-1014	LLKHPIVWHV	nsp3(2720-8554)	1167-1176
2	1015-1024	PRRARSVRYP linker 1-10
2	1025-1042	YQDVNCTEVPVAIHADQL	surface_glycoprotein(21563-25384)	612-629
2	1043-1052	PRRARSVRYP linker 1-10
2	1053-1076	SELVIGAVILRGHLRIAGHHLGRC	membrane_glycoprotein	136-159
			(26523-27191)
2	1077-1086	PRRARSVRYP linker 1-10
2	1087-1094	TDAVDCAL	surface_glycoprotein(21563-25384)	286-293
2	1095-1104	PRRARSVRYP linker 1-10
2	1105-1112	SLIDLQEL	surface_glycoprotein(21563-25384)	1196-1203
2	1113-1122	PRRARSVRYP linker 1-10
2	1123-1135	RTCCLCDRRATCF	3′-to-5′_exonuclease(18040-19620)	205-217
2	1136-1145	PRRARSVRYP linker 1-10
2	1146-1153	FVKATCEF	nsp2(806-2719)	156-163
2	1154-1163	PRRARSVRYP linker 1-10
2	1164-1179	NFLVQAGNVQLRVIGH	3C-like_protinase(10055-10972)	65-80
2	1180-1189	PRRARSVRYP linker 1-10
2	1190-1197	EVTPSGTW	nucleocapsid_phosphoprotein	323-330
			(28274-29533)
2	1198-1207	PRRARSVRYP linker 1-10
2	1208-1217	FKHLIPLMYK	3′-to-5′_exonuclease(18040-19620)	146-155
2	1218-1227	PRRARSVRYP linker 1-10
2	1228-1255	SIPCSVCLSGLDSLDTYPSLETIQITI	nsp3(2720-8554)	1467-1494
		S
2	1256-1265	PRRARSVRYP linker 1-10
2	1266-1273	ISDYDYYR	RNA-dependent_RNA_polymerase	450-457
			(13442-13468 + 13468-16236)
2	1274-1283	PRRARSVRYP linker 1-10
2	1284-1297	FQTLLALHRSYLTP	surface_glycoprotein(21563-25384)	238-251
2	1298-1307	PRRARSVRYP linker 1-10
2	1308-1315	NHTGVVGE	nsp2(806-2719)	254-261
2	1316-1325	PRRARSVRYP linker 1-10
2	1326-1342	AAAYYVGYLQPRTFLLK	surface_glycoprotein(21563-25384)	262-278
2	1343-1352	PRRARSVRYP linker 1-10
2	1353-1360	STFKCYGV	surface_glycoprotein(21563-25384)	375-382
2	1364-1370	PRRARSVRYP linker 1-10
2	1371-1385	FKELLVYAADPAMHA	RNA-dependent_RNA_polymerase	368-382
			(13442-13468 + 13468-16236)
3	1-28	RLCAYCCNIVNVSLVKPSFYVYSRVKN	envelope_protein(26245-26472)	38-65
		L
3	29-38	PRRARSVRYP linker 1-10
3	39-52	MPVCVETKAIVSTI	nsp3(2720-8554)	571-584
3	53-62	PRRARSVRYP linker 1-10
3	63-74	KTTEVVGDIILK	nsp3(2720-8554)	1249-1260
3	75-84	PRRARSVRYP linker 1-10
3	85-102	AFKLNIKLLGVGGKPCIK	nsp6(10973-11842)	268-285
3	103-112	PRRARSVRYP linker 1-10
3	113-120	LLLDQALF	nsp3(2720-8554)	1752-1759
3	121-130	PRRARSVRYP linker 1-10
3	131-150	ANSIVCRFDTRVLSNLNLPG	3′-to-5′_exonuclease(18040-19620)	394-413
3	151-160	PRRARSVRYP linker 1-10
3	161-172	LKKLKKSLNVAK	nsp8(12092-12685)	35-46
3	173-182	PRRARSVRYP linker 1-10
3	183-192	KESVQTFFKL	nsp2(806-2719)	492-501
3	193-202	PRRARSVRYP linker 1-10
3	203-225	GEAVKTQFNYYKKVDGVVQQLPE	endoRNAse(19621-20658)	169-191
3	226-235	PRRARSVRYP linker 1-10
3	236-245	IGDCATVHTA	2′-O-ribose_methyltransferase	112-121
			(20659-21552)
3	246-255	PRRARSVRYP linker 1-10
3	256-265	AQYELKHGTF	nsp3(2720-8554)	994-1003
3	266-275	PRRARSVRYP linker 1-10
3	276-286	HNLAKHCLHVV	nsp3(2720-8554)	290-300
3	287-296	PRRARSVRYP linker 1-10
3	297-333	GCDVTDVTQLYYLGGMSYYCKSHKPPI	helicase(16237-18039)	54-90
		SFPLCANGQVF
3	334-343	PRRARSVRYP linker 1-10
3	344-370	NAACRKVQHMVVKAALLADKFPVLHDI	3′-to-5′_exonuclease(18040-19620)	306-332
3	371-380	PRRARSVRYP linker 1-10
3	381-391	VEEVLSEARQH	leader_protein(266-805)	35-45
3	392-401	PRRARSVRYP linker 1-10
3	402-413	IEVQGYKSVNIT	nsp3(2720-8554)	13-24
3	414-423	PRRARSVRYP linker 1-10
3	424-431	NYQCGHYK	nsp3(2720-8554)	1012-1019
3	432-441	PRRARSVRYP linker 1-10
3	442-453	TVNVLAWLYAAV	3C-like_proteinase(10055-10972)	201-212
3	454-463	PRRARSVRYP linker 1-10
3	464-479	SEFSSLPSYAAFATAQ	nsp8(12092-12685)	4-19
3	480-489	PRRARSVRYP linker 1-10
3	490-511	LPRVFSAVGNICYTPSKLIEYT	nsp4(8555-10054)	122-143
3	512-521	PRRARSVRYP linker 1-10
3	522-536	SVLLSMQGAVDINKL	nsp7(11843-12091)	57-71
3	537-546	PRRARSVRYP linker 1-10
3	547-560	CGACIRRPFLCCKC	helicase(16237-18039)	16-29
3	561-570	PRRARSVRYP linker 1-10
3	571-594	DPIHSLRVCVDTVRTNVYLAVFDK	nsp3(2720-8554)	339-362
3	595-604	PRRARSVRYP linker 1-10
3	605-615	SEAFLIGCNYL	2′-O-ribose_methyltransferase	202-212
			(20659-21552)
3	616-625	PRRARSVRYP linker 1-10
3	626-641	DQVILLNKHIDAYKTF	nucleocapsid_phosphoprotein	348-363
			(28274-29533)
3	642-651	PRRARSVRYP linker 1-10
3	652-659	EHVQIHTI	ORF3a_protein(25393-26220)	242-249
3	660-669	PRRARSVRYP linker 1-10
3	670-696	AKYTQLCQYLNTLTLAVPYNMRVIHF	2′-O-ribose_methyltransferase	45-71
			(20659-21552)
3	697-706	PRRARSVRYP linker 1-10
3	707-726	GYLPQNAVVKIYCPACHNSE	nsp2(806-2719)	178-197
3	727-736	PRRARSVRYP linker 1-10
3	737-753	IVKFISTCACEIVGGQI	nsp2(806-2719)	468-484
3	754-763	PRRARSVRYP linker 1-10
3	764-775	VPVVDSYYSLLM	RNA-dependent_RNA_polymerase	231-242
			(13442-13468 + 13468-16236)
3	776-785	PRRARSVRYP linker 1-10
3	786-810	DDRVILHCANFNVLFSTVFPPTSFG	RNA-dependent_RNA_polymerase	303-327
			(13442-13468 + 13468-16236)
3	811-820	PRRARSVRYP linker 1-10
3	821-846	QNSVRVLQKAAITILDGISQYSLRLI	nsp2(806-2719)	376-401
3	847-856	PRRARSVRYP linker 1-10
3	857-876	VVIKVCEFQFCNDPFLGVYY	surface_glycoprotein(21563-25384)	126-145
3	877-886	PRRARSVRYP linker 1-10
3	887-897	IEELFYSYATH	3′-to-5′_exonuclease(18040-19620)	363-373
3	898-907	PRRARSVRYP linker 1-10
3	908-939	VDFCGKGYHLMSFPQSAPHGVVFLHVT	surface_glycoprotein(21563-25384)	1040-1071
		YVPAQ
3	940-949	PRRARSVRYP linker 1-10
3	950-967	PNFVFPLNSIIKTIQPRV	nsp2(806-2719)	91-108
3	968-977	PRRARSVRYP linker 1-10
3	978-993	NDLCFTNVYADSFVIR	surface_glycoprotein(21563-25384)	388-403
3	994-1003	PRRARSVRYP linker 1-10
3	1004-1012	VLGSLAATV	nsp9(12686-13024)	102-110
3	1013-1022	PRRARSVRYP linker 1-10
3	1023-1032	FEYVSQPFLM	surface_glycoprotein(21563-25384)	168-177
3	1033-1042	PRRARSVRYP linker 1-10
3	1043-1062	KGFCDLKGKYVQIPTTCAND	nsp10(13025-13441)	87-106
3	1063-1072	PRRARSVRYP linker 1-10
3	1073-1092	INLVRDLPQGFSALEPLVDL	surface_glycoprotein(21563-25384)	210-229
3	1093-1102	PRRARSVRYP linker 1-10
3	1103-1120	YADVFHLYLQYIRKLHDE	RNA-dependent_RNA_polymerase	877-894
			(13442-13468 + 13468-16236)
3	1121-1130	PRRARSVRYP linker 1-10
3	1131-1140	KQYGDCLGDI	surface_glycoprotein(21563-25384)	835-844
3	1141-1150	PRRARSVRYP linker 1-10
3	1151-1160	GVITHDVSSA	helicase(16237-18039)	478-487
3	1161-1170	PRRARSVRYP linker 1-10
3	1171-1180	GLPVKYLYFI	nsp9(12686-13024)	82-91
3	1181-1190	PRRARSVRYP linker 1-10
3	1191-1201	SPDAVTAYNGY	nsp3(2720-8554)	661-671
3	1202-1211	PRRARSVRYP linker 1-10
3	1212-1225	ARSVASQSIIAYTM	surface_glycoprotein(21563-25384)	684-697
3	1226-1235	PRRARSVRYP linker 1-10
3	1236-1246	VLPFNDGVYFA	surface_glycoprotein(21563-25384)	83-93
3	1247-1256	PRRARSVRYP linker 1-10
3	1257-1271	AQSFLNRVCGVSAAR	RNA-dependent_RNA_polymerase	4-18
			(13442-13468 + 13468-16236)
3	1272-1281	PRRARSVRYP linker 1-10
3	1282-1289	AEVQIDRL	surface_glycoprotein(21563-25384)	989-996
3	1290-1299	PRRARSVRYP linker 1-10
3	1300-1307	DLSVVNAR	helicase(16237-18039)	383-390
3	1308-1317	PRRARSVRYP linker 1-10
3	1318-1334	FRELGVVHNQDVNLHSS	RNA-dependent_RNA_polymerase	348-364
			(13442-13468 + 13468-16236)
3	1335-1344	PRRARSVRYP linker 1-10
3	1345-1356	NFRVQPTESIVR	surface_glycoprotein(21563-25384)	317-328
3	1357-1366	PRRARSVRYP linker 1-10
3	1367-1387	CSARHINAQVAKSHNIALIWN	nsp3(2720-8554)	1876-1896
4	1-10	EQYVFCTVNA	helicase(16237-18039)	353-362
4	11-20	PRRARSVRYP linker 1-10
4	21-32	TRAKVGILCIMS	helicase(16237-18039)	566-577
4	33-42	PRRARSVRYP linker 1-10
4	43-54	FKLASHMYCSFY	nsp3(2720-8554)	96-107
4	55-64	PRRARSVRYP linker 1-10
4	65-72	SRELKVTF	nsp3(2720-8554)	1134-1141
4	73-82	PRRARSVRYP linker 1-10
4	83-100	DKACPLIAAVITREVGFV	nsp4(8555-10054)	85-102
4	101-110	PRRARSVRYP linker 1-10
4	111-120	LEGSVAYESL	nsp4(8555-10054)	176-185
4	121-130	PRRARSVRYP linker 1-10
4	131-140	GTNLPLQLGF	3′-to-5′_exonuclease(18040-19620)	102-111
4	141-150	PRRARSVRYP linker 1-10
4	151-158	ADAVIKTL	nsp3(2720-8554)	58-65
4	159-168	PRRARSVRYP linker 1-10
4	169-177	RSVYPVASP	nsp2(806-2719)	121-129
4	178-187	PRRARSVRYP linker 1-10
4	188-217	SDIDITFLKKDAPYIVGDVVQEGVLTA	nsp3(2720-8554)	454-483
		VVI
4	218-227	PRRARSVRYP linker 1-10
4	228-238	TEISFMLWCKD	endoRNAse(19621-20658)	325-335
4	239-248	PRRARSVRYP linker 1-10
4	249-256	ARDLSLQF	nsp3(2720-8554)	1652-1659
4	257-266	PRRARSVRYP linker 1-10
4	267-279	KLALGGSVAIKIT	2′-O-ribose_methyltransferase	160-172
			(20659-21552)
4	280-289	PRRARSVRYP linker 1-10
4	290-299	FDVVRQCSGV	3C-like_proteinase(10055-10972)	294-303
4	300-309	PRRARSVRYP linker 1-10
4	310-319	RHSLSHFVNL	nsp3(2720-8554)	1697-1706
4	320-329	PRRARSVRYP linker 1-10
4	330-337	KAVFISPY	helicase(16237-18039)	508-515
4	338-347	PRRARSVRYP linker 1-10
4	348-368	LGVLVPHVGEIPVAYRKVLLR	leader_protein(266-805)	104-124
4	369-378	PRRARSVRYP linker 1-10
4	379-394	IKPVTYKLDGVVCTEI	nsp3(2720-8554)	1059-1074
4	395-404	PRRARSVRYP linker 1-10
4	405-412	SLWVYKQF	3′-to-5′_exonuclease(18040-19620)	507-514
4	413-422	PRRARSVRYP linker 1-10
4	423-436	RLTLGVYDYLVSTQ	nsp6(10973-11842)	236-249
4	437-446	PRRARSVRYP linker 1-10
4	447-469	ELYHYQECVRGTTVLLKEPCSSG	ORF7a_protein(27394-27759)	16-38
4	470-479	PRRARSVRYP linker 1-10
4	480-506	FSASTSAFVETVKGLDYKAFKQIVESC	nsp2(806-2719)	300-326
4	507-516	PRRARSVRYP linker 1-10
4	517-546	CQVHGNAHVASCSAIMTRCLAVHECFV	3′-to-5′_exonuclease(18040-19620)	261-290
		KRV
4	547-556	PRRARSVRYP linker 1-10
4	557-577	VKDCVVLHSYFTSDYYQLYST	ORF3a_protein(25393-26220)	197-217
4	578-587	PRRARSVRYP linker 1-10
4	588-600	YTELEPPCRFVTD	nsp9(12686-13024)	66-78
4	601-610	PRRARSVRYP linker 1-10
4	611-631	QPYRVVVLSFELLHAPATVCG	surface_glycoprotein(21563-25384)	506-526
4	632-641	PRRARSVRYP linker 1-10
4	642-651	PRWYFYYLGT	nucleocapsid_phosphoprotein	106-115
			(28274-29533)
4	652-661	PRRARSVRYP linker 1-10
4	662-698	ALTCFSTQFAFACPDGVKHVYQLRARS	ORF7a_protein(27394-27759)	55-91
		VSPKLFIRQE
4	699-708	PRRARSVRYP linker 1-10
4	709-723	VEHVTFFIYNKIVDE	ORF3a_protein(25393-26220)	225-239
4	724-733	PRRARSVRYP linker 1-10
4	734-757	LGSLVVRCSFYEDFLEYHDVRVVL	ORF8_protein(27894-28259)	95-118
4	758-767	PRRARSVRYP linker 1-10
4	768-779	ALGKLQDVVNQN	surface_glycoprotein(21563-25384)	944-955
4	780-789	PRRARSVRYP linker 1-10
4	790-846	HFAIGLALYYPSARIVYTACSHAAVDA	helicase(16237-18039)	290-346
		LCEKALKYLPIDKCSRIIPARARVECF
		DKF
4	847-856	PRRARSVRYP linker 1-10
4	857-874	ANSVFNICQAVTANVNAL	RNA-dependent_RNA_polymerase	690-707
			(13442-13468 + 13468-16236)
4	875-884	PRRARSVRYP linker 1-10
4	885-900	VREVLSDRELHLSWEV	helicase(16237-18039)	154-169
4	901-910	PRRARSVRYP linker 1-10
4	911-918	FNSVCRLM	helicase(16237-18039)	422-429
4	919-928	PRRARSVRYP linker 1-10
4	929-936	SASKIITL	ORF3a_protein(25393-26220)	58-65
4	937-946	PRRARSVRYP linker 1-10
4	947-959	VEGCMVQVTCGTT	3C-like_proteinase(10055-10972)	13-25
4	960-969	PRRARSVRYP linker 1-10
4	970-1013	KSAFVNLKQLPFFYYSDSPCESHGKQV	3′-to-5′_exonuclease(18040-19620)	433-476
		VSDIDYVPLKSATCITR
4	1014-1023	PRRARSVRYP linker 1-10
4	1024-1038	EVPANSTVLSFCAFA	nsp10(13025-13441)	6-20
4	1039-1048	PRRARSVRYP linker 1-10
4	1049-1065	LTQYNRYLALYNKYKYF	nsp4(8555-10054)	438-454
4	1066-1075	PRRARSVRYP linker 1-10
4	1076-1083	NNLVVMAY	nsp2(806-2719)	413-420
4	1084-1093	PRRARSVRYP linker 1-10
4	1094-1101	CSCGSCCK	surface_glycoprotein(21563-25384)	1248-1255
4	1102-1111	PRRARSVRYP linker 1-10
4	1112-1119	DSYFVVKR	RNA-dependent_RNA_polymerase	67-74
			(13442-13468 + 13468-16236)
4	1120-1129	PRRARSVRYP linker 1-10
4	1130-1139	RQALLKTVQF	RNA-dependent_RNA_polymerase	183-192
			(13442-13468 + 13468-16236)
4	1140-1149	PRRARSVRYP linker 1-10
4	1150-1160	AALALLLLDRL	nucleocapsid_phosphoprotein	217-227
			(28274-29533)
4	1161-1170	PRRARSVRYP linker 1-10
4	1171-1180	SVLNDILSRL	surface_glycoprotein(21563-25384)	975-984
4	1181-1190	PRRARSVRYP linker 1-10
4	1191-1210	YLFQHANLDSCKRVLNVVCK	nsp3(2720-8554)	916-935
4	1211-1220	PRRARSVRYP linker 1-10
4	1221-1233	GVNLVAVPTGYVD	3′-to-5′_exonuclease(18040-19620)	114-126
4	1234-1243	PRRARSVRYP linker 1-10
4	1244-1251	ISEHDYQI	ORF3a_protein(25393-26220)	179-186
4	1252-1261	PRRARSVRYP linker 1-10
4	1262-1282	KSILSPLYAFASEAARVVRSI	nsp2(806-2719)	347-367
4	1283-1292	PRRARSVRYP linker 1-10
4	1293-1300	FTGCVIAW	surface_glycoprotein(21563-25384)	429-436
4	1301-1310	PRRARSVRYP linker 1-10
4	1311-1322	MPLKAPKEIIFL	nsp2(806-2719)	551-562
4	1323-1332	PRRARSVRYP linker 1-10
4	1333-1346	WNVVRIKIVQMLSD	3′-to-5′_exonuclease(18040-19620)	159-172
4	1347-1356	PRRARSVRYP linker 1-10
4	1357-1382	KNPLLYDANYFLCWHTNVYDYCIPYN	ORF3a_protein(25393-26220)	136-161
4	1383-1392	PRRARSVRYP linker 1-10
4	1393-1408	LQSLQTYVTQQLIRAA	surface_glycoprotein(21563-25384)	1001-1016

In certain embodiments, the vaccine comprises or expresses at least one of the contigs concatemers of epitopes from SARS-COV-2 with intervening linker sequences set forth in Table 2 (also see FIG. 13). In certain embodiments, the vaccine comprises or expresses at least two of the concatemers set forth below. In certain embodiments, the vaccine comprises or expresses three of the concatemers set forth below. In certain embodiments, the vaccine comprises or expresses all the concatemers set forth below.

TABLE 2
concat-	pos_in_			pos_in_
emer	concatemer	epitope	gene	gene
1	1-24	TYASALWEIQQVVDADSKIVQLSE	nsp8(12092-12685)	148-171
1	25-34	PRRARSVRYP linker 1-10
1	35-44	FDVVRQCSGV	3C-like_proteinase(10055-10972)	294-303
1	45-54	PRRARSVRYP linker 1-10
1	55-62	LMVVIPDY	nsp8(12092-12685)	128-135
1	63-72	PRRARSVRYP linker 1-10
1	73-90	KILNNLGVDIAANTVIWD	endoRNAse(19621-20658)	70-87
1	91-100	PRRARSVRYP linker 1-10
1	101-111	TKVDGVDVELF	endoRNAse(19621-20658)	33-43
1	112-121	PRRARSVRYP linker 1-10
1	122-130	VLGSLAATV	nsp9(12686-13024)	102-110
1	131-140	PRRARSVRYP linker 1-10
1	141-148	CSCGSCCK	surface_glycoprotein(21563-25384)	1248-1255
1	149-158	PRRARSVRYP linker 1-10
1	159-169	VLPFNDGVYFA	surface_glycoprotein(21563-25384)	83-93
1	170-179	PRRARSVRYP linker 1-10
1	180-193	FFSNVTWFHAIHVS	surface_glycoprotein(21563-25384)
1	194-203	PRRARSVRYP linker 1-10
1	204-211	SQDLSVVS	endoRNAse(19621-20658)	308-315
1	212-221	PRRARSVRYP linker 1-10
1	222-232	SEAFLIGCNYL	2′-O-ribose_methyltransferase	202-212
			(20659-21552)
1	233-242	PRRARSVRYP linker 1-10
1	243-250	AEVQIDRL	surface_glycoprotein(21563-25384)	989-996
1	251-260	PRRARSVRYP linker 1-10
1	261-272	GSNVFQTRAGCL	surface_glycoprotein(21563-25384)	639-650
1	273-282	PRRARSVRYP linker 1-10
1	283-310	IKDLPKEITVATSRTLSYYKLGASQRVA	membrane_glycoprotein(26523-27191)	161-188
1	311-320	PRRARSVRYP linker 1-10
1	321-328	TDAVDCAL	surface_glycoprotein(21563-25384)	286-293
1	329-338	PRRARSVRYP linker 1-10
1	339-350	FNCYFPLQSYGF	surface_glycoprotein(21563-25384)	486-497
1	351-360	PRRARSVRYP linker 1-10
1	361-370	GPKVKYLYFI	nsp9(12686-13024)	82-91
1	371-380	PRRARSVRYP linker 1-10
1	381-390	FEYVSQPFLM	surface_glycoprotein(21563-25384)	168-177
1	391-400	PRRARSVRYP linker 1-10
1	401-416	LQSLQTYVTQQLIRAA	surface_glycoprotein(21563-25384)	1001-1016
1	417-426	PRRARSVRYP linker 1-10
1	427-440	TSACVLAAECTIFK	nsp4(8555-10054)	147-160
1	441-450	PRRARSVRYP linker 1-10
1	451-458	TSCCSCLK	surface_glycoprotein(21563-25384)	1238-1245
1	459-468	PRRARSVRYP linker 1-10
1	469-496	RLCAYCCNIVNVSLVKPSFYVYSRVKNL	envelope_protein(26245-26472)	38-65
1	497-506	PRRARSVRYP linker 1-10
1	507-516	TPLIQPIGAL	nsp4(8555-10054)	269-278
1	517-526	PRRARSVRYP linker 1-10
1	527-538	ALGKLQDVVNQN	surface_glycoprotein(21563-25384)	944-955
1	539-548	PRRARSVRYP linker 1-10
1	549-556	FTGCVIAW	surface_glycoprotein(21563-25384)	429-436
1	557-566	PRRARSVRYP linker 1-10
1	567-579	YTELEPPCRFVTD	nsp9(12686-13024)	66-78
1	580-589	PRRARSVRYP linker 1-10
1	590-603	LSPVALRQMSCAAG	nsp9(12686-13024)	4-17
1	604-613	PRRARSVRYP linker 1-10
1	614-622	IQLSSYSLF	2′-O-ribose_methyltransferase	237-245
			(20659-21552)
2	1-10	EGSVRVVTTF	nsp4(8555-10054)	207-216
2	11-20	PRRARSVRYP linker 1-10
2	21-36	SEFSSLPSYAAFATAQ	nsp8(12092-12685)	4-19
2	37-46	PRRARSVRYP linker 1-10
2	47-54	VAFNVVNK	endoRNAse(19621-20658)	5-12
2	55-64	PRRARSVRYP linker 1-10
2	65-85	LGVLVPHVGEIPVAYRKVLLR	leader_protein(266-805)	104-124
2	86-95	PRRARSVRYP linker 1-10
2	96-105	ARDLICAQKF	surface_glycoprotein(21563-25384)	846-855
2	106-115	PRRARSVRYP linker 1-10
2	116-127	LNVPLHGTILTR	membrane_glycoprotein(26523-27191)	120-131
2	128-137	PRRARSVRYP linker 1-10
2	138-147	SVLNDILSRL	surface_glycoprotein(21563-25384)	975-984
2	148-157	PRRARSVRYP linker 1-10
2	158-168	AALALLLLDRL	nucleocapsid_phosphoprotein	217-227
			(28274-29533)
2	169-178	PRRARSVRYP linker 1-10
2	179-186	EVTPSGTW	nucleocapsid_phosphoprotein	323-330
			(28274-29533)
2	187-196	PRRARSVRYP linker 1-10
2	197-204	AALQIPFA	surface_glycoprotein(21563-25384)	892-899
2	205-214	PRRARSVRYP linker 1-10
2	215-232	YQDVNCTEVPVAIHADQL	surface_glycoprotein(21563-25384)	612-629
2	233-242	PRRARSVRYP linker 1-10
2	243-252	KQYGDCLGDI	surface_glycoprotein(21563-25384)	835-844
2	253-262	PRRARSVRYP linker 1-10
2	263-275	QCVQLHNDILLAK	nsp7(11843-12091)	31-43
2	276-285	PRRARSVRYP linker 1-10
2	286-295	LAWPLIVTAL	nsp8(12092-12685)	180-189
2	296-305	PRRARSVRYP linker 1-10
2	306-323	HVQLSLPVLQVRDVLVRG	leader_protein(266-805)	13-30
2	324-333	PRRARSVRYP linker 1-10
2	334-349	LVDFQVTIAEILLIIM	ORF6_protein(27202-27387)	4-19
2	350-359	PRRARSVRYP linker 1-10
2	360-367	SLIDLQEL	surface_glycoprotein(21563-25384)	1196-1203
2	368-377	PRRARSVRYP linker 1-10
2	378-409	VDFCGKGYHLMSFPQSAPHGVVFLHVTY	surface_glycoprotein(21563-25384)	1040-1071
		VPAQ
2	410-419	PRRARSVRYP linker 1-10
2	420-429	LEGSVAYESL	nsp4(8555-10054)	176-185
2	430-439	PRRARSVRYP linker 1-10
2	440-466	AKYTQLCQYLNTLTLAVPYNMRVIHFG	2′-O-ribose_methyltransferase	45-71
			(20659-21552)
2	467-476	PRRARSVRYP linker 1-10
2	477-513	ALTCFSTQFAFACPDGVKHVYQLRARSV	ORF7a_protein(27394-27759)	55-91
		SPKLFIRQE
2	514-523	PRRARSVRYP linker 1-10
2	524-534	ITNCVKMLCTH	nsp10(13025-13441)	38-48
2	535-544	PRRARSVRYP linker 1-10
2	545-557	YTVSCLPFTINCQ	ORF8_protein(27894-28259)	79-91
2	558-567	PRRARSVRYP linker 1-10
2	568-591	LGSLVVRCSFYEDFLEYHDVRVVL	ORF8_protein(27894-28259)	95-118
2	592-601	PRRARSVRYP linker 1-10
2	602-614	KLALGGSVAIKIT	2′-O-ribose_methyltransferase	160-172
			(20659-21552)
2	615-624	PRRARSVRYP linker 1-10
2	625-636	LKKLKKSLNVAK	nsp8(12092-12685)	35-46
3	1-15	SVLLSMQGAVDINKL	nsp7(11843-12091)	57-71
3	16-25	PRRARSVRYP linker 1-10
3	26-58	YEPLTQDHVDILGPLSAQTGIAVLDMCA	3C-like_proteinase(10055-10972)	239-271
		SLKEI
3	59-68	PRRARSVRYP linker 1-10
3	69-84	NDLCFTNVYADSFVIR	surface_glycoprotein(21563-25384)	388-403
3	85-94	PRRARSVRYP linker 1-10
3	95-110	DQVILLNKHIDAYKTF	nucleocapsid_phosphoprotein	348-363
			(28274-29533)
3	111-120	PRRARSVRYP linker 1-10
3	121-132	EVFAQVKQIYKT	surface_glycoprotein(21563-25384)	780-791
3	133-142	PRRARSVRYP linker 1-10
3	143-162	VVIKVCEFQFCNDPFLGVYY	surface_glycoprotein(21563-25384)	126-145
3	163-172	PRRARSVRYP linker 1-10
3	173-187	EILDITPCSFGGVSV	surface_glycoprotein(21563-25384)	583-597
3	188-197	PRRARSVRYP linker 1-10
3	198-207	IGDCATVHTA	2′-O-ribose_methyltransferase	112-121
			(20659-21552)
3	208-217	PRRARSVRYP linker 1-10
3	218-232	SDVLYQPPQTSITSA	nsp4(8555-10054)	483-497
3	233-242	PRRARSVRYP linker 1-10
3	243-250	YLKLRSDV	nsp4(8555-10054)	427-434
3	251-260	PRRARSVRYP linker 1-10
3	261-274	DYDCVSFCYMHHME	3C-like_proteinase(10055-10972)	153-166
3	275-284	PRRARSVRYP linker 1-10
3	285-292	GYVMHANY	2′-O-ribose_methyltransferase	221-228
			(20659-21552)
3	293-302	PRRARSVRYP linker 1-10
3	303-312	GEVPVSIINN	endoRNAse(19621-20658)	20-29
3	313-322	PRRARSVRYP linker 1-10
3	323-345	TFKVSIWNLDYIINLIIKNLSKS	ORF6_protein(27202-27387)	21-43
3	346-355	PRRARSVRYP linker 1-10
3	356-392	FHQECSLQSCTQHQPYVVDDPCPIHFYS	ORF8_protein(27894-28259)	16-52
		KWYIRVGAR
3	393-402	PRRARSVRYP linker 1-10
3	403-413	ETICAPLTVFF	endoRNAse(19621-20658)	113-123
3	414-423	PRRARSVRYP linker 1-10
3	424-439	NFLVQAGNVQLRVIGH	3C-like_proteinase(10055-10972)	65-80
3	440-449	PRRARSVRYP linker 1-10
3	450-466	LTQYNRYLALYNKYKYF	nsp4(8555-10054)	438-454
3	467-476	PRRARSVRYP linker 1-10
3	477-498	LPRVFSAVGNICYTPSKLIEYT	nsp4(8555-10054)	122-143
3	499-508	PRRARSVRYP linker 1-10
3	509-520	NFRVQPTESIVR	surface_glycoprotein(21563-25384)	317-328
3	521-530	PRRARSVRYP linker 1-10
3	531-545	EVPANSTVLSFCAFA	nsp10(13025-13441)	6-20
3	546-555	PRRARSVRYP linker 1-10
3	556-569	FQTLLALHRSYLTP	surface_glycoprotein(21563-25384)	238-251
3	570-579	PRRARSVRYP linker 1-10
3	580-596	AAAYYVGYLQPRTFLLK	surface_glycoprotein(21563-25384)	262-278
3	597-606	PRRARSVRYP linker 1-10
3	607-616	PRWYFYYLGT	nucleocapsid_phosphoprotein	106-115
			(28274-29533)
3	617-626	PRRARSVRYP linker 1-10
3	627-640	RLTLGVYDYLVSTQ	nsp6(10973-11842)	236-249
4	1-14	ARSVASQSIIAYTM	surface_glycoprotein(21563-25384)	684-697
4	15-24	PRRARSVRYP linker 1-10
4	25-35	TEISFMLWCKD	endoRNAse(19621-20658)	325-335
4	36-45	PRRARSVRYP linker 1-10
4	46-66	QPYRVVVLSFELLHAPATVCG	surface_glycoprotein(21563-25384)	506-526
4	67-76	PRRARSVRYP linker 1-10
4	77-99	GEAVKTQFNYYKKVDGVVQQLPE	endoRNAse(19621-20658)	169-191
4	100-109	PRRARSVRYP linker 1-10
4	110-126	KHWPQIAQFAPSASAFF	nucleocapsid_phosphoprotein	299-315
			(28274-29533)
4	127-136	PRRARSVRYP linker 1-10
4	137-144	TFSVLACY	3C-like_proteinase(10055-10972)	111-118
4	145-154	PRRARSVRYP linker 1-10
4	155-162	EHIVYGDF	endoRNAse(19621-20658)	233-240
4	163-172	PRRARSVRYP linker 1-10
4	173-181	KFPLKLRGT	2′-O-ribose_methyltransferase	249-257
			(20659-21552)
4	182-191	PRRARSVRYP linker 1-10
4	192-199	STFKCYGV	surface_glycoprotein(21563-25384)	375-382
4	200-209	PRRARSVRYP linker 1-10
4	210-219	LQYGSFCTQL	surface_glycoprotein(21563-25384)	754-763
4	220-229	PRRARSVRYP linker 1-10
4	230-240	CTLKSFTVEKG	surface_glycoprotein(21563-25384)	301-311
4	241-250	PRRARSVRYP linker 1-10
4	251-261	VEEVLSEARQH	leader_protein(266-805)	35-45
4	262-271	PRRARSVRYP linker 1-10
4	272-289	AFKLNIKLLGVGGKPCIK	nsp6(10973-11842)	268-285
4	290-299	PRRARSVRYP linker 1-10
4	300-313	DGCVPLNIIPLTTA	nsp8(12092-12685)	112-125
4	314-323	PRRARSVRYP linker 1-10
4	324-336	VEGCMVQVTCGTT	3C-like_proteinase(10055-10972)	13-25
4	337-346	PRRARSVRYP linker 1-10
4	347-366	KGFCDLKGKYVQIPTTCAND	nsp10(13025-13441)	87-106
4	367-376	PRRARSVRYP linker 1-10
4	377-396	INLVRDLPQGFSALEPLVDL	surface_glycoprotein(21563-25384)	210-229
4	397-406	PRRARSVRYP linker 1-10
4	407-416	CPRHVICTSE	3C-like_proteinase(10055-10972)	38-47
4	417-426	PRRARSVRYP linker 1-10
4	427-444	DKACPLIAAVITREVGFV	nsp4(8555-10054)	85-102
4	445-454	PRRARSVRYP linker 1-10
4	455-466	TVNVLAWLYAAV	3C-like_proteinase(10055-10972)	201-212
4	467-476	PRRARSVRYP linker 1-10
4	477-500	SELVIGAVILRGHLRIAGHHLGRC	membrane_glycoprotein(26523-27191)	136-159
4	501-510	PRRARSVRYP linker 1-10
4	511-533	ELYHYQECVRGTTVLLKEPCSSG	ORF7a_protein(27394-27759)	16-38
4	534-543	PRRARSVRYP linker 1-10
4	544-553	TLPVNVAFEL	endoRNAse(19621-20658)	48-57
4	554-563	PRRARSVRYP linker 1-10
4	564-575	ISVTTEILPVSM	surface_glycoprotein(21563-25384)	720-731
4	576-585	PRRARSVRYP linker 1-10
4	586-596	ASCCLYCRCHI	nsp10(13025-13441)	71-81
4	597-606	PRRARSVRYP linker 1-10
4	607-621	ISNCVADYSVLYNSA	surface_glycoprotein(21563-25384)	358-372

In certain embodiments, the vaccine comprises or expresses at least one of the concatemers of epitopes from SARS-COV-2 with intervening linker sequences. In certain embodiments, the vaccine comprises or expresses at least two of the concatemers set forth below. In certain embodiments, the vaccine comprises or expresses three of the concatemer set forth below. In certain embodiments, the vaccine comprises or expresses all the concatemers set forth below.

TABLE 3
concat-	pos_in_			pos_in_
emer	concatemer	epitope	gene	gene
1	1-24	TYASALWEIQQVVDADSKIVQLSE	nsp8(12092-12685)	148-171
1	25-34	PRRARSVRYP linker 1-10
1	35-47	QCVQLHNDILLAK	nsp7(11843-12091)	31-43
1	48-57	PRRARSVRYP linker 1-10
1	58-70	VEGCMVQVTCGTT	3C-like_proteinase(10055-10972)	13-25
1	71-80	PRRARSVRYP linker 1-10
1	81-97	LTQYNRYLALYNKYKYF	nsp4(8555-10054)	438-454
1	98-107	PRRARSVRYP linker 1-10
1	108-117	TPLIQPIGAL	nsp4(8555-10054)	269-278
1	118-127	PRRARSVRYP linker 1-10
1	128-135	LMVVIPDY	nsp8(12092-12685)	128-135
1	136-145	PRRARSVRYP linker 1-10
1	146-155	TLPVNVAFEL	endoRNAse(19621-20658)	48-57
1	156-165	PRRARSVRYP linker 1-10
1	166-181	DQVILLNKHIDAYKTF	nucleocapsid_phosphoprotein	348-363
			(28274-29533)
1	182-191	PRRARSVRYP linker 1-10
1	192-203	LKKLKKSLNVAK	nsp8(12092-12685)	35-46
1	204-213	PRRARSVRYP linker 1-10
1	214-221	EHIVYGDF	endoRNAse(19621-20658)	233-240
1	222-231	PRRARSVRYP linker 1-10
1	232-242	VEEVLSEARQH	leader_protein(266-805)	35-45
1	243-252	PRRARSVRYP linker 1-10
1	253-266	DGCVPLNIIPLTTA	nsp8(12092-12685)	112-125
1	267-276	PRRARSVRYP linker 1-10
1	277-299	ELYHYQECVRGTTVLLKEPCSSG	ORF7a_protein(27394-27759)	16-38
1	300-309	PRRARSVRYP linker 1-10
1	310-319	PRWYFYYLGT	nucleocapsid_phosphoprotein	106-115
			(28274-29533)
1	320-329	PRRARSVRYP linker 1-10
1	330-344	SDVLYQPPQTSITSA	nsp4(8555-10054)	483-497
1	345-354	PRRARSVRYP linker 1-10
1	355-378	SELVIGAVILRGHLRIAGHHLGRC	membrane_glycoprotein(26523-27191)	136-159
1	379-388	PRRARSVRYP linker 1-10
1	389-408	KGFCDLKGKYVQIPTTCAND	nsp10(13025-13441)	87-106
1	409-418	PRRARSVRYP linker 1-10
1	419-436	AFKLNIKLLGVGGKPCIK	nsp6(10973-11842)	268-285
2	1-10	EGSVRVVTTF	nsp4(8555-10054)	207-216
2	11-20	PRRARSVRYP linker 1-10
2	21-29	KFPLKLRGT	2′-O-ribose_methyltransferase	249-257
			(20659-21552)
2	30-39	PRRARSVRYP linker 1-10
2	40-49	CPRHVICTSE	3C-like_proteinase(10055-10972)	38-47
2	50-59	PRRARSVRYP linker 1-10
2	60-77	DKACPLIAAVITREVGFV	nsp4(8555-10054)	85-102
2	78-87	PRRARSVRYP linker 1-10
2	88-101	DYDCVSFCYMHHME	3C-like_proteinase(10055-10972)	153-166
2	102-111	PRRARSVRYP linker 1-10
2	112-127	NFLVQAGNVQLRVIGH	3C-like_proteinase(10055-10972)	65-80
2	128-137	PRRARSVRYP linker 1-10
2	138-146	IQLSSYSLF	2′-O-ribose_methyltransferase	237-245
			(20659-21552)
2	147-156	PRRARSVRYP linker 1-10
2	157-169	KLALGGSVAIKIT	2′-O-ribose_methyltransferase	160-172
2	170-179	PRRARSVRYP linker 1-10	(20659-21552)
2	180-197	KILNNLGVDIAANTVIWD	endoRNAse(19621-20658)	70-87
2	198-207	PRRARSVRYP linker 1-10
2	208-235	IKDLPKEITVATSRTLSYYKLGASQRVA	membrane_glycoprotein(26523-27191)	161-188
2	236-245	PRRARSVRYP linker 1-10
2	246-266	LGVLVPHVGEIPVAYRKVLLR	leader_protein(266-805)	104-124
2	267-276	PRRARSVRYP linker 1-10
2	277-286	GEVPVSIINN	endoRNAse(19621-20658)	20-29
2	287-296	PRRARSVRYP linker 1-10
2	297-306	LAWPLIVTAL	nsp8(12092-12685)	180-189
2	307-316	PRRARSVRYP linker 1-10
2	317-328	LNVPLHGTILTR	membrane_glycoprotein(26523-27191)	120-131
2	329-338	PRRARSVRYP linker 1-10
2	339-346	EVTPSGTW	nucleocapsid_phosphoprotein	323-330
			(28274-29533)
2	347-356	PRRARSVRYP linker 1-10
2	357-371	EVPANSTVLSFCAFA	nsp10(13025-13441)	6-20
2	372-381	PRRARSVRYP linker 1-10
2	382-389	VAFNVVNK	endoRNAse(19621-20658)	5-12
2	390-399	PRRARSVRYP linker 1-10
2	400-422	GEAVKTQFNYYKKVDGVVQQLPE	endoRNAse(19621-20658)	169-191
2	423-432	PRRARSVRYP linker 1-10
2	433-443	ASCCLYCRCHI	nsp10(13025-13441)	71-81
3	1-15	SVLLSMQGAVDINKL	nsp7(11843-12091) 57-71	57-71
3	16-25	PRRARSVRYP linker 1-10
3	26-38	YTELEPPCRFVTD	nsp9(12686-13024)	66-78
3	39-48	PRRARSVRYP linker 1-10
3	49-62	RLTLGVYDYLVSTQ	nsp6(10973-11842)	236-249
3	63-72	PRRARSVRYP linker 1-10
3	73-86	LSPVALRQMSCAAG	nsp9(12686-13024)	4-17
3	87-96	PRRARSVRYP linker 1-10
3	97-107	TEISFMLWCKD	endoRNAse(19621-20658)	325-335
3	108-117	PRRARSVRYP linker 1-10
3	118-129	TVNVLAWLYAAV	3C-like_proteinase(10055-10972)	201-212
3	130-139	PRRARSVRYP linker 1-10
3	140-157	HVQLSLPVLQVRDVLVRG	leader_protein(266-805)	13-30
3	158-167	PRRARSVRYP linker 1-10
3	168-180	YTVSCLPFTINCQ	ORF8_protein(27894-28259)	79-91
3	181-190	PRRARSVRYP linker 1-10
3	191-198	GYVMHANY	2′-O-ribose_methyltransferase	221-228
			(20659-21552)
3	199-208	PRRARSVRYP linker 1-10
3	209-232	LGSLVVRCSFYEDFLEYHDVRVVL	ORF8_protein(27894-28259)	95-118
3	233-242	PRRARSVRYP linker 1-10
3	243-253	AALALLLLDRL	nucleocapsid_phosphoprotein	217-227
			(28274-29533)
3	254-263	PRRARSVRYP linker 1-10
3	264-271	YLKLRSDV	nsp4(8555-10054)	427-434
3	272-281	PRRARSVRYP linker 1-10
3	282-292	ITNCVKMLCTH	nsp10(13025-13441)	38-48
3	293-302	PRRARSVRYP linker 1-10
3	303-316	TSACVLAAECTIFK	nsp4(8555-10054) 147-160	147-160
3	317-326	PRRARSVRYP linker 1-10
3	327-335	VLGSLAATV	nsp9(12686-13024)	102-110
3	336-345	PRRARSVRYP linker 1-10
3	346-353	TFSVLACY	3C-like_proteinase(10055-10972)	111-118
3	354-363	PRRARSVRYP linker 1-10
3	364-400	ALTCFSTQFAFACPDGVKHVYQLRARSV	ORF7a_protein(27394-27759)	55-91
		SPKLFIRQE
3	401-410	PRRARSVRYP linker 1-10
3	411-427	KHWPQIAQFAPSASAFF	nucleocapsid_phosphoprotein	299-315
			(28274-29533)
4	1-10	FDVVRQCSGV	3C-like_proteinase(10055-10972)	294-303
4	11-20	PRRARSVRYP linker 1-10
4	21-47	AKYTQLCQYLNTLTLAVPYNMRVIHFG	2′-O-ribose_methyltransferase	45-71
			(20659-21552)
4	48-57	PRRARSVRYP linker 1-10
4	58-67	LEGSVAYESL	nsp4(8555-10054)	176-185
4	68-77	PRRARSVRYP linker 1-10
4	78-85	SQDLSVVS	endoRNAse(19621-20658)	308-315
4	86-95	PRRARSVRYP linker 1-10
4	96-118	TFKVSIWNLDYIINLIIKNLSKS	ORF6_protein(27202-27387)	21-43
4	119-128	PRRARSVRYP linker 1-10
4	129-139	ETICAPLTVFF	endoRNAse(19621-20658)	113-123
4	140-149	PRRARSVRYP linker 1-10
4	150-186	FHQECSLQSCTQHQPYVVDDPCPIHFYS	ORF8_protein(27894-28259)	16-52
		KWYIRVGAR
4	187-196	PRRARSVRYP linker 1-10
4	197-206	IGDCATVHTA	2′-O-ribose_methyltransferase	112-121
			(20659-21552)
4	207-216	PRRARSVRYP linker 1-10
4	217-227	SEAFLIGCNYL	2′-O-ribose_methyltransferase	202-212
			(20659-21552)
4	228-237	PRRARSVRYP linker 1-10
4	238-253	LVDFQVTIAEILLIIM	ORF6_protein(27202-27387)	4-19
4	254-263	PRRARSVRYP linker 1-10
4	264-274	TKVDGVDVELF	endoRNAse(19621-20658)	33-43
4	275-284	PRRARSVRYP linker 1-10
4	285-317	YEPLTQDHVDILGPLSAQTGIAVLDMCA	3C-like_proteinase(10055-10972)	239-271
		SLKEL
4	318-327	PRRARSVRYP linker 1-10
4	328-349	LPRVFSAVGNICYTPSKLIEYT	nsp4(8555-10054)	122-143
4	350-359	PRRARSVRYP linker 1-10
4	360-375	SEFSSLPSYAAFATAQ	nsp8(12092-12685)	4-19
4	376-385	PRRARSVRYP linker 1-10
4	386-395	GPKVKYLYFI	nsp9(12686-13024)	82-91
4	396-405	PRRARSVRYP linker 1-10
4	406-433	RLCAYCCNIVNVSLVKPSFYVYSRVKNL	envelope_protein(26245-26472)	38-65

Depending on the actual embodiment, the number of concatemers can be different. Depending on the actual embodiment, the sequence of the linker can be different. Depending on the actual embodiment, the concatemers can include epitopes derived from viral strains circulating in a specific geographical region or otherwise defined (it should be noted that the country names listed in the following sequences are actually placeholders for viral peptides circulating in more than one country).

In certain embodiments, the vaccine comprises or expresses at least one of the concatemers of epitopes from SARS-COV-2 with intervening linker sequences (and as set forth in FIG. 14). In certain embodiments, the vaccine comprises or expresses at least two of the concatemers set forth below. In certain embodiments, the vaccine comprises or expresses three of the concatemers set forth below. In certain embodiments, the vaccine comprises or expresses four of the concatemers set forth below. In certain embodiments, the vaccine comprises or expresses five of the concatemers set forth below. In certain embodiments, the vaccine comprises or expresses all the concatemers set forth below.

TABLE 4
concat-	pos_in_			pos_in_
emer	concatemer	epitope	gene	gene
1	1-11	GPKVKYLYFIK	nsp9(NC_045512: + : 12686-13024)	82-92
1	12-16	ATLQA linker 1-5
1	17-39	TQLYLGGMSYYCKPHKPPISFPL	helicase@Iceland(NC_045512@Iceland:	61-83
			+ : 16237-18039)
1	40-44	ATLQA linker 1-5
1	45-68	PINLVRDLPQGFSVLEPLVDLPIG	surface_glycoprotein@Belgium	205-228
			(NC_045512@Belgium: + :
			21563-25384)
1	69-73	ATLQA linker 1-5
1	74-89	NYTVSCLPFTINCQEP	ORF8_protein@Bangladesh(NC_045512@	78-93
			Bangladesh: + : 27894-28259)
1	90-94	ATLQA linker 1-5
1	95-109	VNCTEVPVAIHADQL	surface_glycoprotein(NC_045512: + :	615-629
			21563-25384)
1	110-114	ATLQA linker 1-5
1	115-128	TDTVVEHVTFFIYN	ORF3a_protein@CostaRica(NC_045512@	221-234
			CostaRica: + : 25393-26220)
1	129-133	ATLQA linker 1-5
1	134-153	RLCAYCCNIVNVSLVKPSFY	envelope_protein(NC_045512: + :	38-57
			26245-26472)
1	154-158	ATLQA linker 1-5
1	159-173	VEHVTFFIYNKIVDE	ORF3a_protein(NC_045512: + :	225-239
			25393-26220)
1	174-178	ATLQA linker 1-5
1	179-187	VLGSLAATV	nsp9(NC_045512: + : 12686-13024)	102-110
1	188-192	ATLQA linker 1-5
1	193-202	KACVEEVTTT	nsp3(NC_045512: + : 2720-8554)	415-424
1	203-207	ATLQA linker 1-5
1	208-215	PEHSLAEY	nsp2(NC_045512: + : 806-2719)	200-207
1	216-220	ATLQA linker 1-5
1	221-233	IVKFISTCACEIV	nsp2(NC_045512: + : 806-2719)	468-480
1	234-238	ATLQA linker 1-5
1	239-257	LEILDITPCSFGGVSVITP	surface_glycoprotein(NC_045512: + :	582-600
			21563-25384)
1	258-262	ATLQA linker 1-5
1	263-278	VREVLSDRELHLSWEV	helicase(NC_045512: + :	154-169
			16237-18039)
1	279-283	ATLQA linker 1-5
1	284-308	KNPLLYDANYFLCWHTNCYDYCIPY	ORF3a_protein@Aruba(NC_045512@	136-160
			Aruba: + : 25393-26220)
1	309-313	ATLQA linker 1-5
1	314-326	AFASEAARVVRSI	nsp2(NC_045512: + : 806-2719)	355-367
1	327-331	ATLQA linker 1-5
1	332-339	VQLRVIGH	3C-like_proteinase(NC_045512: + :	73-80
			10055-10972)
1	340-344	ATLQA linker 1-5
1	345-368	TTTVAAFHQECSLQLCTQHQPYVVD	ORF8_protein@USA(NC_045512@USA: + :	11-34
			27894-28259)
1	369-373	ATLQA linker 1-5
1	374-385	YPSLETIQITIS	nsp3(NC_045512: + : 2720-8554)	582-600
1	386-390	ATLQA linker 1-5
1	391-400	FCLEASFNYL	nsp3(NC_045512: + : 2720-8554)	1391-1400
1	401-405	ATLQA linker 1-5
1	406-423	QLALFKGVHFVCNLLLLF	ORF3a_protein@CostaRica(NC_045512@	70-87
			CostaRica: + : 25393-26220)
1	424-428	ATLQA linker 1-5
1	429-442	APGCDVTDVTQLYL	helicase@Aruba(NC_045512@Aruba: + :	52-65
			(16237-18039)
1	443-447	ATLQA linker 1-5
1	448-459	ISVTTEILPVSM	surface_glycoprotein(NC_045512: + :	720-731
			21563-25384)
1	460-464	ATLQA linker 1-5
1	465-481	PNFVFPLNSIIKTIQPR	nsp2(NC_045512: + : 806-2719)	91-107
1	482-486	ATLQA linker 1-5
1	487-499	QCVQLHNDILLAK	nsp7(NC_045512: + : 11843-12091)	31-43
1	500-504	ATLQA linker 1-5
1	505-524	ARRPFLCCKCCYDHVISTSH	helicase(NC_045512: + :	20-39
			16237-18039)
1	525-529	ATLQA linker 1-5
1	530-549	DANYFLCWHTNCYHYCIPYN	ORF3a_protein@Indonesia(NC_045512@	142-161
			Indonesia: + : 25393-26220)
1	550-554	ATLQA linker 1-5
1	555-562	APLEILCV	ORF8_protein(NC_045512: + :	55-62
			27894-28259)
1	563-567	ATLQA linker 1-5
1	568-575	TDVVYRAF	RNA-dependent_RNA_polymerase@	28-35
			Aruba(NC_045512@Aruba: + :
			13442-13468 + 13468-16236)
1	576-580	ATLQA linker 1-5
1	581-595	FSVAALTNNVAFQTV	RNA-dependent_RNA_polymerase	396-410
			(NC_045512: + : 13442-13468 +
			13468-16236)
1	596-600	ATLQA linker 1-5
1	601-620	KLTCATTRQVVNVVTTKIAL	nsp3(NC_045512: + : 2720-8554)	1923-1942
1	621-625	ATLQA linker 1-5
1	626-648	RVDFCGKGYHLMSFPQSAPHGVV	surface_glycoprotein(NC_045512: + :	1039-1061
			21563-25384)
1	649-653	ATLQA linker 1-5
1	654-661	KAVFISPY	helicase(NC_045512: + :	508-515
			16237-18039)
1	662-666	ATLQA linker 1-5
1	667-674	YDKLVSSF	nsp3(NC_045512: + : 2720-8554)	365-372
1	675-679	ATLQA linker 1-5
1	680-693	ITTVAAFHQECSLQ	ORF8_protein@Aruba(NC_045512@	10-23
			Aruba: + : 27894-28259)
1	694-698	ATLQA linker 1-5
1	699-707	RSVYPVASP	nsp2(NC_045512: + : 806-2719)	121-129
1	708-712	ATLQA linker 1-5
1	713-727	ALLAVFHSASKIITL	ORF3a_protein@Aruba(NC_045512@	51-65
			Aruba: + : 25393-26220)
1	728-732	ATLQA linker 1-5
1	733-740	TFSVLACY	3C-like_proteinase(NC_045512: + :	111-118
			10055-10972)
1	741-745	ATLQA linker 1-5
1	746-763	CANFNVLFSTVFPFTSFG	RNA-dependent_RNA_polymerase@	310-327
			Nigeria(NC_045512@Nigeria: + :
			13442-13468 + 13468-16236)
1	764-768	ATLQA linker 1-5
1	769-776	YDFAVSKG	RNA-dependent_RNA_polymerase@	420-427
			Aruba(NC_045512@Aruba: + :
			13442-13468 + 13468-16236)
1	777-781	ATLQA linker 1-5
1	782-791	ISEHDYQIGG	ORF3a_protein@FrenchGiana	179-188
			(NC_045512@FrenchGiana: + :
			25393-26220)
1	792-796	ATLQA linker 1-5
1	797-810	IRNLQHRLYECLYR	RNA-dependent_RNA_polymerase@	720-733
			Austria(NC_045512@Austria: + :
			13442-13468 + 13468-16236)
1	811-815	ATLQA linker 1-5
1	816-825	LAWPLIVTAL	nsp8(NC_045512: + : 12092-12685)	180-189
1	826-830	ATLQA linker 1-5
1	831-847	LTQYNRYLALYNKYKYF	nsp4(NC_045512: + : 8555-10054)	438-454
1	848-852	ATLQA linker 1-5
1	853-871	CYDYCIPYNSVTSLIVITS	ORF3a_protein@Netherlands	153-171
			(NC_045512@Netherlands: + :
			25393-26220)
1	872-876	ATLQA linker 1-5
1	877-884	DSYFVVKR	RNA-dependent_RNA_polymerase	67-74
			(NC_045512: + : 13442-13468 +
			13468-16236)
1	885-889	ATLQA linker 1-5
1	890-906	INFVRIIMRLWLCCKCR	ORF3a_protein@Australia	118-134
			(NC_045512@Australia: + :
			25393-26220)
1	907-911	ATLQA linker 1-5
1	912-926	INAACRKVQHMVVKA	3′-to-5′_exonuclease(NC_045512: + :	305-319
			18040-19620)
1	927-931	ATLQA linker 1-5
1	932-946	EVPANSTVLSFCAFA	nsp10(NC_045512: + : 13025-13441)	6-20
1	947-951	ATLQA linker 1-5
1	952-971	RAKHYVYIGDPAQLPAPRTL	helicase(NC_045512: + :	392-411
			16237-18039)
1	972-976	ATLQA linker 1-5
1	977-989	YAKPFLNKVVSTT	nsp3(NC_045512: + : 2720-8554)	1323-1335
1	990-994	ATLQA linker 1-5
1	995-1008	EGVVDYGARFYFYT	nsp3(NC_045512: + : 2720-8554)	595-608
1	1009-1013	ATLQA linker 1-5
1	1014-1035	NVVIKVCEFQFCNYPFLGVYYH	surface_glycoprotein@Brazil	125-146
			(NC_045512@Brazil: + :
			21563-25384)
1	1036-1040	ATLQA linker 1-5
1	1041-1059	ANSVFNICQAVTANVNALL	RNA-dependent_RNA_polymerase@	690-708
			Aruba(NC_045512@Aruba: + :
			13442-13468 + 13468-16236)
1	1060-1064	ATLQA linker 1-5
1	1065-1073	AGFSLWVYK	3′-to-5′_exonuclease(NC_045512: + :	504-512
			18040-19620)
1	1074-1078	ATLQA linker 1-5
1	1079-1086	ISNCVADY	surface_glycoprotein(NC_045512: + :	358-365
			21563-25384)
1	1087-1091	ATLQA linker 1-5
1	1092-1107	GSNVFQTRAGCLIGAE	surface_glycoprotein(NC_045512: + :	639-654
			21563-25384)
1	1108-1112	ATLQA linker 1-5
1	1113-1120	FTGCVIAW	surface_glycoprotein(NC_045512: + :	429-436
			21563-25384)
1	1121-1125	ATLQA linker 1-5
1	1126-1136	LRIAGHHLGRC	membrane_glycoprotein(NC_045512: +	149-159
			: 26523-27191)
1	1137-1141	ATLQA linker 1-5
1	1142-1161	YVYLPYPDPSRILGAGCFVD	RNA-dependent_RNA_polymerase	826-845
			(NC_045512: + : 13442-13468 +
			13468-16236)
1	1162-1166	ATLQA linker 1-5
1	1167-1186	PINLVRGLPQGFSVLEPLVD	surface_glycoprotein@SmallAfrica	209-228
			(NC_045512@SmallAfrica: + :
			21563-25384)
1	1187-1191	ATLQA linker 1-5
1	1192-1206	IPIRASLPFGWLIVG	ORF3a_protein@Iceland(NC_045512@	35-49
			Iceland: + : 25393-26220)
1	1207-1211	ATLQA linker 1-5
1	1212-1225	ETKCTLKSFTVEKG	surface_glycoprotein@Aruba	294-307
			(NC_045512@Aruba: + : 21563-25384)
1	1226-1230	ATLQA linker 1-5
1	1231-1240	KQYGDCLGNI	surface_glycoprotein@Jordan	831-840
			(NC_045512@Jordan: + : 21563-25384)
1	1241-1245	ATLQA linker 1-5
1	1246-1254	AAAYYVGYL	surface_glycoprotein(NC_045512: + :	262-270
			21563-25384)
1	1255-1259	ATLQA linker 1-5
1	1260-1269	TQNVLYENQK	surface_glycoprotein(NC_045512: + :	912-921
			21563-25384)
1	1270-1274	ATLQA linker 1-5
1	1275-1284	QEHYVRITGL	helicase(NC_045512: + :	243-252
			16237-18039)
1	1285-1289	ATLQA linker 1-5
1	1290-1309	MTSCCSCLKGCCSCGSCCKF	surface_glycoprotein(NC_045512: + :	1237-1256
			21563-25384)
1	1310-1314	ATLQA linker 1-5
1	1315-1330	SLRCGACIRRPFLCCK	helicase@Aruba(NC_045512@Aruba: + :	13-28
			16237-188039)
2	1-17	LECNVKTTEVVGDIILK	nsp3(NC_045512: + : 2720-8554)	1244-1260
2	18-22	ATLQA linker 1-5
2	23-33	HFPRKGVFVSN	surface_glycoprotein@SmallAsia	1078-1088
			(NC_045512@SmallAsia: + :
			21563-25384)
2	34-38	ATLQA linker 1-5
2	39-46	WFTALTQH	nucleocapsid_phosphoprotein	52-59
			(NC_045512: + : 28274-29533)
2	47-51	ATLQA linker 1-5
2	52-79	FTSDYYQLYSTQLSTYTGVEHVTFF	ORF3a_protein@Latvia(NC_045512@	207-234
		IYN	Latvia: + : 25393-26220)
2	80-84	ATLQA linker 1-5
2	85-104	LQKAAITILDGISQYSLRLI	nsp2(NC_045512: + : 806-2719)	382-401
2	105-109	ATLQA linker 1-5
2	110-117	ISEHDYQI	ORF3a_protein@Aruba(NC_045512@	179-186
			Aruba: + : 25393-26220)
2	118-122	ATLQA linker 1-5
2	123-132	KNTVCTVCGM	nsp10(NC_045512: + : 10325-13441)	113-122
2	133-137	ATLQA linker 1-5
2	138-158	KLSYGIAIVREVLSDRELHLS	helicase@Colombia(NC_045512@	146-166
			Colombia: + : 16237-18039)
2	159-163	ATLQA linker 1-5
2	164-183	GYLPQNAVVKIYCPACHNSE	nsp2(NC_045512: + : 806-2719)	178-197
2	184-188	ATLQA linker 1-5
2	189-197	VFSQCVNLT	surface_glycoprotein@Egypt	11-19
			(NC_045512@Egypt: + : 21563-25384)
2	198-202	ATLQA linker 1-5
2	203-220	DKACPLIAAVITREVGFV	nsp4(NC_045512: + : 8555-10054)	85-102
2	221-225	ATLQA linker 1-5
2	226-237	VPVVDSYYSLLM	RNA-dependent_RNA_polymerase	231-242
			(NC_045512: + : 13442-13468 +
			13468-16236)
2	238-242	ATLQA linker 1-5
2	243-250	SSIVITSV	ORF3a_protein@Aruba(NC_045512@	165-172
			Aruba: + : 25393-26220)
2	251-255	ATLQA linker 1-5
2	256-263	LPINVIVF	nsp3(NC_045512: + : 2720-8554)	1718-1725
2	264-268	ATLQA linker 1-5
2	269-276	MADLVYAL	RNA-dependent_RNA_polymerase	124-131
			(NC_045512: + : 13442-13468 +
			13468-16236)
2	277-281	ATLQA linker 1-5
2	282-289	KLGASQRV	membrane_glycoprotein(NC_045512: +	180-187
			: 26523-27191)
2	290-294	ATLQA linker 1-5
2	295-304	PFTINCQEPK	ORF8_protein@India(NC_045512@	85-94
			India: + : 27894-28259)
2	305-309	ATLQA linker 1-5
2	310-320	KGVQIPCTCGK	nsp3(NC_045512: + : 2720-8554)	963-973
2	321-325	ATLQA linker 1-5
2	326-337	SSPDAVTAYNGY	nsp3(NC_045512: + : 2720-8554)	660-671
2	338-342	ATLQA linker 1-5
2	343-365	YLGGMSYYCKSHKLPISFPLCAN	helicase@CostaRica(NC_045512@	64-86
			CostaRica: + : 16237-18039)
2	366-370	ATLQA linker 1-5
2	371-378	AEVQIDRL	surface_glycoprotein(NC_045512: +	989-996
			: 21563-25384)
2	379-383	ATLQA linker 1-5
2	384-434	HFAIGLALYYPSARIVYTACSHAAV	helicase(NC_045512: + :	290-340
		DALCEKALKYLPIDKCSRIIPARAR	16237-18039)
		V
2	435-439	ATLQA linker 1-5
2	440-457	LFVVEVVDKYFDCYDGGC	RNA-dependent_RNA_polymerase	470-487
			(NC_045512: + : 13442-13468 +
			13468-16236)
2	458-462	ATLQA linker 1-5
2	463-478	ATVAYFNMVYMPASWV	nsp6@Aruba(NC_045512@Aruba: + :	76-91
			10973-11842)
2	479-483	ATLQA linker 1-5
2	484-498	QIELKFNPPALQDAY	nsp3(NC_045512: + : 2720-8554)	867-881
2	499-503	ATLQA linker 1-5
2	504-511	TQALLQRQ	nucleocapsid_phosphoprotein@	379-386
			CostaRica(NC_045512@CostaRica: + :
			28274-29533)
2	512-516	ATLQA linker 1-5
2	517-526	LPFTINCQEL	ORF8_protein@Mozambique(NC_045512@	84-93
			Mozambique: + : 27894-28259)
2	527-531	ATLQA linker 1-5
2	532-541	YDANYFLCWH	ORF3a_protein(NC_045512: + :	141-150
			25393-26220)
2	542-546	ATLQA linker 1-5
2	547-556	VVADAVIKTL	nsp3(NC_045512: + : 2720-8554)	56-65
2	557-561	ATLQA linker 1-5
2	562-582	HPNCVNCSDDRCILHCANFNV	RNA-dependent_RNA_polymerase@	295-315
			Aruba(NC_045512@Aruba: + :
			13442-13468 + 13468-16236)
2	583-587	ATLQA linker 1-5
2	588-603	RKIFVDGVPFVVSTGY	RNA-dependent_RNA_polymerase	331-346
			(NC_045512: + : 13442-13468 +
			13468-16236)
2	604-608	ATLQA linker 1-5
2	609-620	FRSSVLHSTQDL	surface_glycoprotein@Aruba	43-54
			(NC_045512@Aruba: + : 21563-25384)
2	621-625	ATLQA linker 1-5
2	626-648	GKIQDSLFSTASALGKLQDVVNQ	surface_glycoprotein@NorthMacedonia	928-950
			(NC_045512@NorthMacedonia: + :
			21563-25384)
2	649-653	ATLQA linker 1-5
2	654-662	YDLSVVNAR	helicase(NC_045512: + :	382-390
			16237-18039)
2	663-667	ATLQA linker 1-5
2	668-681	SDRVVFVLWAHGFE	3′-to-5′_exonuclease(NC_045512: + :	178-191
			18040-19620)
2	682-686	ATLQA linker 1-5
2	687-715	FAFACPDGVKHVYQLRARSVSPKLF	ORF7a_protein(NC_045512: + :	63-91
		IRQE	27394-27759)
2	716-720	ATLQA linker 1-5
2	721-739	VKDCVVLHSYFTSDYYQLY	ORF3a_protein@Aruba(NC_045512@	197-215
			Aruba: + : 25393-26220)
2	740-744	ATLQA linker 1-5
2	745-756	TRAKVGILCIMS	helicase(NC_045512: + :	566-577
			16237-18039)
2	757-761	ATLQA linker 1-5
2	762-793	MMFVKHKHAFLVLFLLPSFATVAYF	nsp6@Indonesia(NC_045512@Indonesia:	57-88
		NMVYMPA	+ : 10973-11842)
2	794-798	ATLQA linker 1-5
2	799-806	SDDAVVCF	RNA-dependent_RNA_polymerase@Aruba	759-766
			(NC_045512@Aruba: + :
			13442-13468 + 13468-16236)
2	807-811	ATLQA linker 1-5
2	812-819	YLKLRSDV	nsp4(NC_045512: + : 8555-10054)	427-434
2	820-824	ATLQA linker 1-5
2	825-834	KSASVYYSQL	nsp3(NC_045512: + : 2720-8554)	1737-1746
2	835-839	ATLQA linker 1-5
2	840-856	AQSFLNRVCGVSAARLT	RNA-dependent_RNA_polymerase	4-20
			(NC_045512: + : 13442-13468 +
			13468-16236)
2	857-861	ATLQA linker 1-5
2	862-869	FNSVCRLM	helicase@Aruba(NC_045512@Aruba: + :	422-429
			16237-18039)
2	870-874	ATLQA linker 1-5
2	875-888	HKWPQAIQFAPSAS	nucleocapsid_phosphoprotein@	299-312
			Australia(NC_045512@Australia: + :
			28274-29533)
2	889-893	ATLQA linker 1-5
2	894-906	GVNLVAVPTGYVD	3′-to-5′_exonuclease(NC_045512: + :	114-126
			18040-19620)
2	907-911	ATLQA linker 1-5
2	912-933	GYQPYRVVVLSFELLHAPATVC	surface_glycoprotein(NC_045512: + :	504-525
			21563-25384)
2	934-938	ATLQA linker 1-5
2	939-957	QLSLSKGFHFVCNLLLLFV	ORF3a_protein@Estonia(NC_045512@	70-88
			Estonia: + : 25393-26220)
2	958-962	ATLQA linker 1-5
2	963-979	INFVRIIMRLWLCLKCR	ORF3a_protein@Mozambique(NC_045512@	118-134
			Mozambique: + : 25393-26220)
2	980-984	ATLQA linker 1-5
2	985-993	KLMVVIPDY	nsp8(NC_045512: + : 12092-12685)	127-135
2	994-998	ATLQA linker 1-5
2	999-1009	IEELFYSYATH	3′-to-5′_exonuclease(NC_045512: + :	363-373
			18040-19620)
2	1010-1014	ATLQA linker 1-5
2	1015-1025	AALALLLLDRL	nucleocapsid_phosphoprotein@Aruba	217-227
			(NC_045512@Aruba: + : 28274-29533)
2	1026-1030	ATLQA linker 1-5
2	1031-1044	DYDCVSFCYMHHME	3C-like_proteinase(NC_045512: + :	153-166
			10055-10972)
2	1045-1049	ATLQA linker 1-5
2	1050-1057	AWLYAAVI	3C-like_proteinase(NC_045512: + :	206-213
			10055-10972)
2	1058-1062	ATLQA linker 1-5
2	1063-1075	NFRVQPTESIVRF	surface_glycoprotein(NC_045512: + :	317-329
			21563-25384)
2	1076-1080	ATLQA linker 1-5
2	1084-1103	YALVYFLQSINFVIIIMRLWLCW	ORF3a_protein@Denmark(NC_045512@	109-131
			Denmark: + : 25393-26220)
2	1104-1108	ATLQA linker 1-5
2	1109-1120	ALGKLQDVVNQN	surface_glycoprotein(NC_045512: + :	944-955
			21563-25384)
2	1121-1125	ATLQA linker 1-5
2	1126-1134	IQLSSYSLF	2′-O-ribose_methyltransferase	237-245
			(NC_045512: + : 20659-21552)
2	1135-1139	ATLQA linker 1-5
2	1140-1149	NYQCGHYKHI	nsp3(NC_045512: + : 2720-8554)	1012-1021
2	1150-1154	ATLQA linker 1-5
2	1155-1165	ETICAPLTVFF	endoRNAse(NC_045512: + :	113-123
			19621-20658)
2	1166-1170	ATLQA linker 1-5
2	1171-1184	RNLQHRLYECLYRN	RNA-dependent_RNA_polymerase	721-734
			(NC_045512: + : 13442-13468 +
			13468-16236)
2	1185-1189	ATLQA linker 1-5
2	1190-1197	FNSVCRFM	helicase@Malaysia(NC_045512@	422-429
			Malaysia: + : 16237-18039)
2	1198-1202	ATLQA linker 1-5
2	1203-1212	SSVLHSTQDF	surface_glycoprotein@Norway	45-54
			(NC_045512@Norway: + :
			21563-25384)
2	1213-1217	ATLQA linker 1-5
2	1218-1228	MMFVKHKHAFL	nsp6@Aruba(NC_045512@Aruba: + :	57-67
			10973-11842)
2	1229-1233	ATLQA linker 1-5
2	1234-1242	LKLKDCVMY	nsp6@Aruba(NC_045512@Aruba: + :	105-113
			10973-11842)
2	1243-1247	ATLQA linker 1-5
2	1248-1262	EFQFCNYPFLGVYHK	surface_glycoprotein@Norway	129-143
			(NC_045512@Norway: + :
			21563-25384)
2	1263-1267	ATLQA linker 1-5
2	1268-1279	TRAKVGILCITS	helicase@SouthKorea(NC_045512@	566-577
			SouthKorea: + : 16237-18039)
2	1280-1284	ATLQA linker 1-5
2	1285-1292	TDAVDCAL	surface_glycoprotein(NC_045512: + :	286-293
			21563-25384)
2	1293-1297	ATLQA linker 1-5
2	1298-1311	IKVCEFQFCNDPYY	surface_glycoprotein@CostaRica	128-141
			(NC_045512@CostaRica: + :
			21563-25384)
2	1312-1316	ATLQA linker 1-5
2	1317-1338	LLYDANYFLCWHINCYDYCIPY	ORF3a_protein@Estonia(NC_045512@	139-160
			Estonia: + : 25393-26220)
3	1-14	ANPVLPFNDGVYFA	surface_glycoprotein@Austria	77-90
			(NC_045512@Austria: + :
			21563-25384)
3	15-19	ATLQA linker 1-5
3	20-31	VTMPLGYVTHGL	nsp3(NC_045512: + : 2720-8554)	628-639
3	32-36	ATLQA linker 1-5
3	37-48	FNCYFPLQSYGF	surface_glycoprotein(NC_045512: + :	486-497
			21563-25384)
3	49-53	ATLQA linker 1-5
3	54-68	ARSVARQSIIAYTMS	surface_glycoprotein@Mozambique	680-694
			(NC_045512@Mozambique: + :
			21563-25384)
3	69-73	ATLQA linker 1-5
3	74-100	AKYTQLCQYLNTLTLAVPYNMRVIH	2′-O-ribose_methyltransferase	45-71
		F	(NC_045512: + : 20659-21552)
3	101-105	ATLQA linker 1-5
3	106-115	AGAALQIPFA	surface_glycoprotein@Nigeria	886-895
			(NC_045512@Nigeria: + :
			21563-25384)
3	116-120	ATLQA linker 1-5
3	121-133	LLNVPLHGTILTR	membrane_glycoprotein(NC_045512: +	119-131
			: 26523-27191)
3	134-138	ATLQA linker 1-5
3	139-146	VVNPVMEP	ORF3a_protein(NC_045512: + :	255-262
			25393-26220)
3	147-151	ATLQA linker 1-5
3	152-173	SQHTMLVKQFDDYVYLPYPDPS	RNA-dependent_RNA_polymerase@	814-835
			Estonia(NC_045512@Estonia: + :
			13442-13468 + 13468-16236)
3	174-178	ATLQA linker 1-5
3	179-190	FQTLLHRSYLTP	surface_glycoprotein@SmallAsia	230-241
			(NC_045512@SmallAsia: + :
			21563-25384)
3	191-195	ATLQA linker 1-5
3	196-207	IEVQGYKSVNIT	nsp3(NC_045512: + : 2720-8554)	13-24
3	208-212	ATLQA linker 1-5
3	213-223	YCPRHVICTSE	3C-like_proteinase(NC_045512: + :	37-47
			10055-10972)
3	224-228	ATLQA linker 1-5
3	229-237	EPLLKGVKL	surface_glycoprotein@Croatia	1258-1266
			(NC_045512@Croatia: + :
			21563-25384)
3	238-242	ATLQA linker 1-5
3	243-250	YDFVVSKG	RNA-dependent_RNApolymerase@Japan	420-427
			(NC_045512@Japan: + :
			13442-13468 + 13468-16236)
3	251-255	ATLQA linker 1-5
3	256-266	YDKLQFISLEI	helicase@SouthAfrica(NC_045512@	582-592
			SouthAfrica: + : 16237-18039)
3	267-271	ATLQA linker 1-5
3	272-279	REGVFVSN	surface_glycoprotein@Aruba	1087-1094
			(NC_045512@Aruba: + :
			21563-25384)
3	280-284	ATLQA linker 1-5
3	285-295	YELKHGTFTCA	nsp3(NC_045512: + : 2720-8554)	996-1006
3	296-300	ATLQA linker 1-5
3	301-316	FLVLLPLVSSQCVNLT	surface_glycoprotein@Aruba	4-19
			(NC_045512@Aruba: + :
			21563-25384)
3	317-321	ATLQA linker 1-5
3	322-335	LMNVLTLVYKVYYG	nsp6@Aruba(NC_045512@Aruba: + :	139-152
			10973-11842)
3	336-340	ATLQA linker 1-5
3	341-353	KASCTLSEQLDFI	nsp2(NC_045512: + : 806-2719)	30-42
3	354-358	ATLQA linker 1-5
3	359-371	YTELEPPCRFVTD	nsp9(NC_045512: + : 12686-13024)	66-78
3	372-376	ATLQA linker 1-5
3	377-387	DNVLSTFISAA	nsp3(NC_045512: + : 2720-8554)	1809-1819
3	388-392	ATLQA linker 1-5
3	393-419	FSASTSAFVETVKGLDYKAFKQIVE	nsp2(NC_045512: + : 806-2719)	300-326
		SC
3	420-424	ATLQA linker 1-5
3	425-432	DVLYQPPQ	nsp4(NC_045512: + : 8555-10054)	484-491
3	433-437	ATLQA linker 1-5
3	438-453	DKYVRNLQHRLYECLY	RNA-dependent_RNA_polymerase@	717-732
			Aruba(NC_045512@Aruba: + :
			13442-13468 + 13468-16236)
3	454-458	ATLQA linker 1-5
3	459-487	TLQCIMLVYCFLGYFCTCYFGLFCL	nsp6@Aruba(NC_045512@Aruba: + :	203-231
		LNRY	10973-11842)
3	488-492	ATLQA linker 1-5
3	493-502	TLPVNVAFEL	endoRNAse(NC_045512: + :	48-57
			19621-20658)
3	503-507	ATLQA linker 1-5
3	508-517	ALLAVFHNAS	ORF3a_protein@SmallSouthAmerica	51-60
			(NC_045512@SmallSouthAmerica: + :
			25393-26220)
3	518-522	ATLQA linker 1-5
3	523-536	TDTCVEHVTFFIYN	ORF3a_protein@Luxemburg	221-234
			(NC_045512@Luxembourg: + :
			25393-26220)
3	537-541	ATLQA linker 1-5
3	542-550	APLIELCVD	ORF8_protein@Bangladesh(NC_04551@	55-63
			Bangladesh: + : 27894-28259)
3	551-555	ATLQA linker 1-5
3	556-566	RQALLKTVQFC	RNA-dependent_RNA_polymerase@	183-193
			Aruba(NC_045512@Aruba: + :
			13442-13468 + 13468-16236)
3	567-571	ATLQA linker 1-5
3	572-579	DMYSVMLT	RNA-dependent_RNA_polymerase@	901-908
			Malaysia(NC_045512@Malaysia: + :
			13442-13468 + 13468-16236)
3	580-584	ATLQA linker 1-5
3	585-599	FKELLVYAADPAMHA	RNA-dependent_RNA_polymerase	368-382
			(NC_04551: + : 13442-13468 +
			13468-16236)
3	600-604	ATLQA linker 1-5
3	605-617	FQTLLALHRSYLT	surface_glycoprotein@Aruba	234-246
			(NC_04551@Aruba: + :
			21563-25384)
3	618-622	ATLQA linker 1-5
3	623-637	TYGVGYQPYRVVVLS	surface_glycoprotein@Australia	496-510
			(NC_045512@Australia: + :
			21563-25384)
3	638-642	ATLQA linker 1-5
3	643-659	GVHFVCNLLLLFVIVYS	ORF3a_protein@Malaysia	76-92
			(NC_045512@Malaysia: + :
			25393-26220)
3	660-664	ATLQA linker 1-5
3	665-684	FCKLHNWNCVNCDTFCAGST	nsp3(NC_045512: + : 2720-8554)	1626-1645
3	685-689	ATLQA linker 1-5
3	690-705	LMNVLTLFYKVYYGNA	nsp6@Chile(NC_045512@Chile: + :	142-157
			10973-11842)
3	706-710	ATLQA linker 1-5
3	711-733	HQPYVVDDPCPIHFYSKWYIRVG	ORF8_protein(NC_04551: + :	28-50
			27894-28259)
3	734-738	ATLQA linker 1-5
3	739-749	SAPLIELCLDE	ORF8_protein@Russia(NC_04551@	54-64
			Russia: + : 27894-28259)
3	750-754	ATLQA linker 1-5
3	755-777	QLALSKGVYFVCNLLLLFVTVYS	ORF3a_protein@Aruba	70-92
			(NC_045512@Aruba: + :
			25393-26220)
3	778-782	ATLQA linker 1-5
3	783-814	IMASLVLARKHTTCCSLSHRFYRLA	RNA-dependent_RNA_polymerase	632-663
		NECAQVL	(NC_04551: + : 13442-13468 +
			13468-16236)
3	815-819	ATLQA linker 1-5
3	820-838	KLNVGDYFVLTSHTVMPLS	helicase(NC_04551: + :	218-236
			16237-18039)
3	839-843	ATLQA linker 1-5
3	844-860	YADVFHLYLQYIRKLHD	RNA-dependent_RNA_polymerase	877-893
			(NC_04551: + : 13442-13468 +
			13468-16236)
3	861-865	ATLQA linker 1-5
3	866-876	CYTPSKLIEYT	nsp4(NC_045512: + : 8555-10054)	133-143
3	877-881	ATLQA linker 1-5
3	882-890	GVVQQLPET	endoRNAse(NC_045512: + :	184-192
			19621-20658)
3	891-895	ATLQA linker 1-5
3	896-915	SEAVEAPLVGTPVCNINGLML	nsp2(NC_045512: + : 806-2719)	591-610
3	916-920	ATLQA linker 1-5
3	921-936	SRIIPARAVDCFDKF	helicase@Brazil(NC_04551@Brazil:	331-346
			+ : 16237-18039)
3	937-941	ATLQA linker 1-5
3	942-953	EVFAQVKQIYKT	surface_glycoprotein@Aruba	776-787
			(NC_045512@Aruba: + :
			21563-25384)
3	954-958	ATLQA linker 1-5
3	959-971	ISSVLNDILSRLD	surface_glycoprotein@Bangladesh	972-984
			(NC_045512@Bangladesh: + :
			21563-25384)
3	972-976	ATLQA linker 1-5
3	977-988	FSVNTWFHAIVS	surface_glycoprotein@Ghana	59-70
			(NC_045512@Ghana: + :
			21563-25384)
3	989-993	ATLQA linker 1-5
3	994-1001	PSFLGRYM	nsp3(NC_045512: + : 2720-8554)	822-829
3	1002-1006	ATLQA linker 1-5
3	1007-1020	FGTYEKLKPVLDW	nsp2(NC_045512: + : 806-2719)	437-450
3	1021-1025	ATLQA linker 1-5
3	1026-1033	IETISLAG	nsp3(NC_045512: + : 2720-8554)	684-691
3	1034-1038	ATLQA linker 1-5
3	1039-1047	DYYQLYSTQ	ORF3a_protein(NC_045512: + :	210-218
			25393-26220)
3	1048-1052	ATLQA linker 1-5
3	1053-1062	NEFYAYLRKH	RNA-dependent_RNA_polymerase	972-984
			(NC_04551: + : 13442-13468 +
			13468-16236)
3	1063-1067	ATLQA linker 1-5
3	1068-1078	GEVPVSIINNT	endoRNAse(NC_045512: + :	20-30
			19621-20658)
3	1079-1083	ATLQA linker 1-5
3	1084-1098	ISNCVADYSVLYNSA	surface_glycoprotein@Aruba	354-368
			(NC_045512@Aruba: + :
			21563-25384)
3	1099-1103	ATLQA linker 1-5
3	1104-1121	VTTVIFLARGIVFNCVEY	nsp6@Malaysia(NC_045512@Malaysia:	179-196
			+ : 10973-11842)
3	1122-1126	ATLQA linker 1-5
3	1127-1146	PINLVRGLPQGFSALEPLVD	surface_glycoprotein@Austria	205-224
			(NC_045512@Austria: + :
			21563-25384)
3	1147-1151	ATLQA linker 1-5
3	1152-1159	AALQIPFA	surface_glycoprotein(NC_045512: + :	892-899
			21563-25384)
3	1160-1164	ATLQA linker 1-5
3	1165-1175	RFQLHRSYLTP	surface_glycoprotein@Austria	233-243
			(NC_045512@Austria: + :
			21563-25384)
3	1176-1180	ATLQA linker 1-5
3	1181-1190	VTGLFKDCSK	3′-to-5′_exonuclease(NC_045512: + :	4-13
			18040-19620)
3	1191-1195	ATLQA linker 1-5
3	1196-1204	FEHIVYGDF	endoRNAse(NC_045512: + :	232-240
			19621-20658)
3	1205-1209	ATLQA linker 1-5
3	1210-1224	ALLAVFQSASKIITL	ORF2a_protein@Bangladesh	51-65
			(NC_045512@Bangladesh: + :
			25393-26220)
3	1225-1229	ATLQA linker 1-5
3	1230-1239	KCAYWVPRAS	nsp2(NC_045512: + : 806-2719)	239-248
3	1240-1244	ATLQA linker 1-5
3	1245-1259	VDTSLSSLKLKDCVM	nsp6@Latvia(NC_045512@Latvia: + :	101-115
			10973-11842)
3	1260-1264	ATLQA linker 1-5
3	1265-1283	ANSVFNICQSVTANVNALL	RNA-dependent_RNA_polymerase@	690-708
			Croatia(NC_045512@Croatia: + :
			13442-13468 + 13468-16236)
3	1284-1288	ATLQA linker 1-5
3	1289-1296	YDPLQPEL	surface_glycoprotein(NC_045512: + :	1138-1145
			21563-25384)
3	1297-1301	ATLQA linker 1-5
3	1302-1311	DPIHSLRVCV	nsp3(NC_045512: + : 2720-8554)	339-348
3	1312-1316	ATLQA linker 1-5
3	1317-1324	CLNRVCTN	nsp3(NC_045512: + : 2720-8554)	1342-1349
3	1325-1329	ATLQA linker 1-5
3	1330-1338	FFSNVTWFH	surface_glycoprotein(NC_045512: + :	58-66
			21563-25384)
4	1-12	TEISFMLWCKDG	endoRNAse(NC_045512: + :	325-336
			19621-20658)
4	13-17	ATLQA linker 1-5
4	18-35	LNDLCFTNVYADSFVIRG	surface_glycoprotein(NC_045512: + :	387-404
			21563-25384)
4	36-40	ATLQA linker 1-5
4	41-50	GTNLPLQLGF	3′-to-5′_exonuclease(NC_045512: + :	102-111
			18040-19620)
4	51-55	ATLQA linker 1-5
4	56-76	QWNLVGIFLFLTWICLLQFAY	membrane_glycoprotein@Aruba	19-39
			(NC_045512@Aruba: + : 26523-27191)
4	77-81	ATLQA linker 1-5
4	82-102	WMFLARGIVFMCVDYCPIFFI	nsp6@Cyprus(NC_045512@Cyprus: + :	179-199
			10973-11842)
4	103-107	ATLQA linker 1-5
4	108-115	ETQALPQR	nucleocapsid_phosphoprotein@	378-385
			SmallNorthAmerica(NC_045512@
			SmallNorthAmerica: + :
			28274-29533)
4	116-120	ATLQA linker 1-5
4	121-130	SPGVVNPVME	ORF2a_protein@Brazil(NC_045512@	252-261
			Brazil: + : 25393-26220)
4	131-135	ATLQA linker 1-5
4	136-146	ITNCVKMLCTH	nsp10(NC_045512: + : 13025-13441)	38-48
4	147-151	ATLQA linker 1-5
4	152-171	HYQECVRGTTVLLKEPCSSG	ORF3a_protein(NC_045512: + :	19-38
			25393-26220)
4	172-176	ATLQA linker 1-5
4	177-199	KNPLLYDANYFLCCHTNCYDYCI	ORF2a_protein@Senegal(NC_045512@	136-158
			Senegal: + : 25393-26220)
4	200-204	ATLQA linker 1-5
4	205-216	AKLLHKPIVWHV	nsp3(NC_045512: + : 2720-8554)	1165-1176
4	217-221	ATLQA linker 1-5
4	222-234	SMWALIISVTSNY	nsp6@Aruba(NC_045512@Aruba: + :	160-172
			10973-11842)
4	235-239	ATLQA linker 1-5
4	240-247	ARDLSLQF	nsp3(NC_045512: + : 2720-8554)
4	248-252	ATLQA linker 1-5
4	253-281	FLYIIKLIFLWLLWPVTLACFVLAA	membrane_glycoprotein@Aruba	45-73
		VYRI	(NC_045512@Aruba: + : 26523-27191)
4	282-286	ATLQA linker 1-5
4	287-295	ASQGLLASI	RNA-dependent_RNA_polymerase@	771-779
			Austria(NC_045512@Austria: + :
			13442-13468 + 13468-16236)
4	296-300	ATLQA linker 1-5
4	301-311	FFSNVTWFHVS	surface_glycoprotein@Nigeria	58-68
			(NC_045512@Nigeria: + :
			21563-25384)
4	312-316	ATLQA linker 1-5
4	317-325	TENLLLYID	nsp3(NC_045512: + : 2720-8554)	432-440
4	326-330	ATLQA linker 1-5
4	331-342	SVFQSASKIITL	ORF2a_protein@Iceland(NC_045512@	54-65
			Iceland: + : 25393-26220)
4	343-347	ATLQA linker 1-5
4	348-357	GNCDVVIGIV	surface_glycoprotein(NC_045512: + :	1124-1133
			21563-25384)
4	358-362	ATLQA linker 1-5
4	363-383	HPNCVNCLDDRCILHCANFNV	RNA-dependent_RNA_polymerase@	295-315
			Australia(NC_045512@Australia: + :
			13442-13468 + 13468-16236)
4	384-388	ATLQA linker 1-5
4	389-398	ACIDCSARHI	nsp3(NC_045512: + : 2720-8554)	1872-1881
4	399-403	ATLQA linker 1-5
4	404-418	TISVTTEILPVSMAK	surface_glycoprotein@Mexico	719-733
			(NC_045512@Mexico: + :
			21563-25384)
4	419-423	ATLQA linker 1-5
4	424-437	TSACVLAAECTIFK	nsp4(NC_045512: + : 8555-10054)	147-160
4	438-442	ATLQA linker 1-5
4	443-450	SINVANYQ	helicase@Mozambique(NC_045512@	263-270
			@Mozambique: + : 16237-18039)
4	451-455	ATLQA linker 1-5
4	456-465	EGSVRVVTTG	nsp4(NC_045512: + : 8555-10054)	207-216
4	466-470	ATLQA linker 1-5
4	471-495	VLVQSTQWSLFFFFYENAFLPFAMG	nsp6@Iceland(NC_045512@	719-733
			Iceland: + :10973-11842)
4	496-500	ATLQA linker 1-5
4	501-533	YEPLTQDHVDILGPLSAQTGIAVLD	3C-like_proteinase(NC_045512: + :	239-271
		MCASLKEL	10055-10972)
4	534-538	ATLQA linker 1-5
4	539-547	SRELKVTFF	nsp3(NC_045512: + : 2720-8554)	1134-1142
4	548-552	ATLQA linker 1-5
4	553-570	YNLLKDCPAVAKHDFFKF	RNA-dependent_RNA_polymerase@	87-104
			Aruba(NC_045512@Aruba: + :
			13442-13468 + 13468-16236)
4	571-575	ATLQA linker 1-5
4	576-597	TLGVLVPHVGEIPVAYRKVLLR	leader_protein(NC_045512: + :	103-124
			266-805)
4	598-602	ATLQA linker 1-5
4	603-633	YIWLGFIAGLIAIVMVTIMLCCMTS	surface_glycoprotein@Aruba	1211-1241
		CCSCLK	(NC_045512@Aruba: + :
			21563-25384)
4	634-638	ATLQA linker 1-5
4	639-654	LVDFQVTIAEILLIIM	ORF6_protein(NC_045512: + :	4-19
			27202-27387)
4	655-659	ATLQA linker 1-5
4	660-671	TFKVSIWNLDYI	ORF6_protein(NC_045512: + :	21-32
			27202-27387)
4	672-676	ATLQA linker 1-5
4	677-686	GVGGKPCIKV	nsp6@Aruba(NC_045512@	274-283
			Aruba: + :10973-11842)
4	687-691	ATLQA linker 1-5
4	690-716	SDIDITFLKKDAPYIVGDVVQEGVL	nsp3(NC_045512: + : 2720-8554)	454-478
4	717-721	ATLQA linker 1-5
4	722-745	LGSLVVRCSFYEDFLEYHDVRVVL	ORF8_protein(NC_045512: + :	95-118
			27894-28259)
4	746-750	ATLQA linker 1-5
4	751-763	ANFCALILAYCNK	nsp3(NC_045512: + : 2720-8554)	890-902
4	764-768	ATLQA linker 1-5
4	769-794	YRLANECAQVLSEMVMCGGSLYVKP	RNA-dependent_RNA_polymerase@	653-678
		G	Australia(NC_045512@Australia: + :
			13442-13468 + 13468-16236)
4	795-799	ATLQA linker 1-5
4	800-807	QIGVVREF	helicase(NC_045512: + :	492-499
			16237-18039)
4	808-812	ATLQA linker 1-5
4	813-827	SYFAIGLALYYPSAR	helicase@Austria(NC_045512@	289-303
			@Austria: + : 16237-18039)
4	828-832	ATLQA linker 1-5
4	833-842	SFKLKDCVMY	nsp6@Malaysia(NC_045512@	107-116
			Malaysia: + :10973-11842)
4	843-847	ATLQA linker 1-5
4	848-857	PRWYFYYLGT	nucleocapsid_phosphoprotein@Aruba	106-115
			(NC_045512@Aruba: + : 28274-29533)
4	858-862	ATLQA linker 1-5
4	863-899	VAAGLEAPFLYLYALVYFLQSINFV	ORF3a_protein@Aruba(NC_045512@	97-133
		RIIMRLWLCWKC	Aruba: + : 25393-26220)
4	900-904	ATLQA linker 1-5
4	905-916	SVLLSMQGAVDI	nsp7(NC-4551: + : 11843-12091)	57-68
4	917-921	ATLQA linker 1-5
4	922-932	ETTVDIVVFDE	helicase@SmallAsia(NC_045512@	365-375
			@SmallAsia: + : 16237-18039)
4	933-937	ATLQA linker 1-5
4	938-961	TYASALWEIQQVVDADSKIVQLSE	nsp8(NC_045512: + : 12092-12685)	148-171
4	962-966	ATLQA linker 1-5
4	967-977	VLYQGVNCTEV	surface_glycoprotein@Aruba	606-616
			(NC_045512@Aruba: + :
			21563-25384)
4	978-982	ATLQA linker 1-5
4	983-1005	TTVMFLARGIVFMCVEYCPIFFI	nsp6@Aruba(NC_045512@	177-199
			Aruba: + :10973-11842)
4	1006-1010	ATLQA linker 1-5
4	1011-1018	GVYCCREH	nsp2(NC_045512: + : 806-2719)	47-54
4	1019-1023	ATLQA linker 1-5
4	1024-1031	EIYQAGSK	surface_glycoprotein@Mexico	471-478
			(NC_045512@Mexico: + :
			21563-25384)
4	1032-1036	ATLQA linker 1-5
4	1037-1059	LIAIVMVTIMLCCITSCCSCLKG	surface_glycoprotein@Mozambique	1220-1242
			(NC_045512@Mozambique: + :
			21563-25384)
4	1060-1064	ATLQA linker 1-5
4	1065-1074	ARDLICAQKF	surface_glycoprotein(NC_045512: + :	846-855
			21563-25384)
4	1075-1079	ATLQA linker 1-5
4	1080-1092	NPVLPFNDGVYFA	surface_glycoprotein(NC_045512: + :	81-93
			21563-25384)
4	1093-1097	ATLQA linker 1-5
4	1098-1114	VPQEHYVRITGLPTLN	helicase@Aruba(NC_045512@	241-257
			@Aruba: + : 16237-18039)
4	1115-1119	ATLQA linker 1-5
4	1120-1144	VLVQSTQWSLFFFLYENAFLPFAMG	nsp6@Aruba(NC_045512@	24-48
			Aruba: + :10973-11842)
4	1145-1149	ATLQA linker 1-5
4	1150-1161	HEFCSQHTMLVK	RNA-dependent_RNA_polymerase	810-821
			(NC_04551: + : 13442-13468 +
			13468-16236)
4	1162-1166	ATLQA linker 1-5
4	1167-1185	AVAVLYQDVNCTEVPVAIH	surface_glycoprotein@China	607-625
			(NC_045512@China: + :
			21563-25384)
4	1186-1190	ATLQA linker 1-5
4	1191-1210	DDRCILHCANFNVLFSTVFP	RNA-dependent_RNA_polymerase	303-322
			(NC_04551: + : 13442-13468 +
			13468-16236)
4	1211-1512	ATLQA linker 1-5
4	1216-1225	FEYVSQPFLM	surface_glycoprotein@Aruba	163-173
			(NC_045512@Aruba: + :
			21563-25384)
4	1226-1230	ATLQA linker 1-5
4	1231-1244	GFNCYFPLQPYGFQ	surface_glycoprotein@	481-494
			SmallSouthAmerica(NC_045512@
			SmallSouthAmerica: + : 21563-25384)
4	1245-1249	ATLQA linker 1-5
4	1250-1267	IKVCEFQFCNFPFLGVYH	surface_glycoprotein@Aruba	125-142
			(NC_045512@Aruba: + :
			21563-25384)
4	1268-1272	ATLQA linker 1-5
4	1273-1295	NHDLYCQVHGNAHVASCDAIMTR	3′-to-5′_exonuclease(NC_045512: + :	256-278
			18040-19620)
4	1296-1300	ATLQA linker 1-5
4	1301-1323	SHGKQVVSDIDYVPLKSATCITR	3′-to-5′_exonuclease(NC_045512: + :	454-476
			18040-19620)
4	1324-1328	ATLQA linker 1-5
4	1329-1349	AVLYQGVNCTEVPFAIHADQL	surface_glycoprotein@SmallAfrica	605-625
			(NC_045512@SmallAfrica: + :
			21563-25384)
5	1-16	YVRITGLYPTLNISYE	helicase@SmallNorthAmerica	246-261
			(NC_-45512@SmallNorthAmerica: + :
			16237-18039)
5	17-21	ATLQA linker 1-5
5	22-35	LEKILVTYNCCDDD	RNA-dependent_RNA_polymerase	142-155
			(NC_04551: + : 13442-13468 +
			13468-16236)
5	36-40	ATLQA linker 1-5
5	41-50	LSVNPYVCNA	helicase@Cyprus(NC_045512@Cyprus:	43-52
			+ : 16237-18039)
5	51-55	ATLQA linker 1-5
5	56-65	ETFVTHSKGL	nsp2(NC_045512: + : 806-2719)	527-536
5	66-70	ATLQA linker 1-5
5	71-85	TYACWHHSIGFDYVY	3′-to-5′_exonuclease(NC_045512: + :	223-237
			18040-19620)
5	86-90	ATLQA linker 1-5
5	91-101	AVHECFVKRVD	3′-to-5′_exonuclease(NC_045512: + :	281-291
			18040-19620)
5	102-106	ATLQA linker 1-5
5	107-116	SVELKHFFFA	RNA-dependent_RNA_polymerase	434-443
			(NC_04551: + : 13442-13468 +
			13468-16236)
5	117-121	ATLQA linker 1-5
5	122-135	TSGVGYQPYRVVVL	surface_glycoprotein@Aruba	496-509
			(NC_045512@Aruba: + :
			21563-25384)
5	136-140	ATLQA linker 1-5
5	141-148	EVTPSGTS	nucleocapsid_phosphoprotein	323-330
			(NC_045512: + : 28274-29533)
5	149-153	ATLQA linker 1-5
5	154-163	DVVAIDYKHY	nsp3(NC_045512: + : 2720-8554)	1148-1157
5	164-168	ATLQA linker 1-5
5	169-176	NNLVVMAY	nsp2(NC_045512: + : 806-2719)	413-420
5	177-181	ATLQA linker 1-5
5	182-189	SSIVITSG	ORF3a_protein@NorthKorea(NC_045512@	165-172
			NorthKorea: + : 25393-26220)
5	190-194	ATLQA linker 1-5
5	195-233	GCDVTDVTQLYLGGMSYYCKSHKPP	helicase(NC_045512: + :	54-92
		ISFPLCANGQVFGL	16237-18039)
5	234-238	ATLQA linker 1-5
5	239-246	DQDVLFAY	RNA-dependent_RNA_polymerase@	523-530
			FrenchGuiana(NC_045512@FrenchGuiana
			: + :13442-13468 + 13468-16236)
5	247-251	ATLQA linker 1-5
5	252-261	RHSLSHFVNL	nsp3(NC_045512: + : 2720-8554)	1697-1706
5	262-266	ATLQA linker 1-5
5	267-274	SVDCTMYI	surface_glycoprotein(NC_04551: + :	735-742
			21563-25384)
5	275-279	ATLQA linker 1-5
5	280-287	SDFVRATA	ORF3a_protein(NC_04551: + :	26-33
			25393-26220)
5	288-292	ATLQA linker 1-5
5	293-304	FRSSVLHSTRDL	surface_glycoprotein@Nigeria	43-54
			(NC_045512@Nigeria: + :
			21563-25384)
5	305-309	ATLQA linker 1-5
5	310-317	FKLASHMY	nsp3(NC_045512: + : 2720-8554)	96-103
5	318-322	ATLQA linker 1-5
5	323-336	LSPVALRQMSCAAG	nsp9(NC_045512: + : 12686-13024)	4-17
5	337-341	ATLQA linker 1-5
5	342-360	AIPINFTISVTTEILPVSM	surface_glycoprotein@Aruba	709-727
			(NC_045512@Aruba: + :
			21563-25384)
5	361-365	ATLQA linker 1-5
5	366-375	SVLNDILARL	surface_glycoprotein@Aruba	971-980
			(NC_045512@Aruba: + :
			21563-25384)
5	376-380	ATLQA linker 1-5
5	381-394	RLNVGDYFVLTSHT	helicase@Austria(NC_045512@Austria:	218-231
			+ : 16237-18039)
5	395-399	ATLQA linker 1-5
5	400-408	ISEHDYHIG	ORF3a_protein@NorthMacedonia	179-187
			(NC_045512@NorthMacedonia: + :
			25393-26220)
5	409-413	ATLQA linker 1-5
5	414-421	STFKCYGV	surface_glycoprotein@Aruba	371-378
			(NC_045512@Aruba: + :
			21563-25384)
5	422-426	ATLQA linker 1-5
5	427-436	GLGLKDCVMY	nsp6@Peru(NC_045512@Peru: + :	107-116
			10973-11842)
5	437-441	ATLQA linker 1-5
5	442-449	SQDLSVVS	endoRNAse(NC_045512: + :	308-315
			19621-20658)
5	450-454	ATLQA linker 1-5
5	455-468	GFNCYSPLQSYGFQ	surface_glycoprotein@Peru	485-498
			(NC_045512@Peru: + :
			21563-25384)
5	469-473	ATLQA linker 1-5
5	474-489	AFKLNIKLLGVGGKPC	nsp6(NC_045512: + : 10973-11842)	268-283
5	490-494	ATLQA linker 1-5
5	495-502	DCATVHTA	2′-O-ribose_methyltransferase	114-121
			(NC_045112: + : 20659-21552)
5	503-507	ATLQA linker 1-5
5	508-518	SPGVFNPVMEP	ORF3a_protein@Colombia	252-262
			(NC_045512@Colombia: + :
			25393-26220)
5	519-523	ATLQA linker 1-5
5	524-538	VCNLLLLFVTVYSHL	ORF3a_protein@Croatia	80-94
			(NC_045512@Croatia: + :
			25393-26220)
5	539-543	ATLQA linker 1-5
5	544-585	TTVAAFHQECSLQSCTQHQPYVVDD	ORF8_protein@Bangladesh	11-52
		PCPIHFYSKWYIRVGAR	(NC_045512@Bangladesh: + :
			27894-28259)
5	586-590	ATLQA linker 1-5
5	591-600	VMCGGSLYVK	RNA-dependent_RNA_polymerase	667-676
			(NC_04551: + : 13442-13468 +
			13468-16236)
5	601-605	ATLQA linker 1-5
5	606-626	ALCEKALKYFPIDKCSRIIPA	helicase@Colombia(NC_045512@	316-336
			Colombia: + : 16237-18039)
5	627-631	ATLQA linker 1-5
5	632-648	KDQVILLNKHIDAYKTF	nucleocapsid_phosphoprotein@Aruba	347-363
			(NC_04551@Aruba: + : 28274-29533)
5	649-653	ATLQA linker 1-5
5	654-666	KLALGGSVAIKIT	2′-O-ribose_methyltransferase	160-172
			(NC_045112: + : 20659-21552)
5	667-671	ATLQA linker 1-5
5	672-681	NLIIKNLSKS	ORF6_protein(NC_045512: + :	34-43
			27202-27387)
5	682-686	ATLQA linker 1-5
5	687-707	ELVIGAVILRGHLRIAGHHLG	membrane_glycoprotein@Aruba	137-157
			(NC_045512@Aruba: + : 26523-27191)
5	708-712	ATLQA linker 1-5
5	713-726	TCFSVAALTNNVAF	RNA-dependent_RNA_polymerase@Aruba	394-407
			(NC_04551@Aruba: + :
			13442-13468 + 13468-16236)
5	727-731	ATLQA linker 1-5
5	732-754	TIATYCTGSIPCSVCLSGLDSLD	nsp3(NC_045512: + : 2720-8554)	1459-1481
5	755-759	ATLQA linker 1-5
5	760-773	TKDVVECLKLSHQS	nsp3(NC_045512: + : 2720-8554)	1830-1843
5	774-778	ATLQA linker 1-5
5	779-796	IKDLPKEITVATSRTLSY	membrane_glycoprotein_NC_045512:	161-178
			+ : 26523-27191)
5	797-801	ATLQA linker 1-5
5	802-817	TGLHPTQAPTHLSVDT	3′-to-5′_exonuclease(NC_045512: + :	16-31
			18040-19620)
5	818-822	ATLQA linker 1-5
5	823-851	SMWALIISVTSNYSGVVTIVMFLAR	nsp6@SmallSouthAmerica(NC_045512@	160-188
		GIVF	SmallSouthAmerica: + :
			10973-11842)
5	852-856	ATLQA linker 1-5
5	857-864	IAANTVIW	endoRNAse(NC_045512: + :	79-86
			19621-20658)
5	865-869	ATLQA linker 1-5
5	870-878	SEAFLIGCN	2′-O-ribose_methyltransferase	202-210
			(NC_045112: + : 20659-21552)
5	879-883	ATLQA linker 1-5
5	884-892	VTANVNALL	RNA-dependent_RNA_polymerase	700-708
			(NC_04551: + :
			13442-13468 + 13468-16236)
5	893-897	ATLQA linker 1-5
5	898-911	ESVVKDCVVLHSYF	ORF3a_protein@CostaRica(NC_04551@	194-207
			CostaRica: + : 25393-26220)
5	912-916	ATLQA linker 1-5
5	917-929	RSVASQSIIAYTM	surface_glycoprotein@Aruba	681-693
			(NC_045512@Aruba: + :
			21563-25384)
5	930-934	ATLQA linker 1-5
5	935-945	EQYVFCTVANL	helicase(NC_04551: + :	353-363
			16237-18039)
5	946-950	ATLQA linker 1-5
5	951-959	ASQGLVASI	RNA-dependent_RNA_polymerase@Aruba	771-779
			(NC_04551@Aruba: + :
			13442-13468 + 13468-16236)
5	960-964	ATLQA linker 1-5
5	965-980	QLALSKGFHFVCNLLL	ORF3a_protein@Iceland(NC_04551@	70-85
			Iceland: + : 25393-26220)
5	981-985	ATLQA linker 1-5
5	986-999	RLTLGVYDYLVSTQ	nsp6(NC_045512: + : 10973-11842)	236-249
5	1000-1004	ATLQA linker 1-5
5	1005-1015	KESVQTFFKLV	nsp2(NC_04551: + : 806-2719)	492-502
5	1016-1020	ATLQA linker 1-5
5	1021-1043	VAAGLEAPFFYLYALVYFLQSIN	ORF3a_protein@Ecuador(NC_04551@	97-119
			Ecuador: + : 25393-26220)
5	1044-1048	ATLQA linker 1-5
5	1049-1070	SDFVRATATIPIRASLPFGWLI	ORF3a_protein@Belgium(NC_04551@	26-47
			Belgium: + : 25393-26220)
5	1071-1075	ATLQA linker 1-5
5	1076-1094	ECAQVLSETVMCGGSLYVK	RNA-dependent_RNA_polymerase@Aruba	658-676
			(NC_04551@Aruba: + :
			13442-13468 + 13468-16236)
5	1095-1099	ATLQA linker 1-5
5	1100-1111	LKKLKKSLNVAK	nsp8(NC_045512: + : 12092-12685)	35-46
5	1112-1116	ATLQA linker 1-5
5	1117-1138	LGGMSYYCKSHKPSISFPLCAN	helicase@NewZealand(NC_045512@	65-86
			NewZealand: + : 16237-18039)
5	1139-1143	ATLQA linker 1-5
5	1144-1156	WNVVRIKIVQMLS	3′-to-5′_exonuclease(NC_045512: + :	159-171
			18040-19620)
5	1157-1161	ATLQA linker 1-5
5	1162-1177	FSNVTWFHAIHVSGTN	surface_glycoprotein@Peru	59-74
			(NC_045512@Peru: + :
			21563-25384)
5	1178-1182	ATLQA linker 1-5
5	1183-1199	SAAYYVGYLQLRTFLLK	surface_glycoprotein@Italy	258-274
			(NC_045512@Italy: + :
			21563-25384)
5	1200-1204	ATLQA linker 1-5
5	1205-1220	NYTVSCSPFTINCQEP	ORF8_protein@CostaRica(NC_045512@	78-93
			CostaRica: + : 27894-28259)
5	1221-1225	ATLQA linker 1-5
5	1226-1240	YFTSDYYQLYSTQLI	ORF8_protein@Indonesia(NC_045512@	206-220
			Indonesia: + : 27894-28259)
5	1241-1245	ATLQA linker 1-5
5	1246-1260	RIIPARAVECFDKF	helicase@Aruba(NC_045512@	332-346
			Aruba: + : 16237-18039)
5	1261-1265	ATLQA linker 1-5
5	1266-1275	DGYVMHANYI	2′-O-ribose_methyltransferase	220-229
			(NC_045112: + : 20659-21552)
5	1276-1280	ATLQA linker 1-5
5	1281-1294	SYLFQHANLDSCKR	nsp3(NC_045512: + : 2720-8554)	915-928
5	1295-1299	ATLQA linker 1-5
5	1300-1308	EVFAQVKQI	surface_glycoprotein(NC_04551: + :	780-788
			21563-25384)
5	1309-1313	ATLQA linker 1-5
5	1314-1329	FLVLLPLVSIQCVNLT	surface_glycoprotein@	4-19
			SmallNorthAmerica(NC_04551@
			SmallNorthAmerica: + :
			21563-25384)
5	1330-1334	ATLQA linker 1-5
5	1335-1349	YNLLKGCPAVAKHDF	RNA-dependent_RNA_polymerase@Poland	87-101
			(NC_04551@Poland: + :
			13442-13468 + 13468-16236)
6	1-11	GKPVPYCYDTN	nsp4(NC_04551: + : 8555-10054)	164-174
6	12-16	ATLQA linker 1-5
6	17-33	EVTPSGTWLTYTGAIKL	nucleocapsid_phosphoprotein@	323-339
			Bulgaria(NC_04551@Bulgaria: + :
			28274-29533)
6	34-38	ATLQA linker 1-5
6	39-60	INLVRDLPQGFSALEPLVDLPI	surface_glycoprotein@Aruba	206-227
			(NC_045512@Aruba: + :
			21563-25384)
6	61-65	ATLQA linker 1-5
6	66-76	YDNLQFISLEI	helicase@Austria(NC_045512@	582-592
			Austria: + : 16237-18039)
6	77-81	ATLQA linker 1-5
6	82-103	SDFVRATATIPIQASLPFGWLI	ORF3a_protein@Aruba(NC_04551@	26-47
			Aruba: + : 25393-26220)
6	104-108	ATLQA linker 1-5
6	109-116	PVLKGVKL	surface_glycoprotein@Aruba	1259-1266
			(NC_045512@Aruba: + :
			21563-25384)
6	117-121	ATLQA linker 1-5
6	122-131	NVAFNVVNKG	endoRNAase(NC_045512: + :	4-13
			19621-20658)
6	132-136	ATLQA linker 1-5
6	137-153	CSNLLLQYGSFCTQLNR	surface_glycoprotein(NC_04551: + :	749-765
			21563-25384)
6	154-158	ATLQA linker 1-5
6	159-167	SPDVDLADI	surface_glycoprotein@Chile	1161-1169
			(NC_045512@Chile: + :
			21563-25384)
6	168-172	ATLQA linker 1-5
6	173-187	SYELQTPFEIKLAKK	nsp2(NC_045512: + : 806-2719)	68-82
6	188-192	ATLQA linker 1-5
6	193-204	NIGCNHTGVVGE	nsp2(NC_045512: + : 806-2719)	250-261
6	205-209	ATLQA linker 1-5
6	210-221	VRTNVYLAVFDK	nsp3(NC_045512: + : 2720-8554)	351-362
6	222-226	ATLQA linker 1-5
6	227-242	ANSIVCRFDTRVLSNL	3′-to-5′_exonuclease(NC_045512: + :	394-409
			18040-19620)
6	243-247	ATLQA linker 1-5
6	248-260	ATNVVIKVCEFQF	surface_glycoprotein(NC_04551: + :	123-135
			21563-25384)
6	261-265	ATLQA linker 1-5
6	266-287	QLALSKGVHFVCNLLLLFVTVY	ORF3a_protein@Australia(NC_04551@	70-91
			Australia: + : 25393-26220)
6	288-292	ATLQA linker 1-5
6	293-308	HWPQIAQFAPSASAFF	nucleocapsid_phosphoprotein@	300-315
			Aruba(NC_04551@Aruba: + :
			28274-29533)
6	309-313	ATLQA linker 1-5
6	314-321	RVEAFEYY	nsp3(NC_045512: + : 2720-8554)	810-817
6	322-326	ATLQA linker 1-5
6	327-343	ILLNKHIDAYKTFPPIE	nucleocapsid_phosphoprotein@	351-367
			Chile(NC_04551@Chile: + :
			28274-29533)
6	344-348	ATLQA linker 1-5
6	349-357	KFPLKLRGT	2′-O-ribose_methyltransferase	249-257
			(NC_045112: + : 20659-21552)
6	358-362	ATLQA linker 1-5
6	363-372	NCYDYCIPYN	ORF3a_protein(NC_045512: + :	152-161
			25393-26220_
6	373-377	ATLQA linker 1-5
6	378-391	GASCCLYCRCHIDH	nsp10(NC_045512: + :13025-13441)	70-83
6	392-396	ATLQA linker 1-5
6	397-406	VQQESPFVMM	nsp3(NC_045512: + : 2720-8554)	980-989
6	407-411	ATLQA linker 1-5
6	412-422	CLPFTINCQKP	ORF8_protein@Brazil(NC_04551@	83-93
			Brazil: + : 27894-28259)
6	423-427	ATLQA linker 1-5
6	428-450	KEITVATSRTLSYYKLGASQRVA	membrane_glycoprotein@Aruba	166-188
			(NC_045512@Aruba: + :
			26523-27191)
6	451-455	ATLQA linker 1-5
6	456-466	VVNAANVYLKH	nsp3(NC_045512: + : 2720-8554)	239-249
6	467-471	ATLQA linker 1-5
6	472-484	AIKCVPQADVEWK	3′-to-5′_exonuclease(NC_045512: + :	337-349
			18040-19620)
6	485-489	ATLQA linker 1-5
6	590-506	LFFFLYENAFLPFVMGI	nsp6@SmallSouthAmerica(NC_045512@	33-49
			SmallSouthAmerica: + :
			10973-11842)
6	507-511	ATLQA linker 1-5
6	512-522	YDKLQFTSLEI	helicase@Aruba(NC_045512@	582-592
			Aruba: + : 16237-18039)
6	523-527	ATLQA linker 1-5
6	528-535	SSNVANYQ	helicase@Austria(NC_045512@	263-270
			Austria: + : 16237-18039)
6	536-540	ATLQA linker 1-5
6	541-565	AAGLEAPFLYLYVLVYFLQSINFVR	ORF3a_protein@Norway(NC_04551@	98-122
			Norway: + : 25393-26220)
6	566-570	ATLQA linker 1-5
6	571-585	RTCCLCDRRATCFST	3′-to-5′_exonuclease(NC_045512: + :	205-219
			18040-19620)
6	586-590	ATLQA linker 1-5
6	591-605	ERFVSLAIDAYPLTK	RNA-dependent_RNA_polymerase	857-871
			(NC_04551: + :
			13442-13468 + 13468-16236)
6	606-610	ATLQA linker 1-5
6	611-618	VLSEARQH	leader_protein(NC_045512: + :	38-45
			266-805)
6	619-623	ATLQA linker 1-5
6	624-637	SVASQSIIAYTMSL	surface_glycoprotein@Austria	678-691
			(NC_045512@Austria: + :
			21563-25384)
6	638-642	ATLQA linker 1-5
6	643-660	KGFCDLKGKYVQIPTTCA	nsp10(NC_045512: + : 13025-13441)	87-104
6	661-665	ATLQA linker 1-5
6	666-675	GVITHDVSSA	helicase(NC_045512: + :	478-487
			16237-18039)
6	676-680	ATLQA linker 1-5
6	681-702	IAMACLVGLMWLSYFIASFRLF	membrane_glycoprotein@Aruba	82-103
			(NC_045512@Aruba: + :
			26523-27191)
6	703-707	ATLQA linker 1-5
6	708-717	TPLIQPIGAL	nsp4(NC_045512: + : 8555-10054)	269-278
6	718-722	ATLQA linker 1-5
6	723-736	IHFYSKWYIRVGAK	ORF8_protein@Mozambique(NC_04551@	39-52
			Mozambique: + : 27894-28259)
6	737-741	ATLQA linker 1-5
6	742-751	LPRVFSAVGN	nsp4(NC_045512: + : 8555-10054)	122-131
6	752-756	ATLQA linker 1-5
6	757-774	SQHTMLVKQGDDYVYLPY	RNA-dependent_RNA_polymerase@Aruba	814-831
			(NC_04551@Aruba: + :
			13442-13468 + 13468-16236)
6	775-779	ATLQA linker 1-5
6	780-805	YRLANECAQVLSEIVMCGGSLYVKP	RNA-dependent_RNA_polymerase@	653-678
		G	Canada(NC_04551@Canada: + :
			13442-13468 + 13468-16236)
6	806-810	ATLQA linker 1-5
6	811-828	CANFNVLFSTVFPPTSFG	RNA-dependent_RNA_polymerase@	310-327
			China(NC_04551@China: + :
			13442-13468 + 13468-16236)
6	829-833	ATLQA linker 1-5
6	834-845	DTSLKLKECVMY	nsp6@SmallAsia(NC_045512@	102-113
			SmallAsia: + : 10973-11842)
6	846-850	ATLQA linker 1-5
6	851-866	FRELGVVHNQDVNLHS	RNA-dependent_RNA_polymerase	348-363
			(NC_04551: + :
			13442-13468 + 13468-16236)
6	867-871	ATLQA linker 1-5
6	872-880	MPVCVETKA	nsp3(NC_045512: + : 2720-8554)	571-579
6	881-885	ATLQA linker 1-5
6	886-901	SEFSSLPSYAAFATAQ	nsp8(NC_045512: + : 12092-12685)	4-19
6	902-906	ATLQA linker 1-5
6	907-922	EEIIYNLLKDCPAVAK	RNA-dependent_RNA_polymerase@	83-98
			Senegal(NC_04551@Senegal: + :
			13442-13468 + 13468-16236)
6	923-927	ATLQA linker 1-5
6	928-940	VKGLQPSVGPKQA	endoRNAse(NC_04512: + :	148-160
			19621-20658)
6	941-645	ATLQA linker 1-5
6	946-961	TVLKKCKSAFYILPSI	nsp3(NC_045512: + : 2720-8554)	626-541
6	962-966	ATLQA linker 1-5
6	967-980	DGCVPLNIIPLTTA	nsp8(NC_045512: + : 12092-12685)	112-125
6	981-985	ATLQA linker 1-5
6	986-1003	FLYENAFPFAMGVIAMS	nsp6@Mexico(NC_045512@	36-53
			Mexico: + : 10973-11842)
6	1004-1008	ATLQA linker 1-5
6	1009-1016	TQALPHRQ	nucleocapsid_phosphoprotein@	379-386
			Mozambique(NC_04551@Mozambique: + :
			28274-29533)
6	1017-1021	ATLQA linker 1-5
6	1022-1040	DKSAFVNLKQLPFFYYSDS	3′-to-5′_exonuclease(NC_045512: + :	432-450
			18040-19620)
6	1041-1045	ATLQA linker 1-5
6	1046-1061	LQSLQTYVTQQLIRAA	surface_glycoprotein(NC_04551: + :	1001-1016
			21563-25384)
6	1062-1066	ATLQA linker 1-5
6	1067-1086	FPQSAPHGVVFLHVTYVPAQ	surface_glycoprotein@Aruba	1048-1067
			(NC_045512@Aruba: + :
			21563-25384)
6	1087-1091	ATLQA linker 1-5
6	1092-1101	ISDYDYYRYN	RNA-dependent_RNA_polymerase@	450-459
			Aruba(NC_04551@Aruba: + :
			13442-13468 + 13468-16236)
6	1102-1106	ATLQA linker 1-5
6	1107-1114	SLIDLQEL	surface_glycoprotein(NC_04551: + :	1196-1203
			21563-25384)
6	1115-1119	ATLQA linker 1-5
6	1120-1130	SELVIGAVILR	membrane_glycoprotein(NC_045512: +	136-146
			: 26523-27191)
6	1131-1135	ATLQA linker 1-5
6	1136-1154	VKDCVLLHSYFTSDYYQLY	ORF3a_protein@Belgium(NC_04551@	197-215
			Belgium: + : 25393-26220)
6	1155-1159	ATLQA linker 1-5
6	1160-1168	TEIYQAGST	surface_glycoprotein@Aruba	466-474
			(NC_045512@Aruba: + :
			21563-25384)
6	1169-1173	ATLQA linker 1-5
6	1174-1188	HYVRITGLYPTLNIL	helicase@Indonesia(NC_045512@	245-259
			Indonesia: + : 16237-18039)
6	1189-1193	ATLQA linker 1-5
6	1194-1207	FFSNVTWFHAIHVS	surface_glycoprotein@Bangladesh	58-71
			(NC_045512@Bangladesh: + :
			21563-25384)
6	1208-1212	ATLQA linker 1-5
6	1213-1220	GSCGSVGF	3C-like_proteinase(NC_045512: + :	143-150
			10055-10972)
6	1221-1225	ATLQA linker 1-5
6	1226-1234	KHWPQIAQF	nucleocapsid_phosphoprotein	299-307
			(NC_045512: + : 28274-29533)
6	1235-1239	ATLQA linker 1-5
6	1240-1254	AYYVGYLQPRTFLLK	surface_glycoprotein@Aruba	260-274
			(NC_045512@Aruba: + :
			21563-25384)
6	1255-1259	ATLQA linker 1-5
6	1260-1268	YGIIWVATE	nucleocapsid_phosphoprotein@	128-136
			SmallSouthAmerica(NC_045512@
			SmallSouthAmerica: + :
			28274-29533)
6	1269-1273	ATLQA linker 1-5
6	1274-1281	EHVQIHTI	ORF3a_protein(NC_04551: + :	242-249
			25393-26220)
6	1282-1286	ATLQA linker 1-5
6	1287-1301	EFQFCNDPFLGVYYH	surface_glycoprotein@Chile	132-146
			(NC_045512@Chile: + :
			21563-25384)
6	1302-1306	ATLQA linker 1-5
6	1307-1320	LVLLPLVSSQCVNF	surface_glycoprotein@Brazil	5-18
			(NC_045512@Brazil: + :
			21563-25384)
6	1321-1325	ATLQA linker 1-5
6	1326-1335	KQYGDCLGDI	surface_glycoprotein(NC_04551: + :	835-844
			21563-25384)

In certain embodiments, the vaccine comprises or expresses at least one of the concatemers of epitopes from SARS-COV-2 with intervening linker sequences (and as set forth in FIG. 15). In certain embodiments, the vaccine comprises or expresses at least two of the concatemers set forth below. In certain embodiments, the vaccine comprises or expresses three of the concatemers set forth below. In certain embodiments, the vaccine comprises or expresses four of the concatemers set forth below. In certain embodiments, the vaccine comprises or expresses five of the concatemers set forth below. In certain embodiments, the vaccine comprises or expresses all the concatemers set forth below.

TABLE 5
	pos_in_			pos_in_
concatemers	concatemer	epitope	gene	gene
1	1-12	NIGCNHTGVVGE	nsp2(NC_045512:+:806-2719)	250-261
1	13-17	ATLQA	linker	1-5
1	18-34	CSNLLLQYGSFCTQLNR	surface_glycoprotein(NC_045512:+:	749-765
			21563-25384)
1	35-39	ATLQA	linker	1-5
1	40-52	GVNLVAVPTGYVD	3′-to-5′_exonuclease(NC_045512:+:	114-126
			18040-19620)
1	53-57	ATLQA	linker	1-5
1	58-69	ISVTTEILPVSM	surface_glycoprotein(NC_045512:+:	720-731
			21563-25384)
1	70-74	ATLQA	linker	1-5
1	75-89	INAACRKVQHMVVKA	3′-to-5′_exonuclease(NC_045512:+:	305-319
			18040-19620)
1	90-94	ATLQA	linker	1-5
1	95-104	ARDLICAQKF	surface_glycoprotein(NC_045512:+:	846-855
			21563-25384)
1	105-109	ATLQA	linker	1-5
1	110-119	KACVEEVTTT	nsp3(NC_045512:+:2720-8554)	415-424
1	120-124	ATLQA	linker	1-5
1	125-140	RKIFVDGVPFVVSTGY	RNA-dependent_RNA_polymerase(NC_045512:+:	331-346
			13442-13468+13468-16236)
1	141-145	ATLQA	linker	1-5
1	146-161	FRELGVVHNQDVNLHS	RNA-dependent_RNA_polymerase(NC_045512:+:	348-363
			13442-13468+13468-16236)
1	162-166	ATLQA	linker	1-5
1	167-177	SELVIGAVILR	membrane_glycoprotein(NC_045512:+:	136-146
			26523-27191)
1	178-182	ATLQA	linker	1-5
1	183-194	VRTNVYLAVFDK	nsp3(NC_045512:+:2720-8554)	351-362
1	195-199	ATLQA	linker	1-5
1	200-218	KLNVGDYFVLTSHTVMPLS	helicase(NC_045512:+:16237-18039)	218-236
1	219-223	ATLQA	linker	1-5
1	224-236	KASCTLSEQLDFI	nsp2(NC_045512:+:806-2719)	30-42
1	237-241	ATLQA	linker	1-5
1	242-249	IETISLAG	nsp3(NC_045512:+:2720-8554)	684-691
1	250-254	ATLQA	linker	1-5
1	255-268	SYLFQHANLDSCKR	nsp3(NC_045512:+:2720-8554)	915-928
1	269-273	ATLQA	linker	1-5
1	274-287	FGTVYEKLKPVLDW	nsp2(NC_045512:+:806-2719)	437-450
1	288-292	ATLQA	linker	1-5
1	293-308	LQSLQTYVTQQLIRAA	surface_glycoprotein(NC_045512:+:	1001-1016
			21563-25384)
1	309-313	ATLQA	linker	1-5
1	314-325	SSPDAVTAYNGY	nsp3(NC_045512:+:2720-8554)	660-671
1	326-330	ATLQA	linker	1-5
1	331-342	VTMPLGYVTHGL	nsp3(NC_045512:+:2720-8554)	628-639
1	343-347	ATLQA	linker	1-5
1	348-356	TENLLLYID	nsp3(NC_045512:+:2720-8554)	432-440
1	357-361	ATLQA	linker	1-5
1	362-373	VPVVDSYYSLLM	RNA-dependent_RNA_polymerase(NC_045512:+:	231-242
			13442-13468+13468-16236)
1	374-378	ATLQA	linker	1-5
1	379-386	PEHSLAEY	nsp2(NC_045512:+:806-2719)	200-207
1	387-391	ATLQA	linker	1-5
1	392-401	NYQCGHYKHI	nsp3(NC_045512:+:2720-8554)	1012-1021
1	402-406	ATLQA	linker	1-5
1	407-425	DKSAFVNLKQLPFFYYSDS	3′-to-5′_exonuclease(NC_045512:+:	432-450
			18040-19620)
1	426-430	ATLQA	linker	1-5
1	431-448	LFVVEVVDKYFDCYDGGC	RNA-dependent_RNA_polymerase(NC_045512:+:	470-487
			13442-13468+13468-16236)
2	1-13	AFASEAARVVRSI	nsp2(NC_045512:+:806-2719)	355-367
2	14-18	ATLQA	linker	1-5
2	19-32	SDRVVFVLWAHGFE	3′-to-5′_exonuclease(NC_045512:+:	178-191
			18040-19620)
2	33-37	ATLQA	linker	1-5
2	38-45	MADLVYAL	RNA-dependent_RNA_polymerase(NC_045512:+:	124-131
			13442-13468+13468-16236)
2	46-50	ATLQA	linker	1-5
2	51-60	KQYGDCLGDI	surface_glycoprotein(NC_045512:+:	835-844
			21563-25384)
2	61-65	ATLQA	linker	1-5
2	66-73	FTGCVIAW	surface_glycoprotein(NC_045512:+:	429-436
			21563-25384)
2	74-78	ATLQA	linker	1-5
2	79-86	YDPLQPEL	surface_glycoprotein(NC_045512:+:	1138-1145
			21563-25384)
2	87-91	ATLQA	linker	1-5
2	92-111	DDRCILHCANFNVLFSTVFP	RNA-dependent_RNA_polymerase(NC_045512:+:	303-322
			13442-13468+13468-16236)
2	112-116	ATLQA	linker	1-5
2	117-136	GYLPQNAVVKIYCPACHNSE	nsp2(NC_045512:+:806-2719)	178-197
2	137-141	ATLQA	linker	1-5
2	142-153	HEFCSQHTMLVK	RNA-dependent_RNA_polymerase(NC_045512:+:	810-821
			13442-13468+13468-16236)
2	154-158	ATLQA	linker	1-5
2	159-172	EGVVDYGARFYFYT	nsp3(NC_045512:+:2720-8554)	595-608
2	173-177	ATLQA	linker	1-5
2	178-189	IEVQGYKSVNIT	nsp3(NC_045512:+:2720-8554)	13-24
2	190-194	ATLQA	linker	1-5
2	195-207	AIKCVPQADVEWK	3′-to-5′_exonuclease(NC_045512:+:	337-349
			18040-19620)
2	208-212	ATLQA	linker	1-5
2	213-235	SHGKQVVSDIDYVPLKSATCITR	3′-to-5′_exonuclease(NC_045512:+:	454-476
			18040-19620)
2	236-240	ATLQA	linker	1-5
2	241-253	ANFCALILAYCNK	nsp3(NC_045512:+:2720-8554)	890-902
2	254-258	ATLQA	linker	1-5
2	259-268	SVELKHFFFA	RNA-dependent_RNA_polymerase(NC_045512:+:	434-443
			13442-13468+13468-16236)
2	269-273	ATLQA	linker	1-5
2	274-284	KGVQIPCTCGK	nsp3(NC_045512:+:2720-8554)	963-973
2	285-289	ATLQA	linker	1-5
2	290-307	IKDLPKEITVATSRTLSY	membrane_glycoprotein(NC_045512:+:	161-178
			26523-27191)
2	308-312	ATLQA	linker	1-5
2	313-327	SYELQTPFEIKLAKK	nsp2(NC_045512:+:806-2719)	68-82
2	328-332	ATLQA	linker	1-5
2	333-346	TKDVVECLKLSHQS	nsp3(NC_045512:+:2720-8554)	1830-1843
2	347-351	ATLQA	linker	1-5
2	352-359	ISNCVADY	surface_glycoprotein(NC_045512:+:	358-365
			21563-25384)
2	360-364	ATLQA	linker	1-5
2	365-379	RTCCLCDRRATCFST	3′-to-5′_exonuclease(NC_045512:+:	205-219
			18040-19620)
2	380-384	ATLQA	linker	1-5
2	385-393	EVFAQVKQI	surface_glycoprotein(NC_045512:+:	780-788
			21563-25384)
2	394-398	ATLQA	linker	1-5
2	399-409	AVHECFVKRVD	3′-to-5′_exonuclease(NC_045512:+:	281-291
			18040-19620)
2	410-414	ATLQA	linker	1-5
2	415-423	MPVCVETKA	nsp3(NC_045512:+:2720-8554)	571-579
2	424-428	ATLQA	linker	1-5
2	429-436	SVDCTMYI	surface_glycoprotein(NC_045512:+:	735-742
			21563-25384)
2	437-441	ATLQA	linker	1-5
2	442-449	AALQIPFA	surface_glycoprotein(NC_045512:+:	892-899
			21563-25384)
3	1-10	ETFVTHSKGL	nsp2(NC_045512:+:806-2719)	527-536
3	11-15	ATLQA	linker	1-5
3	16-32	AQSFLNRVCGVSAARLT	RNA-dependent_RNA_polymerase(NC_045512:+:	4-20
			13442-13468+13468-16236)
3	33-37	ATLQA	linker	1-5
3	38-53	GSNVFQTRAGCLIGAE	surface_glycoprotein(NC_045512:+:	639-654
			21563-25384)
3	54-58	ATLQA	linker	1-5
3	59-67	AGFSLWVYK	3′-to-5′_exonuclease(NC_045512:+:	504-512
			18040-19620)
3	68-72	ATLQA	linker	1-5
3	73-81	YDLSVVNAR	helicase(NC_045512:+:16237-18039)	382-390
3	82-86	ATLQA	linker	1-5
3	87-101	FSVAALTNNVAFQTV	RNA-dependent_RNA_polymerase(NC_045512:+:	396-410
			13442-13468+13468-16236)
3	102-106	ATLQA	linker	1-5
3	107-114	PSFLGRYM	nsp3(NC_045512:+:2720-8554)	822-829
3	115-119	ATLQA	linker	1-5
3	120-139	SEAVEAPLVGTPVCINGLML	nsp2(NC_045512:+:806-2719)	591-610
3	140-144	ATLQA	linker	1-5
3	145-157	IVKFISTCACEIV	nsp2(NC_045512:+:806-2719)	468-480
3	158-162	ATLQA	linker	1-5
3	163-177	ERFVSLAIDAYPLTK	RNA-dependent_RNA_polymerase(NC_045512:+:	857-871
			13442-13468+13468-16236)
3	178-182	ATLQA	linker	1-5
3	183-192	NEFYAYLRKH	RNA-dependent_RNA_polymerase(NC_045512:+:	743-752
			13442-13468+13468-16236)
3	193-197	ATLQA	linker	1-5
3	198-209	AKLLHKPIVWHV	nsp3(NC_045512:+:2720-8554)	1165-1176
3	210-214	ATLQA	linker	1-5
3	215-237	TIATYCTGSIPCSVCLSGLDSLD	nsp3(NC_045512:+:2720-8554)	1459-1481
3	238-242	ATLQA	linker	1-5
3	243-259	YADVFHLYLQYIRKLHD	RNA-dependent_RNA_polymerase(NC_045512:+:	877-893
			13442-13468+13468-16236)
3	260-264	ATLQA	linker	1-5
3	265-274	VMCGGSLYVK	RNA-dependent_RNA_polymerase(NC_045512:+:	667-676
			13442-13468+13468-16236)
3	275-279	ATLQA	linker	1-5
3	280-294	QIELKFNPPALQDAY	nsp3(NC_045512:+:2720-8554)	867-881

3	295-299	ATLQA	linker	1-5

3	300-319	YVYLPYPDPSRILGAGCFVD	RNA-dependent_RNA_polymerase(NC_045512:+:	826-845
			13442-13468+13468-16236)
3	320-324	ATLQA	linker	1-5
3	325-347	RVDFCGKGYHLMSFPQSAPHGVV	surface_glycoprotein(NC_045512:+:	1039-1061
			21563-25384)
3	348-352	ATLQA	linker	1-5
3	353-362	DPIHSLRVCV	nsp3(NC_045512:+:2720-8554)	339-348
3	363-367	ATLQA	linker	1-5
3	368-379	ALGKLQDVVNQN	surface_glycoprotein(NC_045512:+:	944-955
			21563-25384)
3	380-384	ATLQA	linker	1-5
3	385-392	SLIDLQEL	surface_glycoprotein(NC_045512:+:	1196-1203
			21563-25384)
3	393-397	ATLQA	linker	1-5
3	398-406	FFSNVTWFH	surface_glycoprotein(NC_045512:+:	58-66
			21563-25384)
3	407-411	ATLQA	linker	1-5
3	412-450	GCDVTDVTQLYLGGMSYYCKSHK	helicase(NC_045512:+:16237-18039)	54-92
		PPISFPLCANGQVFGL
4	1-10	ACIDCSARHI	nsp3(NC_045512:+:2720-8554)	1872-1881
4	11-15	ATLQA	linker	1-5
4	16-38	NHDLYCQVHGNAHVASCDAIMTR	3′-to-5′_exonuclease(NC_045512:+:	256-278
			18040-19620)
4	39-43	ATLQA	linker	1-5
4	44-58	VNCTEVPVAIHADQL	surface_glycoprotein(NC_045512:+:	615-629
			21563-25384)
4	59-63	ATLQA	linker	1-5
4	64-114	HFAIGLALYYPSARIVYTACSHA	helicase(NC_045512:+:16237-18039)	290-340
		AVDALCEKALKYLPIDKCSRIIP
		ARARV
4	115-119	ATLQA	linker	1-5
4	120-134	FKELLVYAADPAMHA	RNA-dependent_RNA_polymerase(NC_045512:+:	368-382
			13442-13468+13468-16236)
4	135-139	ATLQA	linker	1-5
4	140-147	RVEAFEYY	nsp3(NC_045512:+:2720-8554)	810-817
4	148-152	ATLQA	linker	1-5
4	153-168	TGLHPTQAPTHLSVDT	3′-to-5′_exonuclease(NC_045512:+:	16-31
			18040-19620)
4	169-173	ATLQA	linker	1-5
4	174-186	LLNVPLHGTILTR	membrane_glycoprotein(NC_045512:+:	119-131
			26523-27191)
4	187-191	ATLQA	linker	1-5
4	192-201	VTGLFKDCSK	3′-to-5′_exonuclease(NC_045512:+:	4-13
			18040-19620)
4	202-206	ATLQA	linker	1-5
4	207-214	TDAVDCAL	surface_glycoprotein(NC_045512:+:	286-293
			21563-25384)
4	215-219	ATLQA	linker	1-5
4	220-230	DNVLSTFISAA	nsp3(NC_045512:+:2720-8554)	1809-1819
4	231-235	ATLQA	linker	1-5
4	236-245	FCLEASFNYL	nsp3(NC_045512:+:2720-8554)	1391-1400
4	246-250	ATLQA	linker	1-5
4	251-260	KCAYWVPRAS	nsp2(NC_045512:+:806-2719)	239-248
4	261-265	ATLQA	linker	1-5
4	266-281	VREVLSDRELHLSWEV	helicase(NC_045512:+:16237-18039)	154-169
4	282-286	ATLQA	linker	1-5
4	287-306	KLTCATTRQVVNVVTTKIAL	nsp3(NC_045512:+:2720-8554)	1923-1942
4	307-311	ATLQA	linker	1-5
4	312-322	YELKHGTFTCA	nsp3(NC_045512:+:2720-8554)	996-1006
4	323-327	ATLQA	linker	1-5
4	328-338	VVNAANVYLKH	nsp3(NC_045512:+:2720-8554)	239-249
4	339-343	ATLQA	linker	1-5
4	344-362	LEILDITPCSFGGVSVITP	surface_glycoprotein(NC_045512:+:	582-600
			21563-25384)
4	363-367	ATLQA	linker	1-5
4	368-387	IRRPFLCCKCCYDHVISTSH	helicase(NC_045512:+:16237-18039)	20-39
4	388-392	ATLQA	linker	1-5
4	393-405	WNVVRIKIVQMLS	3′-to-5′_exonuclease(NC_045512:+:	159-171
			18040-19620)
4	406-410	ATLQA	linker	1-5
4	411-423	NPVLPFNDGVYFA	surface_glycoprotein(NC_045512:+:	81-93
			21563-25384)
4	424-428	ATLQA	linker	1-5
4	429-438	KSASVYYSQL	nsp3(NC_045512:+:2720-8554)	1737-1746
5	1-9	RSVYPVASP	nsp2(NC_045512:+:806-2719)	121-129
5	10-14	ATLQA	linker	1-5
5	15-28	LKEILVTYNCCDDD	RNA-dependent_RNA_polymerase(NC_045512:+:	142-155
			13442-13468+13468-16236)
5	29-33	ATLQA	linker	1-5
5	34-45	FNCYFPLQSYGF	surface_glycoprotein(NC_045512:+:	486-497
			21563-25384)
5	46-50	ATLQA	linker	1-5
5	51-58	AEVQIDRL	surface_glycoprotein(NC_045512:+:	989-996
			21563-25384)
5	59-63	ATLQA	linker	1-5
5	64-74	EQYVFCTVNAL	helicase(NC_045512:+:16237-18039)	353-363
5	75-79	ATLQA	linker	1-5
5	80-89	GTNLPLQLGF	3′-to-5′_exonuclease(NC_045512:+:	102-111
			18040-19620)
5	90-94	ATLQA	linker	1-5
5	95-102	KLGASQRV	membrane_glycoprotein(NC_045512:+:	180-187
			26523-27191)
5	103-107	ATLQA	linker	1-5
5	108-115	CLNRVCTN	nsp3(NC_045512:+:2720-8554)	1342-1349
5	116-120	ATLQA	linker	1-5
5	121-128	YDKLVSSF	nsp3(NC_045512:+:2720-8554)	365-372
5	129-133	ATLQA	linker	1-5
5	134-141	FKLASHMY	nsp3(NC_045512:+:2720-8554)	96-103
5	142-146	ATLQA	linker	1-5
5	147-178	IMASLVLARKHTTCCSLSHRFYR	RNA-dependent_RNA_polymerase(NC_045512:+:	632-663
		LANECAQVL	13442-13468+13468-16236)
5	179-183	ATLQA	linker	1-5
5	184-192	VTANVNALL	RNA-dependent_RNA_polymerase(NC_045512:+:	700-708
			13442-13468+13468-16236)
5	193-197	ATLQA	linker	1-5
5	198-208	LRIAGHHLGRC	membrane_glycoprotein(NC_045512:+:	149-159
			26523-27191)
5	209-213	ATLQA	linker	1-5
5	214-221	ARDLSLQF	nsp3(NC_045512:+:2720-8554)	1652-1659
5	222-226	ATLQA	linker	1-5
5	227-234	KAVFISPY	helicase(NC_045512:+:16237-18039)	508-515
5	235-239	ATLQA	linker	1-5
5	240-247	QIGVVREF	helicase(NC_045512:+:16237-18039)	492-499
5	248-252	ATLQA	linker	1-5
5	253-265	YAKPFLNKVVSTT	nsp3(NC_045512:+:2720-8554)	1323-1335
5	266-270	ATLQA	linker	1-5
5	271-278	DSYFVVKR	RNA-dependent_RNA_polymerase(NC_045512:+:	67-74
			13442-13468+13468-16236)
5	279-283	ATLQA	linker	1-5
5	284-296	NFRVQPTESIVRF	surface_glycoprotein(NC_045512:+:	317-329
			21563-25384)
5	297-301	ATLQA	linker	1-5
5	302-311	QEHYVRITGL	helicase(NC_045512:+:16237-18039)	243-252
5	312-316	ATLQA	linker	1-5
5	317-326	VQQESPFVMM	nsp3(NC_045512:+:2720-8554)	980-989
5	327-331	ATLQA	linker	1-5
5	332-341	GVITHDVSSA	helicase(NC_045512:+:16237-18039)	478-487
5	342-346	ATLQA	linker	1-5
5	347-356	VVADAVIKTL	nsp3(NC_045512:+:2720-8554)	56-65
5	357-361	ATLQA	linker	1-5
5	362-373	TRAKVGILCIMS	helicase(NC_045512:+:16237-18039)	566-577
5	374-378	ATLQA	linker	1-5
5	379-398	MTSCCSCLKGCCSCGSCCKF	surface_glycoprotein(NC_045512:+:	1237-1256
			21563-25384)
5	399-403	ATLQA	linker	1-5
5	404-413	GNCDVVIGIV	surface_glycoprotein(NC_045512:+:	1124-1133
			21563-25384)
5	414-418	ATLQA	linker	1-5
5	419-430	YPSLETIQITIS	nsp3(NC_045512:+:2720-8554)	1483-1494
5	431-435	ATLQA	linker	1-5
5	436-455	RAKHYVYIGDPAQLPAPRTL	helicase(NC_045512:+:16237-18039)	392-411
6	1-18	LNDLCFTNVYADSFVIRG	surface_glycoprotein(NC_045512:+:	387-404
			21563-25384)
6	19-23	ATLQA	linker	1-5
6	24-37	RNLQHRLYECLYRN	RNA-dependent_RNA_polymerase(NC_045512:+:	721-734
			13442-13468+13468-16236)
6	38-42	ATLQA	linker	1-5
6	43-51	AAAYYVGYL	surface_glycoprotein(NC_045512:+:	262-270
			21563-25384)
6	52-56	ATLQA	linker	1-5
6	57-78	GYQPYRVVVLSFELLHAPATVC	surface_glycoprotein(NC_045512:+:	504-525
			21563-25384)
6	79-83	ATLQA	linker	1-5
6	84-92	SRELKVTFF	nsp3(NC_045512:+:2720-8554)	1134-1142
6	93-97	ATLQA	linker	1-5
6	98-105	LPINVIVF	nsp3(NC_045512:+:2720-8554)	1718-1725
6	106-110	ATLQA	linker	1-5
6	111-137	FSASTSAFVETVKGLDYKAFKQI	nsp2(NC_045512:+:806-2719)	300-326
		VESC
6	138-142	ATLQA	linker	1-5
6	143-150	NNLVVMAY	nsp2(NC_045512:+:806-2719)	413-420
6	151-155	ATLQA	linker	1-5
6	156-163	GVYCCREH	nsp2(NC_045512:+:806-2719)	47-54
6	164-168	ATLQA	linker	1-5
6	169-183	TYACWHHSIGFDYVY	3′-to-5′_exonuclease(NC_045512:+:	223-237
			18040-19620)
6	184-188	ATLQA	linker	1-5
6	189-208	FCKLHNWNCVNCDTFCAGST	nsp3(NC_045512:+:2720-8554)	1626-1645
6	209-213	ATLQA	linker	1-5
6	214-223	DVVAIDYKHY	nsp3(NC_045512:+:2720-8554)	1148-1157
6	224-228	ATLQA	linker	1-5
6	229-245	PNFVFPLNSIIKTIQPR	nsp2(NC_045512:+:806-2719)	91-107
6	246-250	ATLQA	linker	1-5
6	251-261	IEELFYSYATH	3′-to-5′_exonuclease(NC_045512:+:	363-373
			18040-19620)
6	262-266	ATLQA	linker	1-5
6	267-276	TQNVLYENQK	surface_glycoprotein(NC_045512:+:	912-921
			21563-25384)
6	277-281	ATLQA	linker	1-5
6	282-297	ANSIVCRFDTRVLSNL	3′-to-5′_exonuclease(NC_045512:+:	394-409
			18040-19620)
6	298-302	ATLQA	linker	1-5
6	303-312	RHSLSHFVNL	nsp3(NC_045512:+:2720-8554)	1697-1706
6	313-317	ATLQA	linker	1-5
6	318-342	SDIDITFLKKDAPYIVGDVVQEG	nsp3(NC_045512:+:2720-8554)	454-478
		VL
6	343-347	ATLQA	linker	1-5
6	348-358	KESVQTFFKLV	nsp2(NC_045512:+:806-2719)	492-502
6	359-363	ATLQA	linker	1-5
6	364-383	LQKAAITILDGISQYSLRLI	nsp2(NC_045512:+:806-2719)	382-401
6	384-388	ATLQA	linker	1-5
6	389-405	LECNVKTTEVVGDIILK	nsp3(NC_045512:+:2720-8554)	1244-1260
6	406-410	ATLQA	linker	1-5
6	411-423	ATNVVIKVCEFQF	surface_glycoprotein(NC_045512:+:	123-135
			21563-25384)
6	424-428	ATLQA	linker	1-5
6	429-444	TVLKKCKSAFYILPSI	nsp3(NC_045512:+:2720-8554)	526-541

In certain embodiments, the vaccine comprises or expresses at least one of the concatemers of epitopes from SARS-COV-2 with intervening linker sequences (and as set forth in FIG. 16). In certain embodiments, the vaccine comprises or expresses at least two of the concatemers set forth below. In certain embodiments, the vaccine comprises or expresses three of the concatemers set forth below. In certain embodiments, the vaccine comprises or expresses four of the concatemers set forth below. In certain embodiments, the vaccine comprises or expresses five of the concatemers set forth below. In certain embodiments, the vaccine comprises or expresses all the concatemers set forth below.

TABLE 6
	pos_in_			pos_
concatemers	concatemer	epitope	gene	in_gene
1	1-12	NIGCNHTGVVGE	nsp2(NC_045512:+:806-2719)	250-261
1	13-17	ATLQA	linker	1-5
1	18-32	ISNCVADYSVLYNSA	surface_glycoprotein@Aruba(NC_045512@Aruba:+:	354-368
			21563-25384)
1	33-37	ATLQA	linker	1-5
1	38-45	MADLVYAL	RNA-dependent_RNA_polymerase(NC_045512:+:	124-131
			13442-13468+13468-16236)
1	46-50	ATLQA	linker	1-5
1	51-58	REGVFVSN	surface_glycoprotein@Aruba(NC_045512@Aruba:+:	1087-1094
			21563-25384)
1	59-63	ATLQA	linker	1-5
1	64-114	HFAIGLALYYPSARIV	helicase(NC_045512:+:16237-18039)	290-340
		YTACSHAAVDALCEKA
		LKYLPIDKCSRIIPAR
		ARV
1	115-119	ATLQA	linker	1-5
1	120-136	YADVFHLYLQYIRKLH	RNA-dependent_RNA_polymerase(NC_045512:+:	877-893
		D	13442-13468+13468-16236)
1	137-141	ATLQA	linker	1-5
1	142-154	IVKFISTCACEIV	nsp2(NC_045512:+:806-2719)	468-480
1	155-159	ATLQA	linker	1-5
1	160-167	RVEAFEYY	nsp3(NC_045512:+:2720-8554)	810-817
1	168-172	ATLQA	linker	1-5
1	173-180	GVYCCREH	nsp2(NC_045512:+:806-2719)	47-54
1	181-185	ATLQA	linker	1-5
1	186-205	RAKHYVYIGDPAQLPA	helicase(NC_045512:+:16237-18039)	392-411
		PRTL
1	206-210	ATLQA	linker	1-5
1	211-218	EIYQAGSK	surface_glycoprotein@Mexico(NC_045512@Mexico:+:	471-478
			21563-25384)
1	219-223	ATLQA	linker	1-5
1	224-235	YPSLETIQITIS	nsp3(NC_045512:+:2720-8554)	1483-1494
1	236-240	ATLQA	linker	1-5
1	241-250	KSASVYYSQL	nsp3(NC_045512:+:2720-8554)	1737-1746
1	251-255	ATLQA	linker	1-5
1	256-270	VNCTEVPVAIHADQL	surface_glycoprotein(NC_045512:+:21563-25384)	615-629
1	271-275	ATLQA	linker	1-5
1	276-291	TGLHPTQAPTHLSVDT	3′-to-5′_exonuclease(NC_045512:+:18040-19620)	16-31
1	292-296	ATLQA	linker	1-5
1	297-309	ISSVLNDILSRLD	surface_glycoprotein@Bangladesh	972-984
			(NC_045512@Bangladesh:+:21563-25384)
1	310-314	ATLQA	linker	1-5
1	315-331	LECNVKTTEVVGDIIL	nsp3(NC_045512:+:2720-8554)	1244-1260
		K
1	332-336	ATLQA	linker	1-5
1	337-351	FKELLVYAADPAMHA	RNA-dependent_RNA_polymerase(NC_045512:+:	368-382
			13442-13468+13468-16236)
1	352-356	ATLQA	linker	1-5
1	357-367	DNVLSTFISAA	nsp3(NC_045512:+:2720-8554)	1809-1819
1	368-372	ATLQA	linker	1-5
1	373-381	VTANVNALL	RNA-dependent_RNA_polymerase(NC_045512:+:	700-708
			13442-13468+13468-16236)
1	382-386	ATLQA	linker	1-5
1	387-401	INAACRKVQHMVVKA	3′-to-5′_exonuclease(NC_045512:+:18040-19620)	305-319
1	402-406	ATLQA	linker	1-5
1	407-418	ALGKLQDVVNQN	surface_glycoprotein(NC_045512:+:21563-25384)	944-955
1	419-423	ATLQA	linker	1-5
1	424-435	SSPDAVTAYNGY	nsp3(NC_045512:+:2720-8554)	660-671
1	436-440	ATLQA	linker	1-5
1	441-460	GYLPQNAVVKIYCPAC	nsp2(NC_045512:+:806-2719)	178-197
		HNSE
1	461-465	ATLQA	linker	1-5
1	466-475	RHSLSHFVNL	nsp3(NC_045512:+:2720-8554)	1697-1706
1	476-480	ATLQA	linker	1-5
1	481-492	FSNVTWFHAIVS	surface_glycoprotein@Ghana(NC_045512@Ghana:+:	59-70
			21563-25384)
1	493-497	ATLQA	linker	1-5
1	498-513	LQSLQTYVTQQLIRAA	surface_glycoprotein(NC_045512:+:21563-25384)	1001-1016
1	514-518	ATLQA	linker	1-5
1	519-541	SHGKQVVSDIDYVPLK	3′-to-5′_exonuclease(NC_045512:+:18040-19620)	454-476
		SATCITR
1	542-546	ATLQA	linker	1-5
1	547-560	LVLLPLVSSQCVNF	surface_glycoprotein@Brazil(NC_045512@Brazil:+:	5-18
			21563-25384)
1	561-565	ATLQA	linker	1-5
1	566-575	TQNVLYENQK	surface_glycoprotein(NC_045512:+:21563-25384)	912-921
1	576-580	ATLQA	linker	1-5
1	581-591	VLYQGVNCTEV	surface_glycoprotein@Aruba(NC_045512@Aruba:+:	606-616
			21563-25384)
1	592-596	ATLQA	linker	1-5
1	597-628	IMASLVLARKHTTCCS	RNA-dependent_RNA_polymerase(NC_045512:+:	632-663
		LSHRFYRLANECAQVL	13442-13468+13468-16236)
2	1-13	AFASEAARVVRSI	nsp2(NC_045512:+:806-2719)	355-367
2	14-18	ATLQA	linker	1-5
2	19-32	SDRVVFVLWAHGFE	3′-to-5′_exonuclease(NC_045512:+:18040-19620)	178-191
2	33-37	ATLQA	linker	1-5
2	38-47	SVLNDILARL	surface_glycoprotein@Aruba(NC_045512@Aruba:+:	971-980
			21563-25384)
2	48-52	ATLQA	linker	1-5
2	53-66	TSGVGYQPYRVVVL	surface_glycoprotein@Aruba(NC_045512@Aruba:+:	496-509
			21563-25384)
2	67-71	ATLQA	linker	1-5
2	72-91	PINLVRGLPQGFSALE	surface_glycoprotein@Austria	205-224
		PLVD	(NC_045512@Austria:+:21563-25384)
2	92-96	ATLQA	linker	1-5
2	97-109	RSVASQSIIAYTM	surface_glycoprotein@Aruba(NC_045512@Aruba:+:	681-693
			21563-25384)
2	110-114	ATLQA	linker	1-5
2	115-125	KGVQIPCTCGK	nsp3(NC_045512:+:2720-8554)	963-973
2	126-130	ATLQA	linker	1-5
2	131-140	KACVEEVTTT	nsp3(NC_045512:+:2720-8554)	415-424
2	141-145	ATLQA	linker	1-5
2	146-155	KCAYWVPRAS	nsp2(NC_045512:+:806-2719)	239-248
2	156-160	ATLQA	linker	1-5
2	161-172	VTMPLGYVTHGL	nsp3(NC_045512:+:2720-8554)	628-639
2	173-177	ATLQA	linker	1-5
2	178-187	NEFYAYLRKH	RNA-dependent_RNA_polymerase(NC_045512:+:	743-752
			13442-13468+13468-16236)
2	188-192	ATLQA	linker	1-5
2	193-207	EFQFCNDPFLGVYYH	surface_glycoprotein@Chile(NC_045512@Chile:+:	132-146
			21563-25384)
2	208-212	ATLQA	linker	1-5
2	213-235	TIATYCTGSIPCSVCL	nsp3(NC_045512:+:2720-8554)	1459-1481
		SGLDSLD
2	236-240	ATLQA	linker	1-5
2	241-257	CSNLLLQYGSFCTQLN	surface_glycoprotein(NC_045512:+:21563-25384)	749-765
		R
2	258-262	ATLQA	linker	1-5
2	263-272	NYQCGHYKHI	nsp3(NC_045512:+:2720-8554)	1012-1021
2	273-277	ATLQA	linker	1-5
2	278-293	ANSIVCRFDTRVLSNL	3′-to-5′_exonuclease(NC_045512:+:18040-19620)	394-409
2	294-298	ATLQA	linker	1-5
2	299-307	SRELKVTFF	nsp3(NC_045512:+:2720-8554)	1134-1142
2	308-312	ATLQA	linker	1-5
2	313-323	YELKHGTFTCA	nsp3(NC_045512:+:2720-8554)	996-1006
2	324-328	ATLQA	linker	1-5
2	329-337	VFSQCVNLT	surface_glycoprotein@Egypt(NC_045512@Egypt:+:	11-19
			21563-25384)
2	338-342	ATLQA	linker	1-5
2	343-364	GYQPYRVVVLSFELLH	surface_glycoprotein(NC_045512:+:21563-25384)	504-525
		APATVC
2	365-369	ATLQA	linker	1-5
2	370-389	FPQSAPHGVVFLHVTY	surface_glycoprotein@Aruba(NC_045512@Aruba:+:	1048-1067
		VPAQ	21563-25384)
2	390-394	ATLQA	linker	1-5
2	395-406	FRSSVLHSTRDL	surface_glycoprotein@Nigeria	43-54
			(NC_045512@Nigeria:+:21563-25384)
2	407-411	ATLQA	linker	1-5
2	412-425	EGVVDYGARFYFYT	nsp3(NC_045512:+:2720-8554)	595-608
2	426-430	ATLQA	linker	1-5
2	431-440	GNCDVVIGIV	surface_glycoprotein(NC_045512:+:21563-25384)	1124-1133
2	441-445	ATLQA	linker	1-5
2	446-453	AALQIPFA	surface_glycoprotein(NC_045512:+:21563-25384)	892-899
2	454-458	ATLQA	linker	1-5
2	459-474	FLVLLPLVSIQCVNLT	surface_glycoprotein@SmallNorthAmerica	4-19
			(NC_045512@SmallNorthAmerica:+:21563-25384)
2	475-479	ATLQA	linker	1-5
2	480-487	CLNRVCTN	nsp3(NC_045512:+:2720-8554)	1342-1349
2	488-492	ATLQA	linker	1-5
2	493-507	EFQFCNYPFLGVYHK	surface_glycoprotein@Norway(NC_045512@Norway:+:	129-143
			21563-25384)
2	508-512	ATLQA	linker	1-5
2	513-527	TYGVGYQPYRVVVLS	surface_glycoprotein@Australia	496-510
			(NC_045512@Australia:+:21563-25384)
2	528-532	ATLQA	linker	1-5
2	533-546	ETKCTLKSFTVEKG	surface_glycoprotein@Aruba(NC_045512@Aruba:+:	294-307
			21563-25384)
2	547-551	ATLQA	linker	1-5
2	552-564	AIKCVPQADVEWK	3′-to-5′_exonuclease(NC_045512:+:18040-19620)	337-349
2	565-569	ATLQA	linker	1-5
2	570-589	IRRPFLCCKCCYDHVI	helicase(NC_045512:+:16237-18039)	20-39
		STSH
2	590-594	ATLQA	linker	1-5
2	595-614	PINLVRGLPQGFSVLE	surface_glycoprotein@SmallAfrica	209-228
		PLVD	(NC_045512@SmallAfrica:+:21563-25384)
2	615-619	ATLQA	linker	1-5
2	620-638	KLNVGDYFVLTSHTVM	helicase(NC_045512:+:16237-18039)	218-236
		PLS
3	1-10	ETFVTHSKGL	nsp2(NC_045512:+:806-2719)	527-536
3	11-15	ATLQA	linker	1-5
3	16-38	NHDLYCQVHGNAHVAS	3′-to-5′_exonuclease(NC_045512:+:18040-19620)	256-278
		CDAIMTR
3	39-43	ATLQA	linker	1-5
3	44-52	TEIYQAGST	surface_glycoprotein@Aruba(NC_045512@Aruba:+:	466-474
			21563-25384)
3	53-57	ATLQA	linker	1-5
3	58-66	AGFSLWVYK	3′-to-5′_exonuclease(NC_045512:+:18040-19620)	504-512
3	67-71	ATLQA	linker	1-5
3	72-84	FQTLLALHRSYLT	surface_glycoprotein@Aruba(NC_045512@Aruba:+:	234-246
			21563-25384)
3	85-89	ATLQA	linker	1-5
3	90-103	TKDVVECLKLSHQS	nsp3(NC_045512:+:2720-8554)	1830-1843
3	104-108	ATLQA	linker	1-5
	109-116	YDKLVSSF	nsp3(NC_045512:+:2720-8554)	365-372
3	117-121	ATLQA	linker	1-5
3	122-129	LPINVIVF	nsp3(NC_045512:+:2720-8554)	1718-1725
	130-134	ATLQA	linker	1-5
3	135-145	SELVIGAVILR	membrane_glycoprotein(NC_045512:+:26523-27191)	136-146
3	146-150	ATLQA	linker	1-5
	151-163	KASCTLSEQLDFI	nsp2(NC_045512:+:806-2719)	30-42
3	164-168	ATLQA	linker	1-5
3	169-183	FSVAALTNNVAFQTV	RNA-dependent_RNA_polymerase(NC_045512:+:	396-410
			13442-13468+13468-16236)
3	184-188	ATLQA	linker	1-5
3	189-197	EPLLKGVKL	surface_glycoprotein@Croatia	1258-1266
			(NC_045512@Croatia:+:21563-25384)
3	198-202	ATLQA	linker	1-5
3	203-241	GCDVTDVTQLYLGGMS	helicase(NC_045512:+:16237-18039)	54-92
		YYCKSHKPPISFPLCA
		NGQVFGL
3	242-246	ATLQA	linker	1-5
3	247-256	FCLEASFNYL	nsp3(NC_045512:+:2720-8554)	1391-1400
3	257-261	ATLQA	linker	1-5
3	262-272	LRIAGHHLGRC	membrane_glycoprotein(NC_045512:+:26523-27191)	149-159
3	273-277	ATLQA	linker	1-5
3	278-289	TRAKVGILCIMS	helicase(NC_045512:+:16237-18039)	566-577
3	290-294	ATLQA	linker	1-5
3	295-302	IETISLAG	nsp3(NC_045512:+:2720-8554)	684-691
3	303-307	ATLQA	linker	1-5
3	308-319	FNCYFPLQSYGF	surface_glycoprotein(NC_045512:+:21563-25384)	486-497
3	320-324	ATLQA	linker	1-5
3	325-339	ARSVARQSIIAYTMS	surface_glycoprotein@Mozambique	680-694
			(NC_045512@Mozambique:+:21563-25384)
3	340-344	ATLQA	linker	1-5
3	345-354	SVELKHFFFA	RNA-dependent_RNA_polymerase(NC_045512:+:	434-443
			13442-13468+13468-16236)
3	355-359	ATLQA	linker	1-5
3	360-372	NFRVQPTESIVRF	surface_glycoprotein(NC_045512:+:21563-25384)	317-329
3	373-377	ATLQA	linker	1-5
3	378-389	VRTNVYLAVFDK	nsp3(NC_045512:+:2720-8554)	351-362
3	390-394	ATLQA	linker	1-5
3	395-407	ATNVVIKVCEFQF	surface_glycoprotein(NC_045512:+:21563-25384)	123-135
3	408-412	ATLQA	linker	1-5
3	413-420	PVLKGVKL	surface_glycoprotein@Aruba(NC_045512@Aruba:+:	1259-1266
			21563-25384)
3	421-425	ATLQA	linker	1-5
3	426-444	LEILDITPCSFGGVSV	surface_glycoprotein(NC_045512:+:21563-25384)	582-600
		ITP
3	445-449	ATLQA	linker	1-5
3	450-465	TVLKKCKSAFYILPSI	nsp3(NC_045512:+:2720-8554)	526-541
3	466-470	ATLQA	linker	1-5
3	471-482	FQTLLHRSYLTP	surface_glycoprotein@SmallAsia	230-241
			(NC_045512@SmallAsia:+:21563-25384)
3	483-487	ATLQA	linker	1-5
3	488-501	FFSNVTWFHAIHVS	surface_glycoprotein@Bangladesh	58-71
			(NC_045512@Bangladesh:+:21563-25384)
3	502-506	ATLQA	linker	1-5
3	507-517	HFPRKGVFVSN	surface_glycoprotein@SmallAsia	1078-1088
			(NC_045512@SmallAsia:+:21563-25384)
3	518-522	ATLQA	linker	1-5
3	523-534	HEFCSQHTMLVK	RNA-dependent_RNA_polymerase(NC_045512:+:	810-821
			13442-13468+13468-16236)
3	535-539	ATLQA	linker	1-5
3	540-547	AEVQIDRL	surface_glycoprotein(NC_045512:+:21563-25384)	989-996
3	548-552	ATLQA	linker	1-5
3	553-568	VREVLSDRELHLSWEV	helicase(NC_045512:+:16237-18039)	154-169
3	569-573	ATLQA	linker	1-5
3	574-589	FSNVTWFHAIHVSGTN	surface_glycoprotein@Peru(NC_045512@Peru:+:	59-74
			21563-25384)
3	590-594	ATLQA	linker	1-5
3	595-602	ARDLSLQF	nsp3(NC_045512:+:2720-8554)	1652-1659
3	603-607	ATLQA	linker	1-5
3	608-615	STFKCYGV	surface_glycoprotein@Aruba(NC_045512@Aruba:+:	371-378
			21563-25384)
3	616-620	ATLQA	linker	1-5
3	621-630	SSVLHSTQDF	surface_glycoprotein@Norway(NC_045512@Norway:+:	45-54
			21563-25384)
4	1-10	ACIDCSARHI	nsp3(NC_045512:+:2720-8554)	1872-1881
4	11-15	ATLQA	linker	1-5
4	16-32	AQSFLNRVCGVSAARL	RNA-dependent_RNA_polymerase(NC_045512:+:	4-20
		T	13442-13468+13468-16236)
4	33-37	ATLQA	linker	1-5
4	38-50	GVNLVAVPTGYVD	3′-to-5′_exonuclease(NC_045512:+:18040-19620)	114-126
4	51-55	ATLQA	linker	1-5
4	56-67	FRSSVLHSTQDL	surface_glycoprotein@Aruba(NC_045512@Aruba:+:	43-54
			21563-25384)
4	68-72	ATLQA	linker	1-5
4	73-86	ANPVLPFNDGVYFA	surface_glycoprotein@Austria	77-90
			(NC_045512@Austria:+:21563-25384)
4	87-91	ATLQA	linker	1-5
4	92-111	YVYLPYPDPSRILGAG	RNA-dependent_RNA_polymerase(NC_045512:+:	826-845
		CFVD	13442-13468+13468-16236)
4	112-116	ATLQA	linker	1-5
4	117-136	LQKAAITILDGISQYS	nsp2(NC_045512:+:806-2719)	382-401
		LRLI
4	137-141	ATLQA	linker	1-5
4	142-153	VPVVDSYYSLLM	RNA-dependent_RNA_polymerase(NC_045512:+:	231-242
			13442-13468+13468-16236)
4	154-158	ATLQA	linker	1-5
4	159-176	LFVVEVVDKYFDCYDG	RNA-dependent_RNA_polymerase(NC_045512:+:	470-487
		GC	13442-13468+13468-16236)
4	177-181	ATLQA	linker	1-5
4	182-192	AVHECFVKRVD	3′-to-5′_exonuclease(NC_045512:+:18040-19620)	281-291
4	193-197	ATLQA	linker	1-5
4	198-207	GVITHDVSSA	helicase(NC_045512:+:16237-18039)	478-487
4	208-212	ATLQA	linker	1-5
4	213-224	IEVQGYKSVNIT	nsp3(NC_045512:+:2720-8554)	13-24
4	225-229	ATLQA	linker	1-5
4	230-243	IKVCEFQFCNDPYY	surface_glycoprotein@CostaRica	128-141
			(NC_045512@CostaRica:+:21563-25384)
4	244-248	ATLQA	linker	1-5
4	249-258	VQQESPFVMM	nsp3(NC_045512:+:2720-8554)	980-989
4	259-263	ATLQA	linker	1-5
4	264-278	TISVTTEILPVSMAK	surface_glycoprotein@Mexico(NC_045512@Mexico:+:	719-733
			21563-25384)
4	279-283	ATLQA	linker	1-5
4	284-295	AKLLHKPIVWHV	nsp3(NC_045512:+:2720-8554)	1165-1176
4	296-300	ATLQA	linker	1-5
4	301-317	PNFVFPLNSIIKTIQP	nsp2(NC_045512:+:806-2719)	91-107
		R
4	318-322	ATLQA	linker	1-5
4	323-331	MPVCVETKA	nsp3(NC_045512:+:2720-8554)	571-579
4	332-336	ATLQA	linker	1-5
4	337-344	PEHSLAEY	nsp2(NC_045512:+:806-2719)	200-207
4	345-349	ATLQA	linker	1-5
4	350-369	KLTCATTRQVVNVVTT	nsp3(NC_045512:+:2720-8554)	1923-1942
		KIAL
4	370-374	ATLQA	linker	1-5
4	375-384	ARDLICAQKF	surface_glycoprotein(NC_045512:+:21563-25384)	846-855
4	385-389	ATLQA	linker	1-5
4	390-408	AIPINFTISVTTEILP	surface_glycoprotein@Aruba(NC_045512@Aruba:+:	709-727
		VSM	21563-25384)
4	409-413	ATLQA	linker	1-5
4	414-422	YDLSVVNAR	helicase(NC_045512:+:16237-18039)	382-390
4	423-427	ATLQA	linker	1-5
4	428-441	GFNCYSPLQSYGFQ	surface_glycoprotein@Peru(NC_045512@Peru:+:	485-498
			21563-25384)
4	442-446	ATLQA	linker	1-5
4	447-456	AGAALQIPFA	surface_glycoprotein@Nigeria	886-895
			(NC_045512@Nigeria:+:21563-25384)
4	457-461	ATLQA	linker	1-5
4	462-480	QVAVLYQDVNCTEVPV	surface_glycoprotein@China(NC_045512@China:+:	607-625
		AIH	21563-25384)
4	481-485	ATLQA	linker	1-5
4	486-495	QEHYVRITGL	helicase(NC_045512:+:16237-18039)	243-252
4	496-500	ATLQA	linker	1-5
4	501-514	FGTVYEKLKPVLDW	nsp2(NC_045512:+:806-2719)	437-450
4	515-519	ATLQA	linker	1-5
4	520-529	VVADAVIKTL	nsp3(NC_045512:+:2720-8554)	56-65
4	530-534	ATLQA	linker	1-5
4	535-542	ISNCVADY	surface_glycoprotein(NC_045512:+:21563-25384)	358-365
4	543-547	ATLQA	linker	1-5
4	548-556	EVFAQVKQI	surface_glycoprotein(NC_045512:+:21563-25384)	780-788
4	557-561	ATLQA	linker	1-5
4	562-574	YAKPFLNKVVSTT	nsp3(NC_045512:+:2720-8554)	1323-1335
4	575-579	ATLQA	linker	1-5
4	580-587	TDAVDCAL	surface_glycoprotein(NC_045512:+:21563-25384)	286-293
4	588-592	ATLQA	linker	1-5
4	593-604	ISVTTEILPVSM	surface_glycoprotein(NC_045512:+:21563-25384)	720-731
4	605-609	ATLQA	linker	1-5
4	610-617	FTGCVIAW	surface_glycoprotein(NC_045512:+:21563-25384)	429-436
4	618-622	ATLQA	linker	1-5
4	623-640	IKVCEFQFCNDPFLGV	surface_glycoprotein@Aruba(NC_045512@Aruba:+:	125-142
		YH	21563-25384)
5	1-9	RSVYPVASP	nsp2(NC_045512:+:806-2719)	121-129
5	10-14	ATLQA	linker	1-5
5	15-28	LKEILVTYNCCDDD	RNA-dependent_RNA_polymerase(NC_045512:+:	142-155
			13442-13468+13468-16236)
5	29-33	ATLQA	linker	1-5
5	34-48	AYYVGYLQPRTFLLK	surface_glycoprotein@Aruba(NC_045512@Aruba:+:	260-274
			21563-25384)
5	49-53	ATLQA	linker	1-5
5	54-84	YIWLGFIAGLIAIVMV	surface_glycoprotein@Aruba(NC_045512@Aruba:+:	1211-1241
		TIMLCCMTSCCSCLK	21563-25384)
5	85-89	ATLQA	linker	1-5
5	90-104	ERFVSLAIDAYPLTK	RNA-dependent_RNA_polymerase(NC_045512:+:	857-871
			13442-13468+13468-16236)
5	105-109	ATLQA	linker	1-5
5	110-117	PSFLGRYM	nsp3(NC_045512:+:2720-8554)	822-829
5	118-122	ATLQA	linker	1-5
5	123-142	DDRCILHCANFNVLFS	RNA-dependent_RNA_polymerase(NC_045512:+:	303-322
		TVFP	13442-13468+13468-16236)
5	143-147	ATLQA	linker	1-5
5	148-155	NNLVVMAY	nsp2(NC_045512:+:806-2719)	413-420
5	156-160	ATLQA	linker	1-5
5	161-176	FRELGVVHNQDVNLHS	RNA-dependent_RNA_polymerase(NC_045512:+:	348-363
			13442-13468+13468-16236)
5	177-181	ATLQA	linker	1-5
5	182-191	FEYVSQPFLM	surface_glycoprotein@Aruba(NC_045512@Aruba:+:	164-173
			21563-25384)
5	192-196	ATLQA	linker	1-5
5	197-218	NVVIKVCEFQFCNYPF	surface_glycoprotein@Brazil(NC_045512@Brazil:+:	125-146
		LGVYYH	21563-25384)
5	219-223	ATLQA	linker	1-5
5	224-231	KAVFISPY	helicase(NC_045512:+:16237-18039)	508-515
5	232-236	ATLQA	linker	1-5
5	237-254	LNDLCFTNVYADSFVI	surface_glycoprotein(NC_045512:+:21563-25384)	387-404
		RG
5	255-259	ATLQA	linker	1-5
5	260-269	DPIHSLRVCV	nsp3(NC_045512:+:2720-8554)	339-348
5	270-274	ATLQA	linker	1-5
5	275-297	LIAIVMVTIMLCCITS	surface_glycoprotein@Mozambique	1220-1242
		CCSCLKG	(NC_045512@Mozambique:+:21563-25384)
5	298-302	ATLQA	linker	1-5
5	303-322	SEAVEAPLVGTPVCIN	nsp2(NC_045512:+:806-2719)	591-610
		GLML
5	323-327	ATLQA	linker	1-5
5	328-342	RTCCLCDRRATCFST	3′-to-5′_exonuclease(NC_045512:+:18040-19620)	205-219
5	343-347	ATLQA	linker	1-5
5	348-370	RVDFCGKGYHLMSFPQ	surface_glycoprotein(NC_045512:+:21563-25384)	1039-1061
		SAPHGVV
5	371-375	ATLQA	linker	1-5
5	376-391	GSNVFQTRAGCLIGAE	surface_glycoprotein(NC_045512:+:21563-25384)	639-654
5	392-396	ATLQA	linker	1-5
5	397-404	QIGVVREF	helicase(NC_045512:+:16237-18039)	492-499
5	405-409	ATLQA	linker	1-5
5	410-419	GTNLPLQLGF	3′-to-5′_exonuclease(NC_045512:+:18040-19620)	102-111
5	420-424	ATLQA	linker	1-5
5	425-439	SYELQTPFEIKLAKK	nsp2(NC_045512:+:806-2719)	68-82
5	440-444	ATLQA	linker	1-5
5	445-455	FFSNVTWFHVS	surface_glycoprotein@Nigeria	58-68
			(NC_045512@Nigeria:+:21563-25384)
5	456-460	ATLQA	linker	1-5
5	461-475	TYACWHHSIGFDYVY	3′-to-5′_exonuclease(NC_045512:+:18040-19620)	223-237
5	476-480	ATLQA	linker	1-5
5	481-500	FCKLHNWNCVNCDTFC	nsp3(NC_045512:+:2720-8554)	1626-1645
		AGST
5	501-505	ATLQA	linker	1-5
5	506-520	QIELKFNPPALQDAY	nsp3(NC_045512:+:2720-8554)	867-881
5	521-525	ATLQA	linker	1-5
5	526-533	FKLASHMY	nsp3(NC_045512:+:2720-8554)	96-103
5	534-538	ATLQA	linker	1-5
5	539-563	SDIDITFLKKDAPYIV	nsp3(NC_045512:+:2720-8554)	454-478
		GDVVQEGVL
5	564-568	ATLQA	linker	1-5
5	569-592	PINLVRDLPQGFSVLE	surface_glycoprotein@Belgium	205-228
		PLVDLPIG	(NC_045512@Belgium:+:21563-25384)
5	593-597	ATLQA	linker	1-5
5	598-607	KQYGDCLGDI	surface_glycoprotein(NC_045512:+:21563-25384)	835-844
5	608-612	ATLQA	linker	1-5
5	613-625	LLNVPLHGTILTR	membrane_glycoprotein(NC_045512:+:26523-27191)	119-131
5	626-630	ATLQA	linker	1-5
5	631-638	SLIDLQEL	surface_glycoprotein(NC_045512:+:21563-25384)	1196-1203
6	1-22	INLVRDLPQGFSALEP	surface_glycoprotein@Aruba(NC_045512@Aruba:+:	206-227
		LVDLPI	21563-25384)
6	23-27	ATLQA	linker	1-5
6	28-41	RNLQHRLYECLYRN	RNA-dependent_RNA_polymerase(NC_045512:+:	721-734
			13442-13468+13468-16236)
6	42-46	ATLQA	linker	1-5
6	47-62	FLVLLPLVSSQCVNLT	surface_glycoprotein@Aruba(NC_045512@Aruba:+:	4-19
			21563-25384)
6	63-67	ATLQA	linker	1-5
6	68-78	EQYVFCTVNAL	helicase(NC_045512:+:16237-18039)	353-363
6	79-83	ATLQA	linker	1-5
6	84-95	EVFAQVKQIYKT	surface_glycoprotein@Aruba(NC_045512@Aruba:+:	776-787
			21563-25384)
6	96-100	ATLQA	linker	1-5
6	101-110	DVVAIDYKHY	nsp3(NC_045512:+:2720-8554)	1148-1157
6	111-115	ATLQA	linker	1-5
6	116-123	KLGASQRV	membrane_glycoprotein(NC_045512:+:26523-27191)	180-187
6	124-128	ATLQA	linker	1-5
6	129-137	TENLLLYID	nsp3(NC_045512:+:2720-8554)	432-440
6	138-142	ATLQA	linker	1-5
6	143-153	KESVQTFFKLV	nsp2(NC_045512:+:806-2719)	492-502
6	154-158	ATLQA	linker	1-5
6	159-174	RKIFVDGVPFVVSTGY	RNA-dependent_RNA_polymerase(NC_045512:+:	331-346
			13442-13468+13468-16236)
6	175-179	ATLQA	linker	1-5
6	180-197	IKDLPKEITVATSRTL	membrane_glycoprotein(NC_045512:+:26523-27191)	161-178
		SY
6	198-202	ATLQA	linker	1-5
6	203-211	SPDVDLADI	surface_glycoprotein@Chile(NC_045512@Chile:+:	1161-1169
			21563-25384)
6	212-216	ATLQA	linker	1-5
6	217-226	KQYGDCLGNI	surface_glycoprotein@Jordan(NC_045512@Jordan:+:	831-840
			21563-25384)
6	227-231	ATLQA	linker	1-5
6	232-245	SVASQSIIAYTMSL	surface_glycoprotein@Austria	678-691
			(NC_045512@Austria:+:21563-25384)
6	246-250	ATLQA	linker	1-5
6	251-270	MTSCCSCLKGCCSCGS	surface_glycoprotein(NC_045512:+:21563-25384)	1237-1256
		CCKF
6	271-275	ATLQA	linker	1-5
6	276-292	SAAYYVGYLQLRTFLL	surface_glycoprotein@Italy(NC_045512@Italy:+:	258-274
		K	21563-25384)
6	293-297	ATLQA	linker	1-5
6	298-305	YDPLQPEL	surface_glycoprotein(NC_045512:+:21563-25384)	1138-1145
6	306-310	ATLQA	linker	1-5
6	311-333	GKIQDSLFSTASALGK	surface_glycoprotein@NorthMacedonia	928-950
		LQDVVNQ	(NC_045512@NorthMacedonia:+:21563-25384)
6	334-338	ATLQA	linker	1-5
6	339-349	IEELFYSYATH	3′-to-5′_exonuclease(NC_045512:+:18040-19620)	363-373
6	350-354	ATLQA	linker	1-5
6	355-373	DKSAFVNLKQLPFFYY	3′-to-5′_exonuclease(NC_045512:+:18040-19620)	432-450
		SDS
6	374-378	ATLQA	linker	1-5
6	379-386	SVDCTMYI	surface_glycoprotein(NC_045512:+:21563-25384)	735-742
6	387-391	ATLQA	linker	1-5
6	392-404	NPVLPFNDGVYFA	surface_glycoprotein(NC_045512:+:21563-25384)	81-93
6	405-409	ATLQA	linker	1-5
6	410-418	AAAYYVGYL	surface_glycoprotein(NC_045512:+:21563-25384)	262-270
6	419-423	ATLQA	linker	1-5
6	424-450	FSASTSAFVETVKGLD	nsp2(NC_045512:+:806-2719)	300-326
		YKAFKQIVESC
6	451-455	ATLQA	linker	1-5
6	456-466	RFQLHRSYLTP	surface_glycoprotein@Austria	233-243
			(NC_045512@Austria:+:21563-25384)
6	467-471	ATLQA	linker	1-5
6	472-484	ANFCALILAYCNK	nsp3(NC_045512:+:2720-8554)	890-902
6	485-489	ATLQA	linker	1-5
6	490-502	WNVVRIKIVQMLS	3′-to-5′_exonuclease(NC_045512:+:18040-19620)	159-171
6	503-507	ATLQA	linker	1-5
6	508-521	SYLFQHANLDSCKR	nsp3(NC_045512:+:2720-8554)	915-928
6	522-526	ATLQA	linker	1-5
6	527-540	GFNCYFPLQPYGFQ	surface_glycoprotein@SmallSouthAmerica	481-494
			(NC_045512@SmallSouthAmerica:+:21563-25384)
6	541-545	ATLQA	linker	1-5
6	546-553	DSYFVVKR	RNA-dependent_RNA_polymerase	67-74
			(NC_045512:+:13442-13468+13468-16236)
6	554-558	ATLQA	linker	1-5
6	559-567	FFSNVTWFH	surface_glycoprotein(NC_045512:+:21563-25384)	58-66
6	568-572	ATLQA	linker	1-5
6	573-582	VMCGGSLYVK	RNA-dependent_RNA_polymerase	667-676
			(NC_045512:+:13442-13468+13468-16236)
6	583-587	ATLQA	linker	1-5
6	588-597	VTGLFKDCSK	3′-to-5′_exonuclease(NC_045512:+:18040-19620)	4-13
6	598-602	ATLQA	linker	1-5
6	603-623	AVLYQGVNCTEVPFAI	surface_glycoprotein@SmallAfrica	605-625
		HADQL	(NC_045512@SmallAfrica:+:21563-25384)
6	624-628	ATLQA	linker	1-5
6	629-639	VVNAANVYLKH	nsp3(NC_045512:+:2720-8554)	239-249

In certain embodiments, the vaccine comprises or expresses at least one of the concatemers of epitopes from SARS-COV-2 with intervening linker sequences (and as set forth in FIG. 17). In certain embodiments, the vaccine comprises or expresses at least two of the concatemers set forth below. In certain embodiments, the vaccine comprises or expresses three of the concatemers set forth below. In certain embodiments, the vaccine comprises or expresses four of the concatemers set forth below. In certain embodiments, the vaccine comprises or expresses five of the concatemers set forth below. In certain embodiments, the vaccine comprises or expresses all the concatemers set forth below.

TABLE 7
	pos_in_			pos_in_
concat	concat	epitope	gene	gene
1	1-20	IRRPFLCCKCCYDHVISTSH	helicase(NC_045512:+:16237-18039)	20-39
1	21-25	ATLQA	linker	1-5
1	26-39	SDRVVFVLWAHGFE	3′-to-5′_exonuclease(NC_045512:+:18040-19620)	178-191
1	40-44	ATLQA	linker	1-5
1	45-63	ANSVFNICQSVTANVNALL	RNA-dependent_RNA_polymerase@Croatia	690-708
			(NC_045512@Croatia:+:13442-13468+13468-16236)
1	64-68	ATLQA	linker	1-5
1	69-83	SYFAIGLALYYPSAR	helicase@Austria	289-303
			(NC_045512@Austria:+:16237-18039)
1	84-88	ATLQA	linker	1-5
1	89-98	VVADAVIKTL	nsp3(NC_045512:+:2720-8554)	56-65
1	99-103	ATLQA	linker	1-5
1	104-115	SSPDAVTAYNGY	nsp3(NC_045512:+:2720-8554)	660-671
1	116-120	ATLQA	linker	1-5
1	121-131	YELKHGTFTCA	nsp3(NC_045512:+:2720-8554)	996-1006
1	132-136	ATLQA	linker	1-5
1	137-147	EQYVFCTVNAL	helicase(NC_045512:+:16237-18039)	353-363
1	148-152	ATLQA	linker	1-5
1	153-172	SEAVEAPLVGTPVCINGLML	nsp2(NC_045512:+:806-2719)	591-610
1	173-177	ATLQA	linker	1-5
1	178-185	FNSVCRLM	helicase@Aruba(NC_045512@Aruba:+:16237-18039)	422-429
1	186-190	ATLQA	linker	1-5
1	191-206	SLRCGACIRRPFLCCK	helicase@Aruba(NC_045512@Aruba:+:16237-18039)	13-28
1	207-211	ATLQA	linker	1-5
1	212-232	KLSYGIAIVREVLSDRELHL	helicase@Colombia(NC_045512@Colombia:+:	146-166
		S	16237-18039)
1	233-237	ATLQA	linker	1-5
1	238-250	ANFCALILAYCNK	nsp3(NC_045512:+:2720-8554)	890-902
1	251-255	ATLQA	linker	1-5
1	256-267	NIGCNHTGVVGE	nsp2(NC_045512:+:806-2719)	250-261
1	268-272	ATLQA	linker	1-5
1	273-280	YDFVVSKG	RNA-dependent_RNA_polymerase@Japan	420-427
			(NC_045512@Japan:+:13442-13468+13468-16236)
1	281-285	ATLQA	linker	1-5
1	286-295	RHSLSHFVNL	nsp3(NC_045512:+:2720-8554)	1697-1706
1	296-300	ATLQA	linker	1-5
1	301-351	HFAIGLALYYPSARIVYTAC	helicase(NC_045512:+:16237-18039)	290-340
		SHAAVDALCEKALKYLPIDK
		CSRIIPARARV
1	352-356	ATLQA	linker	1-5
1	357-364	CLNRVCTN	nsp3(NC_045512:+:2720-8554)	1342-1349
1	365-369	ATLQA	linker	1-5
1	370-396	FSASTSAFVETVKGLDYKAF	nsp2(NC_045512:+:806-2719)	300-326
		KQIVESC
1	397-401	ATLQA	linker	1-5
1	402-411	FEYVSQPFLM	surface_glycoprotein@Aruba(NC_045512@Aruba:+:	164-173
			21563-25384)
1	412-416	ATLQA	linker	1-5
1	417-428	FRSSVLHSTQDL	surface_glycoprotein@Aruba(NC_045512@Aruba:+:	43-54
			21563-25384)
1	429-433	ATLQA	linker	1-5
1	434-446	AFASEAARVVRSI	nsp2(NC_045512:+:806-2719)	355-367
1	447-451	ATLQA	linker	1-5
1	452-471	PINLVRGLPQGFSALEPLVD	surface_glycoprotein@Austria	205-224
			(NC_045512@Austria:+:21563-25384)
1	472-476	ATLQA	linker	1-5
1	477-495	QVAVLYQDVNCTEVPVAIH	surface_glycoprotein@China	607-625
			(NC_045512@China:+:21563-25384)
1	496-500	ATLQA	linker	1-5
1	501-515	TISVTTEILPVSMAK	surface_glycoprotein@Mexico	719-733
			(NC_045512@Mexico:+:21563-25384)
1	516-520	ATLQA	linker	1-5
1	521-531	YDNLQFISLEI	helicase@Austria(NC_045512@Austria:+:	582-592
			16237-18039)
1	532-536	ATLQA	linker	1-5
1	537-555	KLNVGDYFVLTSHTVMPLS	helicase(NC_045512:+:16237-18039)	218-236
1	556-560	ATLQA	linker	1-5
1	561-568	SSNVANYQ	helicase@Austria(NC_045512@Austria:+:	263-270
			16237-18039)
1	569-573	ATLQA	linker	1-5
1	574-588	TYGVGYQPYRVVVLS	surface_glycoprotein@Australia	496-510
			(NC_045512@Australia:+:21563-25384)
1	589-593	ATLQA	linker	1-5
1	594-601	TDAVDCAL	surface_glycoprotein(NC_045512:+:21563-25384)	286-293
1	602-606	ATLQA	linker	1-5
1	607-629	GKIQDSLFSTASALGKLQDV	surface_glycoprotein@NorthMacedonia	928-950
		VNQ	(NC_045512@NorthMacedonia:+:21563-25384)
1	630-634	ATLQA	linker	1-5
1	635-643	SPDVDLADI	surface_glycoprotein@Chile	1161-1169
			(NC_045512@Chile:+:21563-25384)
1	644-648	ATLQA	linker	1-5
1	649-656	KLGASQRV	membrane_glycoprotein(NC_045512:+:26523-27191)	180-187
1	657-661	ATLQA	linker	1-5
1	662-669	AALQIPFA	surface_glycoprotein(NC_045512:+:21563-25384)	892-899
1	670-674	ATLQA	linker	1-5
1	675-685	HFPRKGVFVSN	surface_glycoprotein@SmallAsia	1078-1088
			(NC_045512@SmallAsia:+:21563-25384)
1	686-690	ATLQA	linker	1-5
1	691-702	FRSSVLHSTRDL	surface_glycoprotein@Nigeria	43-54
			(NC_045512@Nigeria:+:21563-25384)
1	703-707	ATLQA	linker	1-5
1	708-724	YADVFHLYLQYIRKLHD	RNA-dependent_RNA_polymerase(NC_045512:+:	877-893
			13442-13468+13468-16236)
1	725-729	ATLQA	linker	1-5
1	730-739	KSASVYYSQL	nsp3(NC_045512:+:2720-8554)	1737-1746
1	740-744	ATLQA	linker	1-5
1	745-760	ANSIVCRFDTRVLSNL	3′-to-5′_exonuclease(NC_045512:+:18040-19620)	394-409
1	761-765	ATLQA	linker	1-5
1	766-776	DNVLSTFISAA	nsp3(NC_045512:+:2720-8554)	1809-1819
1	777-781	ATLQA	linker	1-5
1	782-791	ARDLICAQKF	surface_glycoprotein(NC_045512:+:21563-25384)	846-855
2	1-8	QIGVVREF	helicase(NC_045512:+:16237-18039)	492-499
2	9-13	ATLQA	linker	1-5
2	14-24	KGVQIPCTCGK	nsp3(NC_045512:+:2720-8554)	963-973
2	25-29	ATLQA	linker	1-5
2	30-38	TENLLLYID	nsp3(NC_045512:+:2720-8554)	432-440
2	39-43	ATLQA	linker	1-5
2	44-56	GVNLVAVPTGYVD	3′-to-5′_exonuclease(NC_045512:+:18040-19620)	114-126
2	57-61	ATLQA	linker	1-5
2	62-70	AGFSLWVYK	3′-to-5′_exonuclease(NC_045512:+:18040-19620)	504-512
2	71-75	ATLQA	linker	1-5
2	76-107	IMASLVLARKHTTCCSLSHR	RNA-dependent_RNA_polymerase(NC_045512:+:	632-663
		FYRLANECAQVL	13442-13468+13468-16236)
2	108-112	ATLQA	linker	1-5
2	113-120	SINVANYQ	helicase@Mozambique	263-270
			(NC_045512@Mozambique:+:16237-18039)
2	121-125	ATLQA	linker	1-5
2	126-135	LSVNPYVCNA	helicase@Cyprus(NC_045512@Cyprus:+:16237-18039)	43-52
2	136-140	ATLQA	linker	1-5
2	141-148	KAVFISPY	helicase(NC_045512:+:16237-18039)	508-515
2	149-153	ATLQA	linker	1-5
2	154-163	NYQCGHYKHI	nsp3(NC_045512:+:2720-8554)	1012-1021
2	164-168	ATLQA	linker	1-5
2	169-179	AVHECFVKRVD	3′-to-5′_exonuclease(NC_045512:+:18040-19620)	281-291
2	180-184	ATLQA	linker	1-5
2	185-200	RKIFVDGVPFVVSTGY	RNA-dependent_RNA_polymerase(NC_045512:+:	331-346
			13442-13468+13468-16236)
2	201-205	ATLQA	linker	1-5
2	206-220	SYELQTPFEIKLAKK	nsp2(NC_045512:+:806-2719)	68-82
2	221-225	ATLQA	linker	1-5
2	226-233	GVYCCREH	nsp2(NC_045512:+:806-2719)	47-54
2	234-238	ATLQA	linker	1-5
2	239-256	IKVCEFQFCNDPFLGVYH	surface_glycoprotein@Aruba	125-142
			(NC_045512@Aruba:+:21563-25384)
2	257-261	ATLQA	linker	1-5
2	262-276	ERFVSLAIDAYPLTK	RNA-dependent_RNA_polymerase(NC_045512:+:	857-871
			13442-13468+13468-16236)
2	277-281	ATLQA	linker	1-5
2	282-301	YVYLPYPDPSRILGAGCFVD	RNA-dependent_RNA_polymerase(NC_045512:+:	826-845
			13442-13468+13468-16236)
2	302-306	ATLQA	linker	1-5
2	307-314	PEHSLAEY	nsp2(NC_045512:+:806-2719)	200-207
2	315-319	ATLQA	linker	1-5
2	320-330	LRIAGHHLGRC	membrane_glycoprotein(NC_045512:+:26523-27191)	149-159
2	331-335	ATLQA	linker	1-5
2	336-355	FCKLHNWNCVNCDTFCAGST	nsp3(NC_045512:+:2720-8554)	1626-1645
2	356-360	ATLQA	linker	1-5
2	361-368	IETISLAG	nsp3(NC_045512:+:2720-8554)	684-691
2	369-373	ATLQA	linker	1-5
2	374-384	SELVIGAVILR	membrane_glycoprotein(NC_045512:+:26523-27191)	136-146
2	385-389	ATLQA	linker	1-5
2	390-405	LQSLQTYVTQQLIRAA	surface_glycoprotein(NC_045512:+:21563-25384)	1001-1016
2	406-410	ATLQA	linker	1-5
2	411-423	RSVASQSIIAYTM	surface_glycoprotein@Aruba	681-693
			(NC_045512@Aruba:+:21563-25384)
2	424-428	ATLQA	linker	1-5
2	429-437	TEIYQAGST	surface_glycoprotein@Aruba	466-474
			(NC_045512@Aruba:+:21563-25384)
2	438-442	ATLQA	linker	1-5
2	443-456	EGVVDYGARFYFYT	nsp3(NC_045512:+:2720-8554)	595-608
2	457-461	ATLQA	linker	1-5
2	462-475	LVLLPLVSSQCVNF	surface_glycoprotein@Brazil	5-18
			(NC_045512@Brazil:+:21563-25384)
2	476-480	ATLQA	linker	1-5
2	481-489	AAAYYVGYL	surface_glycoprotein(NC_045512:+:21563-25384)	262-270
2	490-494	ATLQA	linker	1-5
2	495-503	VFSQCVNLT	surface_glycoprotein@Egypt	11-19
			(NC_045512@Egypt:+:21563-25384)
2	504-508	ATLQA	linker	1-5
2	509-520	FNCYFPLQSYGF	surface_glycoprotein(NC_045512:+:21563-25384)	486-497
2	521-525	ATLQA	linker	1-5
2	526-533	SLIDLQEL	surface_glycoprotein(NC_045512:+:21563-25384)	1196-1203
2	534-538	ATLQA	linker	1-5
2	539-553	INAACRKVQHMVVKA	3′-to-5′_exonuclease(NC_045512:+:18040-19620)	305-319
2	554-558	ATLQA	linker	1-5
2	559-568	SVLNDILARL	surface_glycoprotein@Aruba	971-980
			(NC_045512@Aruba:+:21563-25384)
2	569-573	ATLQA	linker	1-5
2	574-581	RVEAFEYY	nsp3(NC_045512:+:2720-8554)	810-817
2	582-586	ATLQA	linker	1-5
2	587-604	CANFNVLFSTVFPPTSFG	RNA-dependent_RNA_polymerase@China	310-327
			(NC_045512@China:+:13442-13468+13468-16236)
2	605-609	ATLQA	linker	1-5
2	610-623	GFNCYSPLQSYGFQ	surface_glycoprotein@Peru	485-498
			(NC_045512@Peru:+:21563-25384)
2	624-628	ATLQA	linker	1-5
2	629-646	LFVVEVVDKYFDCYDGGC	RNA-dependent_RNA_polymerase(NC_045512:+:	470-487
			13442-13468+13468-16236)
2	647-651	ATLQA	linker	1-5
2	652-661	GNCDVVIGIV	surface_glycoprotein(NC_045512:+:21563-25384)	1124-1133
2	662-666	ATLQA	linker	1-5
2	667-674	SVDCTMYI	surface_glycoprotein(NC_045512:+:21563-25384)	735-742
2	675-679	ATLQA	linker	1-5
2	680-687	NNLVVMAY	nsp2(NC_045512:+:806-2719)	413-420
2	688-692	ATLQA	linker	1-5
2	693-715	TIATYCTGSIPCSVCLSGLD	nsp3(NC_045512:+:2720-8554)	1459-1481
		SLD
2	716-720	ATLQA	linker	1-5
2	721-735	ARSVARQSIIAYTMS	surface_glycoprotein@Mozambique	680-694
			(NC_045512@Mozambique:+:21563-25384)
2	736-740	ATLQA	linker	1-5
2	741-751	IEELFYSYATH	3′-to-5′_exonuclease(NC_045512:+:18040-19620)	363-373
2	752-756	ATLQA	linker	1-5
2	757-765	EVFAQVKQI	surface_glycoprotein(NC_045512:+:21563-25384)	780-788
2	766-770	ATLQA	linker	1-5
2	771-778	EIYQAGSK	surface_glycoprotein@Mexico	471-478
			(NC_045512@Mexico:+:21563-25384)
2	779-783	ATLQA	linker	1-5
2	784-797	APGCDVTDVTQLYL	helicase@Aruba(NC_045512@Aruba:+:16237-18039)	52-65
3	1-12	VRTNVYLAVFDK	nsp3(NC_045512:+:2720-8554)	351-362
3	13-17	ATLQA	linker	1-5
3	18-40	NHDLYCQVHGNAHVASCDAI	3′-to-5′_exonuclease(NC_045512:+:18040-19620)	256-278
		MTR
3	41-45	ATLQA	linker	1-5
3	46-55	ISDYDYYRYN	RNA-dependent_RNA_polymerase@Aruba	450-459
			(NC_045512@Aruba:+:13442-13468+13468-16236)
3	56-60	ATLQA	linker	1-5
3	61-86	YRLANECAQVLSEMVMCGGS	RNA-dependent_RNA_polymerase@Australia	653-678
		LYVKPG	(NC_045512@Australia:+:13442-13468+13468-16236)
3	87-91	ATLQA	linker	1-5
3	92-99	SDDAVVCF	RNA-dependent_RNA_polymerase@Aruba	759-766
			(NC_045512@Aruba:+:13442-13468+13468-16236)
3	100-104	ATLQA	linker	1-5
3	105-112	FNSVCRFM	helicase@Malaysia(NC_045512@Malaysia:+:	422-429
			16237-18039)
3	113-117	ATLQA	linker	1-5
3	118-128	VVNAANVYLKH	nsp3(NC_045512:+:2720-8554)	239-249
3	129-133	ATLQA	linker	1-5
3	134-145	TRAKVGILCIMS	helicase(NC_045512:+:16237-18039)	566-577
3	146-150	ATLQA	linker	1-5
3	151-160	VQQESPFVMM	nsp3(NC_045512:+:2720-8554)	980-989
3	161-165	ATLQA	linker	1-5
3	166-188	YLGGMSYYCKSHKLPISFPL	helicase@CostaRica(NC_045512@CostaRica:+:	64-86
		CAN	16237-18039)
3	189-193	ATLQA	linker	1-5
3	194-205	VPVVDSYYSLLM	RNA-dependent_RNA_polymerase(NC_045512:+:	231-242
			13442-13468+13468-16236)
3	206-210	ATLQA	linker	1-5
3	211-220	VMCGGSLYVK	RNA-dependent_RNA_polymerase(NC_045512:+:	667-676
			13442-13468+13468-16236)
3	221-225	ATLQA	linker	1-5
3	226-247	INLVRDLPQGFSALEPLVDL	surface_glycoprotein@Aruba	206-227
		PI	(NC_045512@Aruba:+:21563-25384)
3	248-252	ATLQA	linker	1-5
3	253-268	TVLKKCKSAFYILPSI	nsp3(NC_045512:+:2720-8554)	526-541
3	269-273	ATLQA	linker	1-5
3	274-283	QEHYVRITGL	helicase(NC_045512:+:16237-18039)	243-252
3	284-288	ATLQA	linker	1-5
3	289-296	DSYFVVKR	RNA-dependent_RNA_polymerase(NC_045512:+:	67-74
			13442-13468+13468-16236)
3	297-301	ATLQA	linker	1-5
3	302-313	VTMPLGYVTHGL	nsp3(NC_045512:+:2720-8554)	628-639
3	314-318	ATLQA	linker	1-5
3	319-357	GCDVTDVTQLYLGGMSYYCK	helicase(NC_045512:+:16237-18039)	54-92
		SHKPPISFPLCANGQVFGL
3	358-362	ATLQA	linker	1-5
3	363-374	EVFAQVKQIYKT	surface_glycoprotein@Aruba	776-787
			(NC_045512@Aruba:+:21563-25384)
3	375-379	ATLQA	linker	1-5
3	380-398	ANSVFNICQAVTANVNALL	RNA-dependent_RNA_polymerase@Aruba	690-708
			(NC_045512@Aruba:+:13442-13468+13468-16236)
3	399-403	ATLQA	linker	1-5
3	404-413	KQYGDCLGNI	surface_glycoprotein@Jordan	831-840
			(NC_045512@Jordan:+:21563-25384)
3	414-418	ATLQA	linker	1-5
3	419-439	HPNCVNCLDDRCILHCANFN	RNA-dependent_RNA_polymerase@Australia	295-315
		V	(NC_045512@Australia:+:13442-13468+13468-16236)
3	440-444	ATLQA	linker	1-5
3	445-456	FSNVTWFHAIVS	surface_glycoprotein@Ghana	59-70
			(NC_045512@Ghana:+:21563-25384)
3	457-461	ATLQA	linker	1-5
3	462-472	KESVQTFFKLV	nsp2(NC_045512:+:806-2719)	492-502
3	473-477	ATLQA	linker	1-5
3	478-487	AGAALQIPFA	surface_glycoprotein@Nigeria	886-895
			(NC_045512@Nigeria:+:21563-25384)
3	488-492	ATLQA	linker	1-5
3	493-509	CSNLLLQYGSFCTQLNR	surface_glycoprotein(NC_045512:+:21563-25384)	749-765
3	510-514	ATLQA	linker	1-5
3	515-532	LNDLCFTNVYADSFVIRG	surface_glycoprotein(NC_045512:+:21563-25384)	387-404
3	533-537	ATLQA	linker	1-5
3	538-550	NFRVQPTESIVRF	surface_glycoprotein(NC_045512:+:21563-25384)	317-329
3	551-555	ATLQA	linker	1-5
3	556-569	RLNVGDYFVLTSHT	helicase@Austria(NC_045512@Austria:+:	218-231
			16237-18039)
3	570-574	ATLQA	linker	1-5
3	575-599	SDIDITFLKKDAPYIVGDVV	nsp3(NC_045512:+:2720-8554)	454-478
		QEGVL
3	600-604	ATLQA	linker	1-5
3	605-620	DKYVRNLQHRLYECLY	RNA-dependent_RNA_polymerase@Aruba	717-732
			(NC_045512@Aruba:+:13442-13468+13468-16236)
3	621-625	ATLQA	linker	1-5
3	626-639	GFNCYFPLQPYGFQ	surface_glycoprotein@SmallSouthAmerica	481-494
			(NC_045512@SmallSouthAmerica:+:21563-25384)
3	640-644	ATLQA	linker	1-5
3	645-661	SAAYYVGYLQLRTFLLK	surface_glycoprotein@Italy	258-274
			(NC_045512@Italy:+:21563-25384)
3	662-666	ATLQA	linker	1-5
3	667-687	ALCEKALKYFPIDKCSRIIP	helicase@Colombia(NC_045512@Colombia:+:	316-336
		A	16237-18039)
3	688-692	ATLQA	linker	1-5
3	693-706	IKVCEFQFCNDPYY	surface_glycoprotein@CostaRica	128-141
			(NC_045512@CostaRica:+:21563-25384)
3	707-711	ATLQA	linker	1-5
3	712-731	GYLPQNAVVKIYCPACHNSE	nsp2(NC_045512:+:806-2719)	178-197
3	732-736	ATLQA	linker	1-5
3	737-744	AEVQIDRL	surface_glycoprotein(NC_045512:+:21563-25384)	989-996
3	745-749	ATLQA	linker	1-5
3	750-760	YDKLQFTSLEI	helicase@Aruba(NC_045512@Aruba:+:16237-18039)	582-592
3	761-765	ATLQA	linker	1-5
3	766-784	LEILDITPCSFGGVSVITP	surface_glycoprotein(NC_045512:+:21563-25384)	582-600
3	785-789	ATLQA	linker	1-5
3	790-804	TYACWHHSIGFDYVY	3′-to-5′_exonuclease(NC_045512:+:18040-19620)	223-237
4	1-11	YDKLQFISLEI	helicase@SouthAfrica(NC_045512@SouthAfrica:+:	582-592
			16237-18039)
4	12-16	ATLQA	linker	1-5
4	17-24	LPINVIVF	nsp3(NC_045512:+:2720-8554)	1718-1725
4	25-29	ATLQA	linker	1-5
4	30-47	SQHTMLVKQGDDYVYLPY	RNA-dependent_RNA_polymerase@Aruba	814-831
			(NC_045512@Aruba:+:13442-13468+13468-16236)
4	48-52	ATLQA	linker	1-5
4	53-66	IRNLQHRLYECLYR	RNA-dependent_RNA_polymerase@Austria	720-733
			(NC_045512@Austria:+:13442-13468+13468-16236)
4	67-71	ATLQA	linker	1-5
4	72-82	RQALLKTVQFC	RNA-dependent_RNA_polymerase@Aruba	183-193
			(NC_045512@Aruba:+:13442-13468+13468-16236)
4	83-87	ATLQA	linker	1-5
4	88-95	YDKLVSSF	nsp3(NC_045512:+:2720-8554)	365-372
4	96-100	ATLQA	linker	1-5
4	101-112	AKLLHKPIVWHV	nsp3(NC_045512:+:2720-8554)	1165-1176
4	113-117	ATLQA	linker	1-5
4	118-131	SYLFQHANLDSCKR	nsp3(NC_045512:+:2720-8554)	915-928
4	132-136	ATLQA	linker	1-5
4	137-145	YDLSVVNAR	helicase(NC_045512:+:16237-18039)	382-390
4	146-150	ATLQA	linker	1-5
4	151-158	ARDLSLQF	nsp3(NC_045512:+:2720-8554)	1652-1659
4	159-163	ATLQA	linker	1-5
4	164-181	IKDLPKEITVATSRTLSY	membrane_glycoprotein(NC_045512:+:26523-27191)	161-178
4	182-186	ATLQA	linker	1-5
4	187-201	FKELLVYAADPAMHA	RNA-dependent_RNA_polymerase(NC_045512:+:	368-382
			13442-13468+13468-16236)
4	202-206	ATLQA	linker	1-5
4	207-219	KASCTLSEQLDFI	nsp2(NC_045512:+:806-2719)	30-42
4	220-224	ATLQA	linker	1-5
4	225-232	DMYSVMLT	RNA-dependent_RNA_polymerase@Malaysia	901-908
			(NC_045512@Malaysia:+:13442-13468+13468-16236)
4	233-237	ATLQA	linker	1-5
4	238-252	YNLLKGCPAVAKHDF	RNA-dependent_RNA_polymerase@Poland	87-101
			(NC_045512@Poland:+:13442-13468+13468-16236)
4	253-257	ATLQA	linker	1-5
4	258-273	VREVLSDRELHLSWEV	helicase(NC_045512:+:16237-18039)	154-169
4	274-278	ATLQA	linker	1-5
4	279-286	STFKCYGV	surface_glycoprotein@Aruba	371-378
			(NC_045512@Aruba:+:21563-25384)
4	287-291	ATLQA	linker	1-5
4	292-305	ANPVLPFNDGVYFA	surface_glycoprotein@Austria	77-90
			(NC_045512@Austria:+:21563-25384)
4	306-310	ATLQA	linker	1-5
4	311-326	FRELGVVHNQDVNLHS	RNA-dependent_RNA_polymerase(NC_045512:+:	348-363
			13442-13468+13468-16236)
4	327-331	ATLQA	linker	1-5
4	332-354	SHGKQVVSDIDYVPLKSATC	3′-to-5′_exonuclease(NC_045512:+:18040-19620)	454-476
		ITR
4	355-359	ATLQA	linker	1-5
4	360-372	YAKPFLNKVVSTT	nsp3(NC_045512:+:2720-8554)	1323-1335
4	373-377	ATLQA	linker	1-5
4	378-396	DKSAFVNLKQLPFFYYSDS	3′-to-5′_exonuclease(NC_045512:+:18040-19620)	432-450
4	397-401	ATLQA	linker	1-5
4	402-418	PNFVFPLNSIIKTIQPR	nsp2(NC_045512:+:806-2719)	91-107
4	419-423	ATLQA	linker	1-5
4	424-431	REGVFVSN	surface_glycoprotein@Aruba	1087-1094
			(NC_045512@Aruba:+:21563-25384)
4	432-436	ATLQA	linker	1-5
4	437-446	GTNLPLQLGF	3′-to-5′_exonuclease(NC_045512:+:18040-19620)	102-111
4	447-451	ATLQA	linker	1-5
4	452-473	GYQPYRVVVLSFELLHAPAT	surface_glycoprotein(NC_045512:+:21563-25384)	504-525
		VC
4	474-478	ATLQA	linker	1-5
4	479-501	LIAIVMVTIMLCCITSCCSC	surface_glycoprotein@Mozambique	1220-1242
		LKG	(NC_045512@Mozambique:+:21563-25384)
4	502-506	ATLQA	linker	1-5
4	507-518	TRAKVGILCITS	helicase@SouthKorea(NC_045512@SouthKorea:+:	566-577
			16237-18039)
4	519-523	ATLQA	linker	1-5
4	524-531	PSFLGRYM	nsp3(NC_045512:+:2720-8554)	822-829
4	532-536	ATLQA	linker	1-5
4	537-544	YDPLQPEL	surface_glycoprotein(NC_045512:+:21563-25384)	1138-1145
4	545-549	ATLQA	linker	1-5
4	550-565	FLVLLPLVSSQCVNLT	surface_glycoprotein@Aruba(NC_045512@Aruba:+:	4-19
			21563-25384)
4	566-570	ATLQA	linker	1-5
4	571-579	EPLLKGVKL	surface_glycoprotein@Croatia	1258-1266
			(NC_045512@Croatia:+:21563-25384)
4	580-584	ATLQA	linker	1-5
4	585-594	TQNVLYENQK	surface_glycoprotein(NC_045512:+:21563-25384)	912-921
4	595-599	ATLQA	linker	1-5
4	600-613	ETKCTLKSFTVEKG	surface_glycoprotein@Aruba	294-307
			(NC_045512@Aruba:+:21563-25384)
4	614-618	ATLQA	linker	1-5
4	619-634	FLVLLPLVSIQCVNLT	surface_glycoprotein@SmallNorthAmerica	4-19
			(NC_045512@SmallNorthAmerica:+:21563-25384)
4	635-639	ATLQA	linker	1-5
4	640-651	FQTLLHRSYLTP	surface_glycoprotein@SmallAsia	230-241
			(NC_045512@SmallAsia:+:21563-25384)
4	652-656	ATLQA	linker	1-5
4	657-676	MTSCCSCLKGCCSCGSCCKF	surface_glycoprotein(NC_045512:+:21563-25384)	1237-1256
4	677-681	ATLQA	linker	1-5
4	682-691	NEFYAYLRKH	RNA-dependent_RNA_polymerase	743-752
			(NC_045512:+:13442-13468+13468-16236)
4	692-696	ATLQA	linker	1-5
4	697-706	KCAYWVPRAS	nsp2(NC_045512:+:806-2719)	239-248
4	707-711	ATLQA	linker	1-5
4	712-723	ISVTTEILPVSM	surface_glycoprotein(NC_045512:+:21563-25384)	720-731
4	724-728	ATLQA	linker	1-5
4	729-738	VTGLFKDCSK	3′-to-5′_exonuclease(NC_045512:+:18040-19620)	4-13
4	739-743	ATLQA	linker	1-5
4	744-757	SVASQSIIAYTMSL	surface_glycoprotein@Austria	678-691
			(NC_045512@Austria:+:21563-25384)
4	758-762	ATLQA	linker	1-5
4	763-777	RTCCLCDRRATCFST	3′-to-5′_exonuclease(NC_045512:+:18040-19620)	205-219
4	778-782	ATLQA	linker	1-5
4	783-793	FFSNVTWFHVS	surface_glycoprotein@Nigeria	58-68
			(NC_045512@Nigeria:+:21563-25384)
5	1-22	LGGMSYYCKSHKPSISFPLC	helicase@NewZealand(NC_045512@NewZealand:+:	65-86
		AN	16237-18039)
5	23-27	ATLQA	linker	1-5
5	28-37	DPIHSLRVCV	nsp3(NC_045512:+:2720-8554)	339-348
5	38-42	ATLQA	linker	1-5
5	43-50	YDFAVSKG	RNA-dependent_RNA_polymerase@Aruba	420-427
			(NC_045512@Aruba:+:13442-13468+13468-16236)
5	51-55	ATLQA	linker	1-5
5	56-63	FKLASHMY	nsp3(NC_045512:+:2720-8554)	96-103
5	64-68	ATLQA	linker	1-5
5	69-76	DQDVLFAY	RNA-dependent_RNA_polymerase@FrenchGuiana	523-530
			(NC_045512@FrenchGuiana:+:
			13442-13468+13468-16236)
5	77-81	ATLQA	linker	1-5
5	82-90	ASQGLVASI	RNA-dependent_RNA_polymerase@Aruba	771-779
			(NC_045512@Aruba:+:13442-13468+13468-16236)
5	91-95	ATLQA	linker	1-5
5	96-115	KLTCATTRQVVNVVTTKIAL	nsp3(NC_045512:+:2720-8554)	1923-1942
5	116-120	ATLQA	linker	1-5
5	121-129	SRELKVTFF	nsp3(NC_045512:+:2720-8554)	1134-1142
5	130-134	ATLQA	linker	1-5
5	135-144	DVVAIDYKHY	nsp3(NC_045512:+:2720-8554)	1148-1157
5	145-149	ATLQA	linker	1-5
5	150-159	ACIDCSARHI	nsp3(NC_045512:+:2720-8554)	1872-1881
5	160-164	ATLQA	linker	1-5
5	165-174	KACVEEVTTT	nsp3(NC_045512:+:2720-8554)	415-424
5	175-179	ATLQA	linker	1-5
5	180-193	RNLQHRLYECLYRN	RNA-dependent_RNA_polymerase(NC_045512:+:	721-734
5	194-198	ATLQA	linker13442-13468+13468-16236)	1-5
5	199-208	SVELKHFFFA	RNA-dependent_RNA_polymerase(NC_045512:+:	434-443
			13442-13468+13468-16236)
5	209-213	ATLQA	linker	1-5
5	214-230	AQSFLNRVCGVSAARLT	RNA-dependent_RNA_polymerase(NC_045512:+:	4-20
			13442-13468+13468-16236)
5	231-235	ATLQA	linker	1-5
5	236-250	QIELKFNPPALQDAY	nsp3(NC_045512:+:2720-8554)	867-881
5	251-255	ATLQA	linker	1-5
5	256-270	HYVRITGLYPTLNIL	helicase@Indonesia(NC_045512@Indonesia:+:	245-259
			16237-18039)
5	271-275	ATLQA	linker	1-5
5	276-288	IVKFISTCACEIV	nsp2(NC_045512:+:806-2719)	468-480
5	289-293	ATLQA	linker	1-5
5	294-313	DDRCILHCANFNVLFSTVFP	RNA-dependent_RNA_polymerase(NC_045512:+:	303-322
			13442-13468+13468-16236)
5	314-318	ATLQA	linker	1-5
5	319-338	LQKAAITILDGISQYSLRLI	nsp2(NC_045512:+:806-2719)	382-401
5	339-343	ATLQA	linker	1-5
5	344-374	YIWLGFIAGLIAIVMVTIML	surface_glycoprotein@Aruba(NC_045512@Aruba:+:	1211-1241
		CCMTSCCSCLK	21563-25384)
5	375-379	ATLQA	linker	1-5
5	380-398	AIPINFTISVTTEILPVSM	surface_glycoprotein@Aruba(NC_045512@Aruba:+:	709-727
			21563-25384)
5	399-403	ATLQA	linker	1-5
5	404-412	FFSNVTWFH	surface_glycoprotein(NC_045512:+:21563-25384)	58-66
5	413-417	ATLQA	linker	1-5
5	418-432	RIIPARARVECFDKF	helicase@Aruba(NC_045512@Aruba:+:16237-18039)	332-346
5	433-437	ATLQA	linker	1-5
5	438-448	RFQLHRSYLTP	surface_glycoprotein@Austria	233-243
			(NC_045512@Austria:+:21563-25384)
5	449-453	ATLQA	linker	1-5
5	454-477	PINLVRDLPQGFSVLEPLVD	surface_glycoprotein@Belgium	205-228
		LPIG	(NC_045512@Belgium:+:21563-25384)
5	478-482	ATLQA	linker	1-5
5	483-498	FSNVTWFHAIHVSGTN	surface_glycoprotein@Peru(NC_045512@Peru:+:	59-74
			21563-25384)
5	499-503	ATLQA	linker	1-5
5	504-511	TDVVYRAF	RNA-dependent_RNA_polymerase@Aruba	28-35
			(NC_045512@Aruba:+:13442-13468+13468-16236)
5	512-516	ATLQA	linker	1-5
5	517-529	NPVLPFNDGVYFA	surface_glycoprotein(NC_045512:+:21563-25384)	81-93
5	530-534	ATLQA	linker	1-5
5	535-547	AIKCVPQADVEWK	3′-to-5′_exonuclease(NC_045512:+:18040-19620)	337-349
5	548-552	ATLQA	linker	1-5
5	553-565	ATNVVIKVCEFQF	surface_glycoprotein(NC_045512:+:21563-25384)	123-135
5	566-570	ATLQA	linker	1-5
5	571-593	RVDFCGKGYHLMSFPQSAPH	surface_glycoprotein(NC_045512:+:21563-25384)	1039-1061
		GVV
5	594-598	ATLQA	linker	1-5
5	599-613	EFQFCNYPFLGVYHK	surface_glycoprotein@Norway	129-143
			(NC_045512@Norway:+:21563-25384)
5	614-618	ATLQA	linker	1-5
5	619-639	AVLYQGVNCTEVPFAIHADQ	surface_glycoprotein@SmallAfrica	605-625
		L	(NC_045512@SmallAfrica:+:21563-25384)
5	640-644	ATLQA	linker	1-5
5	645-656	HEFCSQHTMLVK	RNA-dependent_RNA_polymerase(NC_045512:+:	810-821
			13442-13468+13468-16236)
5	657-661	ATLQA	linker	1-5
5	662-677	EEIIYNLLKDCPAVAK	RNA-dependent_RNA_polymerase@Senegal	83-98
			(NC_045512@Senegal:+:13442-13468+13468-16236)
5	678-682	ATLQA	linker	1-5
5	683-694	ALGKLQDVVNQN	surface_glycoprotein(NC_045512:+:21563-25384)	944-955
5	695-699	ATLQA	linker	1-5
5	700-722	TQLYLGGMSYYCKPHKPPIS	helicase@Iceland(NC_045512@Iceland:+:	61-83
		FPL	16237-18039)
5	723-727	ATLQA	linker	1-5
5	728-738	VLYQGVNCTEV	surface_glycoprotein@Aruba	606-616
			(NC_045512@Aruba:+:21563-25384)
5	739-743	ATLQA	linker	1-5
5	744-753	FCLEASFNYL	nsp3(NC_045512:+:2720-8554)	1391-1400
5	754-758	ATLQA	linker	1-5
5	759-766	PVLKGVKL	surface_glycoprotein@Aruba	1259-1266
			(NC_045512@Aruba:+:21563-25384)
5	767-771	ATLQA	linker	1-5
5	772-779	FTGCVIAW	surface_glycoprotein(NC_045512:+:21563-25384)	429-436
5	780-784	ATLQA	linker	1-5
5	785-794	KQYGDCLGDI	surface_glycoprotein(NC_045512:+:21563-25384)	835-844
6	1-18	YNLLKDCPAVAKHDFFKF	RNA-dependent_RNA_polymerase@Aruba	87-104
			(NC_045512@Aruba:+:13442-13468+13468-16236)
6	19-23	ATLQA	linker	1-5
6	24-44	HPNCVNCSDDRCILHCANFN	RNA-dependent_RNA_polymerase@Aruba	295-315
		V	(NC_045512@Aruba:+:13442-13468+13468-16236)
6	45-49	ATLQA	linker	1-5
6	50-58	ASQGLLASI	RNA-dependent_RNA_polymerase@Austria	771-779
			(NC_045512@Austria:+:13442-13468+13468-16236)
6	59-63	ATLQA	linker	1-5
6	64-80	VPQEHYVRITGLYPTLN	helicase@Aruba(NC_045512@Aruba:+:16237-18039)	241-257
6	81-85	ATLQA	linker	1-5
6	86-95	ETFVTHSKGL	nsp2(NC_045512:+:806-2719)	527-536
6	96-100	ATLQA	linker	1-5
6	101-117	LECNVKTTEVVGDIILK	nsp3(NC_045512:+:2720-8554)	1244-1260
6	118-122	ATLQA	linker	1-5
6	123-136	TKDVVECLKLSHQS	nsp3(NC_045512:+:2720-8554)	1830-1843
6	137-141	ATLQA	linker	1-5
6	142-151	GVITHDVSSA	helicase(NC_045512:+:16237-18039)	478-487
6	152-156	ATLQA	linker	1-5
6	157-165	MPVCVETKA	nsp3(NC_045512:+:2720-8554)	571-579
6	166-170	ATLQA	linker	1-5
6	171-184	TCFSVAALTNNVAF	RNA-dependent_RNA_polymerase@Aruba	394-407
			(NC_045512@Aruba:+:13442-13468+13468-16236)
6	185-189	ATLQA	linker	1-5
6	190-205	SRIIPARARVDCFDKF	helicase@Brazil(NC_045512@Brazil:+:16237-18039)	331-346
6	206-210	ATLQA	linker	1-5
6	211-219	RSVYPVASP	nsp2(NC_045512:+:806-2719)	121-129
6	220-224	ATLQA	linker	1-5
6	225-242	CANFNVLFSTVFPFTSFG	RNA-dependent_RNA_polymerase@Nigeria	310-327
			(NC_045512@Nigeria:+:13442-13468+13468-16236)
6	243-247	ATLQA	linker	1-5
6	248-261	LKEILVTYNCCDDD	RNA-dependent_RNA_polymerase(NC_045512:+:	142-155
			13442-13468+13468-16236)
6	262-266	ATLQA	linker	1-5
6	267-288	SQHTMLVKQFDDYVYLPYPD	RNA-dependent_RNA_polymerase@Estonia	814-835
		PS	(NC_045512@Estonia:+:13442-13468+13468-16236)
6	289-293	ATLQA	linker	1-5
6	294-301	MADLVYAL	RNA-dependent_RNA_polymerase(NC_045512:+:	124-131
			13442-13468+13468-16236)
6	302-306	ATLQA	linker	1-5
6	307-315	VTANVNALL	RNA-dependent_RNA_polymerase(NC_045512:+:	700-708
			13442-13468+13468-16236)
6	316-320	ATLQA	linker	1-5
6	321-340	RAKHYVYIGDPAQLPAPRTL	helicase(NC_045512:+:16237-18039)	392-411
6	341-345	ATLQA	linker	1-5
6	346-358	WNVVRIKIVQMLS	3′-to-5′_exonuclease(NC_045512:+:18040-19620)	159-171
6	359-363	ATLQA	linker	1-5
6	364-383	FPQSAPHGVVFLHVTYVPAQ	surface_glycoprotein@Aruba(NC_045512@Aruba:+:	1048-1067
			21563-25384)
6	384-388	ATLQA	linker	1-5
6	389-403	ISNCVADYSVLYNSA	surface_glycoprotein@Aruba(NC_045512@Aruba:+:	354-368
			21563-25384)
6	404-408	ATLQA	linker	1-5
6	409-424	TGLHPTQAPTHLSVDT	3′-to-5′_exonuclease(NC_045512:+:18040-19620)	16-31
6	425-429	ATLQA	linker	1-5
6	430-443	FFSNVTWFHAIHVS	surface_glycoprotein@Bangladesh	58-71
			(NC_045512@Bangladesh:+:21563-25384)
6	444-448	ATLQA	linker	1-5
6	449-461	ISSVLNDILSRLD	surface_glycoprotein@Bangladesh	972-984
			(NC_045512@Bangladesh:+:21563-25384)
6	462-466	ATLQA	linker	1-5
6	467-481	EFQFCNDPFLGVYYH	surface_glycoprotein@Chile	132-146
			(NC_045512@Chile:+:21563-25384)
6	482-486	ATLQA	linker	1-5
6	487-501	FSVAALTNNVAFQTV	RNA-dependent_RNA_polymerase(NC_045512:+:	396-410
			13442-13468+13468-16236)
6	502-506	ATLQA	linker	1-5
6	507-519	LLNVPLHGTILTR	membrane_glycoprotein(NC_045512:+:26523-27191)	119-131
6	520-524	ATLQA	linker	1-5
6	525-543	ECAQVLSETVMCGGSLYVK	RNA-dependent_RNA_polymerase@Aruba	658-676
			(NC_045512@Aruba:+:13442-13468+13468-16236)
6	544-548	ATLQA	linker	1-5
6	549-564	GSNVFQTRAGCLIGAE	surface_glycoprotein(NC_045512:+:21563-25384)	639-654
6	565-569	ATLQA	linker	1-5
6	570-579	SSVLHSTQDF	surface_glycoprotein@Norway	45-54
			(NC_045512@Norway:+:21563-25384)
6	580-584	ATLQA	linker	1-5
6	585-610	YRLANECAQVLSEIVMCGGS	RNA-dependent_RNA_polymerase@Canada	653-678
		LYVKPG	(NC_045512@Canada:+:13442-13468+13468-16236)
6	611-615	ATLQA	linker	1-5
6	616-637	NVVIKVCEFQFCNYPFLGVY	surface_glycoprotein@Brazil	125-146
		YH	(NC_045512@Brazil:+:21563-25384)
6	638-642	ATLQA	linker	1-5
6	643-654	YPSLETIQITIS	nsp3(NC_045512:+:2720-8554)	1483-1494
6	655-659	ATLQA	linker	1-5
6	660-673	TSGVGYQPYRVVVL	surface_glycoprotein@Aruba	496-509
			(NC_045512@Aruba:+:21563-25384)
6	674-678	ATLQA	linker	1-5
6	679-693	VNCTEVPVAIHADQL	surface_glycoprotein(NC_045512:+:21563-25384)	615-629
6	694-698	ATLQA	linker	1-5
6	699-706	ISNCVADY	surface_glycoprotein(NC_045512:+:21563-25384)	358-365
6	707-711	ATLQA	linker	1-5
6	712-723	IEVQGYKSVNIT	nsp3(NC_045512:+:2720-8554)	13-24
6	724-728	ATLQA	linker	1-5
6	729-742	FGTVYEKLKPVLDW	nsp2(NC_045512:+:806-2719)	437-450
6	743-747	ATLQA	linker	1-5
6	748-762	AYYVGYLQPRTFLLK	surface_glycoprotein@Aruba	260-274
			(NC_045512@Aruba:+:21563-25384)
6	763-767	ATLQA	linker	1-5
6	768-787	PINLVRGLPQGFSVLEPLVD	surface_glycoprotein@SmallAfrica	209-228
			(NC_045512@SmallAfrica:+:21563-25384)
6	788-792	ATLQA	linker	1-5
6	793-805	FQTLLALHRSYLT	surface_glycoprotein@Aruba	234-246
			(NC_045512@Aruba:+:21563-25384)

In certain embodiments, the vaccine comprises or expresses at least one of the concatemers of epitopes from SARS-COV-2 with intervening linker sequences (and as set forth in FIG. 18). In certain embodiments, the vaccine comprises or expresses at least two of the concatemers set forth below. In certain embodiments, the vaccine comprises or expresses three of the concatemers set forth below. In certain embodiments, the vaccine comprises or expresses four of the concatemers set forth below. In certain embodiments, the vaccine comprises or expresses five of the concatemers set forth below. In certain embodiments, the vaccine comprises or expresses all the concatemers set forth below.

TABLE 8
concatemer	pos_in_concatemer	epitope	gebe	pos_in_gene
1	1-8	TQALLQRQ	nucleocapsid_phosphoprotein@CostaRica(NC_045512@CostaRica: + :	379-386
			28274-29533)
1	9-13	ATLQA linker 1-5
1	14-28	AYYVGYLQPRTFLLK	surface_glycoprotein@Aruba(NC_045512@Aruba: + : 21563-25384)	260-274
1	29-33	ATLQA linker 1-5
1	34-45	FRSSVLHSTQDL	surface_glycoprotein@Aruba(NC_045512@Aruba: + : 21563-25384)	43-54
1	46-50	ATLQA linker 1-5
1	51-58	PVLKGVKL	surface_glycoprotein@Aruba(NC_045512@Aruba: + : 21563-25384)	1259-1266
1	59-63	ATLQA linker 1-5
1	64-76	SMWALIISVTSNY	nsp6@Aruba(NC_045512@Aruba: + : 10973-11842)	160-172
1	77-81	ATLQA linker 1-5
1	82-100	QLSLSKGFHFVCNLLLFV	ORF3a_protein@Estonia(NC_045512@Estonia: + : 25393-26220)	70-88
1	101-105	ATLQA linker 1-5
1	106-114	ISEHDYHIG	ORF3a_protein@NorthMacedonia(NC_045512@NorthMacedonia: + : 25393-26220)	179-187
1	115-119	ATLQA linker 1-5
1	120-129	PFTINCQEPK	ORF8_protein@India(NC_045512@India: + : 27894-28259)	85-94
1	130-134	ATLQA linker 1-5
1	135-142	WFTALTQH	nucleocapsid_phosphoprotein(NC_045512: + : 28274-29533)	52-59
1	143-147	ATLQA linker 1-5
1	148-156	YGIIWVATE	nucleocapsid_phosphoprotein@SmallSouthAmerica(NC_045512@	128-136
			SmallSouthAmerica: + : 28274-29533)
1	157-161	ATLQA linker 1-5
1	162-203	TTVAAFHQECSLQSCTQHQPYVVDDPCPIHFY	ORF8_protein@Bangladesh(NC_045512@Bangladesh: + : 27894-28259)	11-52
		SKWYIRVGAR
1	204-208	ATLQA linker 1-5
1	209-222	RLTLGVYDYLVSTQ	nsp6(NC_045512: + : 10973-11842)	236-249
1	223-227	ATLQA linker 1-5
1	228-242	VCNLLLLFVTVYSHL	ORF3a_protein@Croatia(NC_045512@Croatia: + : 25393-26220)	80-94
1	243-247	ATLQA linker 1-5
1	248-255	ISEHDYQI	ORF3a_protein@Aruba(NC_045512@Aruba: + : 25393-26220)	179-186
1	256-260	ATLQA linker 1-5
1	261-275	YFTSDYYQLYSTQLI	ORF3a_protein@Indonesia(NC_045512@Indonesia: + : 25393-26220)	206-220
1	276-280	ATLQA linker 1-5
1	281-289	AAAYYVGYL	surface_glycoprotein(NC_045512: + : 21563-25384)	262-270
1	290-294	ATLQA linker 1-5
1	295-304	GLKLKDCVMY	nsp6@Peru(NC_045512@Peru: + : 10973-11842)	107-116
1	305-309	ATLQA linker 1-5
1	310-318	VFSQCVNLT	surface_glycoprotein@Egypt(NC_045512@Egypt: + : 21563-25384)	11-19
1	319-323	ATLQA linker 1-5
1	324-344	AVLYQGVNCTEVPFAIHADQL	surface_glycoprotein@SmallAfrica(NC_045512@SmallAfrica: + : 21563-25384)	605-625
1	345-349	ATLQA linker 1-5
1	350-372	GKIQDSLFSTASALGKLQDVVNQ	surface_glycoprotein@NorthMacedonia(NC_045512@NorthMacedonia: + :	928-950
			21563-25384)
1	373-377	ATLQA linker 1-5
1	378-395	IKVCEFQFCNDPFLGVYH	surface_glycoprotein@Aruba(NC_045512@Aruba: + : 21563-25384)	125-142
1	396-400	ATLQA linker 1-5
1	401-408	KLGASQRV	membrane_glycoprotein(NC_045512: + : 26523-27191)	180-187
1	409-413	ATLQA linker 1-5
1	414-421	FTGCVIAW	surface_glycoprotein(NC_045512: + : 21563-25384)	429-436
1	422-426	ATLQA linker 1-5
1	427-438	FRSSVLHSTRDL	surface_glycoprotein@Nigeria(NC_045512@Nigeria: + : 21563-25384)	43-54
1	439-443	ATLQA linker 1-5
1	444-460	EVTPSGTWLTYTGAIKL	nucleocapsid_phosphoprotein@Bulgaria(NC_045512@Bulgaria: + :	323-339
			28274-29533)
1	461-465	ATLQA linker 1-5
1	466-476	VLYQGVNCTEV	surface_glycoprotein@Aruba(NC_045512@Aruba: + : 21563-25384)	606-616
1	477-481	ATLQA linker 1-5
1	482-491	SSVLHSTQDF	surface_glycoprotein@Norway(NC_045512@Norway: + : 21563-25384)	45-54
1	492-496	ATLQA linker 1-5
1	497-513	ILLNKHIDAYKTFPPIE	nucleocapsid_phosphoprotein@Chile(NC_045512@Chile: + : 28274-29533)	351-367
1	514-518	ATLQA linker 1-5
1	519-529	SPGVFNPVMEP	ORF3a_protein@Colombia(NC_045512@Colombia: + : 25393-26220)	252-262
1	530-534	ATLQA linker 1-5
1	535-542	ISNCVADY	surface_glycoprotein(NC_045512: + : 21563-25384)	358-365
1	543-547	ATLQA linker 1-5
1	548-569	IAMACLVGLMWLSYFIASFRLF	membrane_glycoprotein@Aruba(NC_045512@Aruba: + : 26523-27191)	82-103
1	570-574	ATLQA linker 1-5
1	575-589	IPIRASLPFGWLIVG	ORF3a_protein@Iceland(NC_045512@Iceland: + : 25393-26220)	35-49
1	590-594	ATLQA linker 1-5
1	595-606	FQTLLHRSYLTP	surface_glycoprotein@SmallAsia(NC_045512@SmallAsia: + : 21563-25384)	230-241
1	607-611	ATLQA linker 1-5
1	612-632	ELVIGAVILRGHLRIAGHHLG	membrane_glycoprotein@Aruba(NC_045512@Aruba: + : 26523-27191)	137-157
1	633-637	ATLQA linker 1-5
1	638-652	TISVTTEILPVSMAK	membrane_glycoprotein@Mexico(NC_045512@Mexico: + : 26523-27191)	719-733
2	1-37	VAAGLEAPFLYLYALVYFLQSINFVRIIMRLW	ORF3a_protein@Aruba(NC_045512@Aruba: + : 25393-26220)	97-133
		LCWKC
2	38-42	ATLQA linker 1-5
2	43-53	LRIAGHHLGRC	membrane_glycoprotein(NC_045512: + : 26523-27191)	149-159
2	54-58	ATLQA linker 1-5
2	59-72	FFSNVTWFHAIHVS	surface_glycoprotein@Bangledesh(NC_045512@Bangledesh: + : 21563-25384)	58-71
2	73-77	ATLQA linker 1-5
2	78-86	SPDVDLADI	surface_glycoprotein@Chile(NC_045512@Chile: + : 21563-25384)	1161-1169
2	87-91	ATLQA linker 1-5
2	92-111	FPQSAPHGVVFLHVTYVPAQ	surface_glycoprotein@Aruba(NC_045512@Aruba: + : 21563-25384)	1048-1067
2	112-116	ATLQA linker 1-5
2	117-127	CLPFTINCQKP	ORF8_protein@Brazil(NC_045512@Brazil: + : 27894-28259)	83-93
2	128-132	ATLQA linker 1-5
2	133-161	MWALIISVTSNYSGVVTIVMFLARGIVF	nsp6@SmallSouthAmerica(NC_045512@SmallSouthAmerical: + :	160-188
2	162-166	ATLQA linker 1-5
2	167-197	YIWLGFIAGLIAIVMVTIMLCCMTSCCSCLK	surface_glycoprotein@Aruba(NC_045512@Aruba: + : 21563-25384)	1121-1241
2	198-202	ATLQA linker 1-5
2	203-234	MMFVKHKHAFLCLFLLPSFATVAYFNMVYMPA	nsp6@Indonesia(NC_045512@Indonesia: + : 10973-11842)	57-88
2	235-239	ATLQA linker 1-5
2	240-255	QLALSKGFHFVCNLLL	ORF3a_protein@Iceland(NC_045512@Iceland: + : 25393-26220)	70-85
2	256-260	ATLQA linker 1-5
2	261-272	ALGKLQDVVNQN	surface_glycoprotein(NC_045512: + : 21563-25384)	944-955
2	273-277	ATLQA linker 1-5
2	278-290	NPVLPFNDGVYFA	surface_glycoprotein(NC_045512: + : 21563-25384)	81-93
2	291-295	ATLQA linker 1-5
2	296-306	AALALLLLDRL	nucleocapsid_phosphoprotein@Aruba(NC_045512@Aruba: + : 28274-29533)	217-227
2	307-311	ATLQA linker 1-5
2	312-319	SSIVITSV	ORF3a_protein@Aruba(NC_045512@Aruba: + : 25393-26220) 165-172
2	320-324	ATLQA linker 1-5	1-5
2	325-338	ESVVKDCVVLHSYF	ORF3a_protein@CostaRica(NC_045512@CostaRica: + : 25393-26220)	194-207
2	339-343	ATLQA linker 1-5
2	344-355	SVFQSASKIITL	ORF3a_protein@Iceland(NC_045512@Iceland: + : 25393-26220)	54-65
2	356-360	ATLQA linker 1-5
2	361-379	CYDYCIPYNSVTSLIVITS	ORF3a_protein@Netherlands(NC_045512@Netherlands: + : 25393-26220)	153-171
2	380-384	ATLQA linker 1-5
2	385-395	MMFVKHKHAFL	nsp6@Aruba(NC_045512@Aruba: + : 10973-11842)	57-67
2	396-400	ATLQA linker 1-5
2	401-408	YDPLQPEL	surface_glycoprotein(NC_045512: + : 21563-25384)	1138-1145
2	409-413	ATLQA linker 1-5
2	414-435	QLALSKGVHFVCNLLLLFVTVY	ORF3a_protein@Australia(NC_045512@Australia: + : 25393-26220)	70-91
2	436-440	ATLQA linker 1-5
2	441-454	ETKCTLKSFTVEKG	surface_glycoprotein@Aruba(NC_045512@Aruba: + : 21563-25384)	294-307
2	455-459	ATLQA linker 1-5
2	460-467	AALQIPFA	surface_glycoprotein(NC_045512: + : 21563-25384)	892-899
2	468-472	ATLQA linker 1-5
2	473-488	FLVLLPLVSIQCVNLT	surface_glycoprotein@SmallNorthAmerica(NC_045512@SmallNorthAmerica: + :	4-19
			21563-25384)
2	494-507	ITTVAAFHQECSLQ	ORF8_protein@Aruba(NC_045512@Aruba: + : 27894-28259)	10-23
2	508-512	ATLQA linker 1-5
2	513-527	ARSVARQSIIAYTMS	surface_glycoprotein@Mozambique(NC_045512@Mozambique: + : 21563-25384)	680-694
2	528-532	ATLQA linker 1-5
2	533-555	KNPLLYDANYFLCCHTNCYDYCI	ORF3a_protein@Senegal(NC_045512@Senegal: + : 25393-26220)	136-158
2	556-560	ATLQA linker 1-5
2	561-579	AIPINFTISVTTEILPVSM	surface_glycoprotein@Aruba(NC_045512@Aruba: + : 21563-25384)	709-727
2	580-584	ATLQA linker 1-5
2	585-595	HFPRKGVFVSN	surface_glycoprotein@SmallAsia(NC_045512@SmallAsia: + : 21563-25384)	1078-
2	596-600	ATLQA linker 1-5
2	601-617	SAAYYVGYLQLRTFLLK	surface_glycoprotein@Italy(NC_045512@Italy: + : 21563-25384)	258-274
2	618-622	ATLQA linker 1-5
2	623-641	QVAVLYQDVNCTEVPVAIH	surface_glycoprotein@China(NC_045512@China: + : 21563-25384)	607-625
3	1-10	YDANYFLCWH	ORF3a_protein(NC_045512: + : 25393-26220)	141-150
3	11-15	ATLQA linker 1-5
3	16-26	SAPLIELCLDE	ORF8_protein@Russia(NC_045512@Russia: + : 27894-28259)	54-64
3	27-31	ATLQA linker 1-5
3	32-55	TTVAAFHQECSLQLCTQHQPYVVD	ORF8_protein@USA(NC_045512@USA: + : 27894-28259)	11-34
3	56-60	ATLQA linker 1-5
3	61-74	SVASQSIIAYTMSL	surface_glycoprotein@Austria(NC_045512@Austria: + : 21563-25384)	678-691
3	75-79	ATLQA linker 1-5
3	80-88	EPLLKGVKL	surface_glycoprotein@Croatia(NC_045512@Croatia: + : 21563-25384)	1258-1266
3	89-93	ATLQA linker 1-5
3	94-109	NYTVSCSPFTINCQEP	ORF8_protein@CostaRica(NC_045512@CostaRica: + : 27894-28259)	78-93
3	110-114	ATLQA linker 1-5
3	115-124	PRWYFYYLGT	nucleocapsid_phosphoprotein@Aruba(NC_045512@Aruba: + : 28274-29533)	106-115
3	125-129	ATLQA linker 1-5
3	130-137	SSIVITSG	ORF3a_protein@SouthKorea(NC_045512@SouthKorea: + : 25393-26220)	165-172
3	138-142	ATLQA linker 1-5
3	143-150	ETQALPQR	nucleocapsid_phosphoprotein@SmallNorthAmerica(NC_04551@	378-385
3	151-155	ATLQA linker 1-5
3	156-179	LGSLVVRCSFYEDFLEYHDVRVVL	ORF8_protein(NC_045512: + : 27894-28259)	95-118
3	180-184	ATLQA linker 1-5
3	185-197	FQTLLALHRSYLT	surface_glycoprotein@Aruba(NC_045512@Aruba: + : 21563-25384)	234-246
3	198-202	ATLQA linker 1-5
3	203-210	EIYQAGSK	surface_glycoprotein@Mexico(NC_045512@Mexico: + : 21563-25384)	471-478
3	211-215	ATLQA linker 1-5
3	216-225	GVGGKPCIKV	nsp6@Aruba(NC_045512@Aruba: + : 10973-11842)	274-283
3	226-230	ATLQA linker 1-5
3	231-252	LLYDANYFLCWHINCYDYCIPY	ORF3a_protein@Estonia(NC_045512@Estonia: + : 25393-26220)	139-160
3	253-257	ATLQA linker 1-5
3	258-273	GSNVFQTRAGCLIGAE	surface_glycoprotein(NC_045512: + : 21563-25384)	639-654
3	274-278	ATLQA linker 1-5
3	279-291	ATNVVIKVCEFQF	surface_glycoprotein(NC_045512: + : 21563-25384)	123-135
3	292-296	ATLQA linker 1-5
3	297-309	NFRVQPTESIVRF	surface_glycoprotein(NC_045512: + : 21563-25384)	317-329
3	310-314	ATLQA linker 1-5
3	315-324	ISEHDYQIGG	ORF3a_protein@FrenchGuiana(NC_045512@FrenchGuiana: + : 25393-26220)	179-188
3	325-329	ATLQA linker 1-5
3	330-351	SDFVRATATIPIQASLPFGWL	ORF3a_protein@Aruba(NC_045512@Aruba: + : 25393-26220)	26-47
3	352-356	ATLQA linker 1-5
3	357-364	AEVQIDRL	surface_glycoprotein(NC_045512: + : 21563-25384)	989-996
3	365-369	ATLQA linker 1-5
3	370-386	GVHFVCNLLLLFVIVYS	ORF3a_protein@Malaysia(NC_045512@Malaysia: + : 25393-26220)	76-92
3	387-391	ATLQA linker 1-5
3	392-412	VMFLARGIVFMCVDYCPIFFI	nsp6@Cyprus(NC_045512@Cyprus: + : 10973-11842)	179-199
3	413-417	ATLQA linker 1-5
3	418-426	EVFAQVKQI	surface_glycoprotein(NC_045512: + : 21563-25384)	780-788
3	427-431	ATLQA linker 1-5
3	432-445	ANPVLPFNDGVYFA	surface_glycoprotein@Austria(NC_045512@Austria: + : 21563-25384)	77-90
3	446-450	ATLQA linker 1-5
3	451-466	AFKLNIKLLGVGGKPC	nsp6(NC_045512: + : 10973-11842)	268-283
3	467-471	ATLQA linker 1-5
3	472-485	GFNCYFPLQPYGFQ	surface_glycoprotein@SmallSouthAmerica(NC_045512@SmallSouthAmerica: + :	481-494
3	486-490	ATLQA linker 1-5
3	491-511	QWNLVIGFLFLTWICLLQFAY	membrane_glycoprotein@Aruba(NC_045512@Aruba: + : 26523-27191)	19-39
3	512-516	ATLQA linker 1-5
3	517-534	VTTVIFLARGIVFMCVEY	nsp6@Malaysia(NC_045512@Malaysia: + : 10973-11842)	179-196
3	535-539	ATLQA linker 1-5
3	540-556	LFFFLYENAFLPFVMGI	nsp6@SmallSouthAmerica(NC_045512@SmallSouthAmerica: + : 10973-11842)	33-49
3	557-561	ATLQA linker 1-5
3	562-573	FSNVTWFHAIVS	surface_glycoprotein@Ghana(NC_045512@Ghana: + : 21563-25384)	59-70
3	574-578	ATLQA linker 1-5
3	579-606	FTSDYYQLYSTQLSTYTGVEHVTFFIYN	ORF3a_protein@Latvia(NC_045512@Latvia: + : 25393-26220)	207-234
3	607-611	ATLQA linker 1-5
3	612-621	SFKLKDCVMY	nsp6@Malaysia(NC_045512@Malaysia: + : 10973-11842)	107-116
3	622-626	ATLQA linker 1-5
3	627-641	EFQFCNDPFLGVYYH	surface_glycoprotein@Chile(NC_045512@Chile: + : 21563-25384)	132-146
4	1-23	QLALSKGVYFVCNLLLLFVTVYS	ORF3a_protein@Aruba(NC_045512@Aruba: + : 25393-26220)	70-92
4	24-28	ATLQA inker
4	29-36	REGVFVSN	surface_glycoprotein@Aruba(NC_045512@Aruba: + : 21563-25384)	1087-1094
4	37-41	ATLQA linker 1-5
4	42-52	RFQLHRSYLTP	surface_glycoprotein@Austria(NC_045512@Austria: + : 21563-25384)	233-243
4	53-57	ATLQA linker 1-5
4	58-70	ISSVLNDILSRLD	surface_glycoprotein@Bangladesh(NC_045512@Bangladesh: + : 21563-25384)	972-984
4	71-75	ATLQA linker 1-5
4	76-90	VDTSLSSLKLKDCVM	nsp6@Latvia(NC_045512@Latvia: + : 10973-11842)	101-115
4	91-95	ATLQA linker 1-5
4	96-104	TEIYQAGST	surface_glycoprotein@Aruba(NC_045512@Aruba: + : 21563-25384)	466-474
4	105-109	ATLQA linker 1-5
4	110-134	AAGLEAPFLYLYVLVYFLQSINFVR	ORF3a_protein@Norway(NC_045512@Norway: + : 25393-26220)	98-122
4	135-139	ATLQA linker 1-5
4	140-148	KHWPQIAQF	nucleocapsid_phosphoprotein(NC_045512: + : 28274-29533)	299-307
4	149-153	ATLQA linker 1-5
4	154-161	APLIELCV	ORF8_protien(NC_045512: + : 27894-28259)	55-62
4	162-166	ATLQA linker 1-5
4	167-188	INLVRDLPQGFSALEPLVDLPI	surface_glycoprotein@Aruba(NC_045512@Aruba: + : 21563-25384)	206-227
4	189-193	ATLQA linker 1-5
4	194-201	STFKCYGV	surface_glycoprotein@Aruba(NC_045512@Aruba: + : 21563-25384)	371-378
4	202-206	ATLQA linker 1-5
4	207-216	KQYGDCLGNI	surface_glycoprotein@Jordan(NC_045512@Jordan: + : 21563-25384)	831-840
4	217-221	ATLQA linker 1-5
4	222-238	CSNLLLQYGSFCTQLNR	surface_glycoprotein(NC_045512: + : 21563-25384)	749-765
4	239-243	ATLQA linker 1-5
4	244-263	DANYFLCWHTNCYHYCIPYN	ORF3a_protein@Indonesia(NC_045512@Indonesia: + : 25393-26220)	142-161
4	264-268	ATLQA linker 1-5
4	269-291	KEITVATSRTLSYYKLGASQRVA	membrane_glycoprotein@Aruba(NC_045512@Aruba: + : 26523-27191)	166-188
4	292-296	ATLQA linker 1-5
4	297-306	LPFTINCQEL	ORF8_protien@Mozambique(NC_045512@Mozambique: + : 27894-28259)	84-93
4	307-311	ATLQA linker 1-5
4	312-320	APLEILCVD	ORF8_protien@Bangladesh(NC_045512@Bangladesh: + : 27894-28259)	55-63
4	321-325	ATLQA linker 1-5
4	326-334	DYYQLYSTQ	ORF3a_protein(NC_045512: + : 25393-26220)	210-218
4	335-339	ATLQA linker 1-5
4	340-358	VKDCVLLHSYFTSDYYQLY	ORF3a_protein@Belgium(NC_045512@Belgium: + : 25393-26220)	197-215
4	359-363	ATLQA linker 1-5
4	364-373	ARDLICAQKF	surface_glycoprotein(NC_045512: + : 21563-25384)	846-855
4	374-378	ATLQA linker 1-5
4	379-386	SDFVRATA	ORF3a_protein(NC_045512: + : 25393-26220)	26-33
4	387-391	ATLQA linker 1-5
4	392-401	SVLNDILARL	surface_glycoprotein@Aruba(NC_045512@Aruba: + : 21563-25384)	971-980
4	402-406	ATLQA linker 1-5
4	407-424	FLYENAFLPFAMGVIAMS	nsp6@Mexico(NC_045512@Mexico: + : 10973-11842)	36-53
4	425-429	ATLQA linker 1-5
4	430-442	LLNVPLHGTILTR	membrane_glycoprotein(NC_045512: + : 26523-27191)	119-131
4	443-447	ATLQA linker 1-5
4	448-469	SDFVRATATIPIRALSPFGWLI	ORF3a_protein@Belgium(NC_045512@Belgium: + : 25393-26220)	26-47
4	470-474	ATLQA linker 1-5
4	475-503	FLYIIKLIFLWLLWPVTLACFVLAAVYRI	membrane_glycoprotein@Aruba(NC_045512@Aruba: + : 26523-27191)	45-73
4	504-508	ATLQA linker 1-5
4	509-524	FSNVTWFHAIHVSGTN	surface_glycoprotein@Peru(NC_045512@Peru: + : 21563-25384)	59-74
4	525-529	ATLQA linker 1-5
4	530-558	TLQCIMLVYCFGYFCTCYFGLFCLLNRY	nsp6@Aruba(NC_045512@Aruba: + : 10973-11842)	203-231
4	559-563	ATLQA linker 1-5
4	564-586	VAAGLEAPFFYLYALVYFLQSIN	ORF3a_protein@Ecuador(NC_045512@Ecuador: + : 25393-26220)	97-119
4	587-591	ATLQA linker 1-5
4	592-599	TDAVDCAL	surface_glycoprotein(NC_045512: + : 21563-25384)	286-293
4	600-604	ATLQA linker 1-5
4	605-619	EFQFCNUPFLGVYHK	surface_glycoprotein@Norway(NC_045512@Norway: + : 21563-25384)	129-143
4	620-624	ATLQA linker 1-5
4	625-634	SPGVVNPVME	ORF3a_protein@Brazil(NC_045512@Brazil: + : 25393-26220)	252-261
4	635-639	ATLQA linker 1-5
4	640-659	MTSCCSCLKGCCSCGSCCKF	surface_glycoprotein(NC_045512: + : 21563-25384)	1237-1256
5	1-25	KNPLLYDANYFLCWHTNCYDYCIPY	ORF3a_protein@Aruba(NC_045512@Aruba: + : 25393-26220)	136-160
5	26-30	ATLQA linker 1-5
5	31-41	SELVIGAVILR	membrane_glycoprotein(NC_045512: + : 26523-27191)	136-146
5	42-46	ATLQA linker 1-5
5	47-60	LVLLPLVSSQCVNF	surface_glycoprotein@Brazil(NC_045512@Brazil: + : 21563-25384)	5-18
5	61-65	ATLQA linker 1-5
5	66-74	LKLKDCVMY	nsp6@Aruba(NC_045512@Aruba: + : 10973-11842)	105-113
5	75-79	ATLQA linker 1-5
5	80-99	PINLVRGLPQGFSALEPLVD	surface_glycoprotein@Austria(NC_045512@Austria: + : 21563-25384)	205-224
5	100-104	ATLQA linker 1-5
5	105-112	VVNPVMEP	ORF3a_protein(NC_045512: + : 25393-26220)	255-262
5	113-117	ATLQA linker 1-5
5	118-125	EHVQIHTI	ORF3a_protein(NC_045512: + : 25393-26220)	242-249
5	126-130	ATLQA linker 1-5
5	131-140	ALAAVFHNAS	ORF3a_protein@SmallSouthAmerica(NC_045512@SmallSouthAmerica: + :	51-60
			25393-26220)
5	141-145	ATLQA linker 1-5
5	146-164	VKDCVVLHSYFTSDYYQLY	ORF3a_protein@Aruba(NC_045512@Aruba: + : 25393-26220)	197-215
5	165-169	ATLQA linker 1-5
5	170-184	ALLAVFHSASKIITL	ORF3a_protein@Aruba(NC_045512@Aruba: + : 25393-26220)	51-65
5	185-189	ATLQA linker 1-5
5	190-212	TTVMFLARGIVFMCVEYCPIFFI	nsp6@Aruba(NC_045512@Aruba: + : 10973-11842)	177-199
5	213-217	ATLQA linker 1-5
5	218-240	LIAIVMVTIMLCCITSCCSCLKG	surface_glycoprotein@Mozambique(NC_045512@Mozambique: + : 21563-25384)	1220-1242
5	241-245	ATLQA linker 1-5
5	246-260	VNCTEVPVAIHADQL	surface_glycoprotein(NC_045512: + : 21563-25384)	615-629
5	261-265	ATLQA linker 1-5
5	266-282	INFVRIIMRLWLCLKCR	ORF3a_protein@Mozambique(NC_045512@Mozambique: + : 25393-26220)	118-134
5	283-287	ATLQA linker 1-5
5	288-301	KHWPQAIQFAPSAS	nucleocapsid_phosphoprotein@Australia(NC_045512@Australia: + :	299-312
			28274-29533)
5	302-306	ATLQA linker 1-5
5	307-320	IKVCEFQFCNDPYY	surface_glycoprotein@CostaRica(NC_045512@CostaRica: + : 21563-25384)	128-141
5	321-325	ATLQA linker 1-5
5	326-340	ALLAVFQSASKIITL	ORF3a_protein@Bangladesh(NC_045512@Bangladesh: + : 25393-26220)	51-65
5	341-345	ATLQA linker 1-5
5	346-359	LMNVLTLVYKVYYG	nsp6@Aruba(NC_045512@Aruba: + : 10973-11842)	139-152
5	360-364	ATLQA linker 1-5
5	365-373	FFSNVTWFH	surface_glycoprotein(NC_045512: + : 21563-25384)	58-66
5	374-378	ATLQA linker 1-5
5	379-386	SLIDLQEL	surface_glycoprotein(NC_045512: + : 21563-25384)	1196-1203
5	387-391	ATLQA linker 1-5
5	392-401	GNCDVVIGIV	surface_glycoprotein(NC_045512: + : 21563-25384)	1124-1133
5	402-406	ATLQA linker 1-5
5	407-421	TYGVGYQPYRVVVLS	surface_glycoprotein@Australia(NC_045512@Australia: + : 21563-25384)	496-510
5	422-426	ATLQA linker 1-5
5	427-442	LMNVLTLFYKVYYGNA	nsp6@Chile(NC_045512@Chile: + : 10973-11842)	142-157
5	443-447	ATLQA linker 1-5
5	448-463	FLVLLPLVSSQCVNLT	surface_glycoprotein@Aruba(NC_045512@Aruba: + : 21563-25384)	4-19
5	464-468	ATLQA linker 1-5
5	469-488	PINLVRGLPQGFSVLEPLVD	surface_glycoprotein@SmallAfrica(NC_045512@SmallAfrica: + : 21563-25384)	209-228
5	489-493	ATLQA linker 1-5
5	494-508	VEHVTFFIYNKIVDE	ORF3a_protein(NC_045512: + : 25393-26220)	225-239
5	509-513	ATLQA linker 1-5
5	514-531	LNDLCFTNVYADSFVIRG	surface_glycoprotein(NC_045512: + : 21563-25384)	387-404
5	532-536	ATLQA linker 1-5
5	537-550	TDTVVEHVTFFIYN	ORF3a_protein@CostaRica(NC_045512@CostaRica: + : 25393-26220)	221-234
5	551-555	ATLQA linker 1-5
5	556-571	NYTVSCLPFTINCQEP	ORF8_protein@Bangladesh(NC_045512@Bangladesh: + : 27894-28259)	78-93
5	572-576	ATLQA linker 1-5
5	577-586	KQYGDCLGDI	surface_glycoprotein(NC_045512: + : 21563-25384)	835-844
5	587-591	ATLQA linker 1-5
5	592-601	AGAALQIPFA	surface_glycoprotein@Nigeria(NC_045512@Nigeria: + : 21563-25384)	886-895
5	602-606	ATLQA linker 1-5
5	607-616	FEYVSQPFLM	surface_glycoprotein@Aruba(NC_045512@Aruba: + : 21563-25384)	164-173
5	617-621	ATLQA linker 1-5
5	622-635	TDTCVEHVTFFIYN	ORF3a_protein@Luxembourg(NC_045512@Luxembourg: + : 25393-26220)	221-234
6	1-12	EVFAQVKQIYKT	surface_glycoprotein@Aruba(NC_045512@Aruba: + : 21563-25384)	776-787
6	13-17	ATLQA linker 1-5
6	18-35	IKDLPKEITVATSRTLSY	membrane_glycoprotein(NC_045512: + : 26523-27191)	161-178
6	36-40	ATLQA linker 1-5
6	41-55	ISNCVADYSVLYNSA	surface_glycoprotein@Aruba(NC_045512@Aruba: + : 21563-25384)	354-368
6	56-60	ATLQA linker 1-5
6	61-73	RSVASQSIIAYTM	surface_glycoprotein@Aruba(NC_045512@Aruba: + : 21563-25384)	681-693
6	74-78	ATLQA linker 1-5
6	79-92	TSGVGYQPYRVVVL	surface_glycoprotein@Aruba(NC_045512@Aruba: + : 21563-25384)	496-509
6	93-97	ATLQA linker 1-5
6	98-107	NCYDYCIPYN	ORF3a_protein(NC_045512: + : 25393-26220)	152-161
6	108-112	ATLQA linker 1-5
6	113-129	KDQVILLNKHIDAYKTF	nucleocapsid_phosphoprotein@Aruba(NC_045512@Aruba: + : 28274-29533)	347-363
6	130-134	ATLQA linker 1-5
6	135-157	HQPYVVDDPCPIHFYSKWYIRVG	ORF8_protein(NC_045512: + : 27894-28259)	28-50
6	158-162	ATLQA linker 1-5
6	163-180	QLALFKGVHFVCNLLLLF	ORF3a_protein@CostaRica(NC_045512@CostaRica: + : 25393-26220)	70-87
6	181-185	ATLQA linker 1-5
6	186-197	DTSLKLKECVMY	nsp6@SmallAsia(NC_045512@SmallAsia: + : 10973-11842)	102-113
6	198-202	ATLQA linker 1-5
6	203-225	RVDFCGKGYHLMSFPQSAPHGVV	surface_glycoprotein(NC_045512: + : 21563-25384)	1039-1061
6	226-230	ATLQA linker 1-5
6	231-249	LEILDITPCSFGGVSVITP	surface_glycoprotein(NC_045512: + : 21563-25384)	582-600
6	250-254	ATLQA linker 1-5
6	255-277	YALVYFLQSINFVIIIMRLWLCW	ORF3a_protein@Denmark(NC_045512@Denmark: + : 25393-26220)	109-131
6	278-282	ATLQA linker 1-5
6	283-298	HWPQIAQFAPSASAFF	nucleocapsid_phosphoprotein@Aruba(NC_045512@Aruba: + : 28274-29533)	300-315
6	299-303	ATLQA linker 1-5
6	304-319	LQSLQTYVTQQLIRAA	surface_glycoprotein(NC_045512: + : 21563-25384)	1001-1016
6	320-324	ATLQA linker 1-5
6	325-332	TQALPHRQ	nucleocapsid_phosphoprotein@Mozambique(NC_045512@Mozambique: + :	379-386
			28274-29533)
6	333-337	ATLQA linker 1-5
6	338-345	EVTPSGTW	nucleocapsid_phosphoprotein(NC_045512: + : 28274-29533)	323-330
6	346-350	ATLQA linker 1-5
6	351-362	FNCYFPLQSYGF	surface_glycoprotein(NC_045512: + : 21563-25384)	486-497
6	363-367	ATLQA linker 1-5
6	368-383	ATVAYFNMVYMPASWV	nsp6@Aruba(NC_045512@Aruba: + : 10973-11842)	76-91
6	384-388	ATLQA linker 1-5
6	389-396	SVDCTMYI	surface_glycoprotein(NC_045512: + : 21563-25384)	735-742
6	397-401	ATLQA linker 1-5
6	402-415	GFNCYSPLQSYGFQ	surface_glycoprotein@Peru(NC_045512@Peru: + : 21563-25384)	485-498
6	416-420	ATLQA linker 1-5
6	421-442	NVVIKVCEFQFCNYPFLGVYYH	surface_glycoprotein@Brazil(NC_045512@Brazil: + : 21563-25384)	125-146
6	443-447	ATLQA linker 1-5
6	448-472	VLVQSTQWSLFFFFYENAFLPFAMG	nsp6@Iceland(NC_045512@Iceland: + : 10973-11842)	24-48
6	473-477	ATLQA linker 1-5
6	478-499	GYQPYRVVVLSFELLHAPATVC	surface_glycoprotein(NC_045512: + : 21563-25384)	504-525
6	500-504	ATLQA linker 1-5
6	505-529	VLVQSTQWSLFFFLYENAFLPFAMG	nsp6@Aruba(NC_045512@Aruba: + : 10973-11842)	24-48
6	530-534	ATLQA linker 1-5
6	535-545	FFSNVTWFHVS	surface_glycoprotein@Nigeria(NC_045512@Nigeria: + : 21563-25384)	58-68
6	546-550	ATLQA linker 1-5
6	551-564	IHFYSKWYIRVGAK	ORF8_protein@Mozambique(NC_045512@Mozambique: + : 27894-28259)	39-52
6	565-569	ATLQA linker 1-5
6	570-579	TQNVLYENQK	surface_glycoprotein(NC_045512: + : 21563-25384)	912-921
6	580-584	ATLQA linker 1-5
6	585-601	INFVRIIMRLWLCCKCR	ORF3a_protein@Australia(NC_045512@Australia: + : 25393-26220)	118-134
6	602-606	ATLQA linker 1-5
6	607-630	PINLVRDLPQGFSVLEPLVDLPIG	surface_glycoprotein@Belgium(NC_045512@Belgium: + : 21563-25384)	205-228
6	631-635	ATLQA linker 1-5
6	636-647	ISVTTEILPVSM	surface_glycoprotein(NC_045512: + : 21563-25384)	720-731

In certain embodiments, the vaccine comprises or expresses at least one of the concatemers of epitopes with intervening linker sequences (and as set forth in FIG. 19). In certain embodiments, the vaccine comprises or expresses at least two of the concatemers set forth below. In certain embodiments, the vaccine comprises or expresses three of the concatemers set forth below. In certain embodiments, the vaccine comprises or expresses all the concatemers set forth below.

TABLE 9
concatemer	pos_in_concatemer	epitope	gene	pos_in_gene
1	1-16	YVRITGLYPTLNISYE	helicase@SmallNorthAmerical(NC_045512@SmallNorthAmerica: + : 16237-18039)	246-261
1	17-26	PRRARSVRYP linker 1-10
1	27-49	TQLYLGGMSYYCKPHKPPISFPL	helicase@Iceland(NC_045512@Iceland: + : 16237-18039)	61-83
1	50-59	PRRARSVRYP linker 1-10
1	60-70	HFPRKGVFVSN	surface_glycoprotein@SmallAsia(NC_045512@SmallAsia: + : 21563-25384)	1078-1088
1	71-80	PRRARSVRYP linker 1-10
1	81-90	GTNLPLQLGF	3′-to-5′_exonuclease(NC_045512: + : 10840-19620)	102-111
1	91-100	PRRARSVRYP linker 1-10
1	101-128	FTSDYYQLYSTQLSTYTGVEHVTFFIYN	ORF3a_protein@Lativa(NC_045512@Lativa: + : 25393-26220)	207-234
1	129-138	PRRARSVRYP linker 1-10
1	139-154	NYTVSCLPFTINCQEP	ORF8_protein@Bangladesh(NC_045512@Bangladesh: + : 27894-28259)	78-93
1	155-164	PRRARSVRYP linker 1-10
1	165-186	LQKAAITILDGISQYSLRLI	nsp2(NC_045512: + : 806-2719)	382-401
1	185-194	PRRARSVRYP linker 1-10
1	195-204	SVELKHFFFA	RNA-dependent_RNA-polymerase(NC_045512: + : 13442-13468 + 13468-16236)	434-443
1	205-214	PRRARSVRYP linker 1-10
1	215-228	TDTVVEHVTFFIYN	ORF3a_protein@CostaRica(NC_045512@CostaRica: + : 25393-26220)	221-234
1	229-238	PRRARSVRYP linker 1-10
1	239-248	NVAFNVVNKG	endoRNAse(NC_045512: + : 19621-20658)	4-13
1	249-258	PRRARSVRYP linker 1-10
1	259-275	CSNLLLQYGSFCTQLNR	surface_glycoprotein(NC_045512: + : 21563-25384)	749-765
1	276-285	PRRARSVRYP linker 1-10
1	286-307	SQHTMLVKQFDDYVYLPYPDPS	RNA-dependent_RNA_polymerase@Estonia(NC_045512@Estonia: + :	814-835
			13442-13468 + 13468-16236)
1	308-317	PRRARSVRYP linker 1-10
1	318-337	GYLPQNAVVKIYCPACHNSE	nsp2(NC_045512: + : 806-2719)	178-197
1	338-347	PRRARSVRYP linker 1-10
1	348-359	FQTLLHRSYLTP	surface_glycoprotein@SmallAsia(NC_045512@SmallAsia: + : 21563-25384)	230-241
1	360-369	PRRARSVRYP linker 1-10
1	370-408	GCDVTDVTQLYLGGMSYYCKSHKPPISFPLCAN	helicase(NC_045512: + : 16237-18039)	54-92
		GQVFGL
1	409-418	PRRARSVRYP linker 1-10
1	419-431	IVKFISTCACEIV	nsp2(NC_045512: + : 806-2719)	468-480
1	432-441	PRRARSVRYP linker 1-10
1	442-450	EPLLKGVKL	surface_glycoprotein@Croatia(NC_045512@Croatia: + : 21563-25384)	1258-1266
1	451-460	PRRARSVRYP linker 1-10
1	461-468	ARDLSLQF	nsp3(NC_045512: + : 2720-8554)	1652-1659
1	469-478	PRRARSVRYP linker 1-10
1	479-488	RHSLSHFVNL	nsp3(NC_045512: + : 2720-8554)	1697-1706
1	489-498	PRRARSVRYP linker 1-10
1	499-514	VREVLSDRELHLSWEV	helicase(NC_045512: + : 16237-18039)	154-169
1	515-524	PRRARSVRYP linker 1-10
1	525-532	REGVFVSN	surface_glycoprotein@Aruba(NC_045512@Aruba: + : 21563-25384)	1087-1094
1	533-542	PRRARSVRYP linker 1-10
1	543-553	YELKHGTFTCA	nsp3(NC_045512: + : 2720-8554)	996-1006
1	554-563	PRRARSVRYP linker 1-10
1	564-579	HWPQIAQFAPSASAFF	nucleocapsid_phosphoprotein@Aruba(NC_045512@Aruba: + : 28274-29533)	300-315
1	580-589	PRRARSVRYP linker 1-10
1	590-600	KGVQIPCTCGK	nsp3(NC_045512: + : 2720-8554)	963-973
1	601-610	PRRARSVRYP linker 1-10
1	611-619	TENLLLID	nsp3(NC_045512: + : 2720-8554)	432-440
1	620-629	PRRARSVRYP linker 1-10
1	630-646	ILLNKHIDAYKTFPPIE	nucleocapsid_phosphoprotein@Chile(NC_045512@Chile: + : 28274-29533)	351-367
1	647-656	PRRARSVRYP linker 1-10
1	657-675	AIPINFTISVTTEILPVSM	surface_glycoprotein@Aruba(NC_045512@Aruba: + : 21563-25384)	709-727
1	676-685	PRRARSVRYP linker 1-10
1	686-694	KFPLKLRGT	2′-O-ribose_methyltransferase(NC_045512: + : 20659-21552)	249-257
1	695-704	PRRARSVRYP linker 1-10
1	705-714	SVLNDILARL	surface_glycoprotein@Aruba(NC_045512@Aruba: + : 21563-25384)	971-980
1	715-724	PRRARSVRYP linker 1-10
1	725-735	DNVLSTFISAA	nsp3(NC_045512: + : 2720-8554)	1809-1819
1	736-745	PRRARSVRYP linker 1-10
1	746-755	ACIDCSARHI	nsp3(NC_045512: + : 2720-8554)	1872-1881
1	756-765	PRRARSVRYP linker 1-10
1	766-775	VQQESPFVMM	nsp3(NC_045512: + : 2720-8554)	980-989
1	776-785	PRRARSVRYP linker 1-10
1	786-800	TISVTTEILPVSMAK	surface_glycoprotein@Mexico(NC_045512@Mexico: + : 21563-25384)	719-733
1	801-810	PRRARSVRYP linker 1-10
1	811-824	TSACLVLAAECTIFK	nsp4(NC_045512: + : 8555-10054)	147-160
1	825-834	PRRARSVRYP linker 1-10
1	835-852	LFVVEVVDKYFDCYDGGC	RNA-dependent_RNA_polymerase(NC_045512: + : 13442-13468 + 13468-16236)	470-487
1	853-862	PRRARSVRYP linker 1-10
1	863-876	GFNCYSPLQSYGFQ	surface_glycoprotein@Peru(NC_045512@Peru: + : 21563-25384)	485-498
1	877-886	PRRARSVRYP linker 1-10
1	887-902	ATVAYFNMVYMPASWV	nsp6@Aruba(NC_04551@Aruba: + : 10973-11842)	76-91
1	903-912	PRRARSVRYP linker 1-10
1	913-925	AIKCVPQADVEWK	3′-to-5′_exonuclease(NC_045512: + : 10840-19620)	337-349
1	926-935	PRRARSVRYP linker 1-10
1	936-952	LFFFLYENAFLPFVMGI	nsp6@SmallSouthAmerica(NC_045512@SmallSouthAmerica: + : 10973-11842)	33-49
1	953-962	PRRARSVRYP linker 1-10
1	963-972	ALLAVFHNAS	ORF3a_protein@SmallSouthAmerica(NC_045512@SmallSouthAmerica: + :	51-60
			25393-26220)
1	973-982	PRRARSVRYP linker 1-10
1	983-993	YDKLQFTSLEI	helicase@Aruba(NC_045512@Aruba: + : 16237-18039)	582-592
1	994-1003	PRRARSVRYP linker 1-10
1	1004-1011	SSNVANYQ	helicase@Austria(NC_045512@Austria: + : 16237-18039)	263-270
1	1012-1021	PRRARSVRYP linker 1-10
1	1022-1030	SRELKVTFF	nsp3(NC_045512: + : 2720-8554)	1134-1142
1	1031-1040	PRRARSVRYP linker 1-10
1	1041-1082	TTVAAFHQECSLQSCTQHQPYVVDDPCPIHFYS	ORF8_protein@Bangladesh(NC_045512@Bangladesh: + : 27894-28259)	11-52
		KWYIRVGAR
1	1083-1092	PRRARSVRYP linker 1-10
1	1093-1100	DMYSVMLT	RNA-dependent_RNA_polymerase@Malaysia(NC_045512@Malaysia: + :	901-908
			13442-13468 + 13468-16236)
1	1101-1110	PRRARSVRYP linker 1-10
1	1111-1126	RKIFVDGVPFVVSTGY	RNA-dependent_RNA_polymerase(NC_045512: + : 13442-13468 + 13468-16236)	331-346
1	1127-1136	PRRARSVRYP linker 1-10
1	1137-1167	YIWLGFIAGLIAIVMVTIMLCCMTSCCSCLK	surface_glycoprotein@Aruba(NC_045512@Aruba: + : 21563-25384)	1211-1241
1	1168-1177	PRRARSVRYP linker 1-10
1	1178-1192	TYGVGYQPYRVVVLS	surface_glycoprotein@Australia(NC_045512@Australia: + : 21563-25384)	496-510
1	1193-1202	PRRARSVRYP linker 1-10
1	1203-1219	KDQVILLNKHIDAYKTF	nucleocapsid_phosphoprotein@Aruba(NC_045512@Aruba: + : 28274-29533)	347-363
1	1220-1229	PRRARSVRYP linker 1-10
1	1230-1237	KAVFISPY	helicase(NC_045512: + : 16237-18039)	508-515
1	1238-1247	PRRARSVRYP linker 1-10
1	1248-1260	KLALGGSVAIKIT	2′-O-ribose_methyltransferase(NC_045512: + : 20659-21552)	160-172
1	1261-1270	PRRARSVRYP linker 1-10
1	1271-1278	YDKLVSSF	nsp3(NC_045512: + : 2720-8554)	365-372
1	1279-1288	PRRARSVRYP linker 1-10
1	1289-1302	ITTVAAFHQECSLQ	ORF8_protein@Aruba(NC_045512@Aruba: + : 27894-28259)	10-23
1	1303-1312	PRRARSVRYP linker 1-10
1	1313-1328	LMNVLTLFYKVYYGNA	nsp6@Chile(NC_045512@Chile: + : 10973-11842)	142-157
1	1329-1338	PRRARSVRYP linker 1-10
1	1339-1361	HQPYVVDDPCPIHFYSKWYIRVG	ORF8_protein(NC_045512: + : 27894-28259)	28-50
1	1362-1371	PRRARSVRYP linker 1-10
1	1372-1395	LGSLVVRCSFYEDFLEYHDVRVVL	ORF8_protein(NC_045512: + : 27894-28259)	95-118
1	1396-1405	PRRARSVRYP linker 1-10
1	1406-1415	LPRVFSAVGN	nsp4(NC_045512: + : 8555-10054)	122-131
1	1416-1425	PRRARSVRYP linker 1-10
1	1426-1448	QLALSKGVYFVCNLLLLFVTVYS	ORF3a_protein@Aruba(NC_045512@Aruba: + : 25393-26220)	70-92
1	1449-1458	PRRARSVRYP linker 1-10
1	1459-1466	YDFAVSKG	RNA-dependent_RNA_polymerase@Aruba(NC_045512@Aruba: + :	420-427
			13442-13468 + 13468-16236)
1	1467-1476	PRRARSVRYP linker 1-10
1	1477-1502	YRLANECAQVLSEIVMCGGSLYVKPG	RNA-dependent_RNA_polymerase@Canada(NC_045512@Canada: + :	653-678
			13442-13468 + 13468-16236)
1	1503-1512	PRRARSVRYP linker 1-10
1	1513-1520	QIGVVREF	helicase(NC_045512: + : 16237-18039)	492-499
1	1521-1530	PRRARSVRYP linker 1-10
1	1531-1538	YLKLRSDV	nsp4(NC_045512: + : 8555-10054)	427-434
1	1539-1547	PRRARSVRYP linker 1-10
1	1547-1567	KLNVGDYFVLTSHTVMPLS	helicase(NC_045512: + : 16237-18039)	218-236
1	1568-1577	PRRARSVRYP linker 1-10
1	1578-1587	SFLKLDCVMY	nsp6@Malaysia(NC_04551@Malaysia: + : 10973-11842)	107-116
1	1588-1597	PRRARSVRYP linker 1-10
1	1598-1607	PRWYFYYLGT	nucleocapsid_phosphoprotein@Aruba(NC_045512@Aruba: + : 28274-29533)	106-115
1	1608-1617	PRRARSVRYP linker 1-10
1	1618-1636	CYDYCIPYNSVTSLIVITS	ORF3a_protein@Netherlands(NC_045512@Netherlands: + : 25393-26220)	153-171
1	1637-1646	PRRARSVRYP linker 1-10
1	1647-1655	MPVCVETKA	nsp3(NC_045512: + : 2720-8554)	571-579
1	1656-1665	PRRARSVRYP linker 1-10
1	1666-1674	GVVQQLPET	endoRNAase(NC_045512: + : 184-192)
1	1675-1684	PRRARSVRYP linker 1-10
1	1685-1697	GVNLVAVPTGYVD	3′-to-5′_exonuclease(NC_045512: + : 10840-19620)	114-126
1	1698-1707	PRRARSVRYP linker 1-10
1	1708-1719	SVLLSMQGAVDI	nsp7(NC_045512: + : 11843-12091)	57-68
1	1720-1729	PRRARSVRYP linker 1-10
1	1730-1742	RSVASQSIIAYTM	surface_glycoprotein@Aruba(NC_045512@Aruba: + : 21563-25384)	681-693
1	1743-1752	PRRARSVRYP linker 1-10
1	1753-1765	VKGLQPSVGPKQA	endoRNAase(NC_045512: + : 184-192)	148-160
1	1766-1775	PRRARSVRYP linker 1-10
1	1776-1794	QLSLSKGFHFVCNLLLLFV	ORF3a_protein@Estonia(NC_045512@Estonia: + : 25393-26220)	70-88
1	1795-1804	PRRARSVRYP linker 1-10
1	1805-1817	ISSVLNDILSRLD	surface_glycoprotein@Bangladesh(NC_045512@Bangladesh: + : 21563-25384)	972-984
1	1818-1827	PRRARSVRYP linker 1-10
1	1828-1838	VLYQGVNCTEV	surface_glycoprotein@Aruba(NC_045512@Aruba: + : 21563-25384)	606-616
1	1839-1848	PRRARSVRYP linker 1-10
1	1849-1860	FSNVTWFHAIVS	surface_glycoprotein@Ghana(NC_045512@Ghana: + : 21563-25384)	59-70
1	1861-1870	PRRARSVRYP linker 1-10
1	1871-1884	RLTLGVYDYLVSTQ	nsp6(NC_045512: + : 10973-11842)	236-249
1	1885-1894	PRRARSVRYP linker 1-10
1	1895-1905	KESVQTFFKLV	nsp2(NC_045512: + : 806-2719)	492-502
1	1906-1915	PRRARSVRYP linker 1-10
1	1916-1937	NVVIKVCEFQFCNYPFLGVYYH	surface_glycoprotein@Brazil(NC_045512@Brazil: + : 21563-25384)	125-146
1	1938-1947	PRRARSVRYP linker 1-10
1	1948-1955	IETISLAG	nsp3(NC_045512: + : 2720-8554)	684-691
1	1956-1965	PRRARSVRYP linker 1-10
1	1966-1984	ANSVFNICQAVTANVNALL	RNA-dependent_RNA_polymerase@Aruba(NC_045512@Aruba: + :	690-708
			13442-13468 + 13468-16236)
1	1985-1994	PRRARSVRYP linker 1-10
1	1995-2004	NEVYAYLRKH	RNA-dependent_RNA_polymerase(NC_045512: + : 13442-13468 + 13468-16236)	743-752
1	2005-2014	PRRARSVRYP linker 1-10
1	2015-2034	FPQSAPHGVVFLHVTYVPAQ	surface_glycoprotein@Aruba(NC_045512@Aruba: + : 21563-25384)	1048-1067
1	2035-2044	PRRARSVRYP linker 1-10
1	2045-2057	NPVLPFNDGVYFA	surface_glycoprotein(NC_045512: + : 21563-25384)	81-93
1	2058-2067	PRRARSVRYP linker 1-10
1	2068-2077	ISDYDYYRYN	RNA-dependent_RNA_polymerase@Aruba(NC_045512@Aruba: + :	450-459
			13442-13468 + 13468-16236)
1	2078-2087	PRRARSVRYP linker 1-10
1	2088-2095	SLIDLQEL	surface_glycoprotein(NC_045512: + : 21563-25384)	1196-1203
1	2096-2105	PRRARSVRYP linker 1-10
1	2106-2127	LGGMSYYCKSHKPSISFPLCAN	helicase@NewZealand(NC-045512@NewZealand: + : 16237-18039)	65-86
1	2128-2137	PRRARSVRYP linker 1-10
1	2138-2146	IQLSSYSLF	2′-O-ribose_methyltransferase(NC_045512: + : 20659-21552)	237-245
1	2147-2156	PRRARSVRYP linker 1-10
1	2157-2176	YVYLPYPDPSRILGAGCFVD	RNA-dependent_RNA_polymerase(NC_045512: + : 13442-13468 + 13468-16236)	826-845
1	2177-2186	PRRARSVRYP linker 1-10
1	2187-2197	ETICAPLTVFF	endoRNAase(NC_045512: + : 184-192)	113-123
1	2198-2207	PRRARSVRYP linker 1-10
1	2208-2226	QVAVLYQDVNCTEVPVAIH	surface_glycoprotein@China(NC_045512@China: + : 21563-25384)	607-625
1	2227-2236	PRRARSVRYP linker 1-10
1	2239-2246	VTGLFKDCSK	3′-to-5′_exonuclease(NC_045512: + : 10840-19620)	4-13
1	2247-2256	PRRARSVRYP linker 1-10
1	2257-2270	FFSNVTWFHAIHVS	surface_glycoprotein@Bangladehs(NC_045512@Bangladesh: + : 21563-25384)	58-71
1	2271-2280	PRRARSVRYP linker 1-10
1	2281-2296	NYTVSCSPFTINCQEP	ORF8_protein@CostaRica(NC_045512@CostaRica: + : 27894-28259)	78-93
1	2297-2306	PRRARSVRYP linker 1-10
1	2307-2317	MMFVKHKHAFL	nsp6@Aruba(NC_04551@Aruba: + : 10973-11842)	57-67
1	2318-2327	PRRARSVRYP linker 1-10
1	2328-2341	GFNCYFPLQPYGFQ	surface_glycoprotein@SmallSouthAmerica(NC_045512@SmallSouthAmerica: + :	481-494
			21563-25384)
1	2342-2351	PRRARSVRYP linker 1-10
1	2352-2360	AAAYYVGYL	surface_glycoprotein(NC_045512: + : 21563-25384)	262-270
1	2361-2370	PRRARSVRYP linker 1-10
1	2371-2385	EFQFCNYPFLGVYHK	surface_glycoprotein@Norway(NC_045512@Norway: + : 21563-25384)	129-143
1	2386-2395	PRRARSVRYP linker 1-10
1	2396-2405	DGYVMHANYI	2′-O-ribose_methyltransferase(NC_045512: + : 20659-21552)	220-229
1	2406-2415	PRRARSVRYP linker 1-10
1	2416-2423	EHVQIHTI	ORF3a_protein(NC_045512: + : 25393-26220)	242-249
1	2424-2433	PRRARSVRYP linker 1-10
1	2434-2448	EFQFCNDPFLGVYYH	surface_glycoprotein@Chile(NC_045512@Chile: + : 21563-25384)	132-146
1	2449-2458	PRRARSVRYP linker 1-10
1	2459-2481	SHGKQVVSDIDYVPLKSATCITR	3′-to-5′_exonuclease(NC_045512: + : 10840-19620)	454-476
1	2482-2491	PRRARSVRYP linker 1-10
1	2492-2507	SLRCGACIRRPFLCCK	helicase@Aruba(NC-045512@Aruba: + : 16237-18039)	13-28
1	2508-2517	PRRARSVRYP linker 1-10
1	2518-2526	FFSNVTWFH	surface_glycoprotein@Chile(NC_045512@Chile: + : 21563-25384)	58-66
2	1-11	GPKVKYLYFIK	nsp9(NC_045512: + : 12686-13024)	82-92
2	12-21	PRRARSVRYP linker 1-10
2	22-33	TEISFMLWCKDG	endoRNAase(NC_045512: + : 184-192)	325-336
2	34-43	PRRARSVRYP linker 1-10
2	44-61	LNDLCFTNVYADSFVIRG	surface_glycoprotein(NC_045512: + : 21563-25384)	387-404
2	62-71	PRRARSVRYP linker 1-10
2	72-79	WFTALTQH	nucleocapsid_phosphoprotein(NC_045512: + : 28274-29533)	52-59
2	80-89	PRRARSVRYP linker 1-10
2	90-99	LSVNPYVCNA	helicase@Cyprus(NC-045512@Cyprus: + : 16237-18039)	43-52
2	100-109	PRRARSVRYP linker 1-10
2	110-124	ARSVARQSIIAYTMS	surface_glycoprotein@Mozambiqye(NC_045512@Mozambique: + : 21563-25384)	680-694
2	125-134	PRRARSVRYP linker 1-10
2	135-149	TYACWHHSIGFDYVY	3′-to-5′_exonuclease(NC_045512: + : 10840-19620)	223-237
2	150-159	PRRARSVRYP linker 1-10
2	160-180	VMFLARGIVFMCVDYCPIFFI	nsp6@Cyprus(NC_04551@Cyprus: + : 10973-11842)	179-199
2	181-190	PRRARSVRYP linker 1-10
2	191-200	AGAALQIPFA	surface_glycoprotein@Nigeria(NC_045512@Nigeria: + : 21563-25384)	886-895
2	201-210	PRRARSVRYP linker 1-10
2	211-218	PVLKGVKL	surface_glycoprotein@Aruba(NC_045512@Aruba: + : 21563-25384)	1259-1266
2	219-228	PRRARSVRYP linker 1-10
2	229-238	SPGVVNPVME	ORF3a_protein@Brazil(NC_045512@Brazil: + : 25393-26220)	252-261
2	239-248	PRRARSVRYP linker 1-10
2	249-258	KNTVCTVCGM	nsp10(NC_045512: + : 13025-13441)	113-122
2	259-268	PRRARSVRYP linker 1-10
2	269-289	KLSYGIAIVREVLSDRELHLS	helicase@Colombia(NC-045512@Colombia: + : 16237-18039)	146-166
2	290-299	PRRARSVRYP linker 1-10
2	300-314	VEHVTFFIYNKIVDE	ORF3a_protein(NC_045512: + : 25393-26220)	225-239
2	315-324	PRRARSVRYP linker 1-10
2	325-332	NNLVVMAY	nsp2(NC_045512: + : 806-2719)	413-420
2	333-342	PRRARSVRYP linker 1-10
2	343-351	VLGSLAATV	nsp9(NC_045512: + : 12686-13024)	102-110
2	352-361	PRRARSVRYP linker 1-10
2	362-370	VFSQCVNLT	surface_glycoprotein@Egypt(NC_045512@Egypt: + : 21563-25384)	11-19
2	371-380	PRRARSVRYP linker 1-10
2	381-392	IEVQGYKSVNIT	nsp3(NC_045512: + : 2720-8554)	13-24
2	393-402	PRRARSVRYP linker 1-10
2	403-410	PEHSLAEY	nsp2(NC_045512: + : 806-2719)	200-207
2	411-420	PRRARSVRYP linker 1-10
2	421-433	SMWALIISVTSNY	nsp6@Aruba(NC_04551@Aruba: + : 10973-11842)	160-172
2	434-443	PRRARSVRYP linker 1-10
2	444-462	LEILDITPCSFGGVSVITP	surface_glycoprotein(NC_045512: + : 21563-25384)	582-600
2	463-472	PRRARSVRYP linker 1-10
2	473-480	YDFVVSKG	RNA-dependent_RNA_polymerase@Japan(NC_045512@Japan: + :	420-427
			13442-13468 + 13468-16236)
2	481-490	PRRARSVRYP linker 1-10
2	491-498	LPINVIVF	nsp3(NC_045512: + : 2720-8554)	1718-1725
2	499-508	PRRARSVRYP linker 1-10
2	509-530	QLALSKGVHFVCNLLLLFVTVY	ORF3a_protein@Australia(NC_045512@Australia: + : 25393-26220)	70-91
2	531-540	PRRARSVRYP linker 1-10
2	541-565	KNPLLYDANYFLCWHTNCYDYCIPY	ORF3a_protein@Aruba(NC_045512@Aruba: + : 25393-26220)	136-160
2	566-575	PRRARSVRYP linker 1-10
2	576-591	FLVLLPLVSSQCVNLT	surface_glycoprotein@Aruba(NC_045512@Aruba: + : 21563-25384)	4-19
2	592-601	PRRARSVRYP linker 1-10
2	602-609	RVEAFEYY	nsp3(NC_045512: + : 2720-8554)	810-817
2	610-619	PRRARSVRYP linker 1-10
2	620-633	LSPVALRQMSCAAAG	nsp9(NC_045512: + : 12686-13024)	4-17
2	634-643	PRRARSVRYP linker 1-10
2	644-651	VQLRVIGH	3C-like_proteinase(NC_045512: + : 10055-10972)	73-80
2	652-661	PRRARSVRYP linker 1-10
2	662-685	TTVAAFHQECSLQLCTQHQPYVVD	ORF8_protein@USA(NC_045512@USA: + : 27894-28259)	11-34
2	686-695	PRRARSVRYP linker 1-10
2	696-716	HPNCVNCLDDRCILHCANFNV	RNA-dependent_RNA_polymerase@Australia(NC_045512@Australia: + :	295-315
			13442-13468 + 13468-16236)
2	717-726	PRRARSVRYP linker 1-10
2	727-740	GASCCLYCRCHIDH	nsp10(NC_045512: + : 13025-13441)	70-83
2	741-750	PRRARSVRYP linker 1-10
2	751-760	FCLEASFNYL	nsp3(NC_045512: + : 2720-8554)	1391-1400
2	761-770	PRRARSVRYP linker 1-10
2	771-779	ISEHDYHIG	ORF3a_protein@NorthMacedonia(NC_045512@NorthMacedonia: + : 25393-26220)	179-187
2	780-789	PRRARSVRYP linker 1-10
2	790-800	CLPFTINCQKP	ORF8_protein@Brazil(NC_045512@Brazil: + : 27894-28259)	83-93
2	801-810	PRRARSVRYP linker 1-10
2	811-818	DVLYQPPQ	nsp4(NC_045512: + : 8555-10054)	484-491
2	819-828	PRRARSVRYP linker 1-10
2	829-842	APGCDVTDVTQLYL	helicase@Aruba(NC-045512@Aruba: + : 16237-18039)	52-65
2	843-852	PRRARSVRYP linker 1-10
2	853-860	SINVANYQ	helicase@Mozambique(NC-045512@Mozambique: + : 16237-18039)	263-270
2	861-870	PRRARSVRYP linker 1-10
2	871-881	VVNAANVYLKH	nsp3(NC_045512: + : 2720-8554)	239-249
2	882-891	PRRARSVRYP linker 1-10
2	892-916	VLVQSTQWSLFFFFYENAFLPFAMG	nsp6@Iceland(NC_04551@Iceland: + : 10973-11842)	24-48
2	917-926	PRRARSVRYP linker 1-10
2	927-939	QCVQLHNDILLAK	nsp7(NC_045512: + : 11843-12091)	31-43
2	940-949	PRRARSVRYP linker 1-10
2	950-982	YEPLTQDHVDILGPLSAQTGIAVLDMCASLKEL	3C-like_proteinase(NC_045512: + : 10055-10972)	239-271
2	983-992	PRRARSVRYP linker 1-10
2	993-1006	TDTCVEHVTFFIYN	ORF3a_protein@Luxembourg(NC_045512@Luxembourg: + : 25393-26220)	221-234
2	1007-1016	PRRARSVRYP linker 1-10
2	1017-1026	YDANYFLCWH	ORF3a_protein(NC_045512: + : 25393-26220)	141-150
2	1027-1036	PRRARSVRYP linker 1-10
2	1037-1045	APLIELCVD	ORF8_protein@Bangladesh(NC_045512@Bangladesh: + : 27894-28259)	55-63
2	1046-1055	PRRARSVRYP linker 1-10
2	1056-1073	YNLLKDCPAVAKHDFFKV	RNA-dependent_RNA_polymerase@Aruba(NC_045512@Aruba: + :	87-104
			13442-13468 + 13468-16236)
2	1074-1083	PRRARSVRYP linker 1-10
2	1084-1098	RTCCLCDRRATCFST	3′-to-5′_exonuclease(NC_045512: + : 18040-19620)	205-219
2	1099-1108	PRRARSVRYP linker 1-10
2	1109-1123	FSVAALTNNVAFQTV	RNA-dependent_RNA_polymerase(NC_045512: + : 13442-13468 + 13468-16236)	396-410
2	1124-1133	PRRARSVRYP linker 1-10
2	1134-1148	ERFVSLAIDAYPLTK	RNA-dependent_RNA_polymerase(NC_045512: + : 13442-13468 + 13468-16236)	857-871
2	1149-1159	PRRARSVRYP linker 1-10
2	1159-1179	ALCEKALKYFPIDKCSRIIPA	helicase@Colombia(NC-045512@Colombia: + : 16237-18039)	316-336
2	1180-1189	PRRARSVRYP linker 1-10
2	1190-1212	RVDFCGKGYHLMSFPQSAPHGVV	surface_glycoprotein(NC_045512: + : 21563-25384)	1039-1061
2	1213-1222	PRRARSVRYP linker 1-10
2	1223-1239	GVHFVCNLLLLFVIVYS	ORF3a_protein@Malaysia(NC_045512@Malaysia: + : 25393-26220)	76-92
2	1240-1249	PRRARSVRYP linker 1-10
2	1250-1261	TFKVSIWNLDYI	ORF6_protein(NC_045512: + : 27202-27387)	21-32
2	1262-1271	PRRARSVRYP linker 1-10
2	1272-1285	SDRVVFVLWAHGFE	3′-to-5′_exonuclease(NC_045512: + : 18040-19620)	178-191
2	1286-1295	PRRARSVRYP linker 1-10
2	1296-1324	FAFACPDGVKHVYQLRARSVSPKLFIRQE	ORF7a_protein(NC_045512: + : 27394-27759)	63-91
2	1325-1334	PRRARSVRYP linker 1-10
2	1335-1343	RSVYPVASP	nsp2(NC_045512: + : 806-2719)	121-129
2	1344-1353	PRRARSVRYP linker 1-10
2	1354-1368	ALLAVFHSASKIITL	ORF3a_protein@Aruba(NC_045512@Aruba: + : 25393-26220)	51-65
2	1369-1378	PRRARSVRYP linker 1-10
2	1379-1392	IHFYSKWYIRVGAK	ORF8_protein@Mozambique(NC_045512@Mozambique: + : 27894-28259)	39-52
2	1393-1402	PRRARSVRYP linker 1-10
2	1403-1413	SAPLIELCLDE	ORF8_protein@Russia(NC_045512@Russia: + : 27894-28259)	54-64
2	1414-1423	PRRARSVRYP linker 1-10
2	1424-1436	ANFCALILAYCNK	nsp3(NC_045512: + : 2720-8554)	890-902
2	1437-1446	PRRARSVRYP linker 1-10
2	1447-1478	MMFVKHKHAFLCLFLLPSFATVAYFNMVYMPA	nsp6@Indonesia(NC_04551@Indonesia: + : 10973-11842)	57-88
2	1479-1488	PRRARSVRYP linker 1-10
2	1489-1498	ISEHDYQIGG	ORF3a_protein@FrenchGuiana(NC_045512@FrenchGuiana: + : 25393-26220)	179-188
2	1499-1508	PRRARSVRYP linker 1-10
2	1509-1516	SDDAVVCF	RNA-dependent_RNA_polymerase@Aruba(NC_045512@Aruba: + :	759-766
			13442-13468 + 13468-16236)
2	1517-1526	PRRARSVRYP linker 1-10
2	1527-1544	CANFNVLFSTVFPPTSFG	RNA-dependent_RNA_polymerase@China(NC_045512@China: + :	310-327
			13442-13468 + 13468-16236)
2	1545-1554	PRRARSVRYP linker 1-10
2	1555-1583	SMWALIISVTSNYSGVVTIVMFLARGIVF	nsp6@SmallSouthAmerica(NC_04551@SmallSouthAmerica: + : 10973-11842)	160-188
2	1584-1593	PRRARSVRYP linker 1-10
2	1594-1610	YADVFHLYLQYIRKLHD	RNA-dependent_RNA_polymerase(NC_045512: + : 13442-13468 + 13468-16236)	877-893
2	1611-1620	PRRARSVRYP linker 1-10
2	1621-1628	FNSVCRLM	helicase@Aruba(NC-045512@Aruba: + : 16237-18039)	422-429
2	1629-1638	PRRARSVRYP linker 1-10
2	1639-1647	SEAFLIGCN	2′-O-ribose_methyltransferase(NC_045512: + : 20659-21552)	202-210
2	1648-1657	PRRARSVRYP linker 1-10
2	1658-1671	KHWPQIAQFAPSAS	nucleocapsid_phosphoprotein@Australia(NC_045512@Australia: + :	299-312
			28274-29533)
2	1672-1681	PRRARSVRYP linker 1-10
2	1682-1698	INFVRIIMRLWLCCKCR	ORF3a_protein@Australia(NC_045512@Australia: + : 25393-26220)	118-134
2	1699-1708	PRRARSVRYP linker 1-10
2	1709-1724	EEIIYNLLKDCPAVAK	RNA-dependent_RNA_polymerase@Senegal(NC_045512@Senegal: + :	83-98
			13442-13468 + 13468-16236)
2	1725-1734	PRRARSVRYP linker 1-10
2	1735-1750	SRIIPARAVDCFDKF	helicase@Brazil(NC-045512@Brazil: + : 16237-18039)	331-346
2	1751-1760	PRRARSVRYP linker 1-10
2	1761-1771	EQYVFCTVNAL	helicase(NC-045512: + : 16237-18039)	353-363
2	1772-1781	PRRARSVRYP linker 1-10
2	1782-1793	EVFAQVKQIYKT	surface_glycoprotein@Aruba(NC_045512@Aruba: + : 21563-25384)	776-787
2	1794-1803	PRRARSVRYP linker 1-10
2	1804-1812	ASQGLVASI	RNA-dependent_RNA_polymerase@Aruba(NC_045512@Aruba: + :	771-779
			13442-13468 + 13468-16236)
2	1813-1822	PRRARSVRYP linker 1-10
2	1823-1838	QLALSKGFHFVCNLLL	ORF3a_protein@Iceland(NC_045512@Iceland: + : 25393-26220)	70-85
2	1839-1848	PRRARSVRYP linker 1-10
2	1849-1871	TTVMFLARGIVFMCVEYCPIFFI	nsp6@Aruba(NC_04551@Aruba: + : 10973-11842)	177-199
2	1872-1881	PRRARSVRYP linker 1-10
2	1882-1895	EGVVDYGARFYFYT	nsp3(NC_045512: + : 2720-8554)	595-608
2	1896-1905	PRRARSVRYP linker 1-10
2	1906-1913	TQALPHRQ	nucleocapsid_phosphoprotein@Mozambique(NC_045512@Mozambique: + :	379-386
			28274-29533)
2	1914-1923	PRRARSVRYP linker 1-10
2	1924-1946	VAAGLEAPFFYLYALVYFLQSIN	ORF3a_protein@Ecuador(NC_045512@Ecuador: + : 25393-26220)	97-119
2	1947-1956	PRRARSVRYP linker 1-10
2	1957-1979	LIAIVMVTIMLCCITSCCSCLKG	surface_glycoprotein@Mozambique(NC_045512@Mozambique: + : 21563-25384)	1220-1242
2	1980-1989	PRRARSVRYP linker 1-10
2	1990-1997	AWLYAAVI	3C-like_proteinase(NC_045512: + : 10055-10972)	206-213
2	1998-2007	PRRARSVRYP linker 1-10
2	2008-2016	AGFSLWVYK	3′-to-5′_exonuclease(NC_045512: + : 18040-19620)	504-512
2	2017-2026	PRRARSVRYP linker 1-10
2	2027-2045	ECAQVLSETVMCGGSLYVK	RNA-dependent_RNA_polymerase@Aruba(NC_045512@Aruba: + :	658-676
			13442-13468 + 13468-16236)
2	2046-2055	PRRARSVRYP linker 1-10
2	2056-2071	GSNVFQTRAGCLIGAE	surface_glycoprotein(NC_045512: + : 21563-25384)	639-654
2	2072-2081	PRRARSVRYP linker 1-10
2	2082-2099	VTTVIFLARGIVFMCVEY	nsp6@Malaysia(NC_04551@Malaysia: + : 10973-11842)	179-196
2	2100-2109	PRRARSVRYP linker 1-10
2	2110-2134	VLVQSTQWSLFFFLYENAFLPFAMG	nsp6@Aruba(NC_04551@Aruba: + : 10973-11842)	24-48
2	2135-2144	PRRARSVRYP linker 1-10
2	2145-2154	NYQCGHYKHI	nsp3(NC_045512: + : 2720-8554)	1012-1021
2	2155-2164	PRRARSVRYP linker 1-10
2	2165-2177	WNVVRIKIVQMLS	3′-to-5′_exonuclease(NC_045512: + : 18040-19620)	159-171
2	2178-2187	PRRARSVRYP linker 1-10
2	2188-2196	TEIYQAGST	surface_glycoprotein@Aruba(NC_045512@Aruba: + : 21563-25384)	466-474
2	2197-2206	PRRARSVRYP linker 1-10
2	2207-2226	PINLVRGLPQGFSVLEPLVD	surface_glycoprotein@SmallAfrica(NC_045512@SmallAfrica: + : 21563-25384)	209-228
2	2227-2236	PRRARSVRYP linker 1-10
2	2237-2253	SAAYYVGYLQLRTFLLK	surface_glycoprotein@Italy(NC_045512@Italy: + : 21563-25384)	258-274
2	2254-2263	PRRARSVRYP linker 1-10
2	2264-2272	FEHIVYGDF	endoRNAse(NC_045512: + : 19621-20658)	232-240
2	2273-2282	PRRARSVRYP linker 1-10
2	2283-2296	ETKCTLKSFTVEKG	surface_glycoprotein@Aruba(NC_045512@Aruba: + : 21563-25384)	294-307
2	2297-2306	PRRARSVRYP linker 1-10
2	2307-2315	KHWPQIAQF	nucleocapsid_phosphoprotein(NC_045512: + : 28274-29533)	299-307
2	2316-2325	PRRARSVRYP linker 1-10
2	2326-2335	KCAYWVPRAS	nsp2(NC_045512: + : 806-2719)	239-248
2	2336-2345	PRRARSVRYP linker 1-10
2	2346-2360	AYYVGYLQPRTFLLK	surface_glycoprotein@Aruba(NC_045512@Aruba: + : 21563-25384)	260-274
2	2361-2370	PRRARSVRYP linker 1-10
2	2371-2388	IKVCEFQFCNDPFLGVHY	surface_glycoprotein@Aruba(NC_045512@Aruba: + : 21563-25384)	125-142
2	2389-2398	PRRARSVRYP linker 1-10
2	2399-2410	TRAKVGILCITS	helicase@SouthKorea(NC-045512@SouthKorea: + : 16237-18039)	566-577
2	2411-2420	PRRARSVRYP linker 1-10
2	2421-2434	SYLFQHANLDSCKR	nsp3(NC_045512: + : 2720-8554)	915-928
2	2435-2444	PRRARSVRYP linker 1-10
2	2445-2464	MTSCCSCLKGCCSCGSCCKF	surface_glycoprotein(NC_045512: + : 21563-25384)	1237-1256
2	2465-2474	PRRARSVRYP linker 1-10
2	2475-2488	LVLLPLVSSQCVNF	surface_glycoprotein@Brazil(NC_045512@Brazil: + : 21563-25384)	5-18
2	2489-2498	PRRARSVRYP linker 1-10
2	2499-2506	CLNRVCTN	nsp3(NC_045512: + : 2720-8554)	1342-1349
2	2507-2516	PRRARSVRYP linker 1-10
2	2517-2537	AVLYQGVNCTEVPFAIHADQL	surface_glycoprotein@SmallAfrica(NC_045512@SmallAfrica: + :	506-625
			21563-25384)
3	1-17	LECNVKTTEVVGDIILK	nsp3(NC_045512: + : 2720-8554)	1244-1260
3	18-27	PRRARSVRYP linker 1-10
3	28-44	EVTPSGTWLTYTGAIKL	nucleocapsid_phosphoprotein@Bulgaria(NC_045512@Bulgaria: + :	323-339
			28274-29533)
3	45-54	PRRARSVRYP linker 1-10
3	55-68	LKEILVTYNCCDDD	RNA-dependent_RNA_polymerase(NC_045512: + : 13442-13468 + 13468-16236)	142-155
3	69-78	PRRARSVRYP linker 1-10
3	79-100	INLVRDLPQGFSALEPLVDLPI	surface_glycoprotein@Aruba(NC_045512@Aruba: + : 21563-25384)	206-227
3	101-110	PRRARSVRYP linker 1-10
3	111-120	ETFVTHSKGL	nsp2(NC_045512: + : 806-2719)	527-536
3	121-130	PRRARSVRYP linker 1-10
3	131-141	YDNLQFISLEI	helicase@Austria(NC-045512@Austria: + : 16237-18039)	582-592
3	142-151	PRRARSVRYP linker 1-10
3	152-178	AKYTQLCQYLNTLTLAVPYNMRVIHFG	2′-O-ribose_methyltransferase(NC_045512: + : 20659-21552)	45-71
3	179-188	PRRARSVRYP linker 1-10
3	189-203	VNCTEVPVAIHADQL	surface_glycoprotein(NC_045512: + : 21563-25384)	615-629
3	204-213	PRRARSVRYP linker 1-10
3	214-221	ISEHDYQI	ORF3a_protein@Aruba(NC_045512@Aruba: + : 25393-26220)	179-186
3	222-231	PRRARSVRYP linker 1-10
3	232-245	TSGVGYQPYRVVVL	surface_glycoprotein@Aruba(NC_045512@Aruba: + : 21563-25384)	496-509
3	246-255	PRRARSVRYP linker 1-10
3	256-266	ITNCVKMLCTH	nsp10(NC_045512: + : 13025-13441)	38-48
3	267-276	PRRARSVRYP linker 1-10
3	277-284	VVNPVMEP	ORF3a_protein(NC_045512: + : 25393-26220)	255-262
3	285-294	PRRARSVRYP linker 1-10
3	295-314	JYQECVRGTTVLLKEPCSSG	ORF7a_protein(NC_045512: + : 27394-27759)	19-38
3	315-324	PRRARSVRYP linker 1-10
3	325-339	SYELQTPFEIKLAKK	nsp2(NC_045512: + : 806-2719)	68-82
3	340-349	PRRARSVRYP linker 1-10
3	350-357	SSIVITSG	ORF3a_protein@SouthKorea(NC_045512@SouthKorea: + : 25393-26220)	165-172
3	358-367	PRRARSVRYP linker 1-10
3	368-377	KACVEEVTTT	nsp3(NC_045512: + : 2720-8554)	415-424
3	378-387	PRRARSVRYP linker 1-10
3	388-405	DKACPLIAAVITREVGFV	nsp4(NC_045512: + : 8555-10054)	85-102
3	406-415	PRRARSVRYP linker 1-10
3	416-426	YCPRHVICTSE	3C-like_proteinase(NC_045512: + : 10055-10972)	37-47
3	427-436	PRRARSVRYP linker 1-10
3	437-452	ANSIVCRFDTRVLSNL	3′-to-5′_exonuclease(NC_045512: + : 18040-19620)	394-409
3	453-462	PRRARSVRYP linker 1-10
3	463-470	SSIVITSV	ORF3a_protein@Aruba(NC_045512@Aruba: + : 25393-26220)	165-172
3	471-480	PRRARSVRYP linker 1-10
3	481-509	FLYIIKLIFLWLLWPVTLACFVLAAVYRI	membrane_glycoprotein@Aruba(NC_045512@Aruba: + : 26523-27191)	45-73
3	510-519	PRRARSVRYP linker 1-10
3	520-527	MADLVYAL	RNA-dependent_RNA_polymerase(NC_045512: + : 13442-13468 + 13468-16236)	124-131
3	528-537	PRRARSVRYP linker 1-10
3	538-545	KLGASQRV	membrane_glycoprotein(NC_045512: + : 26523-27191)	180-187
3	546-555	PRRARSVRYP linker 1-10
3	556-567	FRSSVLHSTRDL	surface_glycoprotein@Nigeria(NC_045512@Nigeria: + : 21563-25384)	43-54
3	568-577	PRRARSVRYP linker 1-10
3	578-588	FFSNVTWFHVS	surface_glycoprotein@Nigeria(NC_045512@Nigeria: + : 21563-25384)	58-68
3	589-598	PRRARSVRYP linker 1-10
3	599-611	AFASEAARVVRSI	nsp2(NC_045512: + : 806-2719)	355-367
3	612-621	PRRARSVRYP linker 1-10
3	622-633	SSPDAVTAYNGY	nsp3(NC_045512: + : 2720-8554)	660-671
3	634-643	PRRARSVRYP linker 1-10
3	644-656	KASCTLSEQLDFI	nsp2(NC_045512: + : 806-2719)	30-42
3	657-666	PRRARSVRYP linker 1-10
3	667-676	GNCDVVIGIV	surface_glycoprotein(NC_045512: + : 21563-25384)	1124-1133
3	677-686	PRRARSVRYP linker 1-10
3	687-699	YTELEPPCRFVTD	nsp9(NC_045512: + : 12686-13024)	66-78
3	700-709	PRRARSVRYP linker 1-10
3	710-717	AEVQIDRL	surface_glycoprotein(NC_045512: + : 21563-25384)	989-996
3	718-727	PRRARSVRYP linker 1-10
3	728-741	RLNVGDYFVLTSHT	helicase@Austria(NC-045512@Austria: + : 16237-18039)	218-231
3	442-751	PRRARSVRYP linker 1-10
3	752-778	FSASTSAFVETVKGLDYKAFKQIVESC	nsp2(NC_045512: + : 806-2719)	300-326
3	779-788	PRRARSVRYP linker 1-10
3	789-806	QLALFKGVHFVCNLLLLF	ORF3a_protein@CostaRica(NC_045512@CostaRica: + : 25393-26220)	70-87
3	807-816	PRRARSVRYP linker 1-10
3	817-839	KEITVATSRTLSYYKLGASQRVA	membrane_glycoprotein@Aruba(NC_045512@Aruba: + : 26523-27191)	166-188
3	840-849	PRRARSVRYP linker 1-10
3	850-857	SQDLSVVS	endoRNAse(NC_045512: + : 19621-20658)	308-315
3	858-867	PRRARSVRYP linker 1-10
3	868-877	EGSVRVVTTF	nsp4(NC_045512: + : 8555-10054)	207-216
3	878-887	PRRARSVRYP linker 1-10
3	888-904	PNFVFPLNSIIKTIQPR	nsp2(NC_045512: + : 806-2719)	91-107
3	905-914	PRRARSVRYP linker 1-10
3	915-930	AFKLNIKLLGVGGKPC	nsp6(NC_045512: + : 10973-11842)	268-283
3	931-940	PRRARSVRYP linker 1-10
3	941-950	TLPVNVAFEL	endoRNAse(NC_045512: + : 19621-20658)	48-57
3	951-960	PRRARSVRYP linker 1-10
3	961-968	TQALLQRQ	nucleocapsid_phosphoprotein@CostaRica(NC_045512@CostaRica: + :	379-386
			28274-29533)
3	969-978	PRRARSVRYP linker 1-10
3	979-989	SPGVFNPVMEP	ORF3a_protein@Colombia(NC_045512@Colombia: + : 25393-26220)	252-262
3	990-999	PRRARSVRYP linker 1-10
3	1000-1014	VCNLLLLFVTVYSHL	ORF3a_protein@Croatia(NC_045512@Croatia: + : 25393-26220)	80-94
3	1015-1024	PRRARSVRYP linker 1-10
3	1025-1049	AAGLEAPFLYLYVLVYFLQSINFVR	ORF3a_protein@Norway(NC_045512@Norway: + : 25393-26220)	98-122
3	1050-1059	PRRARSVRYP linker 1-10
3	1060-1067	APLEILCV	ORF8_protein(NC_045512: + : 27894-28259)	55-62
3	1068-1077	PRRARSVRYP linker 1-10
3	1078-1098	HPNCVNCSDDRCILHCANFNV	RNA-dependent_RNA_polymerase@Aruba(NC_045512@Aruba: + :	295-315
			13442-13468 + 13468-16236)
3	1099-1108	PRRARSVRYP linker 1-10
3	1109-1123	FKELLVYAADPAMHA	RNA-dependent_RNA_polymerase(NC_045512: + : 13442-13468 + 13468-16236)	368-382
3	1124-1133	PRRARSVRYP linker 1-10
3	1134-1153	KLTCATTRQVVNVVTTKIAL	nsp3(NC_045512: + : 2720-8554)	1923-1942
3	1154-1163	PRRARSVRYP linker 1-10
3	1164-1175	FRSSVLHSTQDL	surface_glycoprotein@Aruba(NC_045512@Aruba: + : 21563-25384)	43-54
3	1176-1185	PRRARSVRYP linker 1-10
3	1186-1199	SVASQSIIAYTMSL	surface_glycoprotein@Aruba(NC_045512@Aruba: + : 21563-25384)	678-691
3	1200-1209	PRRARSVRYP linker 1-10
3	1210-1225	LVDFQVTIAEILLIIM	ORF6_protein(NC_045512: + : 27202-27387)	4-19
3	1226-1235	PRRARSVRYP linker 1-10
3	1236-1244	YDLSVVNAR	helicase(NC_045512: + : 16237-18039)	382-390
3	1245-1254	PRRARSVRYP linker 1-10
3	1255-1274	FCKLHNWNCVNCDTFCAGST	nsp3(NC_045512: + : 2720-8554)	1626-1645
3	1275-1284	PRRARSVRYP linker 1-10
3	1285-1294	GVGGKPCIKV	nsp6@Aruba(NC_045512@Aruba: + : 10973-11842)	274-283
3	1295-1304	PRRARSVRYP linker 1-10
3	1305-1325	ELVIGAVILRGHLRIAGHHLG	membrane_glycoprotein@Aruba(NC_045512@Aruba: + : 26523-27191)	137-157
3	1326-1335	PRRARSVRYP linker 1-10
3	1336-1345	TPLIQPIGAL	nsp4(NC_045512: + : 8555-10054)	269-278
3	1346-1355	PRRARSVRYP linker 1-10
3	1356-1369	TCFSVAATNNVAF	RNA-dependent_RNA_polymerase@Aruba(NC_045512@Aruba: + :	394-407
			13442-13468 + 13468-16236)
3	1370-1379	PRRARSVRYP linker 1-10
3	1380-1402	TIATYCTGSIPCSVCLSGLDSLD	nsp3(NC_045512: + : 2720-8554)	1459-1481
3	1403-1412	PRRARSVRYP linker 1-10
3	1413-1430	CANFNVLFSTVFPFTSFG	RNA-dependent_RNA_polymerase@Nigeria(NC_045512@Nigeria: + :	310-327
			13442-13468 + 13468-16236)
3	1431-1440	PRRARSVRYP linker 1-10
3	1441-1454	TKDVVECLKLSHQS	nsp3(NC_045512: + : 2720-8554)	1830-1843
3	1455-1464	PRRARSVRYP linker 1-10
3	1465-1482	IKDLPKEITVATSRTLSY	membrane_glycoprotein(NC_045512: + : 26523-27191)	161-178
3	1483-1492	PRRARSVRYP linker 1-10
3	1493-1524	IMASLVLARKHTTCCSLSHRFYRLANECAQVL	RNA-dependent_RNA_polymerase(NC_045512: + : 13442-13468 + 13468-16236)	632-663
3	1525-1534	PRRARSVRYP linker 1-10
3	1535-1549	SYFAIGLALYYPSAR	helicase@Austria(NC-045512@Austria: + : 16237-18039)	289-303
3	1550-1559	PRRARSVRYP linker 1-10
3	1560-1569	KSASVYYSQL	nsp3(NC_045512: + : 2720-8554)	1737-1746
3	1570-1579	PRRARSVRYP linker 1-10
3	1580-1591	DTSLKLKECVMY	nsp6@SmallAsia(NC_045512@SmallAsia: + : 10973-11842)	102-113
3	1592-1601	PRRARSVRYP linker 1-10
3	1602-1617	FRELGVVHNQDVNLHS	RNA-dependent_RNA_polymerase(NC_045512: + : 13442-13468 + 13468-16236)	348-363
3	1618-1627	PRRARSVRYP linker 1-10
3	1628-1664	VAAGLEAPFLYLYALVYFLQSINFVRIIMRLW	ORF3a_protein@Aruba(NC_045512@Aruba: + : 25393-26220)	97-133
		LCWKC
3	1665-1674	PRRARSVRYP linker 1-10
3	1675-1683	VTANVNALL	RNA-dependent_RNA_polymerase(NC_045512: + : 13442-13468 + 13468-16236)	700-708
3	1684-1693	PRRARSVRYP linker 1-10
3	1694-1713	SEAVEAPLVGTPVCINGLML	nsp2(NC_045512: + : 806-2719)	591-610
3	1714-1723	PRRARSVRYP linker 1-10
3	1724-1738	INAACRKVQHMVVKA	3′-to-5′_exonuclease(NC_045512: + : 18040-19620)	305-319
3	1739-1748	PRRARSVRYP linker 1-10
3	1749-1759	ETTVDIVVFDE	helicase@SmallAsia(NC-045512@SmallAsia: + : 16237-18039)	365-375
3	1760-1769	PRRARSVRYP linker 1-10
3	1770-1793	TYASALWEIQQVVDADSKIVQLSE	nsp8(NC_045512: + : 12092-12685)	148-171
3	1794-1803	PRRARSVRYP linker 1-10
3	1804-1823	RAKHYVYIGDPAQLPAPRTL	helicase(NC_045512: + : 16237-18039)	392-411
3	1824-1833	PRRARSVRYP linker 1-10
3	1834-1847	DGCVPLNIIPLTTA	nsp8(NC_045512: + : 12092-12685)	112-125
3	1848-1857	PRRARSVRYP linker 1-10
3	1858-1866	KLMVVIPDY	nsp8(NC_045512: + : 12092-12685)	127-135
3	1867-1876	PRRARSVRYP linker 1-10
3	1877-1884	PSFLGRYM	nsp3(NC_045512: + : 2720-8554)	822-829
3	1885-1894	PRRARSVRYP linker 1-10
3	1895-1908	FGTVYEKLKPVLDW	nsp2(NC_045512: + : 806-2719)	437-450
3	1909-1918	PRRARSVRYP linker 1-10
3	1919-1929	AALALLLLDRL	nucleocapsid_phosphoprotein@Aruba(NC_045512@Aruba: + : 28274-29533)	217-227
3	1930-1939	PRRARSVRYP linker 1-10
3	1940-1947	EIYQAGSK	surface_glycoprotein@Mexico(NC_045512@Mexico: + : 21563-25384)	471-478
3	1948-1957	PRRARSVRYP linker 1-10
3	1958-1966	DYYQLYSTQ	ORF3a_protein(NC_045512: + : 25393-26220)	210-218
3	1967-1976	PRRARSVRYP linker 1-10
3	1977-1992	LQSLQTYVTQQLIRAA	surface_glycoprotein(NC_045512: + : 21563-25384)	1001-1016
3	1993-2002	PRRARSVRYP linker 1-10
3	2003-2015	NFRVQPTESIVRF	surface_glycoprotein(NC_045512: + : 21563-25384)	317-329
3	2016-2025	PRRARSVRYP linker 1-10
3	2026-2036	GEVPVSIINNT	endoRNAse(NC_045512: + : 19621-20658)	20-30
3	2037-2046	PRRARSVRYP linker 1-10
3	2047-2069	YALVYFLQSINFVIIIMRLWLCW	ORF3a_protein@Denmark(NC_045512@Denmark: + : 25393-26220)	109-131
3	2070-2079	PRRARSVRYP linker 1-10
3	2080-2091	LKKLKKSLNVAK	nsp8(NC_045512: + : 12092-12685)	35-46
3	2092-2101	PRRARSVRYP linker 1-10
3	2102-2109	FTGCVIAW	surface_glycoprotein(NC_045512: + : 21563-25384)	429-436
3	2110-2119	PRRARSVRYP linker 1-10
3	2121-2130	SELVIGAVILR	membrane_glycoprotein(NC_045512: + : 26523-27191)	136-146
3	2131-2140	PRRARSVRYP linker 1-10
3	2141-2160	PINLVRGLPQGFSALEPLVD	surface_glycoprotein@Austria(NC_045512@Austria: + : 21563-25384)	205-224
3	2161-2170	PRRARSVRYP linker 1-10
3	2171-2182	HEFCSQHTMLVK	RNA-dependent_RNA_polymerase(NC_045512: + : 13442-13468 + 13468-16236)	810-821
3	2183-2192	PRRARSVRYP linker 1-10
3	2193-2203	RFQLHRSYLTP	surface_glycoprotein@Austria(NC_045512@Austria: + : 21563-25384)	233-243
3	2204-2213	PRRARSVRYP linker 1-10
3	2214-2227	RNLQHRLYECLYRN	RNA-dependent_RNA_polymerase(NC_045512: + : 13442-13468 + 13468-16236)	721-734
3	2228-2237	PRRARSVRYP linker 1-10
3	2238-2245	FNSVCRFM	helicase@Malaysia(NC_045512@Malaysia: + : 16237-18039)	422-429
3	2246-2255	PRRARSVRYP linker 1-10
3	2256-2270	IPIRASLPFWGLIVG	ORF3a_protein@Iceland(NC_045512@Iceland: + : 25393-26220)	35-49
3	2271-2280	PRRARSVRYP linker 1-10
3	2281-2295	ALLAVFQSASKIITL	ORF3a_protein@Bangladesh(NC_045512@Bangladesh: + : 25393-26220)	51-65
3	2296-2305	PRRARSVRYP linker 1-10
3	2306-2315	FEYVSQPFLM	surface_glycoprotein@Aruba(NC_045512@Aruba: + : 21563-25384)	164-173
3	2316-2325	PRRARSVRYP linker 1-10
3	2326-2335	KQYGDCLGNI	surface_glycoprotein@Jordan(NC_045512@Jordan: + : 21563-25384)	831-840
3	2336-2345	PRRARSVRYP linker 1-10
3	2346-2360	VDTSLSSLKLKDCVM	nsp6@Latvia(NC_045512@Latvia: + : 10973-11842)	101-115
3	2361-2370	PRRARSVRYP linker 1-10
3	2371-2379	YGIIWVATE	nucleocapsid_phosphoprotein@SmallSouthAmerica(NC_045512@	128-136
			SmallSouthAmterica: + : 28274-29533)
3	2380-2389	PRRARSVRYP linker 1-10
3	2390-2408	ANSVFNICQSVTANVNALL	RNA-dependent_RNA_polymerase@Croatia(NC_045512@Croatia: + :	690-708
			13442-13468 + 13468-16236)
3	2409-2418	PRRARSVRYP linker 1-10
3	2419-2428	QEHYVRITGL	helicase(NC_045512: + : 16237-18039)	243-252
3	2429-2438	PRRARSVRYP linker 1-10
3	2439-2446	YDPLQPEL	surface_glycoprotein(NC_045512: + : 21563-25384)	1138-1145
3	2447-2456	PRRARSVRYP linker 1-10
3	2457-2465	EVFAQVKQI	surface_glycoprotein(NC_045512: + : 21563-25384)	780-788
3	2466-2475	PRRARSVRYP linker 1-10
3	2476-2491	FLVLLPLVSIQCVNLT	surface_glycoprotein@SmallNorthAmerica(NC_045512@SmallNorthAmerica: + :	4-19
			21563-25384)
3	2492-2501	PRRARSVRYP linker 1-10
3	2502-2511	KQYGDCLGDI	surface_glycoprotein(NC_045512: + : 21563-25384)	835-844
3	2512-2521	PRRARSVRYP linker 1-10
3	2522-2536	YNLLKGCPAVAKHDF	RNA-dependent_RNA_polymerase@Poland(NC_045512@Poland: + :	87-101
			13442-13468 + 13468-16236)
4	1-14	ANPVLPFNDGVYFA	surface_glycoprotein@Austria(NC_045512@Austria: + : 21563-25384)	77-90
4	15-24	PRRARSVRYP linker 1-10
4	25-35	GKPVPYCYDTN	nsp4(NC_045512: + : 8555-10054)	164-174
4	36-45	PRRARSVRYP linker 1-10
4	46-57	VTMPLGYVTHGL	nsp3(NC_045512: + : 2720-8554)	628-639
4	58-67	PRRARSVRYP linker 1-10
4	68-79	FNCYFPLQSYGF	surface_glycoprotein(NC_045512: + : 21563-25384)	486-497
4	80-89	PRRARSVRYP linker 1-10
4	90-113	PINLVRDLPQGFSVLEPLVDLPIG	surface_glycoprotein@Belgium(NC_045512@Belgium: + : 21563-25384)	205-228
4	114-123	PRRARSVRYP linker 1-10
4	124-144	QWNLVIGFLFLTWICLLQFAY	membrane_glycoprotein@Aruba(NC_045512@Aruba: + : 26523-27191)	19-39
4	145-154	PRRARSVRYP linker 1-10
4	155-176	SDFVRATATIPIQASLPFGWLI	ORF3a_protein@Aruba(NC_045512@Aruba: + : 25393-26220)	26-47
4	177-186	PRRARSVRYP linker 1-10
4	187-197	AVHECFVKRVD	3′-to-5′_exonuclease(NC_045512: + : 18040-19620)	281-291
4	198-207	PRRARSVRYP linker 1-10
4	208-215	ETQALPQR	nucleocapsid_phosphoprotein@SmallNorthAmerica(NC_045512@	378-385
			SmallNorthAmterica: + : 28274-29533)
4	216-225	PRRARSVRYP linker 1-10
4	226-238	LLNVPLHGTILTR	membrane_glycoprotein(NC_045512: + : 26523-27191)	119-131
4	239-248	PRRARSVRYP linker 1-10
4	249-268	RLCAYCCNIVNVSLVKPSFY	envelope_protein(NC_045512: + : 26245-26472)	38-57
4	269-278	PRRARSVRYP linker 1-10
4	279-286	EVTPSGTW	nucleocapsid_phosphoprotein(NC_045512: + : 28274-29533)	323-330
4	287-296	PRRARSVRYP linker 1-10
4	297-306	DVVAIDYKHY	nsp3(NC_045512: + : 2720-8554)	1148-1157
4	307-316	PRRARSVRYP linker 1-10
4	317-325	SPDVDLADI	surface_glycoprotein@Chile(NC_045512@Chile: + : 21563-25384)	1161-1169
4	326-335	PRRARSVRYP linker 1-10
4	336-358	KNPLLYDANYFLCCHTNCYDYCI	ORF3a_protein@Senegal(NC_045512@Senegal: + : 25393-26220)	136-158
4	359-368	PRRARSVRYP linker 1-10
4	369-380	NIGCNHTGVVGE	nsp2(NC_045512: + : 806-2719)	250-261
4	381-390	PRRARSVRYP linker 1-10
4	391-402	AKLLHKPIVWHV	nsp3(NC_045512: + : 2720-8554)	1165-1176
4	403-412	PRRARSVRYP linker 1-10
4	413-424	VRTNVYLAVFDK	nsp3(NC_045512: + : 2720-8554)	351-362
4	425-434	PRRARSVRYP linker 1-10
4	435-446	VPVVDSYYSLLM	RNA-dependent_RNA_polymerase(NC_045512: + : 13442-13468 + 13468-16236)	231-242
4	447-456	PRRARSVRYP linker 1-10
4	457-464	DQDVLFAY	RNA-dependent_RNA_polymerase@FrenchGuiana(NC_045512@	523-530
			FrenchGuiana: + :13442-13468 + 13468-16236)
4	465-474	PRRARSVRYP linker 1-10
4	475-487	ATNVVIKVCEFQF	surface_glycoprotein(NC_045512: + : 21563-25384)	123-135
4	488-497	PRRARSVRYP linker 1-10
4	498-508	YDKLQFISLEI	helicase@SouthAfrica(NC_045512@SouthAfrica: + : 16237-18039)	582-592
4	509-518	PRRARSVRYP linker 1-10
4	519-526	SVDCTMYI	surface_glycoprotein(NC_045512: + : 21563-25384)	735-742
4	528-536	PRRARSVRYP linker 1-10
4	537-544	SDFVRATA	ORF3a_protein(NC_045512: + : 25393-26220)	26-33
4	545-554	PRRARSVRYP linker 1-10
4	555-563	ASQGLLASI	RNA-dependent_RNA_polymerase@Austria(NC_045512@Austria: + :	771-779
			13442-13468 + 13468-16236)
4	564-573	PRRARSVRYP linker 1-10
4	574-583	PFTINVQEPK	ORF8_protein@India(NC_04551@India: + : 27894-28259)	85-94
4	584-593	PRRARSVRYP linker 1-10
4	594-601	FKLASHMY	nsp3(NC_045512: + : 2720-8554)	96-103
4	602-611	PRRARSVRYP linker 1-10
4	612-625	LMNVLTLVYKVYYG	nsp6@Aruba(NC_045512@Aruba: + : 10973-11842)	139-152
4	626-635	PRRARSVRYP linker 1-10
4	636-647	SVFQSASKIITL	ORF3a_protein@Iceland(NC_045512@Iceland: + : 25393-26220)	54-65
4	648-657	PRRARSVRYP linker 1-10
4	658-680	YLGGMSYYCKSHKLPSIFPLCAN	helicase@CostaRica(NC_045512@CostaRica: + : 16237-18039)	64-86
4	681-690	PRRARSVRYP linker 1-10
4	691-700	NCYDYCIPYN	RF3a_protein(NC_045512: + : 25393-26220)	152-161
4	701-710	PRRARSVRYP linker 1-10
4	711-722	YPSLETIQITIS	nsp3(NC_045512: + : 2720-8554)	1483-1494
4	723-732	PRRARSVRYP linker 1-10
4	733-783	HFAIGLALYYPSARIVYTACSHAAVDALCEKY	helicase(NC_045512: + : 16237-18039)	290-340
		LPIDKCSRIIPARARV
4	784-793	PRRARSVRYP linker 1-10
4	794-801	STFKCYGV	surface_glycoprotein@Aruba(NC_045512@Aruba: + : 21563-25384)	371-378
4	802-811	PRRARSVRYP linker 1-10
4	812-821	GLKLKDCVMY	nsp6@Peru(NC_045512@Peru: + : 10973-11842)	107-116
4	822-831	PRRARSVRYP linker 1-10
4	832-847	DKYVRNLQHRLYECLY	RNA-dependent_RNA_polymerase@Aruba(NC_045512@Aruba: + :	717-732
			13442-13468 + 13468-16236)
4	848-857	PRRARSVRYP linker 1-10
4	858-869	ISVTTEILPVSM	surface_glycoprotein(NC_045512: + : 21563-25384)	720-731
4	870-879	PRRARSVRYP linker 1-10
4	880-908	TLQCIMLVYCFLGYGCTCYFGLFCLLNRY	nsp6@Aruba(NC_045512@Aruba: + : 10973-11842)	203-231
4	909-918	PRRARSVRYP linker 1-10
4	919-933	QIELKFNPPALQDAY	nsp3(NC_045512: + : 2720-8554)	867-881
4	934-943	PRRARSVRYP linker 1-10
4	944-951	DCATVHTA	2′-O-ribose_methyltransferase(NC_04551: + : 20659-21552)	114-121
4	952-961	PRRARSVRYP linker 1-10
4	962-981	IRRPFLCCKCCYDHVISTSH	helicase(NC_045512: + : 16237-18039)	20-39
4	982-990	PRRARSVRYP linker 1-10
4	992-1001	LPFTINCQEL	ORF8_protein@Mozambique(NC_04551@Mozambique: + : 27894-28259)	84-93
4	1002-1011	PRRARSVRYP linker 1-10
4	1012-1031	DANYFLCWHTNCYHYCIPYN	ORF3a_protein@Indonesia(NC_045512@Indonesia: + : 25393-26220)	142-161
4	1032-1041	PRRARSVRYP linker 1-10
4	1042-1051	VVADAVIKTL	nsp3(NC_045512: + : 2720-8554)	56-65
4	1052-1061	PRRARSVRYP linker 1-10
4	1062-1072	RQALLKTVQFC	RNA-dependent_RNA_polymerase@Aruba(NC_045512@Aruba: + :	183-193
			13442-13468 + 13468-16236)
4	1073-1082	PRRARSVRYP linker 1-10
4	1083-1090	TDVVYRAF	RNA-dependent_RNA_polymerase@Aruba(NC_045512@Aruba: + :	28-35
			13442-13468 + 13468-16236)
4	1091-1100	PRRARSVRYP linker 1-10
4	1101-1122	TLGVLPHVGEIPVAYRKVLLR	leader_protein(NC_045512: + : 266-805)	103-124
4	1123-1132	PRRARSVRYP linker 1-10
4	1133-1142	VMCGGSLYVK	RNA-dependent_RNA_polymerase(NC_045512: + : 13442-13468 + 13468-16236)	667-676
4	1143-1152	PRRARSVRYP linker 1-10
4	1153-1165	FQTLLALHRSYLT	surface_glycoprotein@Aruba(NC_045512@Aruba: + : 21563-25384)	234-246
4	1166-1175	PRRARSVRYP linker 1-10
4	1176-1183	VLSEARQH	leader_protein(NC_045512: + : 266-805)	38-45
4	1184-1193	PRRARSVRYP linker 1-10
4	1194-1216	GKIQDSLFSTASALGKLQDVVNQ	surface_glycoprotein@NorthMacedonia(NC_045512@NorthMacedonia: + :	928-950
			21563-25384)
4	1217-1226	PRRARSVRYP linker 1-10
4	1227-1244	KGFCDLKGKYVQIPTTCA	nsp10(NC_045512: + : 13025-13441)	87-104
4	1245-1254	PRRARSVRYP linker 1-10
4	1255-1264	GVITHDVSSA	helicase(NC_045512: + : 16237-18039)	478-487
4	1265-1274	PRRARSVRYP linker 1-10
4	1275-1284	NLIIKNLSKS	ORF6_protein(NC_045512: + : 27202-27387)	34-43
4	1285-1291	PRRARSVRYP linker 1-10
4	1295-1316	IAMACLVGLMWLSYFIASFRLF	membrane_glycoprotein@Aruba(NC_045512@Aruba: + : 26523-27191)	82-103
4	1317-1326	PRRARSVRYP linker 1-10
4	1327-1351	SDIDITFLKKDAPYIVGDVVQEGVL	nsp3(NC_045512: + : 2720-8554)	454-478
4	1352-1361	PRRARSVRYP linker 1-10
4	1362-1380	VKDCVVLHSYFTSDYYQLY	ORF3a_protein@Aruba(NC_045512@Aruba: + : 25393-26220)	197-215
4	1381-1390	PRRARSVRYP linker 1-10
4	1391-1398	TFSVLACY	3C-like_proteinase(NC_045512: + : 10055-10972)	111-118
4	1399-1408	PRRARSVRYP linker 1-10
4	1409-1420	TRAKVGILCIMS	helicase(NC_045512: + : 16237-18039)	566-577
4	1421-1430	PRRARSVRYP linker 1-10
4	1431-1448	SQHTMLVKQGDDYVYLPY	RNA-dependent_RNA_polymerase@Aruba(NC_045512@Aruba: + :	814-831
			13442-13468 + 13468-16236)
4	1449-1458	PRRARSVRYP linker 1-10
4	1459-1484	YRLANECAQVLSEMVMCGGSLYVKPG	RNA-dependent_RNA_polymerase@Australia(NC_045512@Australia: + :	653-678
			13442-13468 + 13468-16236)
4	1485-1494	PRRARSVRYP linker 1-10
4	1495-1508	IRNLQHRLYECLYR	RNA-dependent_RNA_polymerase@Austria(NC_045512@Austria: + :	720-733
			13442-13468 + 13468-16236)
4	1509-1518	PRRARSVRYP linker 1-10
4	1519-1534	TGLHPTQAPTHLSVDT	3′-to-5′_exonuclease(NC_045512: + : 18040-19620)	16-31
4	1535-1544	PRRARSVRYP linker 1-10
4	1545-1554	LAWPLIVTAL	nsp8(NC_045512: + : 12092-12685)	180-189
4	1555-1564	PRRARSVRYP linker 1-10
4	1565-1581	LTQYNRYLALYNKYKYF	nsp4(NC_045512: + : 8555-10054)	438-454
4	1582-1591	PRRARSVRYP linker 1-10
4	1592-1608	AQSFLNRVCGVSAARLT	RNA-dependent_RNA_polymerase(NC_045512: + : 13442-13468 + 13468-16236)	4-20
4	1609-1618	PRRARSVRYP linker 1-10
4	1619-1626	IAANTVIW	endoRNAse(NC_045512: + : 19621-20658)	79-86
4	1627-1636	PRRARSVRYP linker 1-10
4	1637-1647	CYTPSLKLIEYT	nsp4(NC_045512: + : 8555-10054)	133-143
4	1648-1657	PRRARSVRYP linker 1-10
4	1658-1665	DSYFVVKR	RNA-dependent_RNA_polymerase(NC_045512: + : 13442-13468 + 13468-16236)	67-74
4	1666-1675	PRRARSVRYP linker 1-10
4	1676-1691	SEFSSLPSYAAFATAQ	nsp8(NC_045512: + : 12092-12685)	4-19
4	1692-1701	PRRARSVRYP linker 1-10
4	1702-1715	ESVVKDCVVLHSYF	ORF3a_protein@CostaRica(NC_045512@CostaRica: + : 25393-26220)	194-207
4	1716-1725	PRRARSVRYP linker 1-10
4	1726-1747	GYQPYRVVVLSFELLHAPATVC	surface_glycoprotein(NC_045512: + : 21563-25384)	504-525
4	1748-1757	PRRARSVRYP linker 1-10
4	1758-1772	EVPANSTVLSFCAFA	nsp10(NC_045512: + : 13025-13441)	6-20
4	1773-1782	PRRARSVRYP linker 1-10
4	1783-1798	TVLKKCKSAFYILPSI	nsp3(NC_045512: + : 2720-8554)	526-541
4	1799-1808	PRRARSVRYP linker 1-10
4	1809-1825	INFVRIIMRLWLCLKCR	ORF3a_protein@Mozambique(NC_045512@Mozambique: + : 25393-26220)	118-134
4	1826-1835	PRRARSVRYP linker 1-10
4	1836-1848	YAKPFLNKVVSTT	nsp3(NC_045512: + : 2720-8554)	1323-1335
4	1849-1858	PRRARSVRYP linker 1-10
4	1859-1876	FLYENAFLPFAMGVIAMS	nsp6@Mexico(NC_045512@Mexico: + : 10973-11842)	36-53
4	1877-1886	PRRARSVRYP linker 1-10
4	1887-1897	IEELFYSYATH	3′-to-5′_exonuclease(NC_045512: + : 18040-19620)	363-373
4	1898-1907	PRRARSVRYP linker 1-10
4	1908-1915	GVYCCREH	nsp2(NC_045512: + : 806-2719)	47-54
4	1916-1925	PRRARSVRYP linker 1-10
4	1926-1944	DKSAFVNLKQLPFFYYSDS	3′-to-5′_exonuclease(NC_045512: + : 18040-19620)	432-450
4	1945-1954	PRRARSVRYP linker 1-10
4	1955-1968	DYDCVSFCYMHHME	3C-like_proteinase(NC_045512: + : 10055-10972)	153-166
4	1969-1978	PRRARSVRYP linker 1-10
4	1979-2000	SDFVRATATIPIRASLPFGWLI	ORF3a_protein@Belgium(NC_045512@Belgium: + : 25393-26220)	26-47
4	2001-2010	PRRARSVRYP linker 1-10
4	2011-2020	ARDLICAQKF	surface_glycoprotein(NC_045512: + : 21563-25384)	846-855
4	2021-2030	PRRARSVRYP linker 1-10
4	2031-2038	ISNCVADY	surface_glycoprotein(NC_045512: + : 21563-25384)	358-365
4	2039-2057	PRRARSVRYP linker 1-10
4	2049-2063	ISNCVADYSVLYNSA	surface_glycoprotein@Aruba(NC_045512@Aruba: + : 21563-25384)	354-368
4	2064-2073	PRRARSVRYP linker 1-10
4	2074-2090	VPQEHYVRITGLYPTLN	helicase@Aruba(NC_045512@Aruba: + : 16237-18039)	241-257
4	2091-2100	PRRARSVRYP linker 1-10
4	2101-2112	ALGKLQDVVNQN	surface_glycoprotein(NC_045512: + : 21563-25384)	944-955
4	2113-2122	PRRARSVRYP linker 1-10
4	2123-2133	LRIAGHHLGRC	membrane_glycoprotein(NC_045512: + : 26523-27191)	149-159
4	2134-2143	PRRARSVRYP linker 1-10
4	2144-2162	VKDCVLLHSYFTSDYYQLY	ORF3a_protein@Belgium(NC_045512@Belgium: + : 25393-26220)	197-215
4	2163-2172	PRRARSVRYP linker 1-10
4	2173-2180	AALQIPFA	surface_glycoprotein(NC_045512: + : 21563-25384)	892-899
4	2181-2190	PRRARSVRYP linker 1-10
4	2191-2206	FSNVTWFHAIHVSGTN	surface_glycoprotein@Peru(NC_045512@Peru: + : 21563-25384)	59-74
4	2207-2216	PRRARSVRYP linker 1-10
4	2217-2231	HYVRITGLYPTLNIL	helicase@Indonesia(NC_045512@Indonesia: + : 16237-18039)	245-259
4	2232-2241	PRRARSVRYP linker 1-10
4	2242-2261	DDRCILHCANFNVLFSTVFP	RNA-dependent_RNA_polymerase(NC_045512: + : 13442-13468 + 13468-16236)	303-322
4	2262-2271	PRRARSVRYP linker 1-10
4	2272-2281	SSVLHSTQDF	surface_glycoprotein@Norway(NC_045512@Norway: + : 21563-25384)	45-54
4	2282-2291	PRRARSVRYP linker 1-10
4	2292-2299	GSCGSVGF	3C-like_proteinase(NC_045512: + : 10055-10972)	143-150
4	2300-2309	PRRARSVRYP linker 1-10
4	2310-2324	YFTSDYYQLYSTQLI	ORF3a_protein@Indonesia(NC_045512@Indonesia: + : 25393-26220)	206-220
4	2325-2334	PRRARSVRYP linker 1-10
4	2335-2343	LKLKDCVMY	nsp6@Aruba(NC_045512@Aruba: + : 10973-11842)	105-113
4	2344-2353	PRRARSVRYP linker 1-10
4	2354-2368	RIIPARARVECFDKF	helicase@Aruba(NC_045512@Aruba: + : 16237-18039)	332-346
4	2369-2378	PRRARSVRYP linker 1-10
4	2379-2388	TQNLYENQK	surface_glycoprotein(NC_045512: + : 21563-25384)	912-921
4	2389-2398	PRRARSVRYP linker 1-10
4	2399-2421	NHDLYCQVHGNAHVASCDAIMTR	3′-to-5′_exonuclease(NC_045512: + : 18040-19620)	256-278
4	2422-2431	PRRARSVRYP linker 1-10
4	2432-2439	TDAVDCAL	surface_glycoprotein(NC_045512: + : 21563-25384)	286-293
4	2440-2449	PRRARSVRYP linker 1-10
4	2450-2463	IKVCEFQFCNDPYY	surface_glycoprotein@CostaRica(NC_045512@CostaRica: + : 21563-25384)	128-141
4	2464-2473	PRRARSVRYP linker 1-10
4	2474-2483	DPIHSLRVCV	nsp3(NC_045512: + : 2720-8554)	339-348
4	2484-2493	PRRARSVRYP linker 1-10
4	2494-2515	LLYDANYFLCWHINCYDYCIPY	ORF3a_protein@Estonai(NC_045512@Estonia: + : 25393-26220)	139-160

In certain embodiments, the vaccine comprises or expresses at least one of the concatemers of epitopes with intervening linker sequences (and as set forth in FIG. 20). In certain embodiments, the vaccine comprises or expresses at least two of the concatemers set forth below. In certain embodiments, the vaccine comprises or expresses three of the concatemers set forth below. In certain embodiments, the vaccine comprises or expresses all the concatemers set forth below.

TABLE 10
concatemer	pos_in_concatemer	epitope	gene	pos_in_gene
1	1-12	NIGCNHTGVVGE	nsp2(NC_045512: + : 806-2719)	250-261
1	13-22	PRRARSVRYP linker 1-10
1	23-36	LKEILVTYNCCDDD	RNA-dependent_RNA_polymerase(NC_045512: + : 13442-13468 + 13468-16236)	142-155
1	37-46	PRRARSVRYP linker 1-10
1	47-63	CSNLLLQYGSFCTQLNR	surface_glycoprotein(NC_045512: + : 21563-25384)	749-765
1	64-73	PRRARSVRYP linker 1-10
1	74-89	GSNVFQTRAGCLIGAE	surface_glycoprotein(NC_045512: + : 21563-25384)	639-654
1	90-99	PRRARSVRYP linker 1-10
1	100-107	AEVQIDRL	surface_glycoprotein(NC_045512: + : 21563-25384)	989-996
1	108-117	PRRARSVRYP linker 1-10
1	118-129	ISVTTEILPVSM	surface_glycoprotein(NC_045512: + : 21563-25384)	720-731
1	130-139	PRRARSVRYP linker 1-10
1	140-147	FTGCVIAW	surface_glycoprotein(NC_045512: + : 21563-25384)	429-436
1	148-157	PRRARSVRYP linker 1-10
1	158-172	INAACRKVQHMVVKA	3′-to-5′_exonuclease(NC_045512: + : 18040-19620)	305-319
1	173-182	PRRARSVRYP linker 1-10
1	183-192	ARDLICAQKF	surface_glycoprotein(NC_045512: + : 21563-25384)	846-855
1	193-202	PRRARSVRYP linker 1-10
1	203-210	LPINVIVF	nsp3(NC_045512: + : 2720-8554)	1718-1725
1	211-220	PRRARSVRYP linker 1-10
1	221-247	FSASTSAFVETVKGLDYKAFKQIVESC	nsp2(NC_045512: + : 806-2719)	300-326
1	248-257	PRRARSVRYP linker 1-10
1	258-273	RKIFVDGVPFVVSTGY	RNA-dependent_RNA_polymerase(NC_045512: + : 13442-13468 + 13468-16236)	331-346
1	274-283	PRRARSVRYP linker 1-10
1	284-299	FRELGVVHNQDVNLHS	RNA-dependent_RNA_polymerase(NC_045512: + : 13442-13468 + 13468-16236)	348-363
1	300-309	PRRARSVRYP linker 1-10
1	310-323	EGVVDYGARFYFYT	nsp3(NC_045512: + : 2720-8554)	595-608
1	324-333	PRRARSVRYP linker 1-10
1	334-348	TYACWHHSIGFDYVY	3′-to-5′_exonuclease(NC_045512: + : 18040-19620)	223-237
1	349-358	PRRARSVRYP linker 1-10
1	359-368	NEFYAYLRKH	RNA-dependent_RNA_polymerase(NC_045512: + : 13442-13468 + 13468-16236)	743-752
1	369-378	PRRARSVRYP linker 1-10
1	379-390	AKLLHKPIVWHV	nsp3(NC_045512: + : 2720-8554)	1165-1176
1	391-400	PRRARSVRYP linker 1-10
1	401-408	TDAVDCAL	surface_glycoprotein(NC_045512: + : 21563-25384)	286-293
1	409-418	PRRARSVRYP linker 1-10
1	419-428	DVVAIDYKHY	nsp3(NC_045512: + : 2720-8554)	1148-1157
1	429-438	PRRARSVRYP linker 1-10
1	439-446	KAVFISPY	helicase(NC_045512: + : 16237-18039)	508-515
1	447-456	PRRARSVRYP linker 1-10
1	457-464	QIGVVREF	helicase(NC_045512: + : 16237-18039)	492-499
1	465-474	PRRARSVRYP linker 1-10
1	475-491	YUADVFHLYLQYRIKLHD	RNA-dependent_RNA_polymerase(NC_045512: + : 13442-13468 + 13468-16236)	877-893
1	492-501	PRRARSVRYP linker 1-10
1	502-511	VMCGGSLYVK	RNA-dependent_RNA_polymerase(NC_045512: + : 13442-13468 + 13468-16236)	667-676
1	512-521	PRRARSVRYP linker 1-10
1	522-535	FGTVYEKLKPVLDW	nsp2(NC_045512: + : 806-2719)	437-450
1	536-545	PRRARSVRYP linker 1-10
1	546-558	VFRVQPTESIVRF	surface_glycoprotein(NC_045512: + : 21563-25384)	317-329
1	559-568	PRRARSVRYP linker 1-10
1	569-588	YVYLPYPDPSRILGAGCFVD	RNA-dependent_RNA_polymerase(NC_045512: + : 13442-13468 + 13468-16236)	826-845
1	589-598	PRRARSVRYP linker 1-10
1	599-613	SYELQTPFEIKLAKK	nsp2(NC_045512: + : 806-2719)	68-82
1	614-623	PRRARSVRYP linker 1-10
1	624-646	RVDFCGKGYHLMSFPQSAPHGVV	surface_glycoprotein(NC_045512: + : 21563-25384)	1039-1061
1	647-656	PRRARSVRYP linker 1-10
1	657-666	VVADAVIKTL	nsp3(NC_045512: + : 2720-8554)	56-65
1	667-676	PRRARSVRYP linker 1-10
1	677-684	ISNCVADY	surface_glycoprotein(NC_045512: + : 21563-25384)	358-365
1	685-694	PRRARSVRYP linker 1-10
1	695-706	TRAKVGILCIMS	helicase(NC_045512: + : 16237-18039)	566-577
1	707-716	PRRARSVRYP linker 1-10
1	717-736	IRRPFLCCKCCYDHVISTSH	helicase(NC_045512: + : 16237-18039)	20-39
1	737-746	PRRARSVRYP linker 1-10
1	747-763	LECNVKTTEVVGDIILK	nsp3(NC_045512: + : 2720-8554)	1244-1260
1	764-773	PRRARSVRYP linker 1-10
1	774-783	GNCDVVIGIV	surface_glycoprotein(NC_045512: + : 21563-25384)	1124-1133
1	784-793	PRRARSVRYP linker 1-10
1	794-832	GCDVTDVTQLYLGGMSYYCKSHKPPISFPLCAN	helicase(NC_045512: + : 16237-18039)	54-92
		GQVFGL
1	833-842	PRRARSVRYP linker 1-10
1	843-862	RAKHYVYIGDPAQLPAPRTL	helicase(NC_045512: + : 16237-18039)	392-411
2	1-13	AFASEAARVVRSI	nsp2(NC_045512: + : 806-2719)	355-367
2	14-23	PRRARSVRYP linker 1-10
2	24-40	AQSFLNRVCGVSAARLT	RNA-dependent_RNA_polymerase(NC_045512: + : 13442-13468 + 13468-16236)	4-20
2	41-50	PRRARSVRYP linker 1-10
2	51-64	RNLQHRLYECLYRN	RNA-dependent_RNA_polymerase(NC_045512: + : 13442-13468 + 13468-16236)	721-734
2	65-74	PRRARSVRYP linker 1-10
2	75-87	GVNLVAVPTGYVD	3′-to-5′_exonuclease(NC_045512: + : 18040-19620)	114-126
2	88-97	PRRARSVRYP linker 1-10
2	98-107	KQYGDCLGDI	surface_glycoprotein(NC_045512: + : 21563-25384)	835-844
2	108-117	PRRARSVRYP linker 1-10
2	118-126	AGFSLWVYK	3′-to-5′_exonuclease(NC_045512: + : 18040-19620)	504-512
2	127-136	PRRARSVRYP linker 1-10
2	137-147	EQYVFCTVNAL	helicase(NC_045512: + : 16237-18039)	353-363
2	148-157	PRRARSVRYP linker 1-10
2	158-165	YDPLQPEL	surface_glycoprotein(NC_045512: + : 21563-25384)	1138-1145
2	166-175	PRRARSVRYP linker 1-10
2	176-184	SRELKVTFF	nsp3(NC_045512: + : 2720-8554)	1134-1142
2	185-194	PRRARSVRYP linker 1-10
2	195-202	KLGASQRV	membrane_glycoprotein(NC_045512: + : 26523-27191)	180-187
2	203-212	PRRARSVRYP linker 1-10
2	213-222	KACVEEVTTT	nsp3(NC_045512: + : 2720-8554)	415-424
2	223-232	PRRARSVRYP linker 1-10
2	233-247	FKELLVYAADPAMHA	RNA-dependent_RNA_polymerase(NC_045512: + : 13442-13468 + 13468-16236)	368-382
2	248-257	PRRARSVRYP linker 1-10
2	258-265	FKLASHMY	nsp3(NC_045512: + : 2720-8554)	96-103
2	266-275	PRRARSVRYP linker 1-10
2	276-283	NNLVVMAY	nsp2(NC_045512: + : 806-2719)	413-420
2	284-293	PRRARSVRYP linker 1-10
2	294-325	IMASLVLARKHTTCCSLSHRFYRLANECAQVL	RNA-dependent_RNA_polymerase(NC_045512: + : 13442-13468 + 13468-16236)	632-663
2	326-335	PRRARSVRYP linker 1-10
2	336-348	LLNVPLHGTILTR	membrane_glycoprotein(NC_045512: + : 26523-27191)	119-131
2	349-358	PRRARSVRYP linker 1-10
2	359-367	VTANVNALL	RNA-dependent_RNA_polymerase(NC_045512: + : 13442-13468 + 13468-16236)	700-706
2	368-377	PRRARSVRYP linker 1-10
2	378-390	AIKCVPQADVEWK	3′-to-5′_exonuclease(NC_045512: + : 18040-19620)	337-349
2	391-400	PRRARSVRYP linker 1-10
2	401-423	SHGKQVVSDIDYVPLKSATCITR	3′-to-5′_exonuclease(NC_045512: + : 18040-19620)	454-476
2	424-433	PRRARSVRYP linker 1-10
2	434-446	KASCTLSEQLDFI	nsp2(NC_045512: + : 806-2719)	30-42
2	447-456	PRRARSVRYP linker 1-10
2	457-469	ANFCALILAYCNK	nsp3(NC_045512: + : 2720-8554)	890-902
2	470-479	PRRARSVRYP linker 1-10
2	480-490	IEELFYSYATH	3′-to-5′_exonuclease(NC_045512: + : 18040-19620)	363-373
2	491-500	PRRARSVRYP linker 1-10
2	501-510	SVELKHFFFA	RNA-dependent_RNA_polymerase(NC_045512: + : 13442-13468+ 13468-16236)	434-443
2	511-520	PRRARSVRYP linker 1-10
2	521-528	DSYFVVKR	RNA-dependent_RNA_polymerase(NC_045512: + : 13442-13468+ 13468-16236)	67-74
2	529-538	PRRARSVRYP linker 1-10
2	539-549	KGVQIPCTCGK	nsp3(NC_045512: + : 2720-8554)	963-973
2	550-559	PRRARSVRYP linker 1-10
2	560-579	KLTCATTRQVVNVVTTKIAL	nsp3(NC_045512: + : 2720-8554)	1923-1942
2	580-589	PRRARSVRYP linker 1-10
2	590-599	QEHYVRITGL	helicase(NC_045512: + : 16237-18039)	243-252
2	600-609	PRRARSVRYP linker 1-10
2	610-621	SSPDAVTAYNGY	nsp3(NC_045512: + : 2720-8554)	660-671
2	622-631	PRRARSVRYP linker 1-10
2	632-643	VTMPLGYVTHGL	nsp3(NC_045512: + : 2720-8554)	628-639
2	644-653	PRRARSVRYP linker 1-10
2	654-672	LEILDITPCSFGGVSVITP	surface_glycoprotein(NC_045512: + : 21563-25384)	582-600
2	673-682	PRRARSVRYP linker 1-10
2	683-692	DPIHSLRVCV	nsp3(NC_045512: + : 2720-8554)	339-348
2	693-702	PRRARSVRYP linker 1-10
2	703-717	RTCCLCDRRATCFST	3′-to-5′_exonuclease(NC_045512: + : 18040-19620)	205-219
2	718-727	PRRARSVRYP linker 1-10
2	728-747	MTSCCSCLKGCCSCGSCCKF	surface_glycoprotein(NC_045512: + : 21563-25384)	1237-1256
2	748-757	PRRARSVRYP linker 1-10
2	758-770	WNVVRIKIVQMLS	3′-to-5′_exonuclease(NC_045512: + : 18040-19620)	159-171
2	771-780	PRRARSVRYP linker 1-10
2	781-799	DKSAFVNLKQLPFFYYSDS	3′-to-5′_exonuclease(NC_045512: + : 18040-19620)	432-450
2	800-809	PRRARSVRYP linker 1-10
2	810-821	YPSLETIQITIS	nsp3(NC_045512: + : 2720-8554)	1483-1494
2	822-831	PRRARSVRYP linker 1-10
2	832-847	TVLKKCKSAFYILPSI	nsp3(NC_045512: + : 2720-8554)	526-541
3	1-10	ETFVTHSKGL	nsp2(NC_045512: + : 806-2719)	527-536
3	11-20	PRRARSVRYP linker 1-10
3	21-29	RSVYPVASP	nsp2(NC_045512: + : 806-2719)	121-129
3	30-39	PRRARSVRYP linker 1-10
3	40-62	NHDLYCQVHGNAHVASCDAIMTR	3′-to-5′_exonuclease(NC_045512: + : 18040-19620)	256-278
3	63-72	PRRARSVRYP linker 1-10
3	73-84	FNCYFPLQSYGF	surface_glycoprotein(NC_045512: + : 21563-25384)	486-497
3	85-94	PRRARSVRYP linker 1-10
3	95-109	VNCTEVPVAIHADQL	surface_glycoprotein(NC_045512: + : 21563-25384)	615-629
3	110-119	PRRARSVRYP linker 1-10
3	120-170	HFAIGLALYYPSARIVYTACSHAAVDALCEKAL	helicase(NC_045512: + : 16237-18039)	290-340
		KYLPIDKCSRIIPARARV
3	171-180	PRRARSVRYP linker 1-10
3	181-195	FSVAALTNNVAFQTV	RNA-dependent_RNA_polymerase(NC_045512: + : 13442-13468+ 13468-16236)	396-410
3	196-205	PRRARSVRYP linker 1-10
3	206-213	PSFLGRYM	nsp3(NC_045512: + : 2720-8554)	822-829
3	214-223	PRRARSVRYP linker 1-10
3	224-243	GYLPQNAVVKIYCPACHNSE	nsp2(NC_045512: + : 806-2719)	178-197
3	244-253	PRRARSVRYP linker 1-10
3	254-261	YDKLVSSF	nsp3(NC_045512: + : 2720-8554)	365-372
3	262-271	PRRARSVRYP linker 1-10
3	272-283	HEFCSQHTMLVK	RNA-dependent_RNA_polymerase(NC_045512: + : 13442-13468+ 13468-16236)	821-821
3	284-293	PRRARSVRYP linker 1-10
3	294-309	TGLHPTQAPTHLSVDT	3′-to-5′_exonuclease(NC_045512: + : 18040-19620)	16-31
3	310-319	PRRARSVRYP linker 1-10
3	320-330	SELVIGAVILR	membrane_glycoprotein(NC_045512: + : 26523-27191)	136-146
3	331-340	PRRARSVRYP linker 1-10
3	341-352	IEVQGYKSVNIT	nsp3(NC_045512: + : 2720-8554)	13-24
3	353-362	PRRARSVRYP linker 1-10
3	363-382	FCKLHNWNCVNCDTFCAGST	nsp3(NC_045512: + : 2720-8554)	1626-1645
3	383-392	PRRARSVRYP linker 1-10
3	393-411	KLNVGDYFVLTSHTVMPLS	helicase(NC_045512: + : 16237-18039)	218-236
3	412-421	PRRARSVRYP linker 1-10
3	422-444	TIATYCTGSIPCSVCLSGLDSLD	nsp3(NC_045512: + : 2720-8554)	1459-1481
3	445-454	PRRARSVRYP linker 1-10
3	455-464	FCLEASFNYL	nsp3(NC_045512: + : 2720-8554)	1931-1400
3	465-474	PRRARSVRYP linker 1-10
3	475-484	KCAYWVPRAS	nsp2(NC_045512: + : 806-2719)	239-248
3	485-494	PRRARSVRYP linker 1-10
3	495-508	SYLFQHANLDSCKR	nsp3(NC_045512: + : 2720-8554)	915-928
3	509-518	PRRARSVRYP linker 1-10
3	519-528	TQNVLYENQK	surface_glycoprotein(NC_045512: + : 21563-25384)	912-921
3	529-538	PRRARSVRYP linker 1-10
3	539-553	QIELKFNPPALQDAY	nsp3(NC_045512: + : 2720-8554)	867-881
3	554-563	PRRARSVRYP linker 1-10
3	564-581	IKDLPKEITVATSRTLSY	membrane_glycoprotein(NC_045512: + : 26523-27191)	161-178
3	582-591	PRRARSVRYP linker 1-10
3	592-602	YELKHGTFTCA	nsp3(NC_045512: + : 2720-8554)	996-1006
3	603-612	PRRARSVRYP linker 1-10
3	613-637	SDIDITFLKKDAPYIVGDVVQEGVL	nsp3(NC_045512: + : 2720-8554)	454-478
3	638-647	PRRARSVRYP linker 1-10
3	648-657	GVITHDVSSA	helicase(NC_045512: + : 16237-18039)	478-487
3	658-667	PRRARSVRYP linker 1-10
3	668-676	TENLLLYID	nsp3(NC_045512: + : 2720-8554)	432-440
3	677-686	PRRARSVRYP linker 1-10
3	687-698	VPVVDAYYSLLM	RNA-dependent_RNA_polymerase(NC_045512: + : 13442-13468+ 13468-16236)	231-242
3	699-708	PRRARSVRYP linker 1-10
3	709-720	ALGKLQDVVNQN	surface_glycoprotein(NC_045512: + : 21563-25384)	944-955
3	721-730	PRRARSVRYP linker 1-10
3	731-739	EVFAQVKQI	surface_glycoprotein(NC_045512: + : 21563-25384)	780-788
3	740-749	PRRARSVRYP linker 1-10
3	750-759	NYQCGHYKHI	nsp3(NC_045512: + : 2720-8554)	1012-1021
3	760-769	PRRARSVRYP linker 1-10
3	770-780	AVHECFVKRVD	3′-to-5′_exonuclease(NC_045512: + : 18040-19620)	281-291
3	781-790	PRRARSVRYP linker 1-10
3	791-803	ATNVVIKVCEFQF	surface_glycoprotein(NC_045512: + : 21563-25384)	123-135
3	804-813	PRRARSVRYP linker 1-10
3	814-821	SVDCTMYI	surface_glycoprotein(NC_045512: + : 21563-25384)	735-742
3	822-831	PRRARSVRYP linker 1-10
3	832-849	LFVVEVVDKYFDCYDGGC	RNA-dependent_RNA_polymerase(NC_045512: + : 13442-13468+ 13468-16236)	470-487
4	1-10	ACIDCSARHI	nsp3(NC_045512: + : 2720-8554)	1872-1881
4	11-20	PRRARSVRYP linker 1-10
4	21-38	LNDLCFTNVYADSFVIRG	surface_glycoprotein(NC_045512: + : 21563-25384)	387-404
4	39-48	PRRARSVRYP linker 1-10
4	49-62	SDRVVFVLWAHGFE	3′-to-5′_exonuclease(NC_045512: + : 18040-19620)	178-191
4	63-72	PRRARSVRYP linker 1-10
4	73-80	MADLVYAL	RNA-dependent_RNA_polymerase(NC_045512: + : 13442-13468+ 13468-16236)	124-131
4	81-90	PRRARSVRYP linker 1-10
4	91-99	AAYYVGYL	surface_glycoprotein(NC_045512: + : 21563-25384)	262-270
4	100-109	PRRARSVRYP linker 1-10
4	110-131	GYQPYRVVVLSFELLHAPATVC	surface_glycoprotein(NC_045512: + : 21563-25384)	504-525
4	132-141	PRRARSVRYP linker 1-10
4	142-150	YDLSVVNAR	helicase(NC_045512: + : 16237-18039)	382-390
4	151-160	PRRARSVRYP linker 1-10
4	161-170	GTNLPLQLGF	3′-to-5′_exonuclease(NC_045512: + : 18040-19620)	102-111
4	171-180	PRRARSVRYP linker 1-10
4	181-200	DDRVILHCANFNVLFSTVFP	RNA-dependent_RNA_polymerase(NC_045512: + : 13442-13468+ 13468-16236)	303-322
4	201-210	PRRARSVRYP linker 1-10
4	211-218	CLNRVCTN	nsp3(NC_045512: + : 2720-8554)	1342-1349
4	219-228	PRRARSVRYP linker 1-10
4	229-248	SEAVEAPLVGTPVCINGLML	nsp2(NC_045512: + : 806-2719)	591-610
4	249-258	PRRARSVRYP linker 1-10
4	259-266	RVEAFEYY	nsp3(NC_045512: + : 2720-8554)	810-817
4	267-276	PRRARSVRYP linker 1-10
4	277-289	IVKFISTCACEIV	nsp2(NC_045512: + : 806-2719)	468-480
4	290-299	PRRARSVRYP linker 1-10
4	300-307	GVYCCREH	nsp2(NC_045512: + : 806-2719)	47-54
4	308-317	PRRARSVRYP linker 1-10
4	318-332	ERFVSLAIDAYPLTK	RNA-dependent_RNA_polymerase(NC_045512: + : 13442-13468+ 13468-16236)	857-871
4	333-342	PRRARSVRYP linker 1-10
4	343-354	VRTNVYLAVFDK	nsp3(NC_045512: + : 2720-8554)
4	355-364	PRRARSVRYP linker 1-10		351-362
4	365-374	VTGLFKDCSK	3′-to-5′_exonuclease(NC_045512: + : 18040-19620)
4	375-384	PRRARSVRYP linker 1-10		4-13
4	385-395	LRIAGHHLGRC	membrane_glycoprotein(NC_045512: + : 26523-27191)	149-159
4	396-405	PRRARSVRYP linker 1-10
4	406-413	ARDLSLQF	nsp3(NC_045512: + : 2720-8554)
4	414-423	PRRARSVRYP linker 1-10		1652-1659
4	424-434	DNVLSTFISAA	nsp3(NC_045512: + : 2720-8554)
4	435-444	PRRARSVRYP linker 1-10		1809-1819
4	445-461	PNFVFPLNSIIKTIQPR	nsp2(NC_045512: + : 806-2719)	91-107
4	462-471	PRRARSVRYP linker 1-10
4	472-479	IETISLAG	nsp3(NC_045512: + : 2720-8554)	684-691
4	480-489	PRRARSVRYP linker 1-10
4	490-502	YAKPFLNKVVSTT	nsp3(NC_045512: + : 2720-8554)
4	503-512	PRRARSVRYP linker 1-10		1323-1335
4	513-528	VREVLSDRELHLSWEV	helicase(NC_045512: + : 16237-18039)	154-169
4	529-538	PRRARSVRYP linker
4	539-554	ANSIVCRFDTRVLSNL	3′-to-5′_exonuclease(NC_045512: + : 18040-19620)	394-409
4	555-564	PRRARSVRYP linker
4	565-580	LQSLQTYVTQQLIRAA	surface_glycoprotein(NC_045512: + : 21563-25384)	1001-1016
4	581-590	PRRARSVRYP linker 1-10
4	591-600	RHSLSHFVNL	nsp3(NC_045512: + : 2720-8554)	1697-1706
4	601-610	PRRARSVRYP linker 1-10
4	611-620	VQQESPFVMM	nsp3(NC_045512: + : 2720-8554)	980-989
4	621-630	PRRARSVRYP linker 1-10
4	631-641	VVNAANVYLKH	nsp3(NC_045512: + : 2720-8554)	239-249
4	642-651	PRRARSVRYP linker 1-10
4	652-665	TKDVVECLKLSHQS	nsp3(NC_045512: + : 2720-8554)	1830-1843
4	666-675	PRRARSVRYP linker 1-10
4	676-686	KESVQTFFKLV	nsp2(NC_045512: + : 806-2719)	492-502
4	687-696	PRRARSVRYP linker 1-10
4	697-716	LQKAAITILDGISQYSLRLI	nsp2(NC_045512: + : 806-2719)	382-401
4	717-726	PRRARSVRYP linker 1-10
4	727-734	PEHSLAEY	nsp2(NC_045512: + : 806-2719)	200-207
4	735-744	PRRARSVRYP linker 1-10
4	745-752	SLIDLQEL	surface_glycoprotein(NC_045512: + : 21563-25384)	1196-1203
4	753-762	PRRARSVRYP linker 1-10
4	763-771	FFSNVTWFH	surface_glycoprotein(NC_045512: + : 21563-25384)	58-66
4	772-781	PRRARSVRYP linker 1-10
4	782-794	NPVLPFNDGVYFA	surface_glycoprotein(NC_045512: + : 21563-25384)
4	795-804	PRRARSVRYP linker 1-10		81-93
4	805-813	MPVCVETKA	nsp3(NC_045512: + : 2720-8554)	571-579
4	814-823	PRRARSVRYP linker 1-10
4	824-833	KSASVYYSQL	nsp3(NC_045512: + : 2720-8554)	1737-1746
4	834-843	PRRARSVRYP linker 1-10
4	844-851	AALQIPFA	surface_glycoprotein(NC_045512: + : 21563-25384)	892-899

In certain embodiments, the vaccine comprises or expresses at least one of the concatemers of epitopes with intervening linker sequences (and as set forth in FIG. 21). In certain embodiments, the vaccine comprises or expresses at least two of the concatemers set forth below. In certain embodiments, the vaccine comprises or expresses three of the concatemers set forth below. In certain embodiments, the vaccine comprises or expresses all the concatemers set forth below.

TABLE 11
	pos_
	in_			pos_in_
concatemer	concat	epitope	gene	gene
1	1-12	NIGCNHTGVVGE	nsp2(NC_045512: + : 806-2719)	250-261
1	13-22	PRRARSVRYP	linker	1-10
1	23-36	LKEILVTYNCCDDD	RNA-dependent_RNA_polymerase(NC_045512: + : 13442-13468 + 13468-16236)	142-155
1	37-46	PRRARSVRYP	linker	1-10
1	47-61	ISNCVADYSVLYNSA	surface_glycoprotein@Aruba(NC_045512@Aruba: + : 21563-25384)	354-368
1	62-71	PRRARSVRYP	linker	1-10
1	72-86	AYYVGYLQPRTFLLK	surface_glycoprotein@Aruba(NC_045512@Aruba: + : 21563-25384)	260-274
1	87-96	PRRARSVRYP	linker	1-10
1	97-104	REGVFVSN	surface_glycoprotein@Aruba(NC_045512@Aruba: + : 21563-25384)	1087-1094
1	105-114	PRRARSVRYP	linker	1-10
1	115-126	FRSSVLHSTQDL	surface_glycoprotein@Aruba(NC_045512@Aruba: + : 21563-25384)	43-54
1	127-136	PRRARSVRYP	linker	1-10
1	137-147	EQYVFCTVNAL	helicase(NC_045512: + : 16237-18039)	353-363
1	148-157	PRRARSVRYP	linker	1-10
1	158-171	ANPVLPFNDGVYFA	surface_glycoprotein@Austria(NC_045512@Austria: + : 21563-25384)	77-90
1	172-181	PRRARSVRYP	linker	1-10
1	182-196	ERFVSLAIDAYPLTK	RNA-dependent_RNA_polymerase(NC_045512: + : 13442-13468 + 13468-16236)	857-871
1	197-206	PRRARSVRYP	linker	1-10
1	207-214	YDKLVSSF	nsp3(NC_045512: + : 2720-8554)	365-372
1	215-224	PRRARSVRYP	linker	1-10
1	225-244	LQKAAITILDGISQYSLRLI	nsp2(NC_045512: + : 806-2719)	382-401
1	245-254	PRRARSVRYP	linker	1-10
1	255-264	KACVEEVTTT	nsp3(NC_045512: + : 2720-8554)	415-424
1	265-274	PRRARSVRYP	linker	1-10
1	275-285	KESVQTFFKLV	nsp2(NC_045512: + : 806-2719)	492-502
1	286-295	PRRARSVRYP	linker	1-10
1	296-313	LFVVEVVDKYFDCYDGGC	RNA-dependent_RNA_polymerase(NC_045512: + : 13442-13468 + 13468-16236)	470-487
1	314-323	PRRARSVRYP	linker	1-10
1	324-339	FRELGVVHNQDVNLHS	RNA-dependent_RNA_polymerase(NC_045512: + : 13442-13468 + 13468-16236)	348-363
1	340-349	PRRARSVRYP	linker	1-10
1	350-360	AVHECFVKRVD	3′-to-5′_exonuclease(NC_045512: + : 18040-19620)	281-291
1	361-370	PRRARSVRYP	linker	1-10
1	371-385	EFQFCNDPFLGVYYH	surface_glycoprotein@Chile(NC_045512@Chile: + : 21563-25384)	132-146
1	386-395	PRRARSVRYP	linker	1-10
1	396-404	SPDVDLADI	surface_glycoprotein@Chile(NC_045512@Chile: + : 21563-25384)	1161-1169
1	405-414	PRRARSVRYP	linker	1-10
1	415-426	IEVQGYKSVNIT	nsp3(NC_045512: + : 2720-8554)	13-24
1	427-436	PRRARSVRYP	linker	1-10
1	437-448	YPSLETIQITIS	nsp3(NC_045512: + : 2720-8554)	1483-1494
1	449-458	PRRARSVRYP	linker	1-10
1	459-468	KSASVYYSQL	nsp3(NC_045512: + : 2720-8554)	1737-1746
1	469-478	PRRARSVRYP	linker	1-10
1	479-488	VQQESPFVMM	nsp3(NC_045512: + : 2720-8554)	980-989
1	489-498	PRRARSVRYP	linker	1-10
1	499-509	LRIAGHHLGRC	membrane_glycoprotein(NC_045512: + : 26523-27191)	149-159
1	510-519	PRRARSVRYP	linker	1-10
1	520-535	TGLHPTQAPTHLSVDT	3′-to-5′_exonuclease(NC_045512: + : 18040-19620)	16-31
1	536-545	PRRARSVRYP	linker	1-10
1	546-561	ANSIVCRFDTRVLSNL	3′-to-5′_exonuclease(NC_045512: + : 18040-19620)	394-409
1	562-571	PRRARSVRYP	linker	1-10
1	572-580	SRELKVTFF	nsp3(NC_045512: + : 2720-8554)	1134-1142
1	581-590	PRRARSVRYP	linker	1-10
1	591-613	GKIQDSLFSTASALGKLQDVVNQ	surface_glycoprotein@NorthMacedonia(NC_045512@NorthMacedonia: + : 21563-25384)	928-950
1	614-623	PRRARSVRYP	linker	1-10
1	624-638	ARSVARQSIIAYTMS	surface_glycoprotein@Mozambique(NC_045512@Mozambique: + : 21563-25384)	680-694
1	639-648	PRRARSVRYP	linker	1-10
1	649-656	PEHSLAEY	nsp2(NC_045512: + : 806-2719)	200-207
1	657-666	PRRARSVRYP	linker	1-10
1	667-689	RVDFCGKGYHLMSFPQSAPHGVV	surface_glycoprotein(NC_045512: + : 21563-25384)	1039-1061
1	690-699	PRRARSVRYP	linker	1-10
1	700-712	NFRVQPTESIVRF	surface_glycoprotein(NC_045512: + : 21563-25384)	317-329
1	713-722	PRRARSVRYP	linker	1-10
1	723-738	GSNVFQTRAGCLIGAE	surface_glycoprotein(NC_045512: + : 21563-25384)	639-654
1	739-748	PRRARSVRYP	linker	1-10
1	749-761	NPVLPFNDGVYFA	surface_glycoprotein(NC_045512: + : 21563-25384)	81-93
1	762-771	PRRARSVRYP	linker	1-10
1	772-783	ALGKLQDVVNQN	surface_glycoprotein(NC_045512: + : 21563-25384)	944-955
1	784-793	PRRARSVRYP	linker	1-10
1	794-801	PVLKGVKL	surface_glycoprotein@Aruba(NC_045512@Aruba: + : 21563-25384)	1259-1266
1	802-811	PRRARSVRYP	linker	1-10
1	812-838	FSASTSAFVETVKGLDYKAFKQIVESC	nsp2(NC_045512: + : 806-2719)	300-326
1	839-848	PRRARSVRYP	linker	1-10
1	849-856	AALQIPFA	surface_glycoprotein(NC_045512: + : 21563-25384)	892-899
1	857-866	PRRARSVRYP	linker	1-10
1	867-877	RFQLHRSYLTP	surface_glycoprotein@Austria(NC_045512@Austria: + : 21563-25384)	233-243
1	878-887	PRRARSVRYP	linker	1-10
1	888-906	QVAVLYQDVNCTEVPVAIH	surface_glycoprotein@China(NC_045512@China: + : 21563-25384)	607-625
1	907-916	PRRARSVRYP	linker	1-10
1	917-928	FSNVTWFHAIVS	surface_glycoprotein@Ghana(NC_045512@Ghana: + : 21563-25384)	59-70
1	929-938	PRRARSVRYP	linker	1-10
1	939-951	WNVVRIKIVQMLS	3′-to-5′_exonuclease(NC_045512: + : 18040-19620)	159-171
1	952-961	PRRARSVRYP	linker	1-10
1	962-976	QIELKFNPPALQDAY	nsp3(NC_045512: + : 2720-8554)	867-881
1	977-986	PRRARSVRYP	linker	1-10
1	987-1009	SHGKQVVSDIDYVPLKSATCITR	3′-to-5′_exonuclease(NC_045512: + : 18040-19620)	454-476
1	1010-1019	PRRARSVRYP	linker	1-10
1	1020-1033	ETKCTLKSFTVEKG	surface_glycoprotein@Aruba(NC_045512@Aruba: + : 21563-25384)	294-307
1	1034-1043	PRRARSVRYP	linker	1-10
1	1044-1057	LVLLPLVSSQCVNF	surface_glycoprotein@Brazil(NC_045512@Brazil: + : 21563-25384)	5-18
1	1058-1067	PRRARSVRYP	linker	1-10
1	1068-1076	FFSNVTWFH	surface_glycoprotein(NC_045512: + : 21563-25384)	58-66
1	1077-1086	PRRARSVRYP	linker	1-10
1	1087-1106	IRRPFLCCKCCYDHVISTSH	helicase(NC_045512: + : 16237-18039)	20-39
1	1107-1116	PRRARSVRYP	linker	1-10
1	1117-1127	VLYQGVNCTEV	surface_glycoprotein@Aruba(NC_045512@Aruba: + : 21563-25384)	606-616
1	1128-1137	PRRARSVRYP	linker	1-10
1	1138-1169	IMASLVLARKHTTCCSLSHRF	RNA-dependent_RNA_polymerase(NC_045512: + : 13442-13468 + 13468-16236)	632-663
		YRLANECAQVL
1	1170-1179	PRRARSVRYP	linker	1-10
1	1180-1192	LLNVPLHGTILTR	membrane_glycoprotein(NC_045512: + : 26523-27191)	119-131
1	1193-1202	PRRARSVRYP	linker	1-10
1	1203-1213	VVNAANVYLKH	nsp3(NC_045512: + : 2720-8554)	239-249
2	1-13	AFASEAARVVRSI	nsp2(NC_045512: + : 806-2719)	355-367
2	14-23	PRRARSVRYP	linker	1-10
2	24-40	AQSFLNRVCGVSAARLT	RNA-dependent_RNA_polymerase(NC_045512: + : 13442-13468 + 13468-16236)	4-20
2	41-50	PRRARSVRYP	linker	1-10
2	51-64	SDRVVFVLWAHGFE	3′-to-5′_exonuclease(NC_045512: + : 18040-19620)	178-191
2	65-74	PRRARSVRYP	linker	1-10
2	75-84	SVLNDILARL	surface_glycoprotein@Aruba(NC_045512@Aruba: + : 21563-25384)	971-980
2	85-94	PRRARSVRYP	linker	1-10
2	95-110	FLVLLPLVSSQCVNLT	surface_glycoprotein@Aruba(NC_045512@Aruba: + : 21563-25384)	4-19
2	111-120	PRRARSVRYP	linker	1-10
2	121-129	AGFSLWVYK	3′-to-5′_exonuclease(NC_045512: + : 18040-19620)	504-512
2	130-139	PRRARSVRYP	linker	1-10
2	140-159	PINLVRGLPQGFSALEPLVD	surface_glycoprotein@Austria(NC_045512@Austria: + : 21563-25384)	205-224
2	160-169	PRRARSVRYP	linker	1-10
2	170-181	EVFAQVKQIYKT	surface_glycoprotein@Aruba(NC_045512@Aruba: + : 21563-25384)	776-787
2	182-191	PRRARSVRYP	linker	1-10
2	192-204	RSVASQSIIAYTM	surface_glycoprotein@Aruba(NC_045512@Aruba: + : 21563-25384)	681-693
2	205-214	PRRARSVRYP	linker	1-10
2	215-222	PSFLGRYM	nsp3(NC_045512: + : 2720-8554)	822-829
2	223-232	PRRARSVRYP	linker	1-10
2	233-249	YADVFHLYLQYIRKLHD	RNA-dependent_RNA_polymerase(NC_045512: + : 13442-13468 + 13468-16236)	877-893
2	250-259	PRRARSVRYP	linker	1-10
2	260-270	SELVIGAVILR	membrane_glycoprotein(NC_045512: + : 26523-27191)	136-146
2	271-280	PRRARSVRYP	linker	1-10
2	281-290	KCAYWVPRAS	nsp2(NC_045512: + : 806-2719)	239-248
2	291-300	PRRARSVRYP	linker	1-10
2	301-316	RKIFVDGVPFVVSTGY	RNA-dependent_RNA_polymerase(NC_045512: + : 13442-13468 + 13468-16236)	331-346
2	317-326	PRRARSVRYP	linker	1-10
2	327-334	GVYCCREH	nsp2(NC_045512: + : 806-2719)	47-54
2	335-344	PRRARSVRYP	linker	1-10
2	345-362	IKDLPKEITVATSRTLSY	membrane_glycoprotein(NC_045512: + : 26523-27191)	161-178
2	363-372	PRRARSVRYP	linker	1-10
2	373-394	NVVIKVCEFQFCNYPFLGVYYH	surface_glycoprotein@Brazil(NC_045512@Brazil: + : 21563-25384)	125-146
2	395-404	PRRARSVRYP	linker	1-10
2	405-412	EIYQAGSK	surface_glycoprotein@Mexico(NC_045512@Mexico: + : 21563-25384)	471-478
2	413-422	PRRARSVRYP	linker	1-10
2	423-432	KQYGDCLGNI	surface_glycoprotein@Jordan(NC_045512@Jordan: + : 21563-25384)	831-840
2	433-442	PRRARSVRYP	linker	1-10
2	443-456	SVASQSIIAYTMSL	surface_glycoprotein@Austria(NC_045512@Austria: + : 21563-25384)	678-691
2	457-466	PRRARSVRYP	linker	1-10
2	467-476	FCLEASFNYL	nsp3(NC_045512: + : 2720-8554)	1391-1400
2	477-486	PRRARSVRYP	linker	1-10
2	487-501	VNCTEVPVAIHADQL	surface_glycoprotein(NC_045512: + : 21563-25384)	615-629
2	502-511	PRRARSVRYP	linker	1-10
2	512-521	NYQCGHYKHI	nsp3(NC_045512: + : 2720-8554)	1012-1021
2	522-531	PRRARSVRYP	linker	1-10
2	532-548	SAAYYVGYLQLRTFLLK	surface_glycoprotein@Italy(NC_045512@Italy: + : 21563-25384)	258-274
2	549-558	PRRARSVRYP	linker	1-10
2	559-566	IETISLAG	nsp3(NC_045512: + : 2720-8554)	684-691
2	567-576	PRRARSVRYP	linker	1-10
2	577-593	PNFVFPLNSIIKTIQPR	nsp2(NC_045512: + : 806-2719)	9 1-107
2	594-603	PRRARSVRYP	linker	1-10
2	604-614	YELKHGTFTCA	nsp3(NC_045512: + : 2720-8554)	996-1006
2	615-624	PRRARSVRYP	linker	1-10
2	625-639	RTCCLCDRRATCFST	3′-to-5′_exonuclease(NC_045512: + : 18040-19620)	205-219
2	640-649	PRRARSVRYP	linker	1-10
2	650-660	IEELFYSYATH	3′-to-5′_exonuclease(NC_045512: + : 18040-19620)	363-373
2	661-670	PRRARSVRYP	linker	1-10
2	671-690	KLTCATTRQVVNVVTTKIAL	nsp3(NC_045512: + : 2720-8554)	1923-1942
2	691-700	PRRARSVRYP	linker	1-10
2	701-720	FPQSAPHGVVFLHVTYVPAQ	surface_glycoprotein@Aruba(NC_045512@Aruba: + : 21563-25384)	1048-1067
2	721-730	PRRARSVRYP	linker	1-10
2	731-738	SVDCTMYI	surface_glycoprotein(NC_045512: + : 21563-25384)	735-742
2	739-748	PRRARSVRYP	linker	1-10
2	749-760	FRSSVLHSTRDL	surface_glycoprotein@Nigeria(NC_045512@Nigeria: + : 21563-25384)	43-54
2	761-770	PRRARSVRYP	linker	1-10
2	771-778	QIGVVREF	helicase(NC_045512: + : 16237-18039)	492-499
2	779-788	PRRARSVRYP	linker	1-10
2	789-802	EGVVDYGARFYFYT	nsp3(NC_045512: + : 2720-8554)	595-608
2	803-812	PRRARSVRYP	linker	1-10
2	813-827	SYELQTPFEIKLAKK	nsp2(NC_045512: + : 806-2719)	68-82
2	828-837	PRRARSVRYP	linker	1-10
2	838-847	GNCDVVIGIV	surface_glycoprotein(NC_045512: + : 21563-25384)	1124-1133
2	848-857	PRRARSVRYP	linker	1-10
2	858-867	AGAALQIPFA	surface_glycoprotein@Nigeria(NC_045512@Nigeria: + : 21563-25384)	886-895
2	868-877	PRRARSVRYP	linker	1-10
2	878-892	TYACWHHSIGFDYVY	3′-to-5′_exonuclease(NC_045512: + : 18040-19620)	223-237
2	893-902	PRRARSVRYP	linker	1-10
2	903-915	ANFCALILAYCNK	nsp3(NC_045512: + : 2720-8554)	890-902
2	916-925	PRRARSVRYP	linker	1-10
2	926-935	QEHYVRITGL	helicase(NC_045512: + : 16237-18039)	243-252
2	936-945	PRRARSVRYP	linker	1-10
2	946-960	EFQFCNYPFLGVYHK	surface_glycoprotein@Norway(NC_045512@Norway: + : 21563-25384)	129-143
2	961-970	PRRARSVRYP	linker	1-10
2	971-981	HFPRKGVFVSN	surface_glycoprotein@SmallAsia(NC_045512@SmallAsia: + : 21563-25384)	1078-1088
2	982-991	PRRARSVRYP	linker	1-10
2	992-1001	VVADAVIKTL	nsp3(NC_045512: + : 2720-8554)	56-65
2	1002-1011	PRRARSVRYP	linker	1-10
2	1012-1025	GFNCYFPLQPYGFQ	surface_glycoprotein@SmallSouthAmerica(NC_045512@	481-494
			SmallSouthAmerica: + : 21563-25384)
2	1026-1035	PRRARSVRYP	linker	1-10
2	1036-1043	AEVQIDRL	surface_glycoprotein(NC_045512: + : 21563-25384)	989-996
2	1044-1053	PRRARSVRYP	linker	1-10
2	1054-1062	EVFAQVKQI	surface_glycoprotein(NC_045512: + : 21563-25384)	780-788
2	1063-1072	PRRARSVRYP	linker	1-10
2	1073-1085	YAKPFLNKVVSTT	nsp3(NC_045512: + : 2720-8554)	1323-1335
2	1086-1095	PRRARSVRYP	linker	1-10
2	1096-1105	VMCGGSLYVK	RNA-dependent_RNA_polymerase(NC_045512: + : 13442-13468 + 13468-16236)	667-676
2	1106-1115	PRRARSVRYP	linker	1-10
2	1116-1123	TDAVDCAL	surface_glycoprotein(NC_045512: + : 21563-25384)	286-293
2	1124-1133	PRRARSVRYP	linker	1-10
2	1134-1153	PINLVRGLPQGFSVLEPLVD	surface_glycoprotein@SmallAfrica(NC_045512@SmallAfrica: + : 21563-25384)	209-228
2	1154-1163	PRRARSVRYP	linker	1-10
2	1164-1171	STFKCYGV	surface_glycoprotein@Aruba(NC_045512@Aruba: + : 21563-25384)	371-378
2	1172-1181	PRRARSVRYP	linker	1-10
2	1182-1200	KLNVGDYFVLTSHTVMPLS	helicase(NC_045512: + : 16237-18039)	218-236
3	1-10	ETFVTHSKGL	nsp2(NC_045512: + : 806-2719)	527-536
3	11-20	PRRARSVRYP	linker	1-10
3	21-29	RSVYPVASP	nsp2(NC_045512: + : 806-2719)	121-129
3	30-39	PRRARSVRYP	linker	1-10
3	40-62	NHDLYCQVHGNAHVASCDAIMTR	3′-to-5′_exonuclease(NC_045512: + : 18040-19620)	256-278
3	63-72	PRRARSVRYP	linker	1-10
3	73-80	MADLVYAL	RNA-dependent_RNA_polymerase(NC_045512: + : 13442-13468 + 13468-16236)	124-131
3	81-90	PRRARSVRYP	linker	1-10
3	91-99	TEIYQAGST	surface_glycoprotein@Aruba(NC_045512@Aruba: + : 21563-25384)	466-474
3	100-109	PRRARSVRYP	linker	1-10
3	110-140	YIWLGFIAGLIAIVMVTIMLCC	surface_glycoprotein@Aruba(NC_045512@Aruba: + : 21563-25384)	1211-1241
		MTSCCSCLK
3	141-150	PRRARSVRYP	linker	1-10
3	151-163	FQTLLALHRSYLT	surface_glycoprotein@Aruba(NC_045512@Aruba: + : 21563-25384)	234-246
3	164-173	PRRARSVRYP	linker	1-10
3	174-187	TKDVVECLKLSHQS	nsp3(NC_045512: + : 2720-8554)	1830-1843
3	188-197	PRRARSVRYP	linker	1-10
3	198-207	DVVAIDYKHY	nsp3(NC_045512: + : 2720-8554)	1148-1157
3	208-217	PRRARSVRYP	linker	1-10
3	218-225	KLGASQRV	membrane_glycoprotein(NC_045512: + : 26523-27191)	180-187
3	226-235	PRRARSVRYP	linker	1-10
3	236-243	LPINVIVF	nsp3(NC_045512: + : 2720-8554)	1718-1725
3	244-253	PRRARSVRYP	linker	1-10
3	254-262	TENLLLYID	nsp3(NC_045512: + : 2720-8554)	432-440
3	263-272	PRRARSVRYP	linker	1-10
3	273-284	VPVVDSYYSLLM	RNA-dependent_RNA_polymerase(NC_045512: + : 13442-13468 + 13468-16236)	231-242
3	285-294	PRRARSVRYP	linker	1-10
3	295-307	KASCTLSEQLDFI	nsp2(NC_045512: + : 806-2719)	30-42
3	308-317	PRRARSVRYP	linker	1-10
3	318-329	VTMPLGYVTHGL	nsp3(NC_045512: + : 2720-8554)	628-639
3	330-339	PRRARSVRYP	linker	1-10
3	340-349	NEFYAYLRKH	RNA-dependent_RNA_polymerase(NC_045512: + : 13442-13468 + 13468-16236)	743-752
3	350-359	PRRARSVRYP	linker	1-10
3	360-379	RAKHYVYIGDPAQLPAPRTL	helicase(NC_045512: + : 16237-18039)	392-411
3	380-389	PRRARSVRYP	linker	1-10
3	390-428	GCDVTDVTQLYLGGMSYYC	helicase(NC_045512: + : 16237-18039)	54-92
		KSHKPPISFPLCANGQVFGL
3	429-438	PRRARSVRYP	linker	1-10
3	439-446	KAVFISPY	helicase(NC_045512: + : 16237-18039)	508-515
3	447-456	PRRARSVRYP	linker	1-10
3	457-474	LNDLCFTNVYADSFVIRG	surface_glycoprotein(NC_045512: + : 21563-25384)	387-404
3	475-484	PRRARSVRYP	linker	1-10
3	485-504	MTSCCSCLKGCCSCGSCCKF	surface_glycoprotein(NC_045512: + : 21563-25384)	1237-1256
3	505-514	PRRARSVRYP	linker	1-10
3	515-537	LIAIVMVTIMLCCITSCCSCLKG	surface_glycoprotein@Mozambique(NC_045512@Mozambique: + : 21563-25384)	1220-1242
3	538-547	PRRARSVRYP	linker	1-10
3	548-559	AKLLHKPIVWHV	nsp3(NC_045512: + : 2720-8554)	1165-1176
3	560-569	PRRARSVRYP	linker	1-10
3	570-577	YDPLQPEL	surface_glycoprotein(NC_045512: + : 21563-25384)	1138-1145
3	578-587	PRRARSVRYP	linker	1-10
3	588-599	FNCYFPLQSYGF	surface_glycoprotein(NC_045512: + : 21563-25384)	486-497
3	600-609	PRRARSVRYP	linker	1-10
3	610-626	LECNVKTTEVVGDIILK	nsp3(NC_045512: + : 2720-8554)	1244-1260
3	627-636	PRRARSVRYP	linker	1-10
3	637-651	FKELLVYAADPAMHA	RNA-dependent_RNA_polymerase(NC_045512: + : 13442-13468 + 13468-16236)	368-382
3	652-661	PRRARSVRYP	linker	1-10
3	662-671	SVELKHFFFA	RNA-dependent_RNA_polymerase(NC_045512: + : 13442-13468 + 13468-16236)	434-443
3	672-681	PRRARSVRYP	linker	1-10
3	682-700	DKSAFVNLKQLPFFYYSDS	3′-to-5′_exonuclease(NC_045512: + : 18040-19620)	432-450
3	701-710	PRRARSVRYP	linker	1-10
3	711-720	ARDLICAQKF	surface_glycoprotein(NC_045512: + : 21563-25384)	846-855
3	721-730	PRRARSVRYP	linker	1-10
3	731-745	INAACRKVQHMVVKA	3′-to-5′_exonuclease(NC_045512: + : 18040-19620)	305-319
3	746-755	PRRARSVRYP	linker	1-10
3	756-768	ATNVVIKVCEFQF	surface_glycoprotein(NC_045512: + : 21563-25384)	123-135
3	769-778	PRRARSVRYP	linker	1-10
3	779-787	AAAYYVGYL	surface_glycoprotein(NC_045512: + : 21563-25384)	262-270
3	788-797	PRRARSVRYP	linker	1-10
3	798-809	SSPDAVTAYNGY	nsp3(NC_045512: + : 2720-8554)	660-671
3	810-819	PRRARSVRYP	linker	1-10
3	820-833	GFNCYSPLQSYGFQ	surface_glycoprotein@Peru(NC_045512@Peru: + : 21563-25384)	485-498
3	834-843	PRRARSVRYP	linker	1-10
3	844-854	FFSNVTWFHVS	surface_glycoprotein@Nigeria(NC_045512@Nigeria: + : 21563-25384)	58-68
3	855-864	PRRARSVRYP	linker	1-10
3	865-880	TVLKKCKSAFYILPSI	nsp3(NC_045512: + : 2720-8554)	526-541
3	881-890	PRRARSVRYP	linker	1-10
3	891-900	RHSLSHFVNL	nsp3(NC_045512: + : 2720-8554)	1697-1706
3	901-910	PRRARSVRYP	linker	1-10
3	911-918	CLNRVCTN	nsp3(NC_045512: + : 2720-8554)	1342-1349
3	919-928	PRRARSVRYP	linker	1-10
3	929-942	FFSNVTWFHAIHVS	surface_glycoprotein@Bangladesh(NC_045512@Bangladesh: + : 21563-25384)	58-71
3	943-952	PRRARSVRYP	linker	1-10
3	953-966	FGTVYEKLKPVLDW	nsp2(NC_045512: + : 806-2719)	437-450
3	967-976	PRRARSVRYP	linker	1-10
3	977-991	TYGVGYQPYRVVVLS	surface_glycoprotein@Australia(NC_045512@Australia: + : 21563-25384)	496-510
3	992-1001	PRRARSVRYP	linker	1-10
3	1002-1009	FKLASHMY	nsp3(NC_045512: + : 2720-8554)	96-103
3	1010-1019	PRRARSVRYP	linker	1-10
3	1020-1027	ISNCVADY	surface_glycoprotein(NC_045512: + : 21563-25384)	358-365
3	1028-1037	PRRARSVRYP	linker	1-10
3	1038-1045	DSYFVVKR	RNA-dependent_RNA_polymerase(NC_045512: + : 13442-13468 + 13468-16236)	67-74
3	1046-1055	PRRARSVRYP	linker	1-10
3	1056-1068	AIKCVPQADVEWK	3′-to-5′_exonuclease(NC_045512: + : 18040-19620)	337-349
3	1069-1078	PRRARSVRYP	linker	1-10
3	1079-1088	TQNVLYENQK	surface_glycoprotein(NC_045512: + : 21563-25384)	912-921
3	1089-1098	PRRARSVRYP	linker	1-10
3	1099-1114	FSNVTWFHAIHVSGTN	surface_glycoprotein@Peru(NC_045512@Peru: + : 21563-25384)	59-74
3	1115-1124	PRRARSVRYP	linker	1-10
3	1125-1136	ISVTTEILPVSM	surface_glycoprotein(NC_045512: + : 21563-25384)	720-731
3	1137-1146	PRRARSVRYP	linker	1-10
3	1147-1156	KQYGDCLGDI	surface_glycoprotein(NC_045512: + : 21563-25384)	835-844
3	1157-1166	PRRARSVRYP	linker	1-10
3	1167-1174	FTGCVIAW	surface_glycoprotein(NC_045512: + : 21563-25384)	429-436
3	1175-1184	PRRARSVRYP	linker	1-10
3	1185-1194	SSVLHSTQDF	surface_glycoprotein@Norway(NC_045512@Norway: + : 21563-25384)	45-54
3	1195-1204	PRRARSVRYP	linker	1-10
3	1205-1212	SLIDLQEL	surface_glycoprotein(NC_045512: + : 21563-25384)	1196-1203
4	1-10	ACIDCSARHI	nsp3(NC_045512: + : 2720-8554)	1872-1881
4	11-20	PRRARSVRYP	linker	1-10
4	21-42	INLVRDLPQGFSALEPLVDLPI	surface_glycoprotein@Aruba(NC_045512@Aruba: + : 21563-25384)	206-227
4	43-52	PRRARSVRYP	linker	1-10
4	53-66	RNLQHRLYECLYRN	RNA-dependent_RNA_polymerase(NC_045512: + : 13442-13468 + 13468-16236)	721-734
4	67-76	PRRARSVRYP	linker	1-10
4	77-89	GVNLVAVPTGYVD	3′-to-5′_exonuclease(NC_045512: + : 18040-19620)	114-126
4	90-99	PRRARSVRYP	linker	1-10
4	100-113	TSGVGYQPYRVVVL	surface_glycoprotein@Aruba(NC_045512@Aruba: + : 21563-25384)	496-509
4	114-123	PRRARSVRYP	linker	1-10
4	124-174	HFAIGLALYYPSARIVYTACSHAAVD	helicase(NC_045512: + : 16237-18039)	290-340
		ALCEKALKYLPIDKCSRIIPARARV
4	175-184	PRRARSVRYP	linker	1-10
4	185-204	YVYLPYPDPSRILGAGCFVD	RNA-dependent_RNA_polymerase(NC_045512: + : 13442-13468 + 13468-16236)	826-845
4	205-214	PRRARSVRYP	linker	1-10
4	215-225	KGVQIPCTCGK	nsp3(NC_045512: + : 2720-8554)	963-973
4	226-235	PRRARSVRYP	linker	1-10
4	236-255	DDRCILHCANFNVLFSTVFP	RNA-dependent_RNA_polymerase(NC_045512: + : 13442-13468 + 13468-16236)	303-322
4	256-265	PRRARSVRYP	linker	1-10
4	266-278	IVKFISTCACEIV	nsp2(NC_045512: + : 806-2719)	468-480
4	279-288	PRRARSVRYP	linker	1-10
4	289-296	NNLVVMAY	nsp2(NC_045512: + : 806-2719)	413-420
4	297-306	PRRARSVRYP	linker	1-10
4	307-314	RVEAFEYY	nsp3(NC_045512: + : 2720-8554)	810-817
4	315-324	PRRARSVRYP	linker	1-10
4	325-339	FSVAALTNNVAFQTV	RNA-dependent_RNA_polymerase(NC_045512: + : 13442-13468 + 13468-16236)	396-410
4	340-349	PRRARSVRYP	linker	1-10
4	350-359	FEYVSQPFLM	surface_glycoprotein@Aruba(NC_045512@Aruba: + : 21563-25384)	164-173
4	360-369	PRRARSVRYP	linker	1-10
4	370-378	EPLLKGVKL	surface_glycoprotein@Croatia(NC_045512@Croatia: + : 21563-25384)	1258-1266
4	379-388	PRRARSVRYP	linker	1-10
4	389-398	GVITHDVSSA	helicase(NC_045512: + : 16237-18039)	478-487
4	399-408	PRRARSVRYP	linker	1-10
4	409-431	TIATYCTGSIPCSVCLSGLDSLD	nsp3(NC_045512: + : 2720-8554)	1459-1481
4	432-441	PRRARSVRYP	linker	1-10
4	442-455	IKVCEFQFCNDPYY	surface_glycoprotein@CostaRica(NC_045512@CostaRica: + : 21563-25384)	128-141
4	456-465	PRRARSVRYP	linker	1-10
4	466-482	CSNLLLQYGSFCTQLNR	surface_glycoprotein(NC_045512: + : 21563-25384)	749-765
4	483-492	PRRARSVRYP	linker	1-10
4	493-502	DPIHSLRVCV	nsp3(NC_045512: + : 2720-8554)	339-348
4	503-512	PRRARSVRYP	linker	1-10
4	513-527	TISVTTEILPVSMAK	surface_glycoprotein@Mexico(NC_045512@Mexico: + : 21563-25384)	719-733
4	528-537	PRRARSVRYP	linker	1-10
4	538-549	TRAKVGILCIMS	helicase(NC_045512: + : 16237-18039)	566-577
4	550-559	PRRARSVRYP	linker	1-10
4	560-572	ISSVLNDILSRLD	surface_glycoprotein@Bangladesh(NC_045512@Bangladesh: + : 21563-25384)	972-984
4	573-582	PRRARSVRYP	linker	1-10
4	583-602	SEAVEAPLVGTPVCINGLML	nsp2(NC_045512: + : 806-2719)	591-610
4	603-612	PRRARSVRYP	linker	1-10
4	613-621	MPVCVETKA	nsp3(NC_045512: + : 2720-8554)	571-579
4	622-631	PRRARSVRYP	linker	1-10
4	632-640	VFSQCVNLT	surface_glycoprotein@Egypt(NC_045512@Egypt: + : 21563-25384)	11-19
4	641-650	PRRARSVRYP	linker	1-10
4	651-672	GYQPYRVVVLSFELLHAPATVC	surface_glycoprotein(NC_045512: + : 21563-25384)	504-525
4	673-682	PRRARSVRYP	linker	1-10
4	683-693	DNVLSTFISAA	nsp3(NC_045512: + : 2720-8554)	1809-1819
4	694-703	PRRARSVRYP	linker	1-10
4	704-712	VTANVNALL	RNA-dependent_RNA_polymerase(NC_045512: + : 13442-13468 + 13468-16236)	700-708
4	713-722	PRRARSVRYP	linker	1-10
4	723-734	VRTNVYLAVFDK	nsp3(NC_045512: + : 2720-8554)	351-362
4	735-744	PRRARSVRYP	linker	1-10
4	745-763	AIPINFTISVTTEILPVSM	surface_glycoprotein@Aruba(NC_045512@Aruba: + : 21563-25384)	709-727
4	764-773	PRRARSVRYP	linker	1-10
4	774-783	GTNLPLQLGF	3′-to-5′_exonuclease(NC_045512: + : 18040-19620)	102-111
4	784-793	PRRARSVRYP	linker	1-10
4	794-802	YDLSVVNAR	helicase(NC_045512: + : 16237-18039)	382-390
4	803-812	PRRARSVRYP	linker	1-10
4	813-831	LEILDITPCSFGGVSVITP	surface_glycoprotein(NC_045512: + : 21563-25384)	582-600
4	832-841	PRRARSVRYP	linker	1-10
4	842-861	GYLPQNAVVKIYCPACHNSE	nsp2(NC_045512: + : 806-2719)	178-197
4	862-871	PRRARSVRYP	linker	1-10
4	872-887	FLVLLPLVSIQCVNLT	surface_glycoprotein@SmallNorthAmerica(NC_045512@	4-19
			SmallNorthAmerica: + : 21563-25384)
4	888-897	PRRARSVRYP	linker	1-10
4	898-909	FQTLLHRSYLTP	surface_glycoprotein@SmallAsia(NC_045512@SmallAsia: + : 21563-25384)	230-241
4	910-919	PRRARSVRYP	linker	1-10
4	920-939	FCKLHNWNCVNCDTFCAGST	nsp3(NC_045512: + : 2720-8554)	1626-1645
4	940-949	PRRARSVRYP	linker	1-10
4	950-965	LQSLQTYVTQQLIRAA	surface_glycoprotein(NC_045512: + : 21563-25384)	100 1-1016
4	966-975	PRRARSVRYP	linker	1-10
4	976-989	SYLFQHANLDSCKR	nsp3(NC_045512: + : 2720-8554)	915-928
4	990-999	PRRARSVRYP	linker	1-10
4	1000-1011	HEFCSQHTMLVK	RNA-dependent_RNA_polymerase(NC_045512: + : 13442-13468 + 13468-16236)	810-821
4	1012-1021	PRRARSVRYP	linker	1-10
4	1022-1046	SDIDITFLKKDAPYIVGDVVQEGVL	nsp3(NC_045512: + : 2720-8554)	454-478
4	1047-1056	PRRARSVRYP	linker	1-10
4	1057-1072	VREVLSDRELHLSWEV	helicase(NC_045512: + : 16237-18039)	154-169
4	1073-1082	PRRARSVRYP	linker	1-10
4	1083-1106	PINLVRDLPQGFSVLEPLVDLPIG	surface_glycoprotein@Belgium(NC_045512@Belgium: + : 21563-25384)	205-228
4	1107-1116	PRRARSVRYP	linker	1-10
4	1117-1126	VTGLFKDCSK	3′-to-5′_exonuclease(NC_045512: + : 18040-19620)	4-13
4	1127-1136	PRRARSVRYP	linker	1-10
4	1137-1144	ARDLSLQF	nsp3(NC_045512: + : 2720-8554)	1652-1659
4	1145-1154	PRRARSVRYP	linker	1-10
4	1155-1175	AVLYQGVNCTEVPFAIHADQL	surface_glycoprotein@SmallAfrica(NC_045512@SmallAfrica: + : 21563-25384)	605-625
4	1176-1185	PRRARSVRYP	linker	1-10
4	1186-1203	IKVCEFQFCNDPFLGVYH	surface_glycoprotein@Aruba(NC_045512@Aruba: + : 21563-25384)	125-142

In certain embodiments, the vaccine comprises or expresses at least one of the concatemers of epitopes with intervening linker sequences (and as set forth in FIG. 22). In certain embodiments, the vaccine comprises or expresses at least two of the concatemers set forth below. In certain embodiments, the vaccine comprises or expresses three of the concatemers set forth below. In certain embodiments, the vaccine comprises or expresses all the concatemers set forth below.

Table 12
	pos_in_			pos_in_
contig	contig	epitope	gene	gene
1	1-11	YDKLQFISLEI	helicase@SouthAfrica(NC_045512@SouthAfrica: + : 16237-18039)	582-592
1	12-21	PRRARSVRYP	linker	1-10
1	22-39	YNLLKDCPAVAKHDFFKF	RNA-dependent_RNA_polymerase@Aruba(NC_045512@Aruba: + : 13442-13468 + 13468-16236)	87-104
1	40-49	PRRARSVRYP	linker	1-10
1	50-63	SDRVVFVLWAHGFE	3′-to-5′_exonuclease(NC_045512: + : 18040-19620)	178-191
1	64-73	PRRARSVRYP	linker	1-10
1	74-82	TENLLLYID	nsp3(NC_045512: + : 2720-8554)	432-440
1	83-92	PRRARSVRYP	linker	1-10
1	93-111	ANSVFNICQSVTANVNALL	RNA-dependent_RNA_polymerase@Croatia(NC_045512@	690-708
			Croatia: + : 13442-13468 + 13468-16236)
1	112-121	PRRARSVRYP	linker	1-10
1	122-130	AGFSLWVYK	3′-to-5′_exonuclease(NC_045512: + : 18040-19620)	504-512
1	131-140	PRRARSVRYP	linker	1-10
1	141-148	DQDVLFAY	RNA-dependent_RNA_polymerase@FrenchGuiana(NC_045512@	523-530
			FrenchGuiana: + : 13442-13468 + 13468-16236)
1	149-158	PRRARSVRYP	linker	1-10
1	159-168	ETFVTHSKGL	nsp2(NC_045512: + : 806-2719)	527-536
1	169-178	PRRARSVRYP	linker	1-10
1	179-186	SDDAVVCF	RNA-dependent_RNA_polymerase@Aruba(NC_045512@Aruba: + : 13442-13468 + 13468-16236)	759-766
1	187-196	PRRARSVRYP	linker	1-10
1	197-208	AKLLHKPIVWHV	nsp3(NC_045512: + : 2720-8554)	1165-1176
1	209-218	PRRARSVRYP	linker	1-10
1	219-226	FNSVCRFM	helicase@Malaysia(NC_045512@Malaysia: + : 16237-18039)	422-429
1	227-236	PRRARSVRYP	linker	1-10
1	237-247	YELKHGTFTCA	nsp3(NC_045512: + : 2720-8554)	996-1006
1	248-257	PRRARSVRYP	linker	1-10
1	258-267	DVVAIDYKHY	nsp3(NC_045512: + : 2720-8554)	1148-1157
1	268-277	PRRARSVRYP	linker	1-10
1	278-285	KAVFISPY	helicase(NC_045512: + : 16237-18039)	508-515
1	286-295	PRRARSVRYP	linker	1-10
1	296-303	ARDLSLQF	nsp3(NC_045512: + : 2720-8554)	1652-1659
1	304-313	PRRARSVRYP	linker	1-10
1	314-331	IKDLPKEITVATSRTLSY	membrane_glycoprotein(NC_045512: + : 26523-27191)	161-178
1	332-341	PRRARSVRYP	linker	1-10
1	342-355	TCFSVAALTNNVAF	RNA-dependent_RNA_polymerase@Aruba(NC_045512@Aruba: + : 13442-13468 + 13468-16236)	394-407
1	356-365	PRRARSVRYP	linker	1-10
1	366-381	SRIIPARARVDCFDKF	helicase@Brazil(NC_045512@Brazil: + : 16237-18039)	331-346
1	382-391	PRRARSVRYP	linker	1-10
1	392-406	SYELQTPFEIKLAKK	nsp2(NC_045512: + : 806-2719)	68-82
1	407-416	PRRARSVRYP	linker	1-10
1	417-437	KLSYGIAIVREVLSDRELHLS	helicase@Colombia(NC_045512@Colombia: + : 16237-18039)	146-166
1	438-447	PRRARSVRYP	linker	1-10
1	448-469	INLVRDLPQGFSALEPLVDLPI	surface_glycoprotein@Aruba(NC_045512@Aruba: + : 21563-25384)	206-227
1	470-479	PRRARSVRYP	linker	1-10
1	480-493	LKEILVTYNCCDDD	RNA-dependent_RNA_polymerase(NC_045512: + : 13442-13468 + 13468-16236)	142-155
1	494-503	PRRARSVRYP	linker	1-10
1	504-519	VREVLSDRELHLSWEV	helicase(NC_045512: + : 16237-18039)	154-169
1	520-529	PRRARSVRYP	linker	1-10
1	530-539	QEHYVRITGL	helicase(NC_045512: + : 16237-18039)	243-252
1	540-549	PRRARSVRYP	linker	1-10
1	550-559	RHSLSHFVNL	nsp3(NC_045512: + : 2720-8554)	1697-1706
1	560-569	PRRARSVRYP	linker	1-10
1	570-577	MADLVYAL	RNA-dependent_RNA_polymerase(NC_045512: + : 13442-13468 + 13468-16236)	124-131
1	578-587	PRRARSVRYP	linker	1-10
1	588-595	PEHSLAEY	nsp2(NC_045512: + : 806-2719)	200-207
1	596-605	PRRARSVRYP	linker	1-10
1	606-621	FRELGVVHNQDVNLHS	RNA-dependent_RNA_polymerase(NC_045512: + : 13442-13468 + 13468-16236)	348-363
1	622-631	PRRARSVRYP	linker	1-10
1	632-642	LRIAGHHLGRC	membrane_glycoprotein(NC_045512: + : 26523-27191)	149-159
1	643-652	PRRARSVRYP	linker	1-10
1	653-672	FCKLHNWNCVNCDTFCAGST	nsp3(NC_045512: + : 2720-8554)	1626-1645
1	673-682	PRRARSVRYP	linker	1-10
1	683-690	CLNRVCTN	nsp3(NC_045512: + : 2720-8554)	1342-1349
1	691-700	PRRARSVRYP	linker	1-10
1	701-720	FPQSAPHGVVFLHVTYVPAQ	surface_glycoprotein@Aruba(NC_045512@Aruba: + : 21563-25384)	1048-1067
1	721-730	PRRARSVRYP	linker	1-10
1	731-749	ANSVFNICQAVTANVNALL	RNA-dependent_RNA_polymerase@Aruba(NC_045512@Aruba: + : 13442-13468 + 13468-16236)	690-708
1	750-759	PRRARSVRYP	linker	1-10
1	760-776	PNFVFPLNSIIKTIQPR	nsp2(NC_045512: + : 806-2719)	91-107
1	777-786	PRRARSVRYP	linker	1-10
1	787-799	RSVASQSIIAYTM	surface_glycoprotein@Aruba(NC_045512@Aruba: + : 21563-25384)	681-693
1	800-809	PRRARSVRYP	linker	1-10
1	810-817	REGVFVSN	surface_glycoprotein@Aruba(NC_045512@Aruba: + : 21563-25384)	1087-1094
1	818-827	PRRARSVRYP	linker	1-10
1	828-840	AFASEAARVVRSI	nsp2(NC_045512: + : 806-2719)	355-367
1	841-850	PRRARSVRYP	linker	1-10
1	851-863	ISSVLNDILSRLD	surface_glycoprotein@Bangladesh(NC_045512@Bangladesh: + : 21563-25384)	972-984
1	864-873	PRRARSVRYP	linker	1-10
1	874-887	LVLLPLVSSQCVNF	surface_glycoprotein@Brazil(NC_045512@Brazil: + : 21563-25384)	5-18
1	888-897	PRRARSVRYP	linker	1-10
1	898-912	EFQFCNDPFLGVYYH	surface_glycoprotein@Chile(NC_045512@Chile: + : 21563-25384)	132-146
1	913-922	PRRARSVRYP	linker	1-10
1	923-931	AAAYYVGYL	surface_glycoprotein(NC_045512: + : 21563-25384)	262-270
1	932-941	PRRARSVRYP	linker	1-10
1	942-950	VFSQCVNLT	surface_glycoprotein@Egypt(NC_045512@Egypt: + : 21563-25384)	11-19
1	951-960	PRRARSVRYP	linker	1-10
1	961-973	LLNVPLHGTILTR	membrane_glycoprotein(NC_045512: + : 26523-27191)	119-131
1	974-983	PRRARSVRYP	linker	1-10
1	984-996	NPVLPFNDGVYFA	surface_glycoprotein(NC_045512: + : 21563-25384)	81-93
1	997-1006	PRRARSVRYP	linker	1-10
1	1007-1014	SLIDLQEL	surface_glycoprotein(NC_045512: + : 21563-25384)	1196-1203
1	1015-1024	PRRARSVRYP	linker	1-10
1	1025-1032	YDPLQPEL	surface_glycoprotein(NC_045512: + : 21563-25384)	1138-1145
1	1033-1042	PRRARSVRYP	linker	1-10
1	1043-1058	FLVLLPLVSSQCVNLT	surface_glycoprotein@Aruba(NC_045512@Aruba: + : 21563-25384)	4-19
1	1059-1068	PRRARSVRYP	linker	1-10
1	1069-1076	SSNVANYQ	helicase@Austria(NC_045512@Austria: + : 16237-18039)	263-270
1	1077-1086	PRRARSVRYP	linker	1-10
1	1087-1101	TYGVGYQPYRVVVLS	surface_glycoprotein@Australia(NC_045512@Australia: + : 21563-25384)	496-510
1	1102-1111	PRRARSVRYP	linker	1-10
1	1112-1121	TQNVLYENQK	surface_glycoprotein(NC_045512: + : 21563-25384)	912-921
1	1122-1131	PRRARSVRYP	linker	1-10
1	1132-1139	TDAVDCAL	surface_glycoprotein(NC_045512: + : 21563-25384)	286-293
1	1140-1149	PRRARSVRYP	linker	1-10
1	1150-1165	DKYVRNLQHRLYECLY	RNA-dependent_RNA_polymerase@Aruba(NC_045512@Aruba: + : 13442-13468 + 13468-16236)	717-732
1	1166-1175	PRRARSVRYP	linker	1-10
1	1176-1191	FLVLLPLVSIQCVNLT	surface_glycoprotein@SmallNorthAmerica(NC_045512@SmallNorthAmerica: + : 21563-25384)	4-19
1	1192-1201	PRRARSVRYP	linker	1-10
1	1202-1219	LFVVEVVDKYFDCYDGGC	RNA-dependent_RNA_polymerase(NC_045512: + : 13442-13468 + 13468-16236)	470-487
1	1220-1229	PRRARSVRYP	linker	1-10
1	1230-1241	HEFCSQHTMLVK	RNA-dependent_RNA_polymerase(NC_045512: + : 13442-13468 + 13468-16236)	810-821
1	1242-1251	PRRARSVRYP	linker	1-10
1	1252-1259	AALQIPFA	surface_glycoprotein(NC_045512: + : 21563-25384)	892-899
1	1260-1269	PRRARSVRYP	linker	1-10
1	1270-1277	SVDCTMYI	surface_glycoprotein(NC_045512: + : 21563-25384)	735-742
1	1278-1287	PRRARSVRYP	linker	1-10
1	1288-1295	NNLVVMAY	nsp2(NC_045512: + : 806-2719)	413-420
1	1296-1305	PRRARSVRYP	linker	1-10
1	1306-1317	FRSSVLHSTRDL	surface_glycoprotein@Nigeria(NC_045512@Nigeria: + : 21563-25384)	43-54
1	1318-1327	PRRARSVRYP	linker	1-10
1	1328-1335	ISNCVADY	surface_glycoprotein(NC_045512: + : 21563-25384)	358-365
1	1336-1345	PRRARSVRYP	linker	1-10
1	1346-1365	GYLPQNAVVKIYCPACHNSE	nsp2(NC_045512: + : 806-2719)	178-197
1	1366-1375	PRRARSVRYP	linker	1-10
1	1376-1385	VTGLFKDCSK	3′-to-5′_exonuclease(NC_045512: + : 18040-19620)	4-13
1	1386-1395	PRRARSVRYP	linker	1-10
1	1396-1403	AEVQIDRL	surface_glycoprotein(NC_045512: + : 21563-25384)	989-996
1	1404-1413	PRRARSVRYP	linker	1-10
1	1414-1427	SVASQSIIAYTMSL	surface_glycoprotein@Austria(NC_045512@Austria: + : 21563-25384)	678-691
1	1428-1437	PRRARSVRYP	linker	1-10
1	1438-1446	EVFAQVKQI	surface_glycoprotein(NC_045512: + : 21563-25384)	780-788
1	1447-1456	PRRARSVRYP	linker	1-10
1	1457-1475	LEILDITPCSFGGVSVITP	surface_glycoprotein(NC_045512: + : 21563-25384)	582-600
1	1476-1485	PRRARSVRYP	linker	1-10
1	1486-1496	FFSNVTWFHVS	surface_glycoprotein@Nigeria(NC_045512@Nigeria: + : 21563-25384)	58-68
1	1497-1506	PRRARSVRYP	linker	1-10
1	1507-1519	FQTLLALHRSYLT	surface_glycoprotein@Aruba(NC_045512@Aruba: + : 21563-25384)	234-246
2	1-20	IRRPFLCCKCCYDHVISTSH	helicase(NC_045512: + : 16237-18039)	20-39
2	21-30	PRRARSVRYP	linker	1-10
2	31-38	LPINVIVF	nsp3(NC_045512: + : 2720-8554)	1718-1725
2	39-48	PRRARSVRYP	linker	1-10
2	49-69	HPNCVNCSDDRCILHCANFNV	RNA- dependent_RNA_polymerase@Aruba(NC_045512@Aruba: + : 13442-13468 + 13468-16236)	295-315
2	70-79	PRRARSVRYP	linker	1-10
2	80-92	GVNLVAVPTGYVD	3′-to-5′_exonuclease(NC_045512: + : 18040-19620)	114-126
2	93-102	PRRARSVRYP	linker	1-10
2	103-116	IRNLQHRLYECLYR	RNA-dependent_RNA_polymerase@Austria(NC_045512@Austria: + : 13442-13468 + 13468-16236)	720-733
2	117-126	PRRARSVRYP	linker	1-10
2	127-143	VPQEHYVRITGLYPTLN	helicase@Aruba(NC_045512@Aruba: + : 16237-18039)	241-257
2	144-153	PRRARSVRYP	linker	1-10
2	154-164	RQALLKTVQFC	RNA-dependent_RNA_polymerase@Aruba(NC_045512@Aruba: + : 13442-13468 + 13468-16236)	183-193
2	165-174	PRRARSVRYP	linker	1-10
2	175-182	YDKLVSSF	nsp3(NC_045512: + : 2720-8554)	365-372
2	183-192	PRRARSVRYP	linker	1-10
2	193-212	KLTCATTRQVVNVVTTKIAL	nsp3(NC_045512: + : 2720-8554)	1923-1942
2	213-222	PRRARSVRYP	linker	1-10
2	223-233	VVNAANVYLKH	nsp3(NC_045512: + : 2720-8554)	239-249
2	234-243	PRRARSVRYP	linker	1-10
2	244-257	TKDVVECLKLSHQS	nsp3(NC_045512: + : 2720-8554)	1830-1843
2	258-267	PRRARSVRYP	linker	1-10
2	268-276	YDLSVVNAR	helicase(NC_045512: + : 16237-18039)	382-390
2	277-286	PRRARSVRYP	linker	1-10
2	287-296	ACIDCSARHI	nsp3(NC_045512: + : 2720-8554)	1872-1881
2	297-306	PRRARSVRYP	linker	1-10
2	307-316	NYQCGHYKHI	nsp3(NC_045512: + : 2720-8554)	1012-1021
2	317-326	PRRARSVRYP	linker	1-10
2	327-336	KACVEEVTTT	nsp3(NC_045512: + : 2720-8554)	415-424
2	337-346	PRRARSVRYP	linker	1-10
2	347-354	FNSVCRLM	helicase@Aruba(NC_045512@Aruba: + : 16237-18039)	422-429
2	355-364	PRRARSVRYP	linker	1-10
2	365-379	FKELLVYAADPAMHA	RNA-dependent_RNA_polymerase(NC_045512: + : 13442-13468 + 13468-16236)	368-382
2	380-389	PRRARSVRYP	linker	1-10
2	390-399	SVELKHFFFA	RNA-dependent_RNA_polymerase(NC_045512: + : 13442-13468 + 13468-16236)	434-443
2	400-409	PRRARSVRYP	linker	1-10
2	410-418	RSVYPVASP	nsp2(NC_045512: + : 806-2719)	121-129
2	419-428	PRRARSVRYP	linker	1-10
2	429-446	CANFNVLFSTVFPFTSFG	RNA-dependent_RNA_polymerase@Nigeria(NC_045512@Nigeria: + : 13442-13468 + 13468-16236)	310-327
2	447-456	PRRARSVRYP	linker	1-10
2	457-469	ANFCALILAYCNK	nsp3(NC_045512: + : 2720-8554)	890-902
2	470-479	PRRARSVRYP	linker	1-10
2	480-495	TVLKKCKSAFYILPSI	nsp3(NC_045512: + : 2720-8554)	526-541
2	496-505	PRRARSVRYP	linker	1-10
2	506-520	ERFVSLAIDAYPLTK	RNA-dependent_RNA_polymerase(NC_045512: + : 13442-13468 + 13468-16236)	857-871
2	521-530	PRRARSVRYP	linker	1-10
2	531-543	IVKFISTCACEIV	nsp2(NC_045512: + : 806-2719)	468-480
2	544-553	PRRARSVRYP	linker	1-10
2	554-561	DSYFVVKR	RNA-dependent_RNA_polymerase(NC_045512: + : 13442-13468 + 13468-16236)	67-74
2	562-571	PRRARSVRYP	linker	1-10
2	572-591	DDRCILHCANFNVLFSTVFP	RNA-dependent_RNA_polymerase(NC_045512: + : 13442-13468 + 13468-16236)	303-322
2	592-601	PRRARSVRYP	linker	1-10
2	602-610	VTANVNALL	RNA-dependent_RNA_polymerase(NC_045512: + : 13442-13468 + 13468-16236)	700-708
2	611-620	PRRARSVRYP	linker	1-10
2	621-640	LQKAAITILDGISQYSLRLI	nsp2(NC_045512: + : 806-2719)	382-401
2	641-650	PRRARSVRYP	linker	1-10
2	651-673	SHGKQVVSDIDYVPLKSATCITR	3′-to-5′_exonuclease(NC_045512: + : 18040-19620)	454-476
2	674-683	PRRARSVRYP	linker	1-10
2	684-696	YAKPFLNKVVSTT	nsp3(NC_045512: + : 2720-8554)	1323-1335
2	697-706	PRRARSVRYP	linker	1-10
2	707-733	FSASTSAFVETVKGLDYKA	nsp2(NC_045512: + : 806-2719)	300-326
		FKQIVESC
2	734-743	PRRARSVRYP	linker	1-10
2	744-758	ISNCVADYSVLYNSA	surface_glycoprotein@Aruba(NC_045512@Aruba: + : 21563-25384)	354-368
2	759-768	PRRARSVRYP	linker	1-10
2	769-778	KQYGDCLGNI	surface_glycoprotein@Jordan(NC_045512@Jordan: + : 21563-25384)	831-840
2	779-788	PRRARSVRYP	linker	1-10
2	789-800	FRSSVLHSTQDL	surface_glycoprotein@Aruba(NC_045512@Aruba: + : 21563-25384)	43-54
2	801-810	PRRARSVRYP	linker	1-10
2	811-819	TEIYQAGST	surface_glycoprotein@Aruba(NC_045512@Aruba: + : 21563-25384)	466-474
2	820-829	PRRARSVRYP	linker	1-10
2	830-839	GTNLPLQLGF	3′-to-5′_exonuclease(NC_045512: + : 18040-19620)	102-111
2	840-849	PRRARSVRYP	linker	1-10
2	850-861	FSNVTWFHAIVS	surface_glycoprotein@Ghana(NC_045512@Ghana: + : 21563-25384)	59-70
2	862-871	PRRARSVRYP	linker	1-10
2	872-895	PINLVRDLPQGFSVLEPLVDLPIG	surface_glycoprotein@Belgium(NC_045512@Belgium: + : 21563-25384)	205-228
2	896-905	PRRARSVRYP	surface_glycoprotein@Nigeria(NC_045512@Nigeria: + : 21563-25384)	886-895
2	906-915	AGAALQIPFA	linker	1-10
2	916-925	PRRARSVRYP	linker	1-10
2	926-941	FSNVTWFHAIHVSGTN	surface_glycoprotein@Peru(NC_045512@Peru: + : 21563-25384)	59-74
2	942-951	PRRARSVRYP	linker	1-10
2	952-966	TISVTTEILPVSMAK	surface_glycoprotein@Mexico(NC_045512@Mexico: + : 21563-25384)	719-733
2	967-976	PRRARSVRYP	linker	1-10
2	977-994	LNDLCFTNVYADSFVIRG	surface_glycoprotein(NC_045512: + : 21563-25384)	387-404
2	995-1004	PRRARSVRYP	linker	1-10
2	1005-1023	ECAQVLSETVMCGGSLYVK	RNA-dependent_RNA_polymerase@Aruba(NC_045512@Aruba: + : 13442-13468 + 13468-16236)	658-676
2	1024-1033	PRRARSVRYP	linker	1-10
2	1034-1048	INAACRKVQHMVVKA	3′-to-5′_exonuclease(NC_045512: + : 18040-19620)	305-319
2	1049-1058	PRRARSVRYP	linker	1-10
2	1059-1072	RLNVGDYFVLTSHT	helicase@Austria(NC_045512@Austria: + : 16237-18039)	218-231
2	1073-1082	PRRARSVRYP	linker	1-10
2	1083-1091	EPLLKGVKL	surface_glycoprotein@Croatia(NC_045512@Croatia: + : 21563-25384)	1258-1266
2	1092-1101	PRRARSVRYP	linker	1-10
2	1102-1126	SDIDITFLKKDAPYIVGDVVQEGVL	nsp3(NC_045512: + : 2720-8554)	454-478
2	1127-1136	PRRARSVRYP	linker	1-10
2	1137-1151	EFQFCNYPFLGVYHK	surface_glycoprotein@Norway(NC_045512@Norway: + : 21563-25384)	129-143
2	1152-1161	PRRARSVRYP	linker	1-10
2	1162-1175	GFNCYSPLQSYGFQ	surface_glycoprotein@Peru(NC_045512@Peru: + : 21563-25384)	485-498
2	1176-1185	PRRARSVRYP	linker	1-10
2	1186-1199	GFNCYFPLQPYGFQ	surface_glycoprotein@SmallSouthAmerica(NC_045512@SmallSouthAmerica: + : 21563-25384)	481-494
2	1200-1209	PRRARSVRYP	linker	1-10
2	1210-1221	FQTLLHRSYLTP	surface_glycoprotein@SmallAsia(NC_045512@SmallAsia: + : 21563-25384)	230-241
2	1222-1231	PRRARSVRYP	linker	1-10
2	1232-1239	KLGASQRV	membrane_glycoprotein(NC_045512: + : 26523-27191)	180-187
2	1240-1249	PRRARSVRYP	linker	1-10
2	1250-1263	TSGVGYQPYRVVVL	surface_glycoprotein@Aruba(NC_045512@Aruba: + : 21563-25384)	496-509
2	1264-1273	PRRARSVRYP	linker	1-10
2	1274-1294	ALCEKALKYFPIDKCSRIIPA	helicase@Colombia(NC_045512@Colombia: + : 16237-18039)	316-336
2	1295-1304	PRRARSVRYP	linker	1-10
2	1305-1316	ALGKLQDVVNQN	surface_glycoprotein(NC_045512: + : 21563-25384)	944-955
2	1317-1326	PRRARSVRYP	linker	1-10
2	1327-1336	KCAYWVPRAS	nsp2(NC_045512: + : 806-2719)	239-248
2	1337-1346	PRRARSVRYP	linker	1-10
2	1347-1358	ISVTTEILPVSM	surface_glycoprotein(NC_045512: + : 21563-25384)	720-731
2	1359-1368	PRRARSVRYP	linker	1-10
2	1369-1380	IEVQGYKSVNIT	nsp3(NC_045512: + : 2720-8554)	13-24
2	1381-1390	PRRARSVRYP	linker	1-10
2	1391-1404	FGTVYEKLKPVLDW	nsp2(NC_045512: + : 806-2719)	437-450
2	1405-1414	PRRARSVRYP	linker	1-10
2	1415-1424	FCLEASFNYL	nsp3(NC_045512: + : 2720-8554)	1391-1400
2	1425-1434	PRRARSVRYP	linker	1-10
2	1435-1445	YDKLQFTSLEI	helicase@Aruba(NC_045512@Aruba: + : 16237-18039)	582-592
2	1 446-1455	PRRARSVRYP	linker	1-10
2	1456-1466	DNVLSTFISAA	nsp3(NC_045512: + : 2720-8554)	1809-1819
2	1467-1476	PRRARSVRYP	linker	1-10
2	1477-1484	FTGCVIAW	surface_glycoprotein(NC_045512: + : 21563-25384)	429-436
2	1485-1494	PRRARSVRYP	linker	1-10
2	1495-1504	KQYGDCLGDI	surface_glycoprotein(NC_045512: + : 21563-25384)	835-844
3	1-8	QIGVVREF	helicase(NC_045512: + : 16237-18039)	492-499
3	9-18	PRRARSVRYP	linker	1-10
3	19-40	LGGMSYYCKSHKPSISFPLCAN	helicase@NewZealand(NC_045512@NewZealand: + : 16237-18039)	65-86
3	41-50	PRRARSVRYP	linker	1-10
3	51-60	DPIHSLRVCV	nsp3(NC_045512: + : 2720-8554)	339-348
3	61-70	PRRARSVRYP	linker	1-10
3	71-88	SQHTMLVKQGDDYVYLPY	RNA-dependent_RNA_polymerase@Aruba(NC_045512@Aruba: + : 13442-13468 + 13468-16236)	814-831
3	89-98	PRRARSVRYP	linker	1-10
3	99-107	ASQGLLASI	RNA-dependent_RNA_polymerase@Austria(NC_045512@Austria: + : 13442-13468 + 13468-16236)	108-117
3	771-779	PRRARSVRYP	linker	1-10
3	118-143	YRLANECAQVLSEMVMCGGSLYVKPG	RNA-dependent_RNA_polymerase@Australia	653-678
			(NC_045512@Australia: + : 13442-13468 + 13468-16236)
3	144-153	PRRARSVRYP	linker	1-10
3	154-185	IMASLVLARKHTTCCSLSHRF	RNA-dependent_RNA_polymerase(NC_045512: + : 13442-13468 + 13468-16236)	632-663
		YRLANECAQVL
3	186-195	PRRARSVRYP	linker	1-10
3	196-212	LECNVKTTEVVGDIILK	nsp3(NC_045512: + : 2720-8554)	1244-1260
3	213-222	PRRARSVRYP	linker	1-10
3	223-236	SYLFQHANLDSCKR	nsp3(NC_045512: + : 2720-8554)	915-928
3	237-246	PRRARSVRYP	linker	1-10
3	247-256	LSVNPYVCNA	helicase@Cyprus(NC_045512@Cyprus: + : 16237-18039)	43-52
3	257-266	PRRARSVRYP	linker	1-10
3	267-277	EQYVFCTVNAL	helicase(NC_045512: + : 16237-18039)	353-363
3	278-287	PRRARSVRYP	linker	1-10
3	288-297	VQQESPFVMM	nsp3(NC_045512: + : 2720-8554)	980-989
3	298-307	PRRARSVRYP	linker	1-10
3	308-316	MPVCVETKA	nsp3(NC_045512: + : 2720-8554)	571-579
3	317-326	PRRARSVRYP	linker	1-10
3	327-349	YLGGMSYYCKSHKLPISFPLCAN	helicase@CostaRica(NC_045512@CostaRica: + : 16237-18039)	64-86
3	350-359	PRRARSVRYP	linker	1-10
3	360-375	RKIFVDGVPFVVSTGY	RNA-dependent_RNA_polymerase(NC_045512: + : 13442-13468 + 13468-16236)	331-346
3	376-385	PRRARSVRYP	linker	1-10
3	386-397	VPVVDSYYSLLM	RNA-dependent_RNA_polymerase(NC_045512: + : 13442-13468 + 13468-16236)	231-242
3	398-407	PRRARSVRYP	linker	1-10
3	408-417	VMCGGSLYVK	RNA-dependent_RNA_polymerase(NC_045512: + : 13442-13468 + 13468-16236)	667-676
3	418-427	PRRARSVRYP	linker	1-10
3	428-435	DMYSVMLT	RNA-dependent_RNA_polymerase@Malaysia(NC_045512@	901-908
			Malaysia: + : 13442-13468 + 13468-16236)
3	436-445	PRRARSVRYP	linker	1-10
3	446-453	GVYCCREH	nsp2(NC_045512: + : 806-2719)	47-54
3	454-463	PRRARSVRYP	linker	1-10
3	464-478	YNLLKGCPAVAKHDF	RNA-dependent_RNA_polymerase@Poland(NC_045512@Poland: + : 13442-13468 + 13468-16236)	87-101
3	479-488	PRRARSVRYP	linker	1-10
3	489-500	NIGCNHTGVVGE	nsp2(NC_045512: + : 806-2719)	250-261
3	501-510	PRRARSVRYP	linker	1-10
3	511-532	SQHTMLVKQFDDYVYLPYPDPS	RNA-dependent_RNA_polymerase@Estonia(NC_045512@	814-835
			Estonia: + : 13442-13468 + 13468-16236)
3	533-542	PRRARSVRYP	linker	1-10
3	543-550	STFKCYGV	surface_glycoprotein@Aruba(NC_045512@Aruba: + : 21563-25384)	371-378
3	551-560	PRRARSVRYP	linker	1-10
3	561-574	ANPVLPFNDGVYFA	surface_glycoprotein@Austria(NC_045512@Austria: + : 21563-25384)	77-90
3	575-584	PRRARSVRYP	linker	1-10
3	585-596	VTMPLGYVTHGL	nsp3(NC_045512: + : 2720-8554)	628-639
3	597-606	PRRARSVRYP	linker	1-10
3	607-645	GCDVTDVTQLYLGGMSYYCKS	helicase(NC_045512: + : 16237-18039)	54-92
		HKPPISFPLCANGQVFGL
3	646-655	PRRARSVRYP	linker	1-10
3	656-686	YIWLGFIAGLIAIVMVTI	surface_glycoprotein@Aruba(NC_045512@Aruba: + : 21563-25384)	1211-1241
		MLCCMTSCCSCLK
3	687-696	PRRARSVRYP	linker	1-10
3	697-708	EVFAQVKQIYKT	surface_glycoprotein@Aruba(NC_045512@Aruba: + : 21563-25384)	776-787
3	709-718	PRRARSVRYP	linker	1-10
3	719-737	DKSAFVNLKQLPFFYYSDS	3′-to-5′_exonuclease(NC_045512: + : 18040-19620)	432-450
3	738-747	PRRARSVRYP	linker	1-10
3	748-763	LQSLQTYVTQQLIRAA	surface_glycoprotein(NC_045512: + : 21563-25384)	1001-1016
3	764-773	PRRARSVRYP	linker	1-10
3	774-782	FFSNVTWFH	surface_glycoprotein(NC_045512: + : 21563-25384)	58-66
3	783-792	PRRARSVRYP	linker	1-10
3	793-807	RIIPARARVECFDKF	helicase@Aruba(NC_045512@Aruba: + : 16237-18039)	332-346
3	808-817	PRRARSVRYP	linker	1-10
3	818-831	FFSNVTWFHAIHVS	surface_glycoprotein@Bangladesh(NC_045512@Bangladesh: + : 21563-25384)	58-71
3	832-841	PRRARSVRYP	linker	1-10
3	842-855	EGVVDYGARFYFYT	nsp3(NC_045512: + : 2720-8554)	595-608
3	856-865	PRRARSVRYP	linker	1-10
3	866-887	GYQPYRVVVLSFELLHAPATVC	surface_glycoprotein(NC_045512: + : 21563-25384)	504-525
3	888-897	PRRARSVRYP	linker	1-10
3	898-916	QVAVLYQDVNCTEVPVAIH	surface_glycoprotein@China(NC_045512@China: + : 21563-25384)	607-625
3	917-926	PRRARSVRYP	linker	1-10
3	927-941	FSVAALTNNVAFQTV	RNA-dependent_RNA_polymerase(NC_045512: + : 13442-13468 + 13468-16236)	396-410
3	942-951	PRRARSVRYP	linker	1-10
3	952-959	TDVVYRAF	RNA-dependent_RNA_polymerase@Aruba(NC_045512@Aruba: + : 13442-13468 + 13468-16236)	28-35
3	960-969	PRRARSVRYP	linker	1-10
3	970-981	FNCYFPLQSYGF	surface_glycoprotein(NC_045512: + : 21563-25384)	486-497
3	982-991	PRRARSVRYP	linker	1-10
3	992-999	PSFLGRYM	nsp3(NC_045512: + : 2720-8554)	822-829
3	1000-1009	PRRARSVRYP	linker	1-10
3	1010-1028	KLNVGDYFVLTSHTVMPLS	helicase(NC_045512: + : 16237-18039)	218-236
3	1029-1038	PRRARSVRYP	linker	1-10
3	1039-1054	GSNVFQTRAGCLIGAE	surface_glycoprotein(NC_045512: + : 21563-25384)	639-654
3	1055-1064	PRRARSVRYP	linker	1-10
3	1065-1074	SVLNDILARL	surface_glycoprotein@Aruba(NC_045512@Aruba: + : 21563-25384)	971-980
3	1075-1084	PRRARSVRYP	linker	1-10
3	1085-1107	RVDFCGKGYHLMSFPQSAPHGVV	surface_glycoprotein(NC_045512: + : 21563-25384)	1039-1061
3	1108-1117	PRRARSVRYP	linker	1-10
3	1118-1135	CANFNVLFSTVFPPTSFG	RNA dependent_RNA_polymerase@China(NC_045512@China: + : 13442-13468 + 13468-16236)	310-327
3	1136-1145	PRRARSVRYP	linker	1-10
3	1146-1159	ETKCTLKSFTVEKG	surface_glycoprotein@Aruba(NC_045512@Aruba: + : 21563-25384)	294-307
3	1160-1169	PRRARSVRYP	linker	1-10
3	1170-1191	NVVIKVCEFQFCNYPFLGVYYH	surface_glycoprotein@Brazil(NC_045512@Brazil: + : 21563-25384)	125-146
3	1192-1201	PRRARSVRYP	linker	1-10
3	1202-1210	SPDVDLADI	surface_glycoprotein@Chile(NC_045512@Chile: + : 21563-25384)	1161-1169
3	1211-1220	PRRARSVRYP	linker	1-10
3	1221-1237	SAAYYVGYLQLRTFLLK	surface_glycoprotein@Italy(NC_045512@Italy: + : 21563-25384)	258-274
3	1238-1247	PRRARSVRYP	linker	1-10
3	1248-1267	MTSCCSCLKGCCSCGSCCKF	surface_glycoprotein(NC_045512: + : 21563-25384)	1237-1256
3	1268-1277	PRRARSVRYP	linker	1-10
3	1278-1288	HFPRKGVFVSN	surface_glycoprotein@SmallAsia(NC_045512@SmallAsia: + : 21563-25384)	1078-1088
3	1289-1298	PRRARSVRYP	linker	1-10
3	1299-1308	NEFYAYLRKH	RNA-dependent_RNA_polymerase(NC_045512: + : 13442-13468 + 13468-16236)	743-752
3	1309-1318	PRRARSVRYP	linker	1-10
3	1319-1332	IKVCEFQFCNDPYY	surface_glycoprotein@CostaRica(NC_045512@CostaRica: + : 21563-25384)	128-141
3	1333-1342	PRRARSVRYP	linker	1-10
3	1343-1359	YADVFHLYLQYIRKLHD	RNA-dependent_RNA_polymerase(NC_045512: + : 13442-13468 + 13468-16236)	877-893
3	1360-1369	PRRARSVRYP	linker	1-10
3	1370-1384	ARSVARQSIIAYTMS	surface_glycoprotein@Mozambique(NC_045512@Mozambique: + : 21563-25384)	680-694
3	1385-1394	PRRARSVRYP	linker	1-10
3	1395-1404	KSASVYYSQL	nsp3(NC_045512: + : 2720-8554)	1737-1746
3	1405-1414	PRRARSVRYP	linker	1-10
3	1415-1430	ANSIVCRFDTRVLSNL	3′-to-5′_exonuclease(NC_045512: + : 18040-19620)	394-409
3	1431-1440	PRRARSVRYP	linker	1-10
3	1441-1448	PVLKGVKL	surface_glycoprotein@Aruba(NC_045512@Aruba: + : 21563-25384)	1259-1266
3	1449-1458	PRRARSVRYP	linker	1-10
3	1459-1478	PINLVRGLPQGFSVLEPLVD	surface_glycoprotein@SmallAfrica(NC_045512@SmallAfrica: + : 21563-25384)	209-228
3	1479-1488	PRRARSVRYP	linker	1-10
3	1489-1502	APGCDVTDVTQLYL	helicase@Aruba(NC_045512@Aruba: + : 16237-18039)	52-65
4	1-12	VRTNVYLAVFDK	nsp3(NC_045512: + : 2720-8554)	351-362
4	13-22	PRRARSVRYP	linker	1-10
4	23-33	KGVQIPCTCGK	nsp3(NC_045512: + : 2720-8554)	963-973
4	34-43	PRRARSVRYP	linker	1-10
4	44-66	NHDLYCQVHGNAHVASCDAIMTR	3′-to-5′_exonuclease(NC_045512: + : 18040-19620)	256-278
4	67-76	PRRARSVRYP	linker	1-10
4	77-84	YDFAVSKG	RNA-dependent_RNA_polymerase@Aruba(NC_045512@Aruba: + : 13442-13468 + 13468-16236)	420-427
4	85-94	PRRARSVRYP	linker	1-10
4	95-104	ISDYDYYRYN	RNA-dependent_RNA_polymerase@Aruba(NC_045512@Aruba: + : 13442-13468 + 13468-16236)	450-459
4	105-114	PRRARSVRYP	linker	1-10
4	115-122	FKLASHMY	nsp3(NC_045512: + : 2720-8554)	96-103
4	123-132	PRRARSVRYP	linker	1-10
4	133-147	SYFAIGLALYYPSAR	helicase@Austria(NC_045512@Austria: + : 16237-18039)	289-303
4	148-157	PRRARSVRYP	linker	1-10
4	158-166	ASQGLVASI	RNA-dependent_RNA_polymerase@Aruba(NC_045512@Aruba: + : 13442-13468 + 13468-16236)	771-779
4	167-176	PRRARSVRYP	linker	1-10
4	177-186	VVADAVIKTL	nsp3(NC_045512: + : 2720-8554)	56-65
4	187-196	PRRARSVRYP	linker	1-10
4	197-208	SSPDAVTAYNGY	nsp3(NC_045512: + : 2720-8554)	660-671
4	209-218	PRRARSVRYP	linker	1-10
4	219-226	SINVANYQ	helicase@Mozambique(NC_045512@Mozambique: + : 16237-18039)	263-270
4	227-236	PRRARSVRYP	linker	1-10
4	237-245	SRELKVTFF	nsp3(NC_045512: + : 2720-8554)	1134-1142
4	246-255	PRRARSVRYP	linker	1-10
4	256-267	TRAKVGILCIMS	helicase(NC_045512: + : 16237-18039)	566-577
4	268-277	PRRARSVRYP	linker	1-10
4	278-287	GVITHDVSSA	helicase(NC_045512: + : 16237-18039)	478-487
4	288-297	PRRARSVRYP	linker	1-10
4	298-317	SEAVEAPLVGTPVCINGLML	nsp2(NC_045512: + : 806-2719)	591-610
4	318-327	PRRARSVRYP	linker	1-10
4	328-338	AVHECFVKRVD	3′-to-5′_exonuclease(NC_045512: + : 18040-19620)	281-291
4	339-348	PRRARSVRYP	linker	1-10
4	349-362	RNLQHRLYECLYRN	RNA-dependent_RNA_polymerase(NC_045512: + : 13442-13468 + 13468-16236)	721-734
4	363-372	PRRARSVRYP	linker	1-10
4	373-388	SLRCGACIRRPFLCCK	helicase@Aruba(NC_045512@Aruba: + : 16237-18039)	13-28
4	389-398	PRRARSVRYP	linker	1-10
4	399-411	KASCTLSEQLDFI	nsp2(NC_045512: + : 806-2719)	30-42
4	412-421	PRRARSVRYP	linker	1-10
4	422-438	AQSFLNRVCGVSAARLT	RNA-dependent_RNA_polymerase(NC_045512: + : 13442-13468 + 13468-16236)	4-20
4	439-448	PRRARSVRYP	linker	1-10
4	449-463	QIELKFNPPALQDAY	nsp3(NC_045512: + : 2720-8554)	867-881
4	464-473	PRRARSVRYP	linker	1-10
4	474-491	IKVCEFQFCNDPFLGVYH	surface_glycoprotein@Aruba(NC_045512@Aruba: + : 21563-25384)	125-142
4	492-501	PRRARSVRYP	linker	1-10
4	502-516	HYVRITGLYPTLNIL	helicase@Indonesia(NC_045512@Indonesia: + : 16237-18039)	245-259
4	517-526	PRRARSVRYP	linker	1-10
4	527-534	YDFVVSKG	RNA-dependent_RNA_polymerase@Japan(NC_045512@Japan: + : 13442-13468 + 13468-16236)	420-427
4	535-544	PRRARSVRYP	linker	1-10
4	545-564	YVYLPYPDPSRILGAGCFVD	RNA-dependent_RNA_polymerase(NC_045512: + : 13442-13468 + 13468-16236)	826-845
4	565-574	PRRARSVRYP	linker	1-10
4	575-625	HFAIGLALYYPSARIVYTACSHAAV	helicase(NC_045512: + : 16237-18039)	290-340
		DALCEKALKYLPIDKCSRIIPARARV
4	626-635	PRRARSVRYP	linker	1-10
4	636-655	RAKHYVYIGDPAQLPAPRTL	helicase(NC_045512: + : 16237-18039)	392-411
4	656-665	PRRARSVRYP	linker	1-10
4	666-678	WNVVRIKIVQMLS	3′-to-5′_exonuclease(NC_045512: + : 18040-19620)	159-171
4	679-688	PRRARSVRYP	linker	1-10
4	689-696	IETISLAG	nsp3(NC_045512: + : 2720-8554)	684-691
4	697-706	PRRARSVRYP	linker	1-10
4	707-717	SELVIGAVILR	membrane_glycoprotein(NC_045512: + : 26523-27191)	136-146
4	718-727	PRRARSVRYP	linker	1-10
4	728-746	AIPINFTISVTTEILPVSM	surface_glycoprotein@Aruba(NC_045512@Aruba: + : 21563-25384)	709-727
4	747-756	PRRARSVRYP	linker	1-10
4	757-766	FEYVSQPFLM	surface_glycoprotein@Aruba(NC_045512@Aruba: + : 21563-25384)	164-173
4	767-776	PRRARSVRYP	linker	1-10
4	777-792	TGLHPTQAPTHLSVDT	3′-to-5′_exonuclease(NC_045512: + : 18040-19620)	16-31
4	793-802	PRRARSVRYP	linker	1-10
4	803-823	HPNCVNCLDDRCILHCANFNV	RNA- dependent_RNA_polymerase@Australia(NC_045512	295-315
			@Australia: + : 13442-13468 + 13468-16236)
4	824-833	PRRARSVRYP	linker	1-10
4	834-844	RFQLHRSYLTP	surface_glycoprotein@Austria(NC_045512@Austria: + : 21563-25384)	233-243
4	845-854	PRRARSVRYP	linker	1-10
4	855-874	PINLVRGLPQGFSALEPLVD	surface_glycoprotein@Austria(NC_045512@Austria: + : 21563-25384)	205-224
4	875-884	PRRARSVRYP	linker	1-10
4	885-895	KESVQTFFKLV	nsp2(NC_045512: + : 806-2719)	492-502
4	896-905	PRRARSVRYP	linker	1-10
4	906-928	LIAIVMVTIMLCCITSCCSCLKG	surface_glycoprotein@Mozambique(NC_045512@Mozambique: + : 21563-25384)	1220-1242
4	929-938	PRRARSVRYP	linker	1-10
4	939-955	CSNLLLQYGSFCTQLNR	surface_glycoprotein(NC_045512: + : 21563-25384)	749-765
4	956-965	PRRARSVRYP	linker	1-10
4	966-977	TRAKVGILCITS	helicase@SouthKorea(NC_045512@SouthKorea: + : 16237-18039)	566-577
4	978-987	PRRARSVRYP	linker	1-10
4	988-998	YDNLQFISLEI	helicase@Austria(NC_045512@Austria: + : 16237-18039)	582-592
4	999-1008	PRRARSVRYP	linker	1-10
4	1009-1021	AIKCVPQADVEWK	3′-to-5′_exonuclease(NC_045512: + : 18040-19620)	337-349
4	1022-1031	PRRARSVRYP	linker	1-10
4	1032-1044	NFRVQPTESIVRF	surface_glycoprotein(NC_045512: + : 21563-25384)	317-329
4	1045-1054	PRRARSVRYP	linker	1-10
4	1055-1067	ATNVVIKVCEFQF	surface_glycoprotein(NC_045512: + : 21563-25384)	123-135
4	1068-1077	PRRARSVRYP	linker	1-10
4	1078-1087	SSVLHSTQDF	surface_glycoprotein@Norway(NC_045512@Norway: + : 21563-25384)	45-54
4	1088-1097	PRRARSVRYP	linker	1-10
4	1098-1105	RVEAFEYY	nsp3(NC_045512: + : 2720-8554)	810-817
4	1106-1115	PRRARSVRYP	linker	1-10
4	1116-1141	YRLANECAQVLSEIV	RNA-dependent_RNA_polymerase@Canada(NC_045512@Canada: + : 13442-13468 + 13468-16236)	653-678
		MCGGSLYVKPG
4	1142-1151	PRRARSVRYP	linker	1-10
4	1152-1174	GKIQDSLFSTASALGKLQDVVNQ	surface_glycoprotein@NorthMacedonia(NC_045512@NorthMacedonia: + : 21563-25384)	928-950
4	1175-1184	PRRARSVRYP	linker	1-10
4	1185-1205	AVLYQGVNCTEVPFAIHADQL	surface_glycoprotein@SmallAfrica(NC_045512@SmallAfrica: + : 21563-25384)	605-625
4	1206-1215	PRRARSVRYP	linker	1-10
4	1216-1227	YPSLETIQITIS	nsp3(NC_045512: + : 2720-8554)	1483-1494
4	1228-1237	PRRARSVRYP	linker	1-10
4	1238-1247	GNCDVVIGIV	surface_glycoprotein(NC_045512: + : 21563-25384)	1124-1133
4	1248-1257	PRRARSVRYP	linker	1-10
4	1258-1273	EEIIYNLLKDCPAVAK	RNA-dependent_RNA_polymerase@Senegal(NC_045512	83-98
			@Senegal: + : 13442-13468 + 13468-16236)
4	1274-1283	PRRARSVRYP	linker	1-10
4	1284-1298	VNCTEVPVAIHADQL	surface_glycoprotein(NC_045512: + : 21563-25384)	615-629
4	1299-1308	PRRARSVRYP	linker	1-10
4	1309-1331	TIATYCTGSIPCSVCLSGLDSLD	nsp3(NC_045512: + : 2720-8554)	1459-1481
4	1332-1341	PRRARSVRYP	linker	1-10
4	1342-1364	TQLYLGGMSYYCKPHKPPISFPL	helicase@Iceland(NC_045512@Iceland: + : 16237-18039)	61-83
4	1365-1374	PRRARSVRYP	linker	1-10
4	1375-1385	VLYQGVNCTEV	surface_glycoprotein@Aruba(NC_045512@Aruba: + : 21563-25384)	606-616
4	1386-1395	PRRARSVRYP	linker	1-10
4	1396-1406	IEELFYSYATH	3′-to-5′_exonuclease(NC_045512: + : 18040-19620)	363-373
4	1407-1416	PRRARSVRYP	linker	1-10
4	1417-1431	AYYVGYLQPRTFLLK	surface_glycoprotein@Aruba(NC_045512@Aruba: + : 21563-25384)	260-274
4	1432-1441	PRRARSVRYP	linker	1-10
4	1442-1456	RTCCLCDRRATCFST	3′-to-5′_exonuclease(NC_045512: + : 18040-19620)	205-219
4	1457-1466	PRRARSVRYP	linker	1-10
4	1467-1474	EIYQAGSK	surface_glycoprotein@Mexico(NC_045512@Mexico: + : 21563-25384)	471-478
4	1475-1484	PRRARSVRYP	linker	1-10
4	1485-1494	ARDLICAQKF	surface_glycoprotein(NC_045512: + : 21563-25384)	846-855
4	1495-1504	PRRARSVRYP	linker	1-10
4	1505-1519	TYACWHHSIGFDYVY	3′-to-5′_exonuclease(NC_045512: + : 18040-19620)	223-237

In certain embodiments, the vaccine comprises or expresses at least one of the concatemers of epitopes with intervening linker sequences (and as set forth in FIG. 23). In certain embodiments, the vaccine comprises or expresses at least two of the concatemers set forth below. In certain embodiments, the vaccine comprises or expresses three of the concatemers set forth below. In certain embodiments, the vaccine comprises or expresses all the concatemers set forth below.

TABLE 13
	pos_in_			pos_in_
mmunoprec	concatemer	epitopes	gene	gene
1	1-23	QLALSKGVYFVCNLLLLFVTVYS	ORF3a_protein@Aruba(NC_045512@Aruba: + : 25393-26220)	70-92
1	24-33	PRRARSVRYP	linker	1-10
1	34-48	AYYVGYLQPRTFLLK	surface_glycoprotein@Aruba(NC_045512@Aruba: + : 21563-25384)	260-274
1	49-58	PRRARSVRYP	linker	1-10
1	59-69	SELVIGAVILR	membrane_glycoprotein(NC_045512: + : 26523-27191)	136-146
1	70-79	PRRARSVRYP	linker	1-10
1	80-90	RFQLHRSYLTP	surface_glycoprotein@Austria(NC_045512@Austria: + : 21563-25384)	233-243
1	91-100	PRRARSVRYP	linker	1-10
1	101-108	PVLKGVKL	surface_glycoprotein@Aruba(NC_045512@Aruba: + : 21563-25384)	1259-1266
1	109-118	PRRARSVRYP	linker	1-10
1	119-131	RSVASQSIIAYTM	surface_glycoprotein@Aruba(NC_045512@Aruba: + : 21563-25384)	681-693
1	132-141	PRRARSVRYP	linker	1-10
1	142-156	VDTSLSSLKLKDCVM	nsp6@Latvia(NC_045512@Latvia: + : 10973-11842)	101-115
1	157-166	PRRARSVRYP	linker	1-10
1	167-185	QLSLSKGFHFVCNLLLLFV	ORF3a_protein@Estonia(NC_045512@Estonia: + : 25393-26220)	70-88
1	186-195	PRRARSVRYP	linker	1-10
1	196-205	NCYDYCIPYN	ORF3a_protein(NC_045512: + : 25393-26220)	152-161
1	206-215	PRRARSVRYP	linker	1-10
1	216-232	KDQVILLNKHIDAYKTF	nucleocapsid_phosphoprotein@Aruba(NC_045512@Aruba: + : 28274-29533)	347-363
1	233-242	PRRARSVRYP	linker	1-10
1	243-252	PFTINCQEPK	ORF8_protein@India(NC_045512@India: + : 27894-28259)	85-94
1	253-262	PRRARSVRYP	linker	1-10
1	263-285	HQPYVVDDPCPIHFYSKWYIRVG	ORF8_protein(NC_045512: + : 27894-28259)	28-50
1	286-295	PRRARSVRYP	linker	1-10
1	296-304	YGIIWVATE	nucleocapsid_phosphoprotein@SmallSouthAmerica	128-136
			(NC_045512@SmallSouthAmerica: + : 28274-29533)
1	305-314	PRRARSVRYP	linker	1-10
1	315-332	QLALFKGVHFVCNLLLLF	ORF3a_protein@CostaRica(NC_045512@CostaRica: + : 25393-26220)	70-87
1	333-342	PRRARSVRYP	linker	1-10
1	343-357	ALLAVFHSASKIITL	ORF3a_protein@Aruba(NC_045512@Aruba: + : 25393-26220)	51-65
1	358-367	PRRARSVRYP	linker	1-10
1	368-375	STFKCYGV	surface_glycoprotein@Aruba(NC_045512@Aruba: + : 21563-25384)	371-378
1	376-385	PRRARSVRYP	linker	1-10
1	386-393	EIYQAGSK	surface_glycoprotein@Mexico(NC_045512@Mexico: + : 21563-25384)	471-478
1	394-403	PRRARSVRYP	linker	1-10
1	404-417	RLTLGVYDYLVSTQ	nsp6(NC_045512: + : 10973-11842)	236-249
1	418-427	PRRARSVRYP	linker	1-10
1	428-442	VCNLLLLFVTVYSHL	ORF3a_protein@Croatia(NC_045512@Croatia: + : 25393-26220)	80-94
1	443-452	PRRARSVRYP	linker	1-10
1	453-472	DANYFLCWHTNCYHYCIPYN	ORF3a_protein@Indonesia(NC_045512@Indonesia: + : 25393-26220)	142-161
1	473-482	PRRARSVRYP	linker	1-10
1	483-498	GSNVFQTRAGCLIGAE	surface_glycoprotein(NC_045512: + : 21563-25384)	639-654
1	499-508	PRRARSVRYP	linker	1-10
1	509-525	INFVRIIMRLWLCLKCR	ORF3a_protein@Mozambique(NC_045512@Mozambique: + : 25393-26220)	118-134
1	526-535	PRRARSVRYP	linker	1-10
1	536-544	AAAYYVGYL	surface_glycoprotein(NC_045512: + : 21563-25384)	262-270
1	545-554	PRRARSVRYP	linker	1-10
1	555-565	AALALLLLDRL	nucleocapsid_phosphoprotein@Aruba(NC_045512@Aruba: + : 28274-29533)	217-227
1	566-575	PRRARSVRYP	linker	1-10
1	576-589	IKVCEFQFCNDPYY	surface_glycoprotein@CostaRica(NC_045512@CostaRica: + : 21563-25384)	128-141
1	590-599	PRRARSVRYP	linker	1-10
1	600-609	ISEHDYQIGG	ORF3a_protein@FrenchGuiana(NC_045512@FrenchGuiana: + : 25393-26220)	179-188
1	610-619	PRRARSVRYP	linker	1-10
1	620-628	DYYQLYSTQ	ORF3a_protein(NC_045512: + : 25393-26220)	210-218
1	629-638	PRRARSVRYP	linker	1-10
1	639-657	VKDCVLLHSYFTSDYYQLY	ORF3a_protein@Belgium(NC_045512@Belgium: + : 25393-26220)	197-215
1	658-667	PRRARSVRYP	linker	1-10
1	668-679	FNCYFPLQSYGF	surface_glycoprotein(NC_045512: + : 21563-25384)	486-497
1	680-689	PRRARSVRYP	linker	1-10
1	690-699	ARDLICAQKF	surface_glycoprotein(NC_045512: + : 21563-25384)	846-855
1	700-709	PRRARSVRYP	linker	1-10
1	710-727	IKVCEFQFCNDPFLGVYH	surface_glycoprotein@Aruba(NC_045512@Aruba: + : 21563-25384)	125-142
1	728-737	PRRARSVRYP	linker	1-10
1	738-758	VMFLARGIVFMCVDYCPIFFI	nsp6@Cyprus(NC_045512@Cyprus: + : 10973-11842)	179-199
1	759-768	PRRARSVRYP	linker	1-10
1	769-782	GFNCYSPLQSYGFQ	surface_glycoprotein@Peru(NC_045512@Peru: + : 21563-25384)	485-498
1	783-792	PRRARSVRYP	linker	1-10
1	793-814	QLALSKGVHFVCNLLLLFVTVY	ORF3a_protein@Australia(NC_045512@Australia: + : 25393-26220)	70-91
1	815-824	PRRARSVRYP	linker	1-10
1	825-838	ANPVLPFNDGVYFA	surface_glycoprotein@Austria(NC_045512@Austria: + : 21563-25384)	77-90
1	839-848	PRRARSVRYP	linker	1-10
1	849-870	SDFVRATATIPIRASLPFGWLI	ORF3a_protein@Belgium(NC_045512@Belgium: + : 25393-26220)	26-47
1	871-880	PRRARSVRYP	linker	1-10
1	881-900	PINLVRGLPQGFSVLEPLVD	surface_glycoprotein@SmallAfrica(NC_045512@SmallAfrica: + : 21563-25384)	209-228
1	901-910	PRRARSVRYP	linker	1-10
1	911-932	GYQPYRVVVLSFELLHAPATVC	surface_glycoprotein(NC_045512: + : 21563-25384)	504-525
1	933-942	PRRARSVRYP	linker	1-10
1	943-959	ILLNKHIDAYKTFPPIE	nucleocapsid_phosphoprotein@Chile(NC_045512@Chile: + : 28274-29533)	351-367
1	960-969	PRRARSVRYP	linker	1-10
1	970-987	LNDLCFTNVYADSFVIRG	surface_glycoprotein(NC_045512: + : 21563-25384)	387-404
1	988-997	PRRARSVRYP	linker	1-10
1	998-1020	KNPLLYDANYFLCCHTNCYDYCI	ORF3a_protein@Senegal(NC_045512@Senegal: + : 25393-26220)	136-158
1	1021-1030	PRRARSVRYP	linker	1-10
1	1031-1052	IAMACLVGLMWLSYFIASFRLF	membrane_glycoprotein@Aruba(NC_045512@Aruba: + : 26523-27191)	82-103
1	1053-1062	PRRARSVRYP	linker	1-10
1	1063-1085	VAAGLEAPFFYLYALVYFLQSIN	ORF3a_protein@Ecuador NC_045512@Ecuador  + : 25393-26220)	97-119
1	1086-1095	PRRARSVRYP	linker	1-10
1	1096-1123	FTSDYYQLYSTQLSTYTGVEHVTFFIYN	ORF3a_protein@Latvia(NC_045512@Latvia: + : 25393-26220)	207-234
1	1124-1133	PRRARSVRYP	linker	1-10
1	1134-1148	EFQFCNYPFLGVYHK	surface_glycoprotein@Norway(NC_045512@Norway: + : 21563-25384)	129-143
1	1149-1158	PRRARSVRYP	linker	1-10
1	1159-1179	ELVIGAVILRGHLRIAGHHLG	membr ne_glycoprotein@Aruba(NC_045512@Aruba: + : 26523-27191)	137-157
1	1180-1189	PRRARSVRYP	linker	1-10
1	1190-1201	ISVTTEILPVSM	surface_glycoprotein(NC_045512: + : 21563-25384)	720-731
2	1-8	TQALLQRQ	nucleocapsid_phosphoprotein@Costa Rica(NC_045512@CostaRica: + : 28274-29533)	379-386
2	9-18	PRRARSVRYP	linker	1-10
2	19-43	KNPLLYDANYFLCWHTNCYDYCIPY	ORF3a_protein@Aruba(NC_045512@Aruba: + : 25393-26220)	136-160
2	44-53	PRRARSVRYP	linker	1-10
2	54-61	REGVFVSN	surface_glycoprotein@Aruba(NC_045512@Aruba: + : 21563-25384)	1087-1094
2	62-71	PRRARSVRYP	linker	1-10
2	72-83	FRSSVLHSTQDL	surface_glycoprotein@Aruba(NC_045512@Aruba: + : 21563-25384)	43-54
2	84-93	PRRARSVRYP	linker	1-10
2	94-104	LRIAGHHLGRC	membr ne_glycoprotein(NC_045512: + : 26523-27191)	149-159
2	105-114	PRRARSVRYP	linker	1-10
2	115-128	FFSNVTWFHAIHVS	surface_glycoprotein@Bangladesh(NC_045512@Bangladesh: + : 21563-25384)	58-71
2	129-138	PRRARSVRYP	linker	1-10
2	139-147	LKLKDCVMY	nsp6@Aruba(NC_045512@Aruba: + : 10973-11842)	105-113
2	148-157	PRRARSVRYP	linker	1-10
2	158-166	EPLLKGVKL	surface_glycoprotein@Croatia(NC_045512@Croatia: + : 21563-25384)	1258-1266
2	167-176	PRRARSVRYP	linker	1-10
2	177-192	NYTVSCSPFTINCQEP	ORF8_protein@CostaRica(NC_045512@CostaRica: + : 27894-28259)	78-93
2	193-202	PRRARSVRYP	linker	1-10
2	203-211	ISEHDYHIG	ORF3a_protein@NorthMacedonia(NC_045512@NorthMacedonia: + : 25393-26220)	179-187
2	212-221	PRRARSVRYP	linker	1-10
2	222-232	CLPFTINCQKP	ORF8_protein@Brazil(NC_045512@Brazil: + : 27894-28259)	83-93
2	233-242	PRRARSVRYP	linker	1-10
2	243-250	SSIVITSG	ORF3a_protein@SouthKorea(NC_045512@SouthKorea: + : 25393-26220)	165-172
2	251-260	PRRARSVRYP	linker	1-10
2	261-268	WFTALTQH	nucleocapsid_phosphoprotein(NC_045512: + : 28274-29533)	52-59
2	269-278	PRRARSVRYP	linker	1-10
2	279-286	ETQALPQR	nucleocapsid_phosphoprotein@SmallNorthAmerica	378-385
			(NC_045512@SmallNorthAmerica: + : 28274-29533)
2	287-296	PRRARSVRYP	linker	1-10
2	297-320	LGSLVVRCSFYEDFLEYHDVRVVL	ORF8_protein(NC_045512: + : 27894-28259)	95-118
2	321-330	PRRARSVRYP	linker	1-10
2	331-352	INLVRDLPQGFSALEPLVDLPI	surface_glycoprotein@Aruba(NC_045512@Aruba: + : 21563-25384)	206-227
2	353-362	PRRARSVRYP	linker	1-10
2	363-374	DTSLKLKECVMY	nsp6@SmallAsia(NC_045512@SmallAsia: + : 10973-11842)	102-113
2	375-384	PRRARSVRYP	linker	1-10
2	385-407	RVDFCGKGYHLMSFPQSAPHGVV	surface_glycoprotein(NC_045512: + : 21563-25384)	1039-1061
2	408-417	PRRARSVRYP	linker	1-10
2	418-427	GVGGKPCIKV	nsp6@Aruba(NC_045512@Aruba: + : 10973-11842)	274-283
2	428-437	PRRARSVRYP	linker	1-10
2	438-459	LLYDANYFLCWHINCYDYCIPY	ORF3a_protein@Estonia(NC_045512@Estonia: + : 25393-26220)	139-160
2	460-469	PRRARSVRYP	linker	1-10
2	470-484	VNCTEVPVAIHADQL	surface_glycoprotein(NC_045512: + : 21563-25384)	615-629
2	485-494	PRRARSVRYP	linker	1-10
2	495-509	YFTSDYYQLYSTQLI	ORF3a_protein@Indonesia(NC_045512@Indonesia: + : 25393-26220)	206-220
2	510-519	PRRARSVRYP	linker	1-10
2	520-532	ATNVVIKVCEFQF	surface_glycoprotein(NC_045512: + : 21563-25384)	123-135
2	533-542	PRRARSVRYP	linker	1-10
2	543-556	KHWPQIAQFAPSAS	nucleocapsid_phosphoprotein@Australia(NC_045512@Australia: + : 28274-29533)	299-312
2	557-566	PRRARSVRYP	linker	1-10
2	567-576	LPFTINCQEL	ORF8_protein@Mozambique(NC_045512@Mozambique: + : 27894-28259)	84-93
2	577-586	PRRARSVRYP	linker	1-10
2	587-595	VFSQCVNLT	surface_glycoprotein@Egypt(NC_045512@Egypt: + : 21563-25384)	11-19
2	596-605	PRRARSVRYP	linker	1-10
2	606-626	AVLYQGVNCTEVPFAIHADQL	surface_glycoprotein@SmallAfrica(NC_045512@SmallAfrica: + : 21563-25384)	605-625
2	627-636	PRRARSVRYP	linker	1-10
2	637-644	EVTPSGTW	nucleocapsid_phosphoprotein(NC_045512: + : 28274-29533)	323-330
2	645-654	PRRARSVRYP	linker	1-10
2	655-666	SVFQSASKIITL	ORF3a_protein@Iceland(NC_045512@Iceland: + : 25393-26220)	54-65
2	667-676	PRRARSVRYP	linker	1-10
2	677-684	AEVQIDRL	surface_glycoprotein(NC_045512: + : 21563-25384)	989-996
2	685-694	PRRARSVRYP	linker	1-10
2	695-703	FFSNVTWFH	surface_glycoprotein(NC_045512: + : 21563-25384)	58-66
2	704-713	PRRARSVRYP	linker	1-10
2	714-721	SDFVRATA	ORF3a_protein(NC_045512: + : 25393-26220)	26-33
2	722-731	PRRARSVRYP	linker	1-10
2	732-742	MMFVKHKHAFL	nsp6@Aruba(NC_045512@Aruba: + : 10973-11842)	57-67
2	743-752	PRRARSVRYP	linker	1-10
2	753-762	GNCDVVIGIV	surface_glycoprotein(NC_045512: + : 21563-25384)	1124-1133
2	763-772	PRRARSVRYP	linker	1-10
2	773-787	TYGVGYQPYRVVVLS	surface_glycoprotein@Australia(NC_045512@Australia: + : 21563-25384)	496-510
2	788-797	PRRARSVRYP	linker	1-10
2	798-819	NVVIKVCEFQFCNYPFLGVYYH	surface_glycoprotein@Brazil(NC_045512@Brazil: + : 21563-25384)	125-146
2	820-829	PRRARSVRYP	linker	1-10
2	830-843	ETKCTLKSFTVEKG	surface_glycoprotein@Aruba(NC_045512@Aruba: + : 21563-25384)	294-307
2	844-853	PRRARSVRYP	linker	1-10
2	854-869	FLVLLPLVSSQCVNLT	surface_glycoprotein@Aruba(NC_045512@Aruba: + : 21563-25384)	4-19
2	870-879	PRRARSVRYP	linker	1-10
2	880-890	VLYQGVNCTEV	surface_glycoprotein@Aruba(NC_045512@Aruba: + : 21563-25384)	606-616
2	891-900	PRRARSVRYP	linker	1-10
2	901-929	FLYIIKLIFLWLLWPVT	membrane_glycoprotein@Aruba(NC_045512@Aruba: + : 26523-27191)	45-73
		LACFVLAAVYRI
2	930-939	PRRARSVRYP	linker	1-10
2	940-954	VEHVTFFIYNKIVDE	ORF3a_protein(NC_045512: + : 25393-26220)	225-239
2	955-964	PRRARSVRYP	linker	1-10
2	965-979	ARSVARQSIIAYTMS	surface_glycoprotein@Mozambique(NC_045512@Mozambique: + : 21563-25384)	680-694
2	980-989	PRRARSVRYP	linker	1-10
2	990-1018	TLQCIMLVYCFLGYFC	nsp6@Aruba(NC_045512@Aruba: + : 10973-11842)	203-231
		TCYFGLFCLLNRY
2	1019-1028	PRRARSVRYP	linker	1-10
2	1029-1045	LFFFLYENAFLPFVMGI	nsp6@SmallSouthAmerica(NC_045512@SmallSouthAmerica: + : 10973-11842)	33-49
2	1046-1055	PRRARSVRYP	linker	1-10
2	1056-1074	AIPINFTISVTTEILPVSM	surface_glycoprotein@Aruba(NC_045512@Aruba: + : 21563-25384)	709-727
2	1075-1084	PRRARSVRYP	linker	1-10
2	1085-1094	KQYGDCLGDI	surface_glycoprotein(NC_045512: + : 21563-25384) 835-844
2	1095-1104	PRRARSVRYP	linker	1-10
2	1105-1121	INFVRIIMRLWLCCKCR	ORF3a_protein@Australia(NC_045512@Australia: + : 25393-26220)	118-134
2	1122-1131	PRRARSVRYP	linker	1-10
2	1132-1148	SAAYYVGYLQLRTFLLK	surface_glycoprotein@Italy(NC_045512@Italy: + : 21563-25384)	258-274
2	1149-1158	PRRARSVRYP	linker	1-10
2	1159-1168	SFKLKDCVMY	nsp6@Malaysia(NC_045512@Malaysia: + : 10973-11842)	107-116
2	1169-1178	PRRARSVRYP	linker	1-10
2	1179-1197	QVAVLYQDVNCTEVPVAIH	surface_glycoprotein@China(NC_045512@China: + : 21563-25384)	607-625
2	1198-1207	PRRARSVRYP	linker	1-10
2	1208-1227	MTSCCSCLKGCCSCGSCCKF	surface_glycoprotein(NC_045512: + : 21563-25384) 1237-	1256
3	1-37	VAAGLEAPFLYLYALVYFLQ	ORF3a_protein@Aruba(NC_045512@Aruba: + : 25393-26220)	97-133
		SINFVRIIMRLWLCWKC
3	38-47	PRRARSVRYP	linker	1-10
3	48-65	IKDLPKEITVATSRTLSY	membrane_glycoprotein(NC_045512: + : 26523-27191)	161-178
3	66-75	PRRARSVRYP	linker	1-10
3	76-90	ISNCVADYSVLYNSA	surface_glycoprotein@Aruba(NC_045512@Aruba: + : 21563-25384)	354-368
3	91-100	PRRARSVRYP	linker	1-10
3	101-113	ISSVLNDILSRLD	surface_glycoprotein@Bangladesh(NC_045512@Bangladesh: + : 21563-25384)	972-984
3	114-123	PRRARSVRYP	linker	1-10
3	124-136	SMWALIISVTSNY	nsp6@Aruba(NC_045512@Aruba: + : 10973-11842)	160-172
3	137-146	PRRARSVRYP	linker	1-10
3	147-160	TSGVGYQPYRVVVL	surface_glycoprotein@Aruba(NC_045512@Aruba: + : 21563-25384)	496-509
3	161-170	PRRARSVRYP	linker	1-10
3	171-190	FPQSAPHGVVFLHVTYVPAQ	surface_glycoprotein@Aruba(NC_045512@Aruba: + : 21563-25384)	1048-1067
3	191-200	PRRARSVRYP	linker	1-10
3	201-208	VVNPVMEP	ORF3a_protein(NC_045512: + : 25393-26220)	255-262
3	209-218	PRRARSVRYP	linker	1-10
3	219-228	PRWYFYYLGT	nucleocapsid_phosphoprotein@Aruba(NC_045512@Aruba: + : 28274-29533)	106-115
3	229-238	PRRARSVRYP	linker	1-10
3	239-246	EHVQIHTI	ORF3a_protein(NC_045512: + : 25393-26220)	242-249
3	247-256	PRRARSVRYP	linker	1-10
3	257-285	SMWALIISVTSNYSGVVTIV	nsp6@SmallSouthAmerica(NC_045512@SmallSouthAmerica: + : 10973-11842)	160-188
		MFLARGIVF
3	286-295	PRRARSVRYP	linker	1-10
3	296-303	APLIELCV	ORF8_protein(NC_045512: + : 27894-28259)	55-62
3	304-313	PRRARSVRYP	linker	1-10
3	314-355	TTVAAFHQECSLQSCTQHQPYVV	ORF8_protein@Bangladesh(NC_045512@Bangladesh: + : 27894-28259)	11-52
		DDPCPIHFYSKWYIRVGAR
3	356-365	PRRARSVRYP	linker	1-10
3	366-388	TTVMFLARGIVFMCVEYCPIFFI	nsp6@Aruba(NC_045512@Aruba: + : 10973-11842)	177-199
3	389-398	PRRARSVRYP	linker	1-10
3	399-408	KQYGDCLGNI	surface_glycoprotein@Jordan(NC_045512@Jordan: + : 21563-25384)	831-840
3	409-418	PRRARSVRYP	linker	1-10
3	419-441	LIAIVMVTIMLCCITSCCSCLKG	surface_glycoprotein@Mozambique(NC_045512@Mozambique: + : 21563-25384)	1220-1242
3	442-451	PRRARSVRYP	linker	1-10
3	452-467	QLALSKGFHFVCNLLL	ORF3a_protein@Iceland(NC_045512@Iceland: + : 25393-26220)	70-85
3	468-477	PRRARSVRYP	linker	1-10
3	478-485	ISEHDYQI	ORF3a_protein@Aruba(NC_045512@Aruba: + : 25393-26220)	179-186
3	486-495	PRRARSVRYP	linker	1-10
3	496-507	ALGKLQDVVNQN	surface_glycoprotein(NC_045512: + : 21563-25384)	944-955
3	508-517	PRRARSVRYP	linker	1-10
3	518-530	NPVLPFNDGVYFA	surface_glycoprotein(NC_045512: + : 21563-25384)	81-93
3	531-540	PRRARSVRYP	linker	1-10
3	541-556	HWPQIAQFAPSASAFF	nucleocapsid_phosphoprotein@Aruba(NC_045512@Aruba: + : 28274-29533)	300-315
3	557-566	PRRARSVRYP	linker	1-10
3	567-582	LQSLQTYVTQQLIRAA	surface_glycoprotein(NC_045512: + : 21563-25384)	1001-1016
3	583-592	PRRARSVRYP	linker	1-10
3	593-601	APLIELCVD	ORF8_protein@Bangladesh(NC_045512@Bangladesh: + : 27894-28259)	55-63
3	602-611	PRRARSVRYP	linker	1-10
3	612-619	TQALPHRQ	nucleocapsid_phosphoprotein@Mozambique(NC_045512@Mozambique: + : 28274-29533)	379-386
3	620-629	PRRARSVRYP	linker	1-10
3	630-644	ALLAVFQSASKIITL	ORF3a_protein@Bangladesh(NC_045512@Bangladesh: + : 25393-26220)	51-65
3	645-654	PRRARSVRYP	linker	1-10
3	655-668	LMNVLTLVYKVYYG	nsp6@Aruba(NC_045512@Aruba: + : 10973-11842)	139-152
3	669-678	PRRARSVRYP	linker	1-10
3	679-697	CYDYCIPYNSVTSLIVITS	ORF3a_protein@Netherlands(NC_045512@Netherlands: + : 25393-26220)	153-171
3	698-707	PRRARSVRYP	linker	1-10
3	708-724	GVHFVCNLLLLFVIVYS	ORF3a_protein@Malaysia(NC_045512@Malaysia: + : 25393-26220)	76-92
3	725-734	PRRARSVRYP	linker	1-10
3	735-742	SVDCTMYI	surface_glycoprotein(NC_045512: + : 21563-25384)	735-742
3	743-752	PRRARSVRYP	linker	1-10
3	753-760	KLGASQRV	membrane_glycoprotein(NC_045512: + : 26523-27191)	180-187
3	761-770	PRRARSVRYP	linker	1-10
3	771-788	FLYENAFLPFAMGVIAMS	nsp6@Mexico(NC_045512@Mexico: + : 10973-11842)	36-53
3	789-798	PRRARSVRYP	linker	1-10
3	799-810	FRSSVLHSTRDL	surface_glycoprotein@Nigeria(NC_045512@Nigeria: + : 21563-25384)	43-54
3	811-820	PRRARSVRYP	linker	1-10
3	821-833	LLNVPLHGTILTR	membrane_glycoprotein(NC_045512: + : 26523-27191)	119-131
3	834-843	PRRARSVRYP	linker	1-10
3	844-868	VLVQSTQWSLFFFFYENAFLPFAMG	nsp6@Iceland(NC_045512@Iceland: + : 10973-11842)	24-48
3	869-878	PRRARSVRYP	linker	1-10
3	879-886	AALQIPFA	surface_glycoprotein(NC_045512: + : 21563-25384)	892-899
3	887-896	PRRARSVRYP	linker	1-10
3	897-912	FLVLLPLVSIQCVNLT	surface_glycoprotein@SmallNorthAmerica	4-19
			(NC_045512@SmallNorthAmerica: + : 21563-25384)
3	913-922	PRRARSVRYP	linker	1-10
3	923-943	QWNLVIGFLFLTWICLLQFAY	membrane_glycoprotein@Aruba(NC_045512@Aruba: + : 26523-27191)	19-39
3	944-953	PRRARSVRYP	linker	1-10
3	954-978	VLVQSTQWSLFFFLYENAFLPFAMG	nsp6@Aruba(NC_045512@Aruba: + : 10973-11842)	24-48
3	979-988	PRRARSVRYP	linker	1-10
3	989-999	SPGVFNPVMEP	ORF3a_protein@Colombia(NC_045512@Colombia: + : 25393-26220)	252-262
3	1000-1009	PRRARSVRYP	linker	1-10
3	1010-1017	ISNCVADY	surface_glycoprotein(NC_045512: + : 21563-25384)	358-365
3	1018-1027	PRRARSVRYP	linker	1-10
3	1028-1041	TDTVVEHVTFFIYN	ORF3a_protein@Costa Rica(NC_045512@CostaRica: + : 25393-26220)	221-234
3	1042-1051	PRRARSVRYP	linker	1-10
3	1052-1067	NYTVSCLPFTINCQEP	ORF8_protein@Bangladesh(NC_045512@Bangladesh: + : 27894-28259)	78-93
3	1068-1077	PRRARSVRYP	linker	1-10
3	1078-1087	TQNVLYENQK	surface_glycoprotein(NC_045512: + : 21563-25384)	912-921
3	1088-1097	PRRARSVRYP	linker	1-10
3	1098-1108	HFPRKGVFVSN	surface_glycoprotein@SmallAsia(NC_045512@SmallAsia: + : 21563-25384)	1078-1088
3	1109-1118	PRRARSVRYP	linker	1-10
3	1119-1128	AGAALQIPFA	surface_glycoprotein@Nigeria(NC_045512@Nigeria: + : 21563-25384)	886-895
3	1129-1138	PRRARSVRYP	linker	1-10
3	1139-1148	FEYVSQPFLM	surface_glycoprotein@Aruba(NC_045512@Aruba: + : 21563-25384)	164-173
3	1149-1158	PRRARSVRYP	linker	1-10
3	1159-1172	TDTCVEHVTFFIYN	ORF3a_protein@Luxembourg(NC_045512@Luxembourg: + : 25393-26220)	221-234
3	1173-1182	PRRARSVRYP	surface_glycoprotein@Chile(NC_045512@Chile: + : 21563-25384)	132-146
3	1183-1197	EFQFCNDPFLGVYYH	linker	1-10
4	1-10	YDANYFLCWH	ORF3a_protein(NC_045512: + : 25393-26220)	141-150
4	11-20	PRRARSVRYP	linker	1-10
4	21-32	EVFAQVKQIYKT	surface_glycoprotein@Aruba(NC_045512@Aruba: + : 21563-25384)	776-787
4	33-42	PRRARSVRYP	linker	1-10
4	43-53	SAPLIELCLDE	ORF8_protein@Russia(NC_045512@Russia: + : 27894-28259)	54-64
4	54-63	PRRARSVRYP	linker	1-10
4	64-87	TTVAAFHQECSLQLCTQHQPYVVD	ORF8_protein@USA(NC_045512@USA: + : 27894-28259)	11-34
4	88-97	PRRARSVRYP	linker	1-10
4	98-111	LVLLPLVSSQCVNF	surface_glycoprotein@Brazil(NC_045512@Brazil: + : 21563-25384)	5-18
4	112-121	PRRARSVRYP	linker	1-10
4	122-135	SVASQSIIAYTMSL	surface_glycoprotein@Austria(NC_045512@Austria: + : 21563-25384)	678-691
4	136-145	PRRARSVRYP	linker	1-10
4	146-154	SPDVDLADI	surface_glycoprotein@Chile(NC_045512@Chile: + : 21563-25384)	1161-1169
4	155-164	PRRARSVRYP	linker	1-10
4	165-184	PINLVRGLPQGFSALEPLVD	surface_glycoprotein@Austria(NC_045512@Austria: + : 21563-25384)	205-224
4	185-194	PRRARSVRYP	linker	1-10
4	195-203	TEIYQAGST	surface_glycoprotein@Aruba(NC_045512@Aruba: + : 21563-25384)	466-474
4	204-213	PRRARSVRYP	linker	1-10
4	214-238	AAGLEAPFLYLYVLVYFLQSINFVR	ORF3a_protein@Norway(NC_045512@Norway: + : 25393-26220)	98-122
4	239-248	PRRARSVRYP	linker	1-10
4	249-258	ALLAVFHNAS	ORF3a_protein@SmallSouthAmerica(NC_045512@SmallSouthAmerica: + : 25393-26220)	51-60
4	259-268	PRRARSVRYP	linker	1-10
4	269-277	KHWPQIAQF	nucleocapsid_phosphoprotein(NC_045512: + : 28274-29533)	299-307
4	278-287	PRRARSVRYP	linker	1-10
4	288-306	VKDCVVLHSYFTSDYYQLY	ORF3a_protein@Aruba(NC_045512@Aruba: + : 25393-26220)	197-215
4	307-316	PRRARSVRYP	linker	1-10
4	317-347	YIWLGFIAGLIAIVMVTIM	surface_glycoprotein@Aruba(NC_045512@Aruba: + : 21563-25384)	1211-1241
		LCCMTSCCSCLK
4	348-357	PRRARSVRYP	linker	1-10
4	358-370	FQTLLALHRSYLT	surface_glycoprotein@Aruba(NC_045512@Aruba: + : 21563-25384)	234-246
4	371-380	PRRARSVRYP	linker	1-10
4	57-88	MMFVKHKHAFLCLFLLPS	nsp6@Indonesia(NC_045512@Indonesia: + : 10973-11842)	381-412
		FATVAYFNMVYMPA
4	413-422	PRRARSVRYP	linker	1-10
4	423-439	CSNLLLQYGSFCTQLNR	surface_glycoprotein(NC_045512: + : 21563-25384)	749-765
4	440-449	PRRARSVRYP	linker	1-10
4	450-468	LEILDITPCSFGGVSVITP	surface_glycoprotein(NC_045512: + : 21563-25384)	582-600
4	469-478	PRRARSVRYP	linker	1-10
4	479-501	YALVYFLQSINFVIIIMRLWLCW	ORF3a_protein@Denmark(NC_045512@Denmark: + : 25393-26220)	109-131
4	502-511	PRRARSVRYP	linker	1-10
4	512-534	KEITVATSRTLSYYKLGASQRVA	membrane_glycoprotein@Aruba(NC_045512@Aruba: + : 26523-27191)	166-188
4	535-544	PRRARSVRYP	linker	1-10
4	545-554	GLKLKDCVMY	nsp6@Peru(NC_045512@Peru: + : 10973-11842)	107-116
4	555-564	PRRARSVRYP	linker	1-10
4	565-577	NFRVQPTESIVRF	surface_glycoprotein(NC_045512: + : 21563-25384)	317-329
4	578-587	PRRARSVRYP	linker	1-10
4	588-595	SSIVITSV	ORF3a_protein@Aruba(NC_045512@Aruba: + : 25393-26220)	165-172
4	596-605	PRRARSVRYP	linker	1-10
4	606-619	ESVVKDCVVLHSYF	ORF3a_protein@CostaRica(NC_045512@CostaRica: + : 25393-26220)	194-207
4	620-629	PRRARSVRYP	linker	1-10
4	630-651	SDFVRATATIPIQASLPFGWLI	ORF3a_protein@Aruba(NC_045512@Aruba: + : 25393-26220)	26-47
4	652-661	PRRARSVRYP	linker	1-10
4	662-684	GKIQDSLFSTASALGKLQDVVNQ	surface_glycoprotein@NorthMacedonia	928-950
			(NC_045512@NorthMacedonia: + : 21563-25384)
4	685-694	PRRARSVRYP	linker	1-10
4	695-710	ATVAYFNMVYMPASWV	nsp6@Aruba(NC_045512@Aruba: + : 10973-11842)	76-91
4	711-720	PRRARSVRYP	linker	1-10
4	721-728	SLIDLQEL	surface_glycoprotein(NC_045512: + : 21563-25384)	1196-1203
4	729-738	PRRARSVRYP	linker	1-10
4	739-748	SVLNDILARL	surface_glycoprotein@Aruba(NC_045512@Aruba: + : 21563-25384)	971-980
4	749-758	PRRARSVRYP	linker	1-10
4	759-766	YDPLQPEL	surface_glycoprotein(NC_045512: + : 21563-25384)	1138-1145
4	767-776	PRRARSVRYP	linker	1-10
4	777-784	FTGCVIAW	surface_glycoprotein(NC_045512: + : 21563-25384)	429-436
4	785-794	PRRARSVRYP	linker	1-10
4	795-803	EVFAQVKQI	surface_glycoprotein(NC_045512: + : 21563-25384)	780-788
4	804-813	PRRARSVRYP	linker	1-10
4	814-829	LMNVLTLFYKVYYGNA	nsp6@Chile(NC_045512@Chile: + : 10973-11842)	142-157
4	830-839	PRRARSVRYP	linker	1-10
4	840-856	EVTPSGTWLTYTGAIKL	nucleocapsid_phosphoprotein@Bulgaria(NC_045512@Bulgaria: + : 28274-29533)	323-339
4	857-866	PRRARSVRYP	linker	1-10
4	867-882	AFKLNIKLLGVGGKPC	nsp6(NC_045512: + : 10973-11842)	268-283
4	883-892	PRRARSVRYP	linker	1-10
4	893-906	GFNCYFPLQPYGFQ	surface_glycoprotein@SmallSouthAmerica	481-494
			(NC_045512@SmallSouthAmerica: + : 21563-25384)
4	907-916	PRRARSVRYP	linker	1-10
4	917-926	SSVLHSTQDF	surface_glycoprotein@Norway(NC_045512@Norway: + : 21563-25384)	45-54
4	927-936	PRRARSVRYP	linker	1-10
4	937-950	ITTVAAFHQECSLQ	ORF8_protein@Aruba(NC_045512@Aruba: + : 27894-28259)	10-23
4	951-960	PRRARSVRYP	linker	1-10
4	961-976	FSNVTWFHAIHVSGTN	surface_glycoprotein@Peru(NC_045512@Peru: + : 21563-25384)	59-74
4	977-986	PRRARSVRYP	linker	1-10
4	987-1004	VTTVIFLARGIVFMCVEY	nsp6@Malaysia(NC_045512@Malaysia: + : 10973-11842)	179-196
4	1005-1014	PRRARSVRYP	linker	1-10
4	1015-1025	FFSNVTWFHVS	surface_glycoprotein@Nigeria(NC_045512@Nigeria: + : 21563-25384)	58-68
4	1026-1035	PRRARSVRYP	linker	1-10
4	1036-1049	IHFYSKWYIRVGAK	ORF8_protein@Mozambique(NC_045512@Mozambique: + : 27894-28259)	39-52
4	1050-1059	PRRARSVRYP	linker	1-10
4	1060-1071	FSNVTWFHAIVS	surface_glycoprotein@Ghana(NC_045512@Ghana: + : 21563-25384)	59-70
4	1072-1081	PRRARSVRYP	linker	1-10
4	1082-1096	IPIRASLPFGWLIVG	ORF3a_protein@Iceland(NC_045512@Iceland: + : 25393-26220)	35-49
4	1097-1106	PRRARSVRYP	linker	1-10
4	1107-1114	TDAVDCAL	surface_glycoprotein(NC_045512: + : 21563-25384)	286-293
4	1115-1124	PRRARSVRYP	linker	1-10
4	1125-1136	FQTLLHRSYLTP	surface_glycoprotein@SmallAsia(NC_045512@SmallAsia: + : 21563-25384)	230-241
4	1137-1146	PRRARSVRYP	linker	1-10
4	1147-1170	PINLVRDLPQGFSVLEPLVDLPIG	surface_glycoprotein@Belgium(NC_045512@Belgium: + : 21563-25384)	205-228
4	1171-1180	PRRARSVRYP	linker	1-10
4	1181-1190	SPGVVNPVME	ORF3a_protein@Brazil(NC_045512@Brazil: + : 25393-26220)	252-261
4	1191-1200	PRRARSVRYP	linker	1-10
4	1201-1215	TISVTTEILPVSMAK	surface_glycoprotein@Mexico(NC_045512@Mexico: + : 21563-25384)	719-733

Immune Response Enhancing Components:

In certain embodiments, the vaccines comprise or are capable of expressing one or more additional components to enhance the immune response to the one or more viral immunogens. These components may include, for example, targeting molecules, elements which enhance antigen processing, immunostimulatory molecules such as cytokines and other adjuvants. In certain embodiments, the vaccine comprises one or more fusion polypeptides comprising the one or more additional components and one or more concatemers of epitopes. The additional components include but are not limited to one or more targeting molecules/motifs. In certain embodiments where the vaccine comprises more than more concatemer, each concatemer is fused to one or more targeting molecules. The targeting molecules may be the same for all immunogens in the vaccine or different.

It is known in the art that targeting the immunogen to antigen presenting cells (APCs), including but not limited to dendritic cells, or enhancing antigen processing by APCs enhances immunogenicity.

In specific embodiments, the fusion protein comprises one or more CD74 or fragment thereof and one or more concatemer(s) of epitopes. In certain embodiments, the fusion protein comprises the CD74 transmembrane and cytoplasmic domain and one or more concatemer(s) of epitopes. In certain embodiments, the CD74 transmembrane and cytoplasmic domain has the sequence set forth below:

	HRRRSRSCREDQKPVMDDQRDLISNNEQLPMLGRRP
	GAPESKCSRGALYTGFSILVTLLLAGQATTAYFLY

In specific embodiments, the fusion protein comprises one or more human leukocyte antigen (HLA) or fragment thereof and the one or more immunogen or fragment thereof. In specific embodiments, the fusion protein comprises the HLA transmembrane and cytoplasmic domain and immunogen or fragment thereof.

In specific embodiment, the HLA fragment comprises the following sequence:

	MVKCATLSVDSGQASDSSAAQTYSGGKRDSSKRRW
	MVAAVVAGTIVAGLLVLGAIIGV

In certain embodiments, the targeting moiety is a chimeric targeting moiety comprising portions of different molecules. For example, the targeting moiety may comprise the cytoplasmic domain from one molecule fused to the transmembrane domain of another molecule. In certain embodiments, the targeting moiety comprises the CD74 cytoplasmic domain fused to an HLA transmembrane sequence. In specific embodiments, the targeting moiety comprises the following sequence:

	HRRRSRSCREDQKPVMDDQRDLISNNEQLPMLGRR
	PGAPESKCSRWMVAAVVAGTIVAGLLVLGAIIGV

Other Elements:

The proteins of the present invention may also include tags. Appropriate tags are known in the art and include but are not limited to HA-, FLAG®- or myc- or alpha tags.

Exemplary Vaccines

Non-limiting exemplary vaccines or concatemers expressed by exemplary vaccines are set forth in the figures.

Vaccine Formulations

The vaccines formulations may also comprise pharmaceutically acceptable carriers, excipients and/or adjuvants. Adjuvants and carriers suitable for administering genetic vaccines and immunogens are known in the art. Conventional carriers and adjuvants are for example reviewed in Kiyono et al. 1996.

A vaccine adjuvant is a component that potentiates the immune responses to an antigen and/or modulates it towards the desired immune responses. A vaccine may include one or more adjuvants. Exemplary adjuvants include mineral salts including but not limited to aluminium salts (such as amorphous aluminum hydroxyphosphate sulfate (AAHS), aluminum hydroxide, aluminum phosphate, potassium aluminum sulfate (Alum)) and calcium phosphate gels; Oil emulsions and surfactant based formulations, including but not limited to MF59 (microfluidised detergent mmunoprec oil-in-water emulsion), QS21 (purified saponin), AS02 [SBAS2] (oil-in-water emulsion+MPL+QS-21), Montanide ISA-51 and ISA-720 (mmunoprec water-in-oil emulsion); Particulate adjuvants, including but not limited to virosomes (unilamellar liposomal vehicles incorporating influenza haemagglutinin), AS04 ([SBAS4] Al salt with MPL), ISCOMS (structured complex of saponins and lipids), polylactide co-glycolide (PLG). And; microbial derivatives (natural and synthetic), including but not limited to monophosphoryl lipid A (MPL), Detox (MPL+M. Phlei cell wall skeleton), AGP [RC-529] (synthetic acylated monosaccharide), DC_Chol (lipoidal immunostimulators able to self mmunopr into liposomes), OM-174 (lipid A derivative), CpG motifs (synthetic oligonucleotides containing immunostimulatory CpG motifs), modified LT and CT (genetically modified bacterial toxins to provide non-toxic adjuvant effects); endogenous human immunomodulators, including but not limited to hGM-CSF or hIL-12 (cytokines that can be administered either as protein or plasmid encoded), Immudaptin (C3d tandem array) and inert vehicles, such as gold particles.

The vaccine formulations may also comprise a stabilizer. Suitable stabilizer are known in the art and include but are not limited to amino acids, antioxidants, cyclodextrins, proteins, sugars/sugar alcohols, and surfactants. See for example Morefield, AAPS J. 2011 June; 13(2): 191-200; https://www.ncbi.nlm.nih.gov/pmc/articles/PMC3085699/).

The vaccine can be incorporated into liposomes, microspheres or other polymer matrices. Liposomes can consist of phospholipids or other lipids, and can be nontoxic, physiologically acceptable and metabolizable carriers that are relatively simple to make and administer.

Previously, it has been found that a SARS-COV-2 SAM lipid nanoparticle (LNP) vaccine induced high neutralizing antibody titers in mice (Mckay et al., Nat Commun 11, 3523 (2020). https://doi.org/10.1038/s41467-020-17409-9). Briefly, the LNP (described in US patent U.S. Pat. No. 10,221,127) contains an ionizable cationic lipid phosphatidylcholine/cholesterol/PEG-lipid. The SAM RNA were encapsulated in LNP using a self-assembly process in which an aqueous solution of SAM RNA at pH=4.0 is rapidly mixed with an ethanolic lipid mixture. LNP.

Accordingly, in certain embodiments, the vaccines formulations comprise lipid nanoparticle delivery formulations of nucleic acid-based vaccines. Optionally, the lipid is cationic. Appropriate cationic lipids are known in the art. Non-limiting examples include phosphatidylcholine/cholesterol/PEG-lipid, C12-200, dimethyldioctadecylammonium (DDA), 1,2-dioleoyl-3-trimethylammonium propane (DOTAP) or 1,2-dilinoleyloxy-3-dimethylaminopropane (DLinDMA). Also see for example, U.S. Pat. No. 10,221,127 (incorporated by reference) and Reichmuth A M et al. (Therapeutic Delivery. 2016; 7(5):319-334. DOI: 10.4155/tde-2016-0006). In specific embodiments, the vaccines formulations comprise lipid nanoparticle delivery formulations of SAM RNA vaccines. In specific embodiments, the LNPs comprise an ionizable cationic lipid (phosphatidylcholine:cholesterol/PEG-lipid (50:10:38.5:1.5 mol/mol). In certain embodiments, the RNA to total lipid ratio in the LNP is approximately 0.05 (wt/wt). In certain embodiments, the LNPs have a diameter of ˜80 nm.

In other embodiments, Charge-Altering Releasable Transporters (CARTs) as a mRNA delivery platform.

Accordingly, in certain embodiments, the vaccines viral vector-based vaccines or nucleic acid-based vaccines. In specific embodiments, the vaccines are SAM RNA-based vaccines. Optionally, the SAM vaccines are in lipid nanoparticle formulations.

Method of Vaccination

Also provided herein is a method of treating, protecting against, and/or preventing disease associated with the infectious agent in a subject in need thereof by administering the vaccine to the subject. For example, a worker skilled in the art would readily appreciate that a SARS-COV-2 vaccine may be used treating, protecting against, and/or preventing disease associated with SARS-COV-2 (i.e. COVID 19). Administration of the vaccine to the subject can induce or elicit a specific immune response against the vaccine target in the subject.

The subject may be a human or other animals, including but not limited to other mammals, such as non-human primates, cats, dogs, equines (including but not limited to horses, donkeys and zebras), camels, sheep, goats, and bovines (including but not limited to cows).

The induced immune response can be used to treat, prevent, and/or protect against disease related to the vaccine target. For example, a SARS-COV-2 vaccine to the subject can induce or elicit a specific immune response against the SARS-COV-2 in the subject. The induced immune response provides the subject administered the vaccine with protection against the vaccine target, such as a SARS-COV-2 vaccine provides resistance to SARS-COV-2.

The induced immune response can include an induced humoral immune response and/or an induced cellular immune response. The induced humoral immune response can include IgG antibodies and/or neutralizing antibodies that are reactive to the antigen. The induced cellular immune response can include a CD8+ T cell response.

The number of vaccine doses for effective treatment can be 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10.

In certain embodiments, a single type of vaccine is used. In other embodiments, multiple types of vaccines are used. For example, in certain embodiments, a prime and boost strategy of vaccination is used. In such embodiments, one vaccine expresses epitopes are linked to CD74/HLA targeting sequences is used (this may promote DC cross priming of T cells). A second vaccine expresses epitopes that lack all signal sequences and transmembrane domains is used (this may promote endogenous antigen presentation). These may be administered together or in 2 separate immunization of priming and boosting to promote optimum T cell response.

The vaccine can be formulated in accordance with standard techniques well known to those skilled in the pharmaceutical art. Such compositions can be administered in dosages and by techniques well known to those skilled in the medical arts taking into consideration such factors as the age, sex, weight, and condition of the particular subject, and the route of administration. The subject can be a mammal, such as a human, an equine, a bovine, a pig, a sheep, a camel, a cat, a dog, a rat, or a mouse.

The vaccine can be administered prophylactically or therapeutically. In prophylactic administration, the vaccines can be administered in an amount sufficient to induce an immune response. In therapeutic applications, the vaccines are administered to a subject in need thereof in an amount sufficient to elicit a therapeutic effect. An amount adequate to accomplish this is defined as “therapeutically effective dose.” Amounts effective for this use will depend on, e.g., the particular composition of the vaccine regimen administered, the manner of administration, the stage and severity of the disease, the general state of health of the patient, and the judgment of the prescribing physician.

The vaccine can be administered by methods well known in the art as described in Donnelly et al. (Ann. Rev. Immunol. 15:617-648 (1997)); Felgner et al. (U.S. Pat. No. 5,580,859, issued Dec. 3, 1996); Felgner (U.S. Pat. No. 5,703,055, issued Dec. 30, 1997); and Carson et al. (U.S. Pat. No. 5,679,647, issued Oct. 21, 1997). The nucleic acid of the vaccine can be complexed to particles or beads that can be administered to an individual, for example, using a vaccine gun. One skilled in the art would know that the choice of a pharmaceutically acceptable carrier, including a physiologically acceptable compound, depends, for example, on the route of administration of the expression vector.

The vaccine can be delivered via a variety of routes. Typical delivery routes include parenteral administration, e.g., intradermal, intramuscular or subcutaneous delivery. Other routes include oral administration, intranasal, and intravaginal routes. The vaccine can be delivered to the interstitial spaces of tissues of an individual (Felgner et al., U.S. Pat. Nos. 5,580,859 and 5,703,055. The vaccine can also be administered to muscle, or can be administered via intradermal or subcutaneous injections, or transdermally, such as by iontophoresis. Epidermal administration of the vaccine can also be employed. Epidermal administration can involve mechanically or chemically irritating the outermost layer of epidermis to stimulate an immune response to the irritant (Carson et al., U.S. Pat. No. 5,679,647, the contents of which are incorporated herein by reference in its entirety).

The vaccine can also be formulated for administration via the nasal passages. Formulations suitable for nasal administration, wherein the carrier is a solid, can include a coarse powder having a particle size, for example, in the range of about 10 to about 500 microns which is administered in the manner in which snuff is taken, i.e., by rapid inhalation through the nasal passage from a container of the powder held close up to the nose. The formulation can be a nasal spray, nasal drops, or by aerosol administration by nebulizer. The formulation can include aqueous or oily solutions of the vaccine.

The vaccine can be a liquid preparation such as a suspension, syrup or elixir. The vaccine can also be a preparation for parenteral, subcutaneous, intradermal, intramuscular or intravenous administration (e.g., injectable administration), such as a sterile suspension or emulsion.

The vaccine can be administered via electroporation, such as by a method described in U.S. Pat. No. 7,664,545. The electroporation can be by a method and/or apparatus described in U.S. Pat. Nos. 6,302,874; 5,676,646; 6,241,701; 6,233,482; 6,216,034; 6,208,893; 6,192,270; 6,181,964; 6,150,148; 6,120,493; 6,096,020; 6,068,650; and 5,702,359. The electroporation may be carried out via a minimally invasive device.

A method of inducing an antigen-specific immune response in a subject, the method comprising administering to the subject the vaccine comprising at least one nucleic acid sequence of SEQ ID NO. 1-51 or a mutated variant thereof capable of expressing a polypeptide in an amount effective to produce an antigen-specific immune response in the subject.

EXAMPLES

Example 1: Identification and Quantification of Peptides Eluted from Hla Molecules from Cultured Cells and from Patient Samples

Peptide analysis from cultured cells: Peptide epitopes in the SARS-COV-2 proteins will be mapped. Using human THP-1 (monocytic) and Calu-3 (lung epithelial) cells, we will treat them with a recombinant version of each SARS-COV-2 protein. The duration of antigen exposure will be optimized for maximum presentation. After antigen challenge, we will first collect host-processed, HLA-bound peptides from the cells by immunoprecipitation (IP) of the HLA, followed by peptide elution using acid stripping (as performed previously). We will use anti-HLA-A (IgG EP1395Y, Abcam 52922), anti HLA-B (IgG1 JOAN-1, Thermo MA1-35410), and anti-HLA-C (IgG EPR6749, Abcam 126722) antibodies to mmunoprecipitated human HLA I proteins and their ligands. For MHC II, we will use the L243 antibody against HLA-DRB1 (IgG2a, Abcam 136320), or other antibodies against several variants, such as the HL-40 antibody against HLA-DR and -DP (IgG2a, Abcam 8085). The IgG will be conjugated to magnetic Protein G beads and cross-linked with disuccinimidyl suberate so that the IgG is not eluted and the beads can be re-used. Post-challenge, cells will be solubilized in a detergent-containing buffer, and HLA molecules will be immunoprecipitated with the IgG conjugated magnetic beads. HLA-bound peptides will then be eluted in 10% acetic acid, separated from larger proteins by a 5000 molecular weight cutoff filter and then detected by mass spectrometry, as performed previously.

Peptide analysis from COVID-19 Patient Cohort: Vancouver General Hospital (VGH) and Surrey Memorial Hospital (SMH) receive >70% of SARS-COV-2 patients in British Columbia who require hospitalization. As of Mar. 30, 2020, 56 patients have been enrolled in the two centers (VGH & SMH). Clinical care will be guided by the discretion of attending intensive care physicians in accordance with the international guidelines for COVID-19 management from the Surviving Sepsis Campaign and the British Columbia COVID-19 Therapeutics Committee recommendations. Clinical data include: date of ICU admission, sex, age, symptoms of viral illness, comorbidities, length of ICU and hospital stay, length of mechanical ventilation, development of acute respiratory distress syndrome, medications administered specific to treatment of SARS-COV-2, length of other treatment modalities. PBMCs will be collected on day 14 and day 21. We will experimentally mapping peptide epitopes in the SARS-COV-2 proteins, in a manner similar to the peptide analysis from cultured cells. We will obtain COVID-19 patient peripheral blood mononuclear cells (PBMCs) from the COVID-19 patient cohort in Vancouver. We will elute the HLA-bound SARS-COV-2 peptides from the PBMCs, and map the peptides using Mass Spectrometry.

HLA haplotype sequencing: In order to begin to understand if some HLA genes confer resistance or susceptibility to SARS-COV-2, as has been noted for other human coronaviruses, we will sequence HLA genes from COVID-19 patients. From the COVID-19 patient PBMC samples, all HLA Class I and Class II HLA genes will be sequenced at single base-pair resolution. 0.6-1.4 μg of high-quality genomic DNA (gDNA) is required for the amplification of HLA-A, HLA-B, HLA-C, HLA-DRB1/3, HLA-DRB4, HLA-DRB5, HLADPA1, HLA-DPB1, HLA-DQA1 and HLA-DQB1 regions. Each patient will be genotyped once. The next generation sequencing tool for HLA typing, Holotype HLA v3.0 (Omixon), is a set of predetermined PCR primers and reagents that provides deep and even coverage of the whole gene region for all 11 HLA class 1 and class 2 genes, with balance between alleles at the same locus. Targeted whole gene libraries will be multiplexed and sequenced on the II lumina MiSeq platform using the 300-cycle Standard flow cell. Data Analysis of fastq files will be done using the Omixon Twin v4.0.1 Software. Polymorphic sites will be identified within all the regions.

Example 2: Creation of Hla Tetramers for Use in Vaccine Testing and Evaluation of Patient Immune Status

HLA tetramers are essentially four HLA molecules together in a tetramer, such that their peptide-binding pockets are exposed. Specific kits for making tetramers with specific HLA haplotypes will be purchased from Mbl International Corp, i.e. QuickSwitch Quant HLA-A*02:01 Tetramer Kit-APC (#TB-7300-K2). These HLA tetramer molecules can then be loaded with a relevant peptide, identified by the studies above. In a tetramer assay, these HLA-tetramers are used to detect T cell with receptors that recognize the peptide:HLA complex. The HLA tetramers are further labeled with a fluorophore (Tetramer Staining Guide, MBL Int. Corp.), allowing tetramer-bound T-cells to be analyzed with flow cytometry. This enables us to quantitate and to investigate the specificity and functionality of the cellular immune response to a SARS-COV-2 viral infection and to an eventual vaccine administration, as HLA tetramer binding to a T cell indicates that a person has encountered the pathogen previously and built an immune response to that pathogen. Mapping HLA-peptide epitopes of SARS-COV-2 proteins will allow generation of HLA Tetramers, which can then be used to quantify T cell specificity in human populations. A tetramer reagent such as this would be invaluable for monitoring patients' immune responses in real time and may inform clinical treatment and vaccine performance.

Example 3: Creation of “String-of-Beads” Vaccines for Covid-19

Self-Amplifying mRNA (SAM) Vaccines production: | “String-of-Beads” SAM candidates vaccines will be produced asdescribed above.

Lipid nanoparticle (LNP) formulation of the RNA-based vaccines: SAM vaccine candidates will be encapsulated state-of-the-art lipid nanoparticles based on clinically approved formulations. Encapsulation uses a self-assembly process, in which an aqueous solution of mRNA at pH=4.0 is rapidly mixed with a solution of lipids dissolved in ethanol. LNPs to be used in this study are similar in composition to those described previously, which contain an ionizable cationic lipid (phosphatidylcholine:cholesterol/PEG-lipid (50:10:38.5:1.5 mol/mol)) and will be encapsulated at an RNA to total lipid ratio of ˜0.05 (wt/wt). This should result in LNPs with a diameter of ˜80 nm as measured by dynamic light scattering using a Zetasizer Nano ZS (Malvern Instruments Ltd., Malvern, UK) instrument. All SAM-LNP formulations will be stored at −80° ° C. at a concentration of mRNA of ˜1 μg/μl.

Validation of recombinant gene and protein expression: Human HEK293 cell and hamster BHK-21 cells will be transfected with the SAM-lipid nanoparticle formulations. RT-PCR and Western blots will be used to test for expression of the constructs from the vaccine candidates. Cell lysates will be run on SDS-PAGE gels and Western blots will be performed with FLAG-specific antibodies.

Testing vaccines in a hamster COVID-19 disease model. The SAM-lipid nanoparticle (SAM-LNP) vaccines will be tested in a hamster model of COVID-19. Vaccine constructs will be tested for their performance in evoking immune responses against the SARS-COV-2 spike protein and to elicit protection in a SARS-COV-2 lethal viral challenge model in Syrian hamsters.

Hamster Vaccination: SAM-LNPs vaccine candidates will be diluted in phosphate-buffered saline (PBS) and injected into animals intramuscularly (i.m.) with a 3/10 cc 29½G insulin syringe. Four sites of injection (30 μl each) over the lower back will be used. For a dose response curve, hamsters will be vaccinated (Primed) on day 0 and receive a booster injection on day 14. Groups will consist of a minimum of 5 animals per group for each vaccine tested, and a minimum of 3 dose ranges (e.g. 0.005 mg/kg-0.250 mg/kg) will be used for each vaccine23. A control group of unimmunized hamsters will be included. Body weights will be determined every day.

Measuring Cellular Immune Responses: Peripheral blood monocytic cells (PBMCs) will be obtained on day 0, 7, 14 and 28 post-infection. We will harvest PBMCs to compare lymphocyte populations (T cell: CD4+, CD8+; B cell) using hamster-specific antibodies available from the Monoclonal Antibody Center at Washington State University. Inflammatory cytokines profiling will be undertaken using ELISA kits (MBL Intl) in samples collected at day 0, 4, 7, 14, 28 after challenge. Quantitative reverse transcriptase polymerase chain reaction (qRT-PCR) will also be used to verify cytokine production from isolated cells and tissues, as previously described. Using blood obtained from the vaccinated hamsters above, we will screen for the production of antibodies which bind to recombinant SARS-COV-2 proteins, using screening assays, e.g. Western blot; ELISA assay; EliSpot.

Viral Challenge: The optimal dose of vaccine to use will be determined from the dose response trial. Hamsters will be vaccinated (Primed) on day 0 and receive a booster injection on day 14. Groups will consist of a minimum of 15 animals per group for each vaccine tested. At 28 days post vaccination, hamsters will be challenged with SARS-COV-2 at a dose of 10 e5 pfu in roughly 30 μl PBS via intranasal administration. Hamsters will be monitored every day for temperature, weight, and survival. Losing over 20% of their body weight will be considered a humane endpoint, and animals will be sacrificed. Tissues and cells will be harvested and examined, as described above, and bronchoalveolar lavage cell suspension will also be obtained at time of mortality.

Example 4: Combinatorially Identified Epitopes and Experimental Data

There appears to be a good concordance between the epitopes identified by the method described in PCT/CA2021/051666 (incorporated by reference) and those found experimentally in infection survivors. With typical parameters, the method described in PCT/CA2021/051666 would identify 251 highly immunogenic loci that are needed to confer a broad population-wide immunity against SARS-CoV-2, and 113 of those (or the 63% of the 180 detected ones) correspond with peptides that have been identified in survivors. It should also be noted that the dataset of detected peptides is by no means exhaustive as it is derived from a sample of survivors that is not representative of the general population, so more of the peptides predicted by PCT/CA2021/0516 might in fact be present in the general population. A pre-gene breakdown of the results is included in the following Table.

	Predicted by	Not predicted by	Predicted by
	PCT/	PCT/	PCT/
	CA2021/	CA2021/	CA2021/
	051666	051666	051666
	and	and	and not
	experim.	experim.	experim.
Gene	detected	detected	detected	TOTAL

surface_glycoprotein	26	7	13	46
	(57% of total,	(15% of total,	(28% of total)
	79% of detected)	21% of detected)
nucleocapsid_phosphoprotein	7	7	2	16
	(44% of total.	(44% of total,	(13% of total)
	50% of detected)	50% of detected)
nsp6	5	1	0	6
	(83% of total,	(17% of total,	(0% of total)
	83% of detected)	17% of detected)
membrane_glycoprotein	4	2	1	7
	(57% of total,	(29% of total,	(14% of total)
	67% of detected)	33% of detected)
ORF3a_protein	4	1	2	7
	(57% of total,	(14% of total,
	80% of detected)	20% of detected)	(29% of total)
3′-to-5′_exonuclease	9	4	5	18
	(50% of total,	(22% of total,	(28% of total)
	69% of detected)	31% of detected)
RNA-dependent_RNA_polymerase	18	7	10	35
	(51% of total,	(20% of total,	(29% of total)
	72% of detected)	28% of detected)
ORF8_protein	3	0	1	4
	(75% of total,	(0% of total,	(25% of total)
	100% of detected)	0% of detected)
nsp2	11	7	7	25
	(44% of total,	(28% of total,	(28% of total)
	61% of detected)	39% of detected)
helicase	8	2	8	18
	(44% of total,	(11% of total,	(44% of total)
	80% of detected)	20% of detected)
nsp3	18	29	22	69
	(26% of total,	(42% of total,	(32% of total)
	38% of detected)	62% of detected)
TOTAL	113	67	71	251
	(45% of total,	(27% of total,	(28% of total)
	63% of detected)	37% of detected)

In more detail, this is the full list of viral loci, with whether they have been predicted/detected:

			Identification
			(J = PCT/
			CA2021/
			051666;
			E =
			experimentally
	Low	High	detected
	AA	AA	peptides;
Viral gene	position	position	J, E = both)

3′-to-5′_exonuclease	1	14	J, E
3′-to-5′_exonuclease	16	30	J
3′-to-5′_exonuclease	64	72	E
3′-to-5′_exonuclease	102	125	J, E
3′-to-5′_exonuclease	156	199	J, E
3′-to-5′_exonuclease	205	219	J
3′-to-5′_exonuclease	223	237	J
3′-to-5′_exonuclease	240	249	E
3′-to-5′_exonuclease	252	291	J, E
3′-to-5′_exonuclease	305	319	J
3′-to-5′_exonuclease	320	328	E
3′-to-5′_exonuclease	337	351	J, E
3′-to-5′_exonuclease	363	381	J, E
3′-to-5′_exonuclease	394	409	J
3′-to-5′_exonuclease	411	419	E
3′-to-5′_exonuclease	428	450	J, E
3′-to-5′_exonuclease	454	476	J, E
3′-to-5′_exonuclease	492	512	J, E
helicase	1	39	J, E
helicase	41	92	J, E
helicase	128	135	J
helicase	146	169	J, E
helicase	173	181	E
helicase	205	213	J
helicase	218	270	J, E
helicase	289	375	J, E
helicase	382	390	J
helicase	392	411	J, E
helicase	422	430	J
helicase	438	447	J
helicase	448	456	E
helicase	478	487	J
helicase	492	499	J
helicase	507	533	J, E
helicase	566	579	J
helicase	582	600	J, E
membrane_glycoprotein	19	73	J, E
membrane_glycoprotein	82	116	J, E
membrane_glycoprotein	119	132	J
membrane_glycoprotein	136	159	J, E
membrane_glycoprotein	161	196	J, E
membrane_glycoprotein	198	206	E
membrane_glycoprotein	213	22	E
nsp2	14	24	J, E
nsp2	30	49	J, E
nsp2	61	81	J, E
nsp2	86	108	J, E
nsp2	112	120	E
nsp2	121	129	J
nsp2	156	163	J
nsp2	178	198	J, E
nsp2	199	207	J, E
nsp2	216	224	E
nsp2	239	248	J
nsp2	265	273	E
nsp2	288	326	J, E
nsp2	347	367	J
nsp2	382	401	J
nsp2	403	412	E
nsp2	413	420	J
nsp2	429	450	J, E
nsp2	461	487	J, E
nsp2	492	513	J, E
nsp2	522	536	J, E
nsp2	551	559	E
nsp2	561	569	E
nsp2	598	610	J
nsp2	625	636	E
nsp3	1	27	J, E
nsp3	42	50	E
nsp3	53	68	J, E
nsp3	81	105	J, E
nsp3	182	201	E
nsp3	239	249	J
nsp3	265	273	E
nsp3	325	338	E
nsp3	339	348	J
nsp3	351	364	J, E
nsp3	367	375	E
nsp3	396	404	E
nsp3	415	424	J
nsp3	430	452	J, E
nsp3	454	476	J, E
nsp3	494	502	E
nsp3	503	511	E
nsp3	525	542	J
nsp3	569	579	J, E
nsp3	595	608	J
nsp3	615	627	E
nsp3	628	639	J
nsp3	647	655	E
nsp3	660	671	J
nsp3	684	691	J
nsp3	718	728	E
nsp3	733	741	E
nsp3	748	756	E
nsp3	810	817	J
nsp3	819	832	J, E
nsp3	851	859	E
nsp3	867	882	J
nsp3	890	904	J, E
nsp3	950	958	E
nsp3	963	973	J
nsp3	980	994	J, E
nsp3	995	1006	J
nsp3	1012	1021	J
nsp3	1073	1089	E
nsp3	1112	1120	E
nsp3	1131	1161	J, E
nsp3	1165	1176	J
nsp3	1199	1207	E
nsp3	1236	1268	J, E
nsp3	1274	1289	E
nsp3	1291	1299	E
nsp3	1303	1312	E
nsp3	1327	1335	E
nsp3	1342	1359	J, E
nsp3	1383	1400	J, E
nsp3	1404	1432	E
nsp3	1452	1481	J, E
nsp3	1483	1494	J
nsp3	1508	1523	E
nsp3	1529	1565	E
nsp3	1574	1582	E
nsp3	1587	1595	E
nsp3	1626	1645	J
nsp3	1652	1659	J
nsp3	1665	1673	E
nsp3	1697	1706	J
nsp3	1718	1725	J
nsp3	1737	1759	J, E
nsp3	1771	1794	E
nsp3	1809	1819	J, E
nsp3	1830	1843	J
nsp3	1866	1881	J, E
nsp3	1885	1897	J
nsp3	1923	1942	J
nsp6	5	13	E
nsp6	24	124	J, E
nsp6	139	155	J, E
nsp6	160	234	J, E
nsp6	236	249	J, E
nsp6	268	286	J, E
nucleocapsid_phosphoprotein	11	19	J, E
nucleocapsid_phosphoprotein	41	59	J, E
nucleocapsid_phosphoprotein	75	87	E
nucleocapsid_phosphoprotein	93	101	E
nucleocapsid_phosphoprotein	104	115	J, E
nucleocapsid_phosphoprotein	128	136	J
nucleocapsid_phosphoprotein	138	146	E
nucleocapsid_phosphoprotein	150	158	E
nucleocapsid_phosphoprotein	189	196	E
nucleocapsid_phosphoprotein	217	234	J, E
nucleocapsid_phosphoprotein	257	265	E
nucleocapsid_phosphoprotein	266	274	J, E
nucleocapsid_phosphoprotein	289	298	E
nucleocapsid_phosphoprotein	299	316	J, E
nucleocapsid_phosphoprotein	323	369	J, E
nucleocapsid_phosphoprotein	375	386	J
ORF3a_protein	2	10	E
ORF3a_protein	25	65	J, E
ORF3a_protein	70	134	J, E
ORF3a_protein	136	175	J, E
ORF3a_protein	176	188	J
ORF3a_protein	194	249	J, E
ORF3a_protein	252	262	J
ORF8_protein	6	52	J, E
ORF8_protein	54	64	J
ORF8_protein	73	93	J, E
ORF8_protein	95	118	J, E
RNA-dependent_RNA_polymerase	4	20	J
RNA-dependent_RNA_polymerase	28	35	J
RNA-dependent_RNA_polymerase	64	74	J, E
RNA-dependent_RNA_polymerase	83	104	J, E
RNA-dependent_RNA_polymerase	122	133	J, E
RNA-dependent_RNA_polymerase	142	155	J
RNA-dependent_RNA_polymerase	183	196	J
RNA-dependent_RNA_polymerase	229	256	J, E
RNA-dependent_RNA_polymerase	263	271	E
RNA-dependent_RNA_polymerase	295	329	J, E
RNA-dependent_RNA_polymerase	331	346	J, E
RNA-dependent_RNA_polymerase	348	363	J
RNA-dependent_RNA_polymerase	365	382	J, E
RNA-dependent_RNA_polymerase	394	410	J, E
RNA-dependent_RNA_polymerase	420	427	J
RNA-dependent_RNA_polymerase	434	443	J
RNA-dependent_RNA_polymerase	450	487	J, E
RNA-dependent_RNA_polymerase	523	530	J
RNA-dependent_RNA_polymerase	536	548	E
RNA-dependent_RNA_polymerase	557	564	J
RNA-dependent_RNA_polymerase	574	589	E
RNA-dependent_RNA_polymerase	603	618	J, E
RNA-dependent_RNA_polymerase	624	678	J, E
RNA-dependent_RNA_polymerase	681	689	E
RNA-dependent_RNA_polymerase	691	708	J, E
RNA-dependent_RNA_polymerase	717	734	J
RNA-dependent_RNA_polymerase	738	752	J, E
RNA-dependent_RNA_polymerase	754	766	J, E
RNA-dependent_RNA_polymerase	771	792	J, E
RNA-dependent_RNA_polymerase	793	801	E
RNA-dependent_RNA_polymerase	810	845	J, E
RNA-dependent_RNA_polymerase	854	871	J, E
RNA-dependent_RNA_polymerase	877	893	J, E
RNA-dependent_RNA_polymerase	895	915	E
RNA-dependent_RNA_polymerase	926	932	E
surface_glycoprotein	2	19	J, E
surface_glycoprotein	24	36	E
surface_glycoprotein	38	54	J, E
surface_glycoprotein	55	74	J, E
surface_glycoprotein	78	93	J
surface_glycoprotein	109	117	E
surface_glycoprotein	123	146	J
surface_glycoprotein	151	160	E
surface_glycoprotein	162	179	J, E
surface_glycoprotein	202	250	J, E
surface_glycoprotein	256	278	J, E
surface_glycoprotein	286	293	J
surface_glycoprotein	298	311	J
surface_glycoprotein	318	337	J, E
surface_glycoprotein	343	382	J, E
surface_glycoprotein	387	404	J
surface_glycoprotein	411	419	E
surface_glycoprotein	424	436	J, E
surface_glycoprotein	445	459	E
surface_glycoprotein	463	528	J, E
surface_glycoprotein	582	600	J
surface_glycoprotein	601	629	J, E
surface_glycoprotein	635	654	J, E
surface_glycoprotein	657	671	E
surface_glycoprotein	680	706	J, E
surface_glycoprotein	710	733	J, E
surface_glycoprotein	735	742	J
surface_glycoprotein	746	767	J, E
surface_glycoprotein	780	794	J, E
surface_glycoprotein	801	815	J, E
surface_glycoprotein	821	829	E
surface_glycoprotein	835	844	J
surface_glycoprotein	846	855	J
surface_glycoprotein	857	881	J, E
surface_glycoprotein	882	906	J, E
surface_glycoprotein	912	927	J, E
surface_glycoprotein	928	955	J, E
surface_glycoprotein	958	1016	J, E
surface_glycoprotein	1039	1071	J, E
surface_glycoprotein	1082	1092	J
surface_glycoprotein	1096	1133	J, E
surface_glycoprotein	1138	1145	J
surface_glycoprotein	1152	1160	J
surface_glycoprotein	1183	1203	J, E
surface_glycoprotein	1208	1262	J, E
surface_glycoprotein	1263	1270	J

It should also be noted that, according to the contents of the current invention and depending on the viral gene, the method described in PCT/CA2021/0516 was used to predict peptides coming from both the wild-type virus and from variants. A table detailing the viral loci, the corresponding number of wild-type and variant peptides, and the corresponding number of HLA I & II alleles that are expected to be protected by these specific sets of peptides, is enclosed below.

	#	# alleles	# peptides	# alleles
	wild-type	protected	from	protected
Gene	peptides	by w.t.p.	variants	by p.f.v.

surface_glycoprotein	30	122	80	122
nucleocapsid_	3	99	16	103
phosphoprotein
nsp6	2	69	23	122
endoRNAse	10	85	—	—
nsp7	2	54	—	—
3C-like_proteinase	8	96	—	—
nsp8	7	110	—	—
membrane_glycoprotein	5	108	11	122
nsp9	4	77	—	—
ORF3a_protein	6	90	44	122
nsp10	4	84	—	—
leader_protein	3	100	—	—
3′-to-5′_exonuclease	17	122	—	—
RNA-dependent_	22	122	34	122
RNA_polymerase
ORF8_protein	3	86	11	115
ORF6_protein	3	103	—	—
2′-O-ribose_	8	110	—	—
methyltransferase
ORF7a_protein	3	91	—	—
nsp2	18	122	—	—
envelope_protein	1	81	—	—
nsp3	41	119	—	—
helicase	14	122	38	122
nsp4	10	106	—	—

Although various embodiments of the invention are disclosed herein, many adaptations and modifications may be made within the scope of the invention in accordance with the common general knowledge of those skilled in this art. Such modifications include the substitution of known equivalents for any aspect of the invention in order to achieve the same result in substantially the same way. Numeric ranges are inclusive of the numbers defining the range. The word “comprising” is used herein as an open ended term, substantially equivalent to the phrase “including, but not limited to”, and the word “comprises” has a corresponding meaning. As used herein, the singular forms “a”, “an” and “the” include plural referents unless the context clearly dictates otherwise. Thus, for example, reference to “a thing” includes more than one such thing. Citation of references herein is not an admission that such references are prior art to an embodiment of the present invention. The invention includes all embodiments and variations substantially as hereinbefore described and with reference to the examples and drawings. Titles, headings, or the like are provided to enhance the reader's comprehension of this document, and should not be read as limiting the scope of the present invention.