US20060286629A1
2006-12-21
11/424,870
2006-06-18
The invention provides novel methionine aminopeptidase enzymes, their use, and related compounds and methods.
Get notified when new applications in this technology area are published.
C12P21/06 » CPC further
Preparation of peptides or proteins produced by the hydrolysis of a peptide bond, e.g. hydrolysate products
C12P21/02 IPC
Preparation of peptides or proteins having a known sequence of two or more amino acids, e.g. glutathione
C07H21/04 IPC
Compounds containing two or more mononucleotide units having separate phosphate or polyphosphate groups linked by saccharide radicals of nucleoside groups, e.g. nucleic acids with deoxyribosyl as saccharide radical
C12N9/48 » CPC main
Enzymes; Proenzymes; Compositions thereof ; Processes for preparing, activating, inhibiting, separating or purifying enzymes; Hydrolases (3) acting on peptide bonds (3.4)
C07K14/54 IPC
Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans; Cytokines; Lymphokines; Interferons Interleukins [IL]
This patent application is a continuation of International Patent Application PCT/DK2004/000891, filed Dec. 20, 2004, published as WO 2005059127, which designates the US, and further claims the benefit of U.S. Provisional Patent Application 60/531,790, filed Dec. 22, 2003, and Danish Patent Application PA200301892, filed Dec. 19, 2003, the entirety of each of which is hereby incorporated by reference.
FIELD OF THE INVENTIONThe invention relates to a method for processing initiator methionine containing proteins by the enzyme Methionine Aminopeptidase and mutants thereof to yield initiator methionine free peptides.
BACKGROUND OF THE INVENTIONProduction of peptides by recombinant techniques using either prokaryotic or eukaryotic expression systems inherently yields the peptide with a leading methionine amino acid. This amino acid may not be present in the native protein i.e. the variant of the peptide processed for translocation. Obtaining the peptide without the leading methionine thus requires a further processing step. In the present invention the step is performed by the enzyme Methionine Aminopeptidase, which selectively cleaves the initiator methionine from the peptide.
Methionine Aminopeptidases (Met-AP's) are known in the art as enzymes which cleaves leading methionines, if the leading peptide sequence is of a certain predetermined character. Wild-type Escherichia coli Met-AP selectively cleaves after an initiator Met residue if the residue in the P1′ position is Gly, Ala, Ser, Thr, Pro, Val or Cys.
In the present invention the methionine aminopeptidases are improved by introducing mutations in the substrate binding sites which results in methionine aminopeptidases which cleaves the methionine regardless of the leading peptide sequence (P1′ position)
SUMMARY OF THE INVENTIONThe invention provides novel mutant methionine aminopeptidases.
The invention provides isolated DNA encoding such methionine aminopeptidases.
The invention provides host cells for producing such methionine aminopeptidases.
The invention provides the use of the mutant methionine aminopeptidase for processing of peptides with an initiator methionine amino acid into a methionine free peptide.
The invention also provides the processing of specific peptides by mutant methionine aminopeptidases.
The invention also provides a method for separating the methionine containing starting material from the final cleaved product.
DESCRIPTION OF THE DRAWINGSFIG. 1: Example of a E. coli Met-AP mutant expression construct layout. Purification indicates tag for purification purposes. Protease indicates protease cleavage site.
FIG. 2: Expression in e.g. E. coli of (A) NT1-Enterokinase-Met-AP Y168A or (B) NT1-Enterokinase-Met-AP Y168G, M206N, Q233A as indicated.
FIG. 3: hexa-His-Xa-Met-AP (M206A, Q233A) cleavage of Met-hIL-21
FIG. 4: Maldi-tof es mass spectrum of purified hexa-His-Xa-Met-AP M206A, Q233A.
FIG. 5: Purification chromotogram of the separation of the three compounds Met-IL-21, IL-21 and pyroglutamine IL-21.
DEFINITIONSP1 defines the first amino acid N-terminal to the recognition site for the enzyme. P1′ denotes the amino acid adjacent to P1 towards the C-terminal. P1 in the present invention is methionine.
In the present invention substrate specificity means selectivity towards the P1′ position—which is the position just C-terminal to methionine. Wild-type Escherichia coli Met-AP exhibits the substrate specificity, that it selectively cleaves after an initiator Met residue if the residue in the P1′ position is Gly, Ala, Ser, Thr, Pro, Val or Cys. The mutants of the present invention showing an extended substrate specificity means that further aminoacid can occupy the P1′ position and still cleavage of the methionine is observed.
In the context of the present invention variant means a sequence which has maintained the qualitative activity of the parent sequence, ie as methionine aminopeptidase, but wherein the sequence differs from the parent sequence by deletions, insertions, extension or substitution of one or more amino acids of the parent sequence. Variants in principle also includes fragments of any length provided the activity is maintained.
In the context of the present invention chemical derivatives of a specific protein means a derivative of the native protein which is not a variant, and which maintains the qualitative activity of the parent protein sequence. The chemical derivative includes derivatives such as PEG-groups.
The terms peptide and proteins are used interchangeable and is not meant as indications or limitations as to size or function of the sequences.
DESCRIPTION OF THE INVENTIONThe Met-Ap from E. coli has a substrate defining pocket (as part of active site) essentially, but probably not exclusively, defined by the amino acids Tyr 168, Met 206 and Gln 233. Mutating these positions extends the enzymes substrate specificity. The novel E.coli aminopeptidases described in the present invention extends the applicability of the Methionine aminopeptidases to be useful for removing the initiating methionine from almost any type of protein or peptide regardless of the amino acid sequence downstream of the methionine (P1′ position). Hence, the initiator methionine can be removed from all initiator methionine containing peptides or proteins to produce initiator methionine-free peptides or proteins.
The E. coli Methionine aminopeptidase gene was cloned and mutant versions have been created using site directed mutagenesis.
The mutants were expressed in E. coli and the resulting enzymes were purified by conventional His-tag system. The enzyme can also be tagged by for example the FLAG-system or tagged and purified by other technologies as described in WO 03042249. Catalytic activity was monitored using initiator Met containing hIL-21 as a substrate.
In principle, the invention is generally applicable to any peptide. The invention is demonstrated as being useful for cleavage of the initiator methionine for peptides such as hIL-21. hIL-21 is a model system for P1′ position being a Gln. IL-21 is described in WO00/53761 and is described as being effective in the treatment of cancer and viral infection among others. IL-20 is described in WO9927103. hGH refers to human Growth Hormone. Both are model systems for other aminoacids in P1′ position.
The invention thus provides the methionine aminopeptidase enzyme having the following sequence (also described as seq. id. no. 1)
MAISIKTPEDIEKMRVAGRLAAEVLEMIEPYVKPGVSTGELDRICNDYIVNEQHAVSACL GYHGYPKSVCISINEVVCHGIPDDAKLLKDGDIVNIDVTVIKDGFHGDTSKMFIVGKP TIMGERLCRITQESLYLALRMVKPGINLREIGAAIQKFVEAEGFSVVREXa CGHGIGRGFHEEPQVLH YDSRETNVVLKPGMTFTIEPXb VNAGKKEIRTMKDGWTVKTKDRSLSAX YEHTIVVT DNGCEILTLRKDDTIPAIISHDE,
wherein Xa, Xb and Xc are variable amino acids, and wherein Xa, Xb and Xc are not simultaneously Tyr, Met and Gln respectively. In an aspect of the invention one or more of Xa, Xb and Xc are exchanged from the wild type amino acid into Gly, Ala, Ser, Thr, Asn or Asp. In an aspect of the invention Xa, Xb and Xc are exchanged from the wild type amino acid into Gly or Ala;. In an aspect of the invention Xa, Xb and Xc are exchanged from the wild type amino acid into Ala.
The present invention thus provides substitution Y168 to Ala (Y168A)(Seq. id no. 9)
MAISIKTPEDIEKMRVAGRLAAEVLEMIEPYVKPGVSTGELDRICNDYIVNEQHAVSACL GYHGYPKSVCISINEVVCHGIPDDAKLLKDGDIVNIDVTVIKDGFHGDTSKMFIVGKPTIM GERLCRITQESLYLALRMVKPGINLREIGAAIQKFVEAEGFSVVREACGHGIGRG FHEEPQVLHYDSRETNVVLKPGMTFTIEPMVNAGKKEIRTMKDGWTVKTKDRSLSAQYEH TIVVTDNGCEILTLRKDDTIPAIISHDE
and the corresponding DNA encoding the above as seq. id. no. 8;
The present invention thus provides substitution Met 206 to Ala (M206A)(Seq. id no. 3)
MAISIKTPEDIEKMRVAGRLAAEVLEMIEPYVKPGVSTGELDRICNDYIVNEQHAVSACL GYHGYPKSVCISINEVVCHGIPDDAKLLKDGDIVNIDVTVIKDGFHGDTSKMFIVGKP TIMGERLCRITQESLYLALRMVKPGINLREIGAAIQKFVEAEGFSVVREXCGHGIGRGF HEEPQVLHYDSRETNVVLKPGMTFTIEPAVNAGKKEIRTMKDGWTVKTKDRSLSAQYE HTIVVTDNGCEILTLRKDDTIPAIISHDE,
which extends the enzymes substrate specificity to allow the following amino acids: Asn, Leu, Ile and Phe in the P1′ postion.
The present invention also provides substituting Gln 233 to Ala (Q233A) (Seq. id. No.5)
MAISIKTPEDIEKMRVAGRLAAEVLEMIEPYVKPGVSTGELDRICNDYIVNEQHAVSACL GYHGYPKSVCISINEVVCHGIPDDAKLLKDGDIVNIDVTVIKDGFHGDTSKMFIVGKP TIMGERLCRITQESLYLALRMVKPGINLREIGAAIQKFVEAEGFSVVREXCGHGIGRGF HEEPQVLHYDSRETNVVLKPGMTFTIEPMVNAGKKEIRTMKDGWTVKTKDRSLSAAYE HTIVVTDNGCEILTLRKDDTIPAIISHDE,
or both Met 206 and Gln 233 into Ala (M206A Q233A)(Seq. id no. 7):
MAISIKTPEDIEKMRVAGRLAAEVLEMIEPYVKPGVSTGELDRICNDYIVNEQHAVSACL GYHGYPKSVCISINEVVCHGIPDDAKLLKDGDIVNIDVTVIKDGFHGDTSKMFIVGKP TIMGERLCRITQESLYLALRMVKPGINLREIGAAIQKFVEAEGFSVVREXCGHGIGRGF HEEPQVLHYDSRETNVVLKPGMTFTIEPAVNAGKKEIRTMKDGWTVKTKDRSLSAAYE HTIVVTDNGCEILTLRKDDTIPAIISHDE,
which further allow the P1′ amino acids to be His, Gln and Trp.
In aspects of the invention postion 168 is amended into Gly (Y168G) or Ala (Y168A) or Asn (Y168N). Aspects of the invention are wherein amino acid 206 is an Ala (M206A) or a Gly (M206G) or Asn (M206N), and/or wherein amino acid 233 is an Ala (Q233A) or a Gly (Q233G) or Asn (Q233N). Aspects of the invention comprise the combination of two or three amendments according to the below,—wherein the wild-type combination of (Y168 M206 233Q) is not within the invention.
| Position 168 | Position 206 | Position 233 |
| A/G/N/Y | A/G/N/M | A/G/N/Q |
Accordingly, aspects of the invention are wherein position 206 and position 233 are both 20 Ala (M206A Q233A) or Gly or Asn, or combinations thereof: (M206G Q233A), (M206G Q233G), (M206A Q233G), (M206N Q233A), (M206N Q233N), (M206A Q233N). Aspects of the invention are wherein postion 168 is amended according to the below:
| Position 168 | Position 206 | Position 233 |
| A/G/N | A | Q |
| A/G/N | G | Q |
| A/G/N | N | Q |
| A/G/N | M | A |
| A/G/N | M | G |
| A/G/N | M | N |
| A/G/N | A | A |
| A/G/N | G | A |
| A/G/N | N | A |
| A/G/N | A | G |
| A/G/N | A | N |
| A/G/N | N | G |
| A/G/N | N | N |
| A/G/N | G | G |
| A/G/N | G | N |
The invention thus provides a novel enzymes capable of cleaving a peptide containing an initiating methionine followed by a Asn, Leu, Ile, Phe, His, Gln or Trp in the P1′ postion as well as the amino acids allowed by the wild type E.coli aminopeptidase. Wild-type E.coli methionine aminopeptidase allows the P1′ to be any of the following amino acids: Gly, Ala, Ser, Thr, Pro, Val or Cys.
The invention thus also provides recombinant DNA molecules encoding the sequence above. The DNA sequences are disclosed in Seq. id. no. 2, 4 and 6.
The invention also provides specifically the DNA encoding the sequences for the mutants M206A, Q233A or M206A Q233A) above.
In the present invention the mutant Methionine aminopeptidases are expressed in E. coli, but in principle the host cells could be of other prokaryotic origin or eukaryotic origin such as Saccharomyces cerevisiae, Schizosaccharomyces pombe, Pichia pastoris etc. or for example mammalian cells.
The invention thus provides host cells transformed by the recombinant DNA molecule of above.
Removal of initiator methionine by methionine aminopeptidase may be performed in vitro following methionine aminopeptidase expression in, and purification from, prokaryotic or eukaryotic cells. This procedure is demonstrated below. Alternatively removal of initiator methionine may take place in vivo either in cells expressing a di-cistronic plasmid or in cells co-expressing plasmids carrying the methionine aminopeptidase and the substrate peptide or protein. In vivo initiator methionine processing may also be performed in cells where the genes encoding the methionine aminopeptidase and the peptide or protein to be processed have been integrated into the genome.
Experiments have been performed which provides a set of optimum conditions for the reaction: The optimal temperature for the reaction was determined to be between 15 and 24 degrees Celsius. Typically the reaction was hereafter performed at 18 degrees Celsius.
The concentration of ZnCl2 was determined to be optimal at around 7.5□M and NaCl concentration was found optimal around 100 mM and acceptable under 130 mM.
After cleavage of the initiator methionine separation of the product from the starting material can be achieved by exploiting the different biophysical properties of the two peptides.
In an embodiment of the invention the peptide is hIL-21, which after removal of the initial methionine contains a Gln in the N-terminal. Treatment with Qcyclase forms a pyroglutamine (pGlu). Due to cyclic amid formation the products net change is negative relative to the Methionine containing peptide. The difference in charge affects the eluation on a cation exchange column, due to Methionine containing peptide having a stronger binding to the cation resin. Further, in non-cyclised hIL-21 the N-terminal positioned Gln residue will have the ability to form a hydrogen bond between the side chain amide oxygen and the charged N-terminal backbone amine and thereby masking the charge at the N-terminus. Met-hIL-21 will not possess the ability for a similar charge masking and will therefore bind stronger to the cation exchange column than hIL-21.
In an embodiment of the invention, a method seperation of protein mixtures between identical proteins starting with Met-Gln and Gln respectively is provided.
In a specific embodiment of the invention seperation of Met-hIL-21 and hIL-21 is provided.
In another specific embodiment of the invention separation of Met-hIL-21 and hIL-21 and mutants thereof is provided.
EXAMPLESVarious Met-AP expression constructs, as outlined in FIG. 1, have been created. NT1 (HHHNSWDHDINR) or hexa-His tag has been added to the various mutant forms of Met-AP for purification purposes. The purification tag may be removed using Factor Xa in some constructs or Enterokinase in others, or the purification tag may be left on the enzyme. mRNA expression was under the control of the T7 or the tac promoter. Constructs under the control of the T7 promoter were expressed in BL21(DE3) whereas constructs under the control of the tac promoter were expressed in BL21. Expression was induced by addition of IPTG to 0.4 mM to cultures (6 mL) grown to OD600 0.4 in LB-medium. Cells were harvested by centrifugation after 2.5 hours. Cell lysis was done by multiple freeze-thaw cycles and soluble or insoluble protein fractions were separated by centrifugation. Soluble or insoluble protein, before or after induction of expression, originating from equal amounts cells (measured by OD600) were subjected to SDS-PAGE and subsequent colloidal blue staining (FIG. 2). Met-AP expression levels were estimated at ˜250 mg/L after 2.5 h of induction in 6 mL cultures.
E. coli cells harvested from 1 L of culture expressing hexa-His-Met-AP M206A, Q233A were lysed using a cell disruptor, and the clarified lysate was applied on a Ni2+-NTA superflow column. Elution with an imidazole gradient released the Met-AP fusion protein at approximately 200 mM imidazole. The enzyme was further purified and buffer exchanged (into storage/cleavage buffer) using size exclusion chromatography. The enzyme was analysed using SDS-PAGE, MALDI-MS and N-terminus sequencing—verifying the molecular mass and identity of the enzyme.
According to the procedure above NT1-Enterokinase-Met-AP mutants were prepared. Expression was under the control of the tac promoter. Addition of IPTG to the cultures induced primarily soluble expression of the Met-AP enzymes. The following mutants were prepared according to the above: (Y168G M206A), (Y168G M206A 233A), (Y168G M206N), (Y168G M206N 233A), (Y168A M206A 233A), (Y168A M206A), (Y168A M206N) and (Y168A M206N 233A)
Hexa-His-Xa-MetAP Q233A was affinity purified using Ni2+-NTA superflow. Malditof es mass spectrum of purified hexa-His-Xa-Met-AP M206A, Q233A shows that the correct enzymes were isolated. A mass of 32038.90 corresponds to Met-hexa-His-Xa-Met-AP M206A, Q233A and a mass of 31942.10 corresponds to hexa-His-Xa-Met-AP M206A, Q233A indicating that hexa-His-Xa-Met-AP M206A, Q233A was processed by WT Met-AP or hexa-His-Xa-Met-AP M206A, Q233A in vivo. The result is demonstrated in FIG. 4.
Addition of hexa-His-Xa-Met-AP M206A, Q233A to Met-hIL-21 at pH 7, 18° C. generated ˜65% Met-free hIL-21. In 44 h. more than 90% cleavage of Met-hIL-21 could be observed (FIG. 3).
Another mutant prepared by this method was hexa-His-Xa-Met-AP Q233A;
Removal of Initiator Met from Met-IL21 by Met-AP (M206A, Q233A).
Purified Met-AP (M206A, Q233A) was used to remove the initiator Methionine from partly or fully purified Met-IL21. The cleavage was performed in a reaction buffer typically consisting of the following components: 2-100 mM K2SO4, 2-500 mM NaCl, 1-100 □M ZnCl2 and 2-30 mM Hepes buffer pH 6-8. The cleavage was assayed by MALDI-TOF spectroscopy. The time of reaction was 2-66 hours. Using these condition removal of Methionine from Met-IL21 below detection limits of Met-IL21 could be performed.
Removal of Initiator Met from Met-IL21 by Met-AP (M206A).
Purified Met-AP (M206A) was used to remove the initiator Methionine from partly or fully purified Met-IL21. The cleavage was performed in a reaction buffer typically consisting of the following components: 2-100 mM K2SO4, 2-500 mM NaCl, 1-100 □M ZnCl2 and 2-30 mM Hepes buffer pH 6-8. The cleavage was assayed by MALDI-TOF spectroscopy. The time of reaction was 2-66 hours. Using these condition removal of Methionine from Met-IL21 below detection limits of Met-IL21 could be performed.
Influence of Temperature on Removal of Initiator Met from Met-IL21 by Met-AP (M206A, Q233A).
Using the conditions and assay described in example 1 the temperature was varied between 4, 15, 24 and 30 degrees Celsius, respectively while the other parameters was fixed. The optimal temperature for the reaction was determined to be between 15 and 24 degrees Celsius. Typically the reaction was hereafter performed at 18 degrees Celsius.
Influence of ZnCl2 Concentration on Removal of Initiator Met from Met-IL21 by Met-AP (M206A, Q233A).
Using the conditions and assay described in example 1 the ZnCl2 concentration was varied between 7.5, 11 and 15 □M, respectively while the other parameters were fixed. The optimal ZnCl2 concentration for the reaction was determined to be 7.5 □M. Typically, the reaction was hereafter performed at 7.5 □M ZnCl2.
Influence of NaCl Concentration on Removal of Initiator Met from Met-IL21 by Met-AP (M206A, Q233A).
Using the conditions and assay described in example 1 the NaCl concentration was varied between 80, 130 and 180 mM, respectively while the other parameters were fixed. The maximum NaCl concentration tolerated for the reaction to run was determined to be 130 mM. Typically the reaction was hereafter performed at 100 mM NaCl.
Influence of the Addition of Q-Cyclase on Removal of Initiator Met from Met-IL21 by Met-AP (M206A, Q233A) and the Formation of Pyro-Glutamine.
Using the conditions as described in examples above the effect of adding Q-cyclase to the reaction mixture was determined. Again MALDI-TOF was used for assaying the removal of Methonine and subsequently conversion of glutamine in position 1 in IL21 into pyro-glutamine. It was found that the addition of Q-cyclase to the reaction mixture did not negatively influence the removal of initiator Methionine from Met-IL21 and further the Q-cyclase was fully efficient in converting converting glutamine in position 1 in IL21 into pyro-glutamine under the reaction conditions described in the examples above.
Purification and Separation of Met-IL21, IL21 and Pyro-Glutamine IL-21 Using a Mono-S Column.
The different bio-physical properties between Met-IL21, IL21 and pyro-glutamine IL21 can be used for purification purposes/separation. Pyro-glutamine IL21 will due to the cyclized amid formation lack the normal protonation of the N-terminus. The (−1) charge difference between hIl-21 starting with pyro-glutamine and Met-IL21 can be used on a cation exchange column that will elute pyro-glutamine IL21 first (due to its lack of one positive charge) and subsequently Met-IL21 which displays a stronger binding to the cation resin. Further, in non-cyclized IL21 the N-terminally positioned glutamine will have the ability to form a hydrogen bond between the side chain amide oxygen and the charged N-terminal backbone amine, and thereby masking the charge at the N-terminus. Met-IL21 will not poses the ability for a similar charge masking and will therefore bind stronger to a cation exchange column than IL21. A mixture of Met-IL21, IL21 and pyro-glytamine IL21 including 300 mM NaCl and buffered at pH 6.5 was loaded on a Mono-S column. The A buffer consisted of 300 mM NaCl buffered at pH 6.5 and the B buffer 1 M NaCl buffered at pH 6.5. A linear gradient (performed on an AKTA system) from 0-20% B buffer was applied over 45 column volumes. The fractions was assayed as described under the Q-cyclase example above. Using the above described gradient, efficient separation of Met-IL21, IL21. pyro-glutamine IL21 was achieved. (FIG. 5)
Met-hGH
Purified Met-AP (M206A) is used to remove the initiator Methionine from partly or fully purified Met-hGH (human growth hormone) where the P1′ is a Phe residue. The cleavage is performed in a reaction buffer typically consisting of the following components: 2-100 mM K2SO4, 2-500 mM NaCl, 1-100 □M ZnCl2 and 2-30 mM Hepes buffer pH 6-8. The cleavage is assayed by MALDI-TOF spectroscopy. The time of reaction is 2-66 hours. Using these conditions partly or full removal of Methionine from Met-hGH is demonstrated.
Met-hGH
Purified Met-AP (M206A, Q233A) is used to remove the initiator Methionine from partly or fully purified Met-hGH (human growth hormone) where the P1′ is a Phe residue. The cleavage is performed in a reaction buffer typically consisting of the following components: 2-100 mM K2SO4, 2-500 mM NaCl, 1-100 □M ZnCl2 and 2-30 mM Hepes buffer pH 6-8. The cleavage is assayed by MALDI-TOF spectroscopy. The time of reaction is 2-66 hours. Using these conditions partly or full removal of Methionine from Met-hGH is achieved.
Met-IL-20
Purified Met-AP (M206A) is used to remove the initiator Methionine from partly or fully purified Met-IL-20 where the P1′ is a Leu residue. The cleavage is performed in a reaction buffer typically consisting of the following components: 2-100 mM K2SO4, 2-500 mM NaCl, 1-100 □M ZnCl2 and 2-30 mM Hepes buffer pH 6-8. The cleavage is assayed by MALDI-TOF spectroscopy. The time of reaction is 2-66 hours. Using these conditions partly or full removal of Methionine from Met-IL-20 is demonstrated.
Met-IL-20
Purified Met-AP (M206A, Q233A) is used to remove the initiator Methionine from partly or fully purified Met-IL-20 where the P1′ is a Leu residue. The cleavage is performed in a reaction buffer typically consisting of the following components: 2-100 mM K2SO4□□□□□□□□□□□□aCl,□□□□□□□□M ZnCl2 and 2-30 mM Hepes buffer pH 6-8. The cleavage is assayed by MALDI-TOF spectroscopy. The time of reaction is 2-66 hours. Using these conditions partly or full removal of Methionine from Met-IL-20 is demonstrated.
All references, including publications, patent applications, and patents, cited herein are hereby incorporated by reference in their entirety and to the same extent as if each reference were individually and specifically indicated to be incorporated by reference and were set forth in its entirety herein (to the maximum extent permitted by law), regardless of any separately provided incorporation of particular documents made elsewhere herein.
The use of the terms “a” and “an” and “the” and similar referents in the context of describing the invention are to be construed to cover both the singular and the plural, unless otherwise indicated herein or clearly contradicted by context.
1. An E. coli aminopeptidase variant comprising one or more amino acid sequence variations in the substrate defining pockets.
2. The aminopeptidase variant of claim 1, wherein the variant has extended substrate specificity the P1′ position relative to the wild-type E. coli aminopeptidase.
2. The aminopeptidase variant of claim 2, wherein the aminopeptidase variant has extended substrate specificity in P1′ position to include Asn, Leu, Ile, Phe, His, Gln or Trp as well as the amino acids allowed in position P1′ by the wild type.
3. The aminopeptidase variant of claim 3, wherein the residues in positions 168, 206 and/or 233 (of the wild type aminopeptidase) are substituted.
5. The aminopeptidase variant of claim 4, wherein the residue in position 168 is substituted.
6. The aminopeptidase variant of claim 4, wherein the residue in position 206 is substituted.
7. The aminopeptidase variant of claim 4, wherein the residue in position 233 is substituted.
8. The aminopeptidase variant of claim 4, wherein the residues in positions 206 and 233 are substituted.
9. The aminopeptidase variant of claim 4, wherein the residues in positions 168 and 206 are substituted.
10. The aminopeptidase variant of claim 4, wherein the residues in positions 168 and 233 are substituted.
11. The aminopeptidase variant of claim 4, wherein the residues in positions 168, 206, and 233 are substituted.
12. The aminopeptidase variant of claim 4, wherein the variant comprises one or more substitutions with amino acid residues selected from the group consisting of Gly, Ala, Ser, Thr, Asn, and Asp.
4. The aminopeptidase variant of claim 12, wherein the substitution is selected from Gly and Ala.
5. The aminopeptidase variant of claim 13, wherein the substitution is with an Ala residue.
6. The aminopeptidase variant of claim 14, wherein the variant comprises a substitution at position 168 with an Ala residue.
7. The aminopeptidase variant of claim 14, wherein the variant comprises a substitution at position 206 with an Ala residue.
8. The aminopeptidase variant of claim 14, wherein the variant comprises a substitution at position 233 with an Ala residue.
18. The aminopeptidase variant of claim 16, wherein the variant comprises substitutions at positions 206 and 233 with Ala.
19. The aminopeptidase variant of claim 1, wherein the variant comprises SEQ ID NO:3.
20. The aminopeptidase variant of claim 1, wherein the variant comprises SEQ ID NO:5.
21. The aminopeptidase variant of claim 1, wherein the variant comprises SEQ ID NO:7.
22. The aminopeptidase variant of claim 1, wherein the variant comprises SEQ ID NO:9.
23. A method of removing an initiator methionine from a peptide comprising contacting the peptide with an amino peptidase variant according to claim 1 under conditions suitable for the aminopeptidase variant to remove the initiator methionine.
24. The method of claim 23, wherein the peptide is selected from (a) a recombinant interleukin-21 (IL-21); (b) an IL-21 variant; or (c) a derivative of either (a) or (b).
25. The method of claim 23, wherein the peptide is recombinant interleukin-20 (IL-20).
26. The method of claim 23, wherein the peptide is recombinant human growth hormone (hGH).
27. The method of claim 24, wherein the peptide is recombinant human IL-21.
28. A method of purifying a peptide product having a Gln residue in the N-terminus from a first peptide comprising the Gln residue and an initiator Met residue, the method comprising applying Qcyclase to the first peptide and purifying the peptide product obtained thereby based on charge differences.
29. The method of claim 28, wherein the peptide product is purified on a cation exchange column.