US20200166512A1
2020-05-28
16/692,574
2019-11-22
US 11,906,520 B2
2024-02-20
-
-
Brian Gangle | Andrea K McCollum
Pearne & Gordon LLP
2042-03-10
The invention relates to antibodies, which bind a peptide having a sequence selected from SEQ ID NO: 2, or a fragment or derivative of such an antibody having essentially the same antigen specificity. In particular, the antibodies suited to be used to detect, manage or monitor cancer in a subject, particularly cancer with IL4I1-expressing cells. The invention also relates to kits or devices containing said antibodies, suitable for immunologic detection or reaction from any biological sample.
Get notified when new applications in this technology area are published.
C07K16/247 » CPC further
Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against cytokines, lymphokines or interferons; Interleukins [IL] IL-4
G01N33/57484 » CPC main
Investigating or analysing materials by specific methods not covered by groups -; Biological material, e.g. blood, urine ; Haemocytometers; Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing; Immunoassay; Biospecific binding assay; Materials therefor for cancer involving compounds serving as markers for tumor, cancer, neoplasia, e.g. cellular determinants, receptors, heat shock/stress proteins, A-protein, oligosaccharides, metabolites
C07K2317/565 » CPC further
Immunoglobulins specific features characterized by immunoglobulin fragments variable (Fv) region, i.e. VH and/or VL Complementarity determining region [CDR]
G01N33/574 IPC
Investigating or analysing materials by specific methods not covered by groups -; Biological material, e.g. blood, urine ; Haemocytometers; Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing; Immunoassay; Biospecific binding assay; Materials therefor for cancer
C07K16/24 IPC
Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against cytokines, lymphokines or interferons
The material in the ASCII text file, named âAPIC-61083-Sequence-Listing_ST25.txtâ, created Nov. 21, 2019, file size of 16,384 bytes, is hereby incorporated by reference.
The present invention relates to the field of medicine, in particular of oncology. Especially, the invention relates to compositions and methods for detecting, managing, monitoring, imaging, diagnosis of various cancers, as well as for drug development. The present invention is particularly suited for detecting, managing or monitoring cancer with IL4I1-expressing cells.
L-amino acid oxidases (LAAOs) are flavin adenine dinucleotide-dependent enzymes present in all major kingdom of life, from bacteria to mammals. They participate in defense mechanisms by limiting the growth of most bacteria and parasites. A few mammalian LAAOs have been described, of which the enzyme âinterleukin-4 induced gene 1â (IL4I1) is the best characterized. The secreted IL4I1 (interleukin-4-induced gene 1) enzyme catabolizes L-phenylalanine and to a lesser extent arginine to generate hydrogen peroxide (H2O2), ammonia (NH3) and the corresponding a-keto acid. (Castellano and Molinier-Frenkel. 2017)
In most cancer patients, IL4I1 is expressed either by tumor cells themselves (e.g., some B cell lymphoma subsets, mesothelioma or ovarian cancer) or by tumor-associated macrophages (TAM) or dendritic cells (DC) (Carbonnelle-Puscian et al. 2009). It is a secreted enzyme physiologically produced by antigen presenting cells (APC) of the myeloid and B cell lineages and T helper type (Th) 17 cells. Important roles of IL4I1 in the fine control of the adaptive immune response in mice and humans have emerged during the last few years. Indeed, IL4I1 inhibits T cell proliferation and cytokine production and facilitates naive CD4+ T-cell differentiation into regulatory T cells in vitro by limiting the capacity of T lymphocytes to respond to clonal receptor stimulation. It also plays a role in controlling the germinal center reaction for antibody production and limits Th1 and Th17 responses. No routinely used diagnostic method currently allows to discriminate between IL4I1-expressing and non-expressing cancers. Commercially available antibodies that recognize IL4I1 are poorly characterized polyclonal rabbit antibodies that lack sensitivity and specificity. Quantification of IL4I1 expression in cancer patients could be useful in the prognosis evaluation, since the enzyme facilitates tumor growth by inhibiting the anti-tumor T-cell response. Furthermore, due to these immunosuppressive properties IL4I1 represents a new potential druggable target in the field of immunomodulation in cancer. Accordingly, there is a need for tools which can be associated with drug development.
In that context, it was notably disclosed methods for determining the prognosis or the responsiveness of a subject suffering from cancer and agents with IL4I1 inhibitory activity in WO2010/066858, including antibody against IL4I1 or a fragment thereof which binds IL4I1 and wherein said antibody against IL4I1 or fragment thereof inhibits IL4I1 enzymatic activity. However, the antibody used was a polyclonal rabbit antibody commercialized by Abcam (reference Ab18524, Cambridge, UK) although it is rather not satisfactory because it needs repeated immunization of the animals and its properties may vary from batch to batch due to variability in the immune response of the animals. Moreover, its sensitivity and specificity were limited due to its polyclonal nature, thus limiting its use in the detection, the management, the monitoring, the imaging or as diagnostics tool. The antibodies developed by the inventors are clonal and validation of their recognition properties has shown that they are highly specific and sensitive.
Further, many antibodies against IL4I1 are disclosed in the background art (see Table 1 below). Antibodies described below have been obtained using various immunogens, including the whole protein and N-terminal and C-terminal peptides, some of which are not clearly defined in the available description (see Table 1).
| TABLEâ1 |
| AntibodiesâagainstâIL4I1âcommerciallyâavailable. |
| Species | ||||||
| Company | Type | Reactivity | Technique | Validation | Antibody | TargetâRegion |
| Abcam | Rabbit | human | WB,âIHC,âIF | IFâonâHela, | Ab18524 | Syntheticâpeptide |
| polyclonal | WBâon | residuesâ350-450âof | ||||
| testis | HumanâIL4I1. | |||||
| Biomatik | Rabbit | Human, | ELISA,âWB, | Noâdata | CAC07670 | Noâdata |
| polyclonal | mouse | IHC,âIF | ||||
| Aviva/Invitrogen/ | Rabbit | Human | WB | WB | ARP65454_P050 | C-terminal |
| Origene | polyclonal | Human | PHGWVETAVKSALRAAI | |||
| Hela | KINSRKGPASDTASPEGH | |||||
| (transfected! | ASDMEGQGHVHGVAS | |||||
| (SEQâIDâNO:â1 | ||||||
| (residuesâ486-535)) | ||||||
| Aviva/Abclonal | Rabbit | Human, | WB | WB, | OAAN02717 | Recombinantâ(whole!) |
| tech/Gentex/St | polyclonal | mouse,ârat | cellâlines, | humanâprotein | ||
| John's | rat,âmouse | |||||
| Laboratory/ | testis | |||||
| Raybiotech | ||||||
| Aviva | Rabbit | Human | WB,âELISA | Noâdata | OASG03841 | N-terminalâregion |
| polyclonal | peptideâ(noâprecision) | |||||
| Aviva | Rabbit | Human, | ELISA,âWB, | IHCâhu | OACA09657 | Recombinantâhuman |
| polyclonal | mouse | IHC,âIF | prostate | proteinâ(139-339AA) | ||
| cancer, | ||||||
| WBâmouse | ||||||
| stomach | ||||||
| tissue | ||||||
| ProSci,âInc/NSJ | Rabbit | Human | WB | Western | 61-234 | KLHâconjugated |
| Bioreagent/United | polyclonal | BlotâHela | syntheticâpeptide | |||
| States | andâHT- | betweenâ391-422 | ||||
| Biological | 1080 | aminoâacidsâfromâhu | ||||
| wholeâcell | IL4I1 | |||||
| lysates | ||||||
| MyBioSource.com/ | Rabbit | Human | WB,âELISA | WBâHela | MBS853867 | Synthesizedâpeptide |
| Biobyt/lnvitrogen/ | polyclonal | (EIA) | without | fromâN-terminal | ||
| Origene | precisions | humanâIL4I1 | ||||
| Biobyt | Rabbit | Human, | WBâIHC-P, | IHCârat | orb100203 | KLHâconjugated |
| polyclonal | Mouse, | P-ELISA | kidney,ârat | syntheticâpeptide | ||
| Rat | spleen,âWB | derivedâbetweenâ61- | ||||
| mouse | 150âaminoâacidsâof | |||||
| kidney. | humanâIL4I1 | |||||
| Abbexa | Rabbit | Human, | WB | Noâdata | abx006138 | Noâdata |
| polyclonal | Mouse, | |||||
| Rat | ||||||
| Biossâantibodies | Rabbit | Human, | WB,âIHC-P, | WB: | bs-6841R | KLHâconjugated |
| polyclonal | Mouse, | IF(IHC-P) | spleen | syntheticâpeptide | ||
| Rat | (negative), | derivedâfromâhuman | ||||
| kidney | IL-4I1â(Rangeâ50- | |||||
| (positive)! | 100/567) | |||||
| IHCârat | ||||||
| kidney | ||||||
As listed in Table 1, the activities of these commercially available antibodies are poorly characterized, sometimes the data are even contradictory with known data of IL4I1 expression, indicating that they have not been validated and might be unspecific and/or not sensitive.
Thus, these antibodies are not satisfactory enough to be used in the detection, the management, the monitoring, the imaging or in diagnostic tools.
Therefore, there is a need for more effective sensitivity and specificity for detecting, managing, monitoring, imaging, diagnosis of various cancers, as well as for drug development, especially in the diagnosis of cancer with IL4I1 (Interleukin 4 Induced gene 1) expressing cells, which are present in a large set of human cancers.
The inventors surprisingly found that the antibodies which bind the specific region 365-381 (SEQ ID NO:2) in IL4I1 protein improved significantly the results compared to antibodies disclosed until now.
| TABLEâ2 |
| SequenceâofâIL4I1âproteinâWildâType. |
| (SEQâIDâNO:â1) |
| MAPLALHLLVLVPILLSLVASQDWKAERSQDPFEKCMQDPDYEQLLKVVTVVGLNRTLKPQRVIVVGAGVAGLVAAKVL |
| SDAGHKVTILEADNRIGGRIFTYRDQNTGWIGELGAMRMPSSHRILHKLCQGLGLNLTKFTQYDKNTWTEVHEVKLRN |
| YVVEKVPEKLGYALRPQEKGHSPEDIYQMALNQALKDLKALGCRKAMKKFERHTLLEYLLGEGNLSRPAVQLLGDVMSE |
| DGFFYLSFAEALRAHSCLSDRLQYSRIVGGWDLLPRALLSSLSGLVLLNAPVVAMTQGPHDVHVQIETSPPARNLKVLKA |
| DVVLLTASGPAVKRITFSPPLPRHMQEALRRLHYVPATKVFLSFRRPFWREEHIEGGHSNTDRPSRMIFYPPPREGALLLA |
| SYTWSDAAAAFAGLSREEALRLALDDVAALHGPVVRQLWDGTGVVKRWAEDQHSQGGFVVQPPALWQTEKDDWT |
| VPYGRIYFAGEHTAYPHGWVETAVKSALRAAIKINSRKGPASDTASPEGHASDMEGQGHVHGVASSPSHDLAKEEGSH |
| PPVQGQLSLQNTTHTRTSH |
In a first aspect, the invention relates to particular antibodies, which bind a peptide having a sequence selected from SEQ ID NO: 2 (REEHIEGGHSNTDRPSR), or a fragment or derivative of such an antibody having essentially the same antigen specificity.
The antibodies, either alone or in combination, can be used to detect, manage or monitor cancer in a subject, particularly cancer with IL4I1-expressing cells. The invention also relates to kits or devices containing said antibodies, suitable for immunologic detection or reaction from any biological sample.
Further, the invention relates to hybridoma cells producing said antibodies and method of production thereof.
In a second aspect, the invention relates to a method for detecting, monitoring, managing, imaging or diagnosing a cancer in a subject, wherein the cancer to be treated displays IL4I1-expressing cells and the subject displays an IL4I1-positive status. The invention also relates to a method for determining the chances of a patient suffering from IL4I1-positive cancer, to respond to a treatment comprising the administration of an IL4I1 inhibitor.
The invention is particularly suited to detect cancers with IL4I1-expressing cells.
FIG. 1. The major step of the monoclonal antibody process.
FIGS. 2A through 2L. Immunohistochemistry on human samples. A reactive lymph node (FIGS. 2A, 2B, 2E, 2F), untransfected HEK293 cells (FIGS. 2C, 2G) and HEK293 transfected with human-IL4I1 cDNA (FIGS. 2D, 2H) or IL4I1 KO mouse spleens (FIGS. 2I, 2J) or WT mouse spleens (FIGS. 2K, 2L) were stained with the anti-IL4I1 antibody, clone A-3 (FIGS. 2A, 2B, 2C, 2D, 2I, 2K) at a dilution of 1.5 ÎŒg/mL or with clone D-5 (FIGS. 2E, 2F, 2G, 2H, 2J, 2L) at a dilution of 470 ng/mL. Specific IL4I1 staining was followed by amplification with anti-rabbit HRP antibody and revelation with the ENVision HRP system. IL4I1 labeling appears as brown dots as indicated by black arrows. FIGS. 2A, 2C, 2F, 2G are at 20Ă magnification, while FIGS. 2B, 2D, 2E, 2H, 2I, 2J, 2K, 2L are at 40Ă magnification.
FIGS. 3A through 3B. Western blot (WB) and immunoprecipitation (IP). FIG. 3A: WB on medium and cell lysates. Medium (Lane 1) or cell lysates from HEK293 cells transfected with a vector expressing human myc-tagged IL4I1 after tetracycline induction for 48 h (Lane 2) or HEK293 cells transfected with an empty vector (Lane 3) were separated on a 10% SDS-PAGE and blotted onto PVDF. Blots were revealed with anti-IL4I1 hybridoma supernatant from clone A-3 (left) and clone D-5 (right) followed by anti-rabbit-HRP antibody and ECL. Images were taken using the Autochemi imager (UVP, UK) using the Labworks software. FIG. 3B: IL4I1 IP using hybridoma clone D-5. HEK293 cells transfected with a vector expressing human myc-tagged IL4I1 after tetracycline induction, or empty vector controls were lysed and immunoprecipitated with the hybridoma supernatant of clone D-5, followed by protein A/G agarose separation. Immunoprecipitates and initial lysates (inputs) were separated on a 10% SDS-PAGE and blotted onto PVDF. Blots were revealed with an anti-myc antibody (clone 9E10).
FIG. 4. IL4I1 detection by single layer ELISA. Human (hIL4I1) and mouse (mIL4I1) IL4I1 recombinant proteins were absorbed on 96 well plates and revealed using clone A-3 hybridoma supernatant or clone D-5 hybridoma supernatant (dilution 1:6), followed by amplification with anti-rabbit HRP antibody and revelation with a fluorometric substrate.
FIG. 5. IL4I1 detection by sandwich ELISA. Anti-IL4I1 hen capture antibody (produced by the inventors) was adsorbed on 96 well plates. Conditioned media containing human recombinant IL4I1 serially diluted in PBS were added. Specific fixation of IL4I1 was revealed with either purified IgG from clone A-3 or clone D-5, followed by fluorometric detection as in FIG. 4. Values are the mean of quadruplicate values±SD FIGS. 6A through 6C. IL4I1 detection by flow cytometry. FIGS. 6A and 6B: THP1 cells and recombinant THP1 cells stably transfected with an IL4I1 coding vector were permeabilized before incubation with increasing doses of purified IgG from clone D-5 (A) or A-3 (B) or a fixed dose of rabbit IgG (isotype control), followed by revelation with an anti-rabbit conjugated with Alexafluor 488. FIG. 6C: Mouse splenocytes were incubated with increasing doses of purified IgG from clone D-5 or a fixed dose of rabbit IgG (isotype control), followed by revelation with an anti-rabbit conjugated with Alexafluor 488. Data were acquired on a Cyan flow cytometer (Dako) and analyzed using the FlowJo software.
As intended herein, the term âcomprisingâ has the meaning of âincludingâ or âcontainingâ, which means that when an object âcomprisesâ one or several elements, other elements than those mentioned may also be included in the object. In contrast, when an object is said to âconsist ofâ one or several elements, the object cannot include other elements than those mentioned.
The term âIL4I1â refers to Interleukin 4-induced gene 1 and encodes a protein with high homology to L-amino acid oxidase which contains the conserved amino acids thought to be involved in catalysis and binding of flavin adenine dinucleotide (FAD) cofactor. IL4I1 is also known as âFIG. 1â and was initially isolated in a screen for IL4-induced genes from mouse B cells using cDNA representational difference analysis. This protein corresponds to isoform 1, whose expression is restricted to lymphoid tissues. A second isoform was described in rare cells of nervous tissue (e.g., Purkinje cells) and of the testis (Sertoli cells) and three other isoforms have been referenced in databases. All these isoforms differ in the first exons encoding their respective signal peptides that should be cleaved at homologous positions in the proteins. Consequently, the five proteins should have identical sequences once processed. IL4I1 (isoform 1) has been detected in several cells of the immune system depending on the inducing stimuli. Apart from B cells, IL4I1 can be expressed by monocytes, macrophages, dendritic cells (DC) and T cells. IL4I1 can also be occasionally expressed by neoplastic B cells and non-lymphoid tumor cells. IL4I1 may play an important immunosuppressive role in several human conditions, including cancer, as it has been shown to regulate T-cell and B-cell properties both in vitro and in vivo. The term âanti-IL4I1â refers to an antibody directed against IL4I1.
According to the present invention, âantibodyâ or âimmunoglobulinâ have the same meaning and will be used equally in the present invention. The term âantibodyâ as used herein refers to immunoglobulin molecules and immunologically active portions of immunoglobulin molecules, i.e., molecules that contain an antigen binding site that immunospecifically binds an antigen. As such, the term antibody encompasses not only whole antibody molecules, but also antibody fragments as well as variants (including derivatives) of antibodies and antibody fragments.
In the basal structure of most mammalian antibodies, including rabbit antibodies, two heavy chains are linked to each other by disulfide bonds and each heavy chain is linked to a light chain by a disulfide bond. Humans and mice have five antibody isotypes (IgA, IgD, IgE, IgG, and IgM) which determine the functional activity of an antibody molecule. So far, four isotypes have been identified (IgA, IgE, IgG, and IgM) in rabbits. There are two types of light chain, lambda (A) and kappa (Îș) in humans. Moreover, rabbits have two K light chain types K1 and K2. Most of rabbit research antibodies are of IgG isotype. Each chain contains distinct sequence domains. The light chain includes two domains, a variable domain (VL) and a constant domain (CL). The IgG heavy chain includes four domains, a variable domain (VH) and three constant domains (CH1, CH2 and CH3, collectively referred to as CH). The variable regions of both light (VL) and heavy (VH) chains determine binding recognition and specificity to the antigen. The constant region domains of the light (CL) and heavy (CH) chains confer important biological properties such as antibody chain association, secretion, trans-placental mobility, complement binding, and binding to Fc receptors (FcR). The Fv fragment is the N-terminal part of the Fab fragment of an immunoglobulin and consists of the variable portions of one light chain and one heavy chain. The specificity of the antibody resides in the structural complementarity between the antibody combining site and the antigenic determinant (epitope). Antibody combining sites are made up of residues that are primarily from the hypervariable or complementarity determining regions (CDRs). Occasionally, residues from no hypervariable or framework regions (FR) influence the overall domain structure and hence the combining site. Complementarity Determining Regions or CDRs refer to amino acid sequences which together define the binding affinity and specificity of the natural Fv region of a native immunoglobulin binding site. The light and heavy chains of an immunoglobulin each has three CDRs, designated L-CDR1, L-CDR2, LCDR3 and H-CDR1, H-CDR2, H-CDR3, respectively. An antigen-binding site, therefore, includes six CDRs, comprising the CDR set from each of a heavy and a light chain V region. Framework Regions (FRs) refer to amino acid sequences interposed between CDRs.
The term âchimeric antibodyâ refers to an antibody which comprises a VH domain and a VL domain of an anti-IL4I1 antibody, and a CH domain and a CL domain of a human antibody. According to the invention, the term âhumanized antibodyâ refers to an antibody having variable region framework and constant regions from a human antibody but retains the CDRs of an anti-IL4I1 antibody. The term âFabâ denotes an antibody fragment having a molecular weight of about 50,000 Da and antigen binding activity, in which about a half of the N-terminal side of H chain and the entire L chain, among fragments obtained by treating IgG with a protease, papain, are bound together through a disulfide bond. The term âF(abâČ)2â refers to an antibody fragment having a molecular weight of about 100,000 Da and antigen binding activity, which is slightly larger than the Fab bound via a disulfide bond of the hinge region, among fragments obtained by treating IgG with a protease, pepsin. The term âFabâČâ refers to an antibody fragment having a molecular weight of about 50,000 Da and antigen binding activity, which is obtained by cutting a disulfide bond of the hinge region of the F(abâČ)2. A single chain Fv (âscFvâ) polypeptide is a covalently linked VH::VL heterodimer which is usually expressed from a gene fusion including VH and VL encoding genes linked by a peptide-encoding linker. âdsFvâ is a VH::VL heterodimer stabilized by a disulfide bond. Divalent and multivalent antibody fragments can form either spontaneously by association of monovalent scFvs, or can be generated by coupling monovalent scFvs by a peptide linker, such as divalent sc(Fv)2. The term âdiabodiesâ refers to small antibody fragments with two antigen-binding sites, which fragments comprise a heavy chain variable domain (VH) connected to a light chain variable domain (VL) in the same polypeptide chain (VH-VL). By using a linker that is too short to allow pairing between the two domains on the same chain, the domains are forced to pair with the complementary domains of another chain and create two antigen-binding sites.
By âpurifiedâ and âisolatedâ it is meant, when referring to an antibody according to the invention or to a nucleotide sequence, that the indicated molecule is present in the substantial absence of other biological macromolecules of the same type. The term âpurifiedâ as used herein preferably means at least 75% by weight, more preferably at least 85% by weight, more preferably still at least 95% by weight, and most preferably at least 98% by weight, of biological macromolecules of the same type are present. An âisolatedâ nucleic acid molecule which encodes a particular polypeptide refers to a nucleic acid molecule which is substantially free of other nucleic acid molecules that do not encode the polypeptide; however, the molecule may include some additional bases or moieties which do not deleteriously affect the basic characteristics of the composition.
According to the invention, the terms âsubjectâ, âindividualâ, and âpatientâ are used interchangeably herein and refer to a mammal affected or likely to be affected with disease associated with overexpression of IL4I1 being, more precisely a mammal suffering from cancer associated with overexpression of IL4I1. Subjects are preferably humans.
The present invention provides isolated anti-IL4I1 antibodies or fragments thereof. These antibodies are specific to the amino acid sequence REEHIEGGHSNTDRPSR (SEQ ID NO: 2). Furthermore, Inventors have found that these new antibodies are particularly suitable for detecting IL4I1, especially when compared to the antibodies of the art. According to the first aspect of the invention, the antibodies bind a peptide having the amino acid sequence REEHIEGGHSNTDRPSR (SEQ ID NO: 2), or a fragment or derivative of such an antibody having essentially the same antigen specificity.
Alternately, the present invention relates to an antibody, fragment or derivative, which binds a polypeptide comprising the peptide sequence REEHIEGGHSNTDRPSR (SEQ ID NO: 2).
Unexpectedly, the inventors found that an antibody binding a peptide which is not a peptide located in the FAD binding Region of IL4I1 protein is beneficial to provide an anti-IL4I1 antibody for detecting, managing, monitoring, imaging, diagnosis of various cancers, as well as for drug development.
It is well-known that the LAAO-similar portion conserves key domains and residues that bind the flavin adenine dinucleotide (FAD) cofactor and is required for its enzymatic activity, as well as residues in the active site of the LAAO crystal structure.
Naturally, though specific to a peptide of SEQ ID NO: 2, it is well-known that antibodies can bind peptides with almost same sequence or structural features. Accordingly, antibodies of the invention are also able to bind peptides showing sufficient similarities with SEQ ID NO: 2. Also, the invention relates to antibodies that bind a peptide having similarities with the human IL4I1 sequence REEHIEGGHSNTDRPSR (SEQ ID NO: 2), such as the corresponding mouse IL4I1 sequence which differs of one amino acid in the first position HEEHIEGGHSNTDRPSR (SEQ ID NO: 17) but have conserved the same antigen specificity.
Accordingly, the invention also provides an antibody that binds a peptide having at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98% or at least 99% identity with sequence set forth as SEQ ID NO:2. More preferably, a peptide having at least 90%, at least 95%, at least 96%, at least 97%, at least 98% or at least 99% identity with sequence set forth as SEQ ID NO:2.
Accordingly, the invention also provides an antibody that binds a peptide having at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98% or at least 99% identity with sequence set forth as SEQ ID NO:17. More preferably, a peptide having at least 90%, at least 95%, at least 96%, at least 97%, at least 98% or at least 99% identity with sequence set forth as SEQ ID NO:17.
| TABLEâ3 |
| Sequenceâofâimmunogenicâpeptide. |
| Human | REEHIEGGHSNTDRPSRâ(SEQâIDâNO:â2) | |
| immunogenic | ||
| peptide | ||
| Mouse | HEEHIEGGHSNTDRPSRâ(SEQâIDâNO:â17) | |
| immunogenic | ||
| peptide |
Contrary to the teachings of the previous art, the inventors have raised a rabbit monoclonal anti-IL4I1 antibody not binding in the FAD Region. The inventors have cloned and characterized the variable domain of both the light and heavy chains, and thus determined the complementary determining regions (CDRs) domains of said antibody as described in Table 1 and Table 2 below.
| TABLEâ4 |
| Proteinâsequenceâcodingâtheâvariableâdomainâofâtheâlightâandâheavy |
| chainâ(VLâandâVH)âofâcloneâD-5. |
| anti-IL4I1 | |
| antibodyâD-5 | |
| IgG/λ:âDomains | ProteinâSequence |
| VL | ELVLTQSPSVSAALGASAKLTCTLSSAHSTYTIEWYQQQPGESPRYLMQLKSDGS |
| YTKGTGVPDRFSGSSSGADRYLIIFSVQADDEADYYCGANYSSGYVFGGGTQLTV | |
| Tâ(SEQâIDâNO:â3) | |
| LâCDR1 | SAHSTYTâ(SEQâIDâNO:â5) |
| LâCDR2 | LKSDGSYâ(SEQâIDâNO:â6) |
| LâCDR3 | GANYSSGYVâ(SEQâIDâNO:â7) |
| VH | QQQLVESGGDLVKPEGSLTLTCTASGFSLSAGYFICWIRQAPGKGLEWIGSVFSG |
| SSGTTYYASWAKGRFTISKTSSTTVTLQMTSLTAADTAIYFCARGGVLGGRVAYD | |
| NSFDHWGPGTLVTVSSâ(SEQâIDâNO:â4) | |
| HâCDR1 | GFSLSAGYFâ(SEQâIDâNO:â8) |
| HâCDR2 | VFSGSSGTTâ(SEQâIDâNO:â9) |
| HâCDR3 | ARGGVLGGRVAYDNSFDHâ(SEQâIDâNO:â10) |
| TABLEâ5 |
| Nucleotideâsequenceâcodingâtheâvariableâdomainâofâtheâlightâand |
| heavyâchainâ(VLâandâVH)âofâcloneâD-5. |
| anti-IL4I1 | |
| antibodyâD-5 | |
| IgG/λ:âDomains | NucleotideâSequence |
| VL | GAGCTCGTGCTGACTCAGTCGCCCTCTGTGTCTGCCGCCCTGGGAGCCTCTGCC |
| AAGCTCACCTGCACCCTGAGCAGTGCCCACAGCACCTACACCATTGAATGGTA | |
| TCAGCAGCAGCCAGGGGAGTCCCCTCGGTACCTGATGCAGCTTAAGAGTGAT | |
| GGAAGCTACACTAAGGGGACCGGGGTCCCTGATCGCTTCTCGGGCTCCAGCTC | |
| TGGGGCTGACCGCTACTTGATCATCTTCAGCGTCCAGGCTGATGACGAAGCCG | |
| ACTACTATTGTGGTGCAAATTATAGTAGTGGATATGTGTTCGGCGGAGGGACC | |
| CAGCTGACCGTCACAâ(SEQâIDâNO:â11) | |
| VH | CAGCAGCAGCTGGTGGAGTCCGGGGGAGACCTGGTCAAGCCTGAGGGATCCC |
| TGACACTCACCTGCACAGCCTCTGGATTCTCCTTAAGTGCCGGCTACTTCATAT | |
| GCTGGATCCGCCAGGCTCCAGGGAAGGGGCTGGAGTGGATCGGATCCGTTTT | |
| TAGTGGGAGTAGTGGTACCACTTACTACGCGAGCTGGGCGAAAGGCCGATTC | |
| ACCATCTCCAAAACCTCGTCGACCACGGTGACTCTGCAAATGACCAGTCTGACA | |
| GCCGCGGACACGGCCATCTATTTCTGTGCGAGGGGGGGTGTTCTTGGTGGTC | |
| GTGTTGCATATGACAACTCTTTTGATCACTGGGGCCCAGGCACCCTGGTCACC | |
| GTCTCCTCAâ(SEQâIDâNO:â12) | |
| TABLEâ6 |
| Proteinâsequenceâcodingâtheâvariableâdomainâofâtheâlightâandâheavy |
| chainâ(VLâandâVH)âofâcloneâA-3. |
| anti-IL4I1 | ||
| antibodyâA-3 | ||
| IgG/λ:âDomains | ProteinâSequence | |
| VL | ELVLTQSPSVSAALGASAKLTCTLSSAHSTYTIDWYQQQPGESPRYLMQLKSDGT | |
| YTKGTGVPDRFSGSSSGADRYLIIPSVQADDEAGYYCGANYSGGYVFGGGTQLT | ||
| VTRTVAâ(SEQâIDâNO:â13) | ||
| VH | QSLEESGGDLVKPEGSLTLTCTASGFSLSAGYFMCWVRQAPGKGLEWIGSIFSGS | |
| SGSTYYASWAKGRFTISKTSSTTVTLQMTSLTAADTAIYFCARGGVVDGRVAYD | ||
| NSFDHWGPGTLVTVSSâ(SEQâIDâNO:â21) | ||
| LâCDR1 | SAHSTYTâ(SEQâIDâNO:â5) | |
| LâCDR2 | LKSDGTYâ(SEQâIDâNO:â14) | |
| LâCDR3 | GANYSGGYVâ(SEQâIDâNO:â15) | |
| HâCDR1 | GFSLSAGYFâ(SEQâIDâNO:â8) | |
| HâCDR2 | IFSGSSGSTâ(SEQâIDâNO:â18) | |
| HâCDR3 | ARGGVVDGRVAYDNSFDHâ(SEQâIDâNO:â19) | |
| TABLEâ7 |
| Nucleotideâsequenceâcodingâtheâvariableâdomainâofâtheâlightâand |
| heavyâchainâ(VLâandâVH)âofâcloneâA-3. |
| anti-IL4I1 | |
| antibodyâA-3 | |
| IgG/λ:âDomains | NucleotideâSequence |
| VL | GAGCTCGTGCTGACTCAGTCGCCCTCTGTGTCTGCCGCCCTGGGAGCCTCTGCC |
| AAGCTCACCTGCACCCTGAGCAGTGCCCACAGCACCTACACCATTGACTGGTA | |
| TCAGCAGCAGCCAGGGGAGTCCCCTCGGTACCTGATGCAGCTTAAGAGTGAT | |
| GGAACTTACACCAAGGGGACCGGGGTCCCTGATCGCTTCTCGGGCTCCAGCTC | |
| CGGGGCTGACCGCTACTTGATCATCCCCAGCGTCCAGGCTGATGACGAAGCCG | |
| GCTACTATTGTGGTGCAAATTATAGCGGTGGGTATGTGTTCGGCGGAGGGAC | |
| CCAGCTGACCGTCACACGAACTGTGGCTâ(SEQâIDâNO:â16) | |
| VH | CAGTCGTTGGAGGAGTCCGGGGGAGACCTGGTCAAGCCTGAGGGATCCCTGA |
| CACTCACCTGCACAGCCTCTGGATTCTCCTTAAGTGCCGGCTACTTCATGTGCT | |
| GGGTCCGCCAGGCTCCAGGGAAGGGGCTGGAGTGGATCGGATCCATTTTTAG | |
| TGGTAGTAGTGGTAGTACTTACTACGCGAGCTGGGCGAAAGGCCGATTCACC | |
| ATCTCCAAAACCTCGTCGACCACGGTGACTCTGCAAATGACCAGTCTGACAGC | |
| CGCGGACACGGCCATCTATTTCTGTGCGAGGGGGGGTGTTGTTGATGGTCGT | |
| GTTGCATATGACAACTCTTTTGATCACTGGGGCCCAGGCACCCTGGTCACCGTC | |
| TCCTCAâ(SEQâIDâNO:â20) | |
Therefore, the invention relates to a monoclonal antibody having specificity for IL4I1 comprising a light chain wherein the variable domain comprises at least one CDR having a sequence selected from the group consisting of SEQ ID NO:5 for L-CDR1, SEQ ID NO:6 or SEQ ID NO:14 for L-CDR2 and SEQ ID NO:7 or SEQ ID NO:15 for L-CDR3.
The invention also relates to a monoclonal antibody having specificity for IL4I1 comprising a heavy chain wherein the variable domain comprises at least one CDR having a sequence selected from the group consisting of SEQ ID NO:8 for H-CDR1, SEQ ID NO:9 or SEQ ID NO: 18 for H-CDR2 and SEQ ID NO:10 or SEQ ID NO: 19 for H-CDR3.
The monoclonal antibody of the invention, may comprise a light chain wherein the variable domain comprises at least one CDR having a sequence selected from the group consisting of SEQ ID NO:5 for L-CDR1, SEQ ID NO:6 or SEQ ID NO:14 for L-CDR2 and SEQ ID NO:7 or SEQ ID NO:15 for L-CDR3 and a heavy chain wherein the variable domain comprises at least one CDR having a sequence selected from the group consisting of SEQ ID NO:8 for H-CDR1, SEQ ID NO:9 or SEQ ID NO: 18 for H-CDR2 and SEQ ID NO:10 or SEQ ID NO: 19 for H-CDR3.
In particular, the invention provides an anti-IL4I1 monoclonal antibody comprising:
In particular, the invention provides an anti-IL4I1 monoclonal antibody comprising:
In a particular embodiment, the heavy chain variable region (VH) of said antibody has the amino acid sequence set forth as SEQ ID NO:4 and/or the light chain variable region (VL) has the amino acid sequence set forth as SEQ ID NO:3 or SEQ ID NO: 13.
In another particular embodiment, the heavy chain variable region (VH) of said antibody has the amino acid sequence set forth as SEQ ID NO:21 and/or the light chain variable region (VL) has the amino acid sequence set forth as SEQ ID NO:3 or SEQ ID NO:13.
In a more particular embodiment, the heavy chain variable region (VH) of said antibody has the amino acid sequence set forth as SEQ ID NO:4 and the light chain variable region (VL) has the amino acid sequence set forth as SEQ ID NO:3.
In a more particular embodiment, the heavy chain variable region (VH) of said antibody has the amino acid sequence set forth as SEQ ID NO:13 and the light chain variable region (VL) has the amino acid sequence set forth as SEQ ID NO:21.
In another embodiment, the monoclonal antibody of the invention is a chimeric antibody, preferably a chimeric rabbit/human antibody. In particular, said rabbit/human chimeric antibody may comprise the variable domains of anti-IL4I1 antibody as defined above.
In another embodiment, the monoclonal of the invention is a humanized antibody. In particular, in said humanized antibody, the variable domain comprises human acceptor frameworks regions, and optionally human constant domain where present, and non-human donor CDRs, such as rabbit CDRs as defined above.
In another aspect, the invention relates to a polypeptide with the same binding specificity toward IL4I1 than antibodies of the invention, and which comprises a sequence selected from the group consisting of SEQ ID NO: 3, SEQ ID NO:4, SEQ ID NO:5, SEQ ID NO:6, SEQ ID NO:7, SEQ ID NO: 8, SEQ ID NO:9, SEQ ID NO:10, SEQ ID NO:13, SEQ ID NO:14, SEQ ID NO:15, SEQ ID NO:21, SEQ ID NO:18 or SEQ ID NO:19.
In another aspect the invention relates to a nucleic acid sequence comprising a sequence selected from the group consisting of SEQ ID NO:11, SEQ ID NO:12, SEQ ID NO:16 and/or SEQ ID NO:20. In a more particular aspect, the invention relates to an hybridoma comprising a nucleic acid sequence comprising a sequence selected from the group consisting of SEQ ID NO:11, SEQ ID NO:12, SEQ ID NO:16 and/or SEQ ID NO:20. In an even more particular embodiment, the invention relates to an hybridoma comprising a nucleic acid sequence comprising a sequence selected from the group consisting of SEQ ID NO:11 and SEQ ID NO:12 or SEQ ID NO:16 and SEQ ID NO:20.
In a further aspect, the invention relates to an hybridoma comprising a nucleotide sequence encoding antibodies, said hybridoma comprising at least one amino acid sequence coding for a polypeptide of a sequence selected from SEQ ID NO: 3, SEQ ID NO:4, SEQ ID NO:5, SEQ ID NO:6, SEQ ID NO:7; SEQ ID NO: 8; SEQ ID NO:9, SEQ ID NO:10, SEQ ID NO:13, SEQ ID NO:14, SEQ ID NO:15, SEQ ID NO:21, SEQ ID NO:18 and SEQ ID NO:19 or a combination thereof, as disclosed above. In a particular embodiment, said hybridoma comprises at least one nucleotide sequence coding for peptide of SEQ ID NO:13 and for a peptide of SEQ ID NO:21. In another particular embodiment, said hybridoma comprises at least one nucleotide sequence coding for a peptide of SEQ ID NO:3 and for a peptide of SEQ ID NO:4. In another particular embodiment, said hybridoma comprises at least a nucleotide sequence coding for peptides SEQ ID NO:5, SEQ ID NO:6, SEQ ID NO:7, SEQ ID NO: 8, SEQ ID NO:9, and SEQ ID NO:10. In another particular embodiment, said hybridoma comprises at least a nucleotide sequence coding for peptides SEQ ID NO:5, SEQ ID NO:14, SEQ ID NO:15, SEQ ID NO: 8, SEQ ID NO:18, and SEQ ID NO:19.
An object of the invention relates to a hybridoma cell producing an antibody according to the invention. Briefly, hybridoma cell may be produced according to conventional methods, including immunization of an animal and spleen cells to produce hybridomas by fusion with PEC between spleen cells and appropriate cell lines. Appropriate cell lines are well-known in the art.
Alternately, fragment or derivative of antibodies of the present invention may be produced by any technique known in the art, such as, recombinant processes.
In particular the inventors have deposited a rabbit anti-human-IL4I1 antibody (D-5)-producing hybridoma cell at the Collection Nationale de Cultures de Microorganismes (CNCM, Institut Pasteur, 25 rue du Docteur Roux, 75724 Paris Cedex 15, France), in accordance with the terms of Budapest Treaty, on Sep. 26, 2018. The deposited hybridoma has CNCM deposit number 1-5355.
Further, anti-IL4I1 antibodies of the invention may be produced by any technique known in the art, such as, without limitation, any chemical, biological, genetic or enzymatic technique, either alone or in combination.
Knowing the amino acid sequence of the desired sequence, one skilled in the art can readily produce said antibodies, by standard techniques for production of polypeptides. For instance, they can be synthesized using well-known solid phase method, preferably using a commercially available peptide synthesis apparatus (such as that made by Applied Biosystems, Foster City, Calif.) and following the manufacturer's instructions. Alternately, antibodies of the invention can be synthesized by recombinant DNA techniques well-known in the art. For example, antibodies can be obtained as DNA expression products after incorporation of DNA sequences encoding the antibodies into expression vectors and introduction of such vectors into suitable eukaryotic or prokaryotic hosts that will express the desired antibodies, from which they can be later isolated using well-known techniques.
As exposed in the experimental data, the antibodies of the invention have been isolated from hybridoma obtained from animals immunized by peptide of sequence SEQ ID NO:2. Thus, the invention also relates to a method for producing an antibody comprising the use of a peptide having a sequence selected from SEQ ID NO:2 (REEHIEGGHSNTDRPSR).
Accordingly, a further object of the invention relates to a nucleic acid sequence encoding an antibody according to the invention. More particularly the nucleic acid sequence encodes a heavy chain or a light chain of an antibody of the invention. Even more particularly, the nucleic acid sequence encoding a heavy chain comprises SEQ ID NO:12 or SEQ ID NO:20 and the nucleic acid sequence encoding a light chain comprises SEQ ID NO:11 or SEQ ID NO:16.
Typically, said nucleic acid is a DNA or RNA molecule, which may be included in any suitable vector, such as a plasmid, cosmid, episome, artificial chromosome, phage or a viral vector. The terms âvectorâ, âcloning vectorâ and âexpression vectorâ mean the vehicle by which a DNA or RNA sequence (e.g. a foreign gene) can be introduced into a host cell, so as to transform the host and promote expression (e.g. transcription and translation) of the introduced sequence.
So, a further object of the invention relates to a vector comprising a nucleic acid of the invention. Such vectors may comprise regulatory elements, such as a promoter, enhancer, terminator and the like, to cause or direct expression of said antibody upon administration to a subject.
Any expression vector for animal cell can be used, so long as a gene encoding the human antibody C region can be inserted and expressed. Examples of suitable vectors include pAGE107 (Miyaji H et al. 1990), pAGE103 (Mizukami T et al. 1987), pHSG274 (Brady G et al. 1984), pKCR (O'Hare K et al. 1981), pSGI beta d2-4-(Miyaji H et al. 1990) and the like. Other examples of plasmids include replicating plasmids comprising an origin of replication, or integrative plasmids, such as for instance pUC, pcDNA, pBR, and the like. Other examples of viral vector include adenoviral, retroviral, herpes virus and AAV vectors. Such recombinant viruses may be produced by techniques known in the art, such as by transfecting packaging cells or by transient transfection with helper plasmids or viruses. Typical examples of virus packaging cells include PA317 cells, PsiCRIP cells, GPenv+ cells, 293 cells, etc.
Protocols for producing such replication-defective recombinant viruses are techniques commonly known in the art.
A further object of the present invention relates to a host cell which has been transfected, infected or transformed by a nucleic acid and/or a vector according to the invention. The term âtransformationâ means the introduction of a âforeignâ (i.e. extrinsic or extracellular) gene, DNA or RNA sequence to a host cell, so that the host cell will express the introduced gene or sequence to produce a desired substance, typically a protein or enzyme coded by the introduced gene or sequence. A host cell that receives and expresses introduced DNA or RNA has been âtransformedâ. The nucleic acids of the invention may be used to produce an antibody of the invention in a suitable expression system. The term âexpression systemâ means a host cell and compatible vector under suitable conditions, e.g. for the expression of a protein coded for by foreign DNA carried by the vector and introduced to the host cell. Common expression systems include E. coli host cells and plasmid vectors, insect host cells and Baculovirus vectors, and mammalian host cells and vectors.
Other examples of host cells include, without limitation, prokaryotic cells (such as bacteria) and eukaryotic cells (such as yeast cells, mammalian cells, insect cells, plant cells, etc.). Specific examples include E. coli, Kluyveromyces or Saccharomyces yeasts, mammalian cell lines (e.g., Vero cells, CHO cells, 3T3 cells, COS cells, etc.) as well as primary or established mammalian cell cultures (e.g., produced from lymphoblasts, fibroblasts, embryonic cells, epithelial cells, nervous cells, adipocytes, etc.).
The present invention also relates to a method of producing a recombinant host cell expressing an antibody according to the invention, said method comprising the steps of:
In another particular embodiment, the method comprises the steps of:
Antibodies of the invention are suitably separated from the culture medium by conventional immunoglobulin purification procedures such as, for example, protein ASepharose, hydroxylapatite chromatography, gel electrophoresis, dialysis, or affinity chromatography.
In a particular embodiment, the human chimeric antibody of the present invention can be produced by obtaining nucleic sequences encoding VL and VH domains as previously described, constructing a human chimeric antibody expression vector by inserting them into an expression vector for animal cell having genes encoding human antibody CH and human antibody CL, and expressing the coding sequence by introducing the expression vector into an animal cell.
As the CH domain of a human chimeric antibody, it may be any region which belongs to human immunoglobulin, but those of IgG class are suitable and any one of subclasses belonging to IgG class, such as IgG1, IgG2, IgG3 and IgG4, can also be used. Also, as the CL of a human chimeric antibody, it may be any region which belongs to Ig, and those of kappa class or lambda class can be used.
Methods for producing chimeric antibodies involve conventional recombinant DNA and gene transfection techniques are well-known in the art.
The humanized antibody of the present invention may be produced by obtaining nucleic acid sequences encoding CDR domains, as previously described, constructing a humanized antibody expression vector by inserting them into an expression vector for animal cell having genes encoding (i) a heavy chain constant region identical to that of a human antibody and (ii) a light chain constant region identical to that of a human antibody, and expressing the genes by introducing the expression vector into an animal cell.
The humanized antibody expression vector may be either of a type in which a gene encoding an antibody heavy chain and a gene encoding an antibody light chain exists on separate vectors or of a type in which both genes exist on the same vector (tandem type). In respect of easiness of construction of a humanized antibody expression vector, easiness of introduction into animal cells, and balance between the expression levels of antibody H and L chains in animal cells, humanized antibody expression vector of the tandem type is preferred.
Methods for producing humanized antibodies based on conventional recombinant DNA and gene transfection techniques are well-known in the art. Antibodies can be humanized using a variety of techniques known in the art including, for example, CDR-grafting, veneering or resurfacing, and chain shuffling. The general recombinant DNA technology for preparation of such antibodies is also known.
The Fab of the present invention can be obtained by treating an antibody which specifically reacts with IL4I1 with a protease, papain. Also, the Fab can be produced by inserting DNA encoding Fab of the antibody into a vector for prokaryotic expression system, or for eukaryotic expression system, and introducing the vector into a prokaryote or eukaryote (as appropriate) to express the Fab.
The F(abâČ)2 of the present invention can be obtained treating an antibody which specifically reacts with IL4I1 with a protease, pepsin. Also, the F(abâČ)2 can be produced by binding FabâČ described below via a thioether bond or a disulfide bond.
The FabâČ of the present invention can be obtained treating F(abâČ)2 which specifically reacts with IL4I1 with a reducing agent, dithiothreitol. Also, the FabâČ can be produced by inserting DNA encoding FabâČ fragment of the antibody into an expression vector for prokaryote, or an expression vector for eukaryote, and introducing the vector into a prokaryote or eukaryote (as appropriate) to perform its expression.
The scFv of the present invention can be produced by obtaining cDNA encoding the VH and VL domains as previously described, constructing DNA encoding scFv, inserting the DNA into an expression vector for prokaryote, or an expression vector for eukaryote, and then introducing the expression vector into a prokaryote or eukaryote (as appropriate) to express the scFv. To generate a humanized scFv fragment, a well-known technology called CDR grafting may be used, which involves selecting the complementary determining regions (CDRs) from a donor scFv fragment, and grafting them onto a human scFv fragment framework of known three dimensional structure.
Amino acid sequence modification(s) of the antibodies described herein are contemplated. For example, it may be desirable to improve the binding affinity and/or other biological properties of the antibody. It is known that when a humanized antibody is produced by simply grafting only CDRs in VH and VL of an antibody derived from a non-human animal in FRs of the VH and VL of a human antibody, the antigen binding activity is reduced in comparison with that of the original antibody derived from a non-human animal. It is considered that several amino acid residues of the VH and VL of the non-human antibody, not only in CDRs but also in FRs, are directly or indirectly associated with the antigen binding activity. Hence, substitution of these amino acid residues with different amino acid residues derived from FRs of the VH and VL of the human antibody would reduce of the binding activity. In order to resolve the problem, in antibodies grafted with human CDR, attempts have to be made to identify, among amino acid sequences of the FR of the VH and VL of human antibodies, an amino acid residue which is directly associated with binding to the antibody, or which interacts with an amino acid residue of CDR, or which maintains the three-dimensional structure of the antibody and which is directly associated with binding to the antigen. The reduced antigen binding activity could be increased by replacing the identified amino acids with amino acid residues of the original antibody derived from a nonhuman animal.
Modifications and changes may be made in the structure of the antibodies of the present invention, and in the DNA sequences encoding them, and still obtain a functional molecule that encodes an antibody with desirable characteristics.
In making the changes in the amino sequences, the hydropathic index of amino acids may be considered. The importance of the hydropathic amino acid index in conferring interactive biologic function on a protein is generally understood in the art. It is accepted that the relative hydropathic character of the amino acid contributes to the secondary structure of the resultant protein, which in turn defines the interaction of the protein with other molecules, for example, enzymes, substrates, receptors, DNA, antibodies, antigens, and the like. Each amino acid has been assigned a hydropathic index on the basis of their hydrophobicity and charge characteristics these are: isoleucine (+4.5); valine (+4.2); leucine (+3.8); phenylalanine (+2.8); cysteine/cystine (+2.5); methionine (+1.9); alanine (+1.8); glycine (â0.4); threonine (â0.7); serine (â0.8); tryptophane (â0.9); tyrosine (â1.3); proline (â1.6); histidine (â3.2); glutamate (â3.5); glutamine (â3.5); aspartate (â3.5); asparagine (â3.5); lysine (â3.9); and arginine (â4.5).
A further object of the present invention also encompasses function-conservative variants of the antibodies of the present invention.
âFunction-conservative variantsâ are those in which a given amino acid residue in a protein or enzyme has been changed without altering the overall conformation and function of the polypeptide, including, but not limited to, replacement of an amino acid with one having similar properties (such as, for example, polarity, hydrogen bonding potential, acidic, basic, hydrophobic, aromatic, and the like). Amino acids other than those indicated as conserved may differ in a protein so that the percent protein or amino acid sequence similarity between any two proteins of similar function may vary and may be, for example, from 70% to 99% as determined according to an alignment scheme such as by the Cluster Method. A âfunction-conservative variantâ also includes a polypeptide which has at least 60% amino acid identity as determined by BLAST or FASTA algorithms, preferably at least 75%, more preferably at least 80%, more preferably at least 85%, still preferably at least 90%, and even more preferably at least 95%, and which has the same or substantially similar properties or functions as the native or parent protein to which it is compared.
Two amino acid sequences are âsubstantially homologousâ or âsubstantially similarâ when greater than 80%, preferably greater than 85%, preferably greater than 90% of the amino acids are identical, or greater than about 90%, preferably greater than 95%, are similar (functionally identical) over the whole length of the shorter sequence. Preferably, the similar or homologous sequences are identified by alignment using, for example, the GCG (Genetics Computer Group, Program Manual for the GCG Package, Version 7, Madison, Wis.) pileup program, or any of sequence comparison algorithms such as BLAST, FASTA, etc.
For example, certain amino acids may be substituted by other amino acids in a protein structure without appreciable loss of activity. Since the interactive capacity and nature of a protein define the protein's biological functional activity, certain amino acid substitutions can be made in a protein sequence, and, of course, in its DNA encoding sequence, while nevertheless obtaining a protein with like properties. It is thus contemplated that various changes may be made in the antibodies sequences of the invention, or corresponding DNA sequences which encode said antibodies, without appreciable loss of their biological activity.
It is known in the art that certain amino acids may be substituted by other amino acids having a similar hydropathic index or score and still result in a protein with similar biological activity, i.e. still obtain a biological functionally equivalent protein. As outlined above, amino acid substitutions are generally therefore based on the relative similarity of the amino acid side-chain substituents, for example, their hydrophobicity, hydrophilicity, charge, size, and the like. Exemplary substitutions which take various of the foregoing characteristics into consideration are well-known to those of skill in the art and include: arginine and lysine; glutamate and aspartate; serine and threonine; glutamine and asparagine; and valine, leucine and isoleucine.
Accordingly, the invention also provides an antibody comprising a heavy and light chain wherein the variable domain comprises:
More particularly, the invention also provides an antibody comprising a heavy and light chain wherein the variable domain comprises:
Accordingly, the invention also provides an antibody which binds to IL4I1, in particular to the epitope of SEQ ID NO:2. The invention more particularly provides an antibody which binds specifically to the epitope of SEQ ID NO:2.
Said antibodies may be assayed for specific binding by any method known in the art. Many different competitive binding assays can be used for epitope binning. The immunoassays which can be used include, but are not limited to, competitive assay systems using techniques such western blots, radio-immunoassays, ELISA, âsandwichâ immunoassays, immunoprecipitation assays, precipitin assays, gel diffusion precipitin assays, immunoradiometric assays, fluorescent immunoassays, protein A immunoassays, and complement-fixation assays. Such assays are routine and well-known in the art.
In another embodiment, the invention relates to a device comprising at least one antibody according to the invention immobilized on a support.
In a preferred embodiment, the support is a membrane, a slide, a microarray, a chip, a microbead or a quartz prism.
A further object of the invention is a kit comprising a device as defined above and a reagent to perform or detect an immune reaction, particularly an antibody-antigen complex. The kits typically comprise containers for the different reagents and products and may further comprise a support or other device suitable to perform the assay.
The antibodies can be used individually or in combination to measure the level of IL4I1, using any number of detection technologies or platforms such as, without limitation Capture assay, Sandwich assay, Competition assay, Radio-immuno assays, Enzyme labels with substrates that generate colored, fluorescent, chemiluminescent, or electrochemically-active products, Fluorescence, fluorescent polarization, Chemiluminescence, Optical and colorimetric, Electrochemiluminescence, Time-resolved fluorescence, Surface plasmon resonance, Evanescent wave, Multiwell plate (ELISA), Individual assay, Multiplex assay, Latex beadâmultiplex assay, Microarray (Laminar surface)âmultiplex assay, Glass, Ceramic (like Randox), Plate based assays, Strip based assays, dipsticks, Closed systems immunoassays. Preferred assay formats include:
An assay carried out using a single immobilized antibody (multiwall plate, latex bead, microarray, etc.) which captures a specific labeled protein from a biofluid, the detection which is measured using appropriate detection reagents as detailed in the following paragraph.
The antibody is immobilized directly to the support or captured by an affinity reagent such as an anti-mouse IgG antibody coated onto the support. The immobilized antibody is then incubated with any of the above-mentioned body fluids in which the proteins have been labeled with a detection molecule such as biotin, with or without pre-treatment to remove abundant proteins. The labeled protein which is bound by the antibody is detected by the addition of an appropriate detection reagent which binds to the label such as avidin or streptavidin which has been modified to be compatible with one of the detection technologies described in the section âdetection technology.â
The resulting signal provides a quantitative measure of the amount of labeled protein bound by the antibody.
An assay using two antibodies, the first which is immobilized on a support (multiwell plate, latex bead, microarray, etc.) which binds a specific protein from a biofluid, the detection which is measured using a labeled second antibody against the same protein and appropriate detection reagents as detailed in the following paragraph.
The first antibody is immobilized directly to the support or captured by an affinity reagent such as an anti-mouse IgG antibody coated onto the support. The immobilized antibody is then incubated with any of the above-mentioned body fluids, with or without pre-treatment to remove abundant proteins. The antibody/antigen complex is then incubated with a second antibody, made against the same protein, which has been labeled with a detection molecule such as biotin. The bound antibody is detected by the addition of an appropriate detection reagent which binds to the label such as avidin or streptavidin which has been modified to be compatible with one of the detection technologies described in the section âdetection technology.â The resulting signal provides a quantitative measure of the amount of protein bound by the antibody
An assay in which the binding of a labeled tracer protein by a single antibody as described in âcapture assayâ is inhibited by pre-incubation of a biofluid to indirectly quantify the analyte.
The antibody is immobilized directly to the support or captured by an affinity reagent such as an anti-mouse IgG antibody coated onto the support. The immobilized antibody is then incubated with any of the above-mentioned body fluids. The immobilized antibody/antigen complex is then incubated with a labeled tracer consisting of either (1) any of the above mentioned body fluids in which the proteins have been labeled with a detection molecule such as biotin, with or without pre-treatment to remove abundant proteins, or (2) a purified or recombinant protein recognized (bound) by the monoclonal antibody, or (3) a peptide which is recognized (bound) by the monoclonal antibody. The labeled protein or peptide which is bound by the antibody is detected by the addition of an appropriate detection reagent which binds to the label such as avidin or streptavidin which has been modified to be compatible with one of the detection technologies described in the section âdetection technology.â
The level of the specific protein in the unlabeled biofluid is determined as a function of the inhibition of signal.
Preferred Detection Technologies include:
Enzyme labels with substrates that generate colored, fluorescent, chemiluminescent, or electrochemically-active products.
The detection reagent (for example steptavidin or avidin, which binds to biotin) is coupled to an enzyme such as horseradish peroxidase which is capable of catalyzing:
The detection reagent (for example streptavidin or avidin, which binds to biotin) is coupled to a fluorescent tag. Preferred platform Technologies include:
Two or more antibodies are immobilized onto a latex bead between x and y microns
Two or more antibodies are spotted onto an activated laminar surface with a spot diameter between 100 ÎŒm-5 mm (arrays), 2 ÎŒm-100 ÎŒm (microarrays), 10 nm-2 ÎŒm (nano-arrays) The surface can be composed of glass, plastic, ceramic, carbon nanotube lattice etc.
A biocaptor can be constructed using the antibody immobilized on gold nanoparticles. The nanoparticles are deposited on a quartz surface. The vibration frequency of the quartz submitted to electric current is modified by the presence of the nanoparticles. The specific ligation of the IL4I1 protein to the antibody slows down the vibration frequency in proportion to the weight of the bound protein.
A further object of the invention is thus a kit comprising an anti-IL4I1 antibody according to the invention or a device as mentioned above, suitable to be used for detecting the level or presence of IL4I1.
A further object of the invention is thus a kit comprising an anti-IL4I1 antibody according to the invention or a device as mentioned above, suitable to be used for detecting the level or presence of IL4I1. In a particular embodiment, said kit further comprises at least one reagent for performing or detecting an immune reaction, particularly an antibody-antigen complex
The second aspect of the invention relates to an anti-IL4I1 antibody for detecting, managing, monitoring, imaging, diagnosis a cancer disease, especially cancer with IL4I1-expressing cells.
In a particular embodiment, the invention relates to an anti-IL4I1 antibody as described above for detecting, managing, monitoring, imaging, diagnosis a cancer disease, especially cancer with IL4I1-expressing cells.
In a preferred embodiment, antibodies of the invention are particularly suited for use detecting, managing, monitoring, imaging, diagnosis cancer diseases associated with IL4I1-expressing cells including, but not limited to, B-cell lymphoid malignancies, such as follicular lymphoma, Hodgkin lymphoma, primary mediastinal B cell lymphoma, diffuse large B cell lymphoma, marginal zone lymphoma and chronic lymphoid leukemia, ovarian carcinomas, mesotheliomas, colon carcinomas, breast carcinomas, melanomas, glioblastomas and lung carcinomas, preferably displaying IL4I1-expressing cells or any cancer intended to be treated by an immune checkpoint inhibitor (anti-PD-1 or anti-PD-L1 or anti CTLA4). More specifically, such cancer intended to be treated by an immune checkpoint inhibitor is a cancer wherein at least some of the tumor cellsâor immune cells that have infiltrated the tumorâexpress the target of the immune check inhibitor, PD1, PDL1 or CTLA4.
Typically, said diagnostic methods involve use of biological sample obtained from the patient. As used herein the term âbiological sampleâ encompasses a variety of sample types obtained from a subject and can be used in a diagnostic or monitoring assay. Biological samples include but are not limited to blood and other liquid samples of biological origin, solid tissue samples such as a biopsy specimen or tissue cultures or cells derived therefrom, and the progeny thereof. For example, biological samples include cells obtained from a tissue sample collected from an individual suspected of having a cancer disease associated with IL4I1 overexpression, and in a preferred embodiment from B-cell lymphoid malignancies, such as follicular lymphoma, Hodgkin lymphoma, primary mediastinal B cell lymphoma, diffuse large B cell lymphoma, marginal zone lymphoma and chronic lymphoid leukemia, ovarian carcinomas, mesotheliomas, colon carcinomas, breast carcinomas, melanomas, glioblastomas and lung carcinomas. Therefore, biological samples encompass clinical samples, cells in culture, primary cell suspensions, cell supernatants, cell lysates, serum, plasma, biological fluid, and tissue samples.
In another embodiment of the invention, antibodies of the invention are used in histopathological classification or immunostaining of cancers in vitro or ex vivo for detecting, diagnosing, monitoring, managing or imaging cancer with IL4I1-expressing cells.
In a particular embodiment, the invention provides a method for detecting or diagnosing a cancer in a subject, wherein the cancer to be treated displays IL4I1-expressing cells and the subject displays an IL4I1-positive status, the method comprising:
In order to monitor the cancer disease, the method of diagnosing according to the invention may be repeated at different intervals of time, in order to determine if antibody binding to the samples increases or decreases, whereby it is determined if the cancer disease progresses or regresses.
In another embodiment, the invention provides a method for determining the chances of a patient suffering from IL4I1-positive cancer to respond to a treatment comprising the administration of an IL4I1 inhibitor, comprising the following step:
The presence of IL4I1 from a biological sample is determined by techniques which are well-known in the art such as immunohistochemistry, immunohistology, flow cytometry, ELISA and other immunodetection techniques.
As used herein, the âreference sampleâ or âreference valueâ which is used to detect an overexpression of IL4I1 is a biological sample from a subject that does not suffer from cancer with IL4I1-expressing cells. Preferably, it is a biological sample of a healthy subject that has neither antecedent of nor predisposition to cancer with IL4I1-expressing cells. More preferably, it is a biological sample obtained from a subject who has undergone a biopsy revealing that it does not suffer from cancer with IL4I1-expressing cells. More preferably, it is a biological sample obtained from a healthy subject. Alternately, it is a healthy biological sample obtained from a subject suffering from cancer with IL4I1-expressing cells, for example the healthy biological sample is healthy tissue adjacent to the tumor. Determining the presence of IL4I1 of the invention in said reference sample enables to set a âreference valueâ (for quantitative measurements) or âreference statusâ (for qualitative measurements) that are then compared with the actual expression value (amount) or status (level) of the tested subject. It is possible to use, as âreference amountâ or âreference levelâ in the methods of the invention, an average expression amount or level of the same protein which has been measured in several reference samples.
In a particular embodiment, the method for determining the chances of a patient suffering from IL4I1-positive cancer to respond to a treatment comprises the administration of an IL4I1 inhibitor and the presence of IL4I1 is determined by immunohistochemistry, flow cytometry, mass cytometry (CyTOF) and/or soluble immunodetection such as ELISA.
In another embodiment, the method for determining the chances of a patient suffering from IL4I1-positive cancer to respond to a treatment comprising the administration of an IL4I1 inhibitor, wherein the method comprising:
Alternately, the method for determining the chances of a patient suffering from an IL4I1-positive cancer, to respond to a treatment comprising the administration of an IL4I1 inhibitor, said method comprising the following steps:
In each of these embodiments related to the method for determining the chances of a patient suffering from IL4I1-positive cancer to respond to a treatment, said treatment comprising the administration of an IL4I1 inhibitor, the step a. is performed using an antibody according to the invention antibodies which binds specifically to the region of the 365-381 amino acid sequence of IL4I1 (SEQ ID NO: 2) as disclosed above.
In another embodiment the invention also relates to a method of treating a patient suffering from an IL4I1-positive cancer, said method comprising the steps of:
Such inhibitors are known from the skilled in the art, and are notably listed in WO2010/066858, the contents of which are hereby incorporated by reference.
Immune checkpoint inhibitors are also well-known from the skilled in the art and are for example CTLA4 inhibitors, PDL1 inhibitors or PD1 inhibitors. A non-limitative list of such inhibitors comprises for example ipilimumab, nivolumab, pembrolizumab, atezolizumab, avelumab, durvalumab, cemiplimab or pidilizumab.
Further aspects and advantages of the invention will be disclosed in the following examples, which should be considered illustrative.
IL4I1 hybridoma of the invention may be produced by any technique known in the art, particularly by methods disclosed in U.S. Pat. Nos. 5,675,063 and 7,429,487 incorporated by reference herein. Briefly, monoclonal antibodies against IL4I1 were developed by sequential immunization (5 injections) of three rabbits. Rabbits were hyperimmunized with KLH conjugates of immunogens peptides (SEQ ID NO: 2).
Peptide-protein conjugates are used to induce the production of antibodies against peptides. Peptide-protein conjugates of the invention may be produced by any technique known in the art. According to the invention, peptide-protein conjugates are KLH conjugates.
Peptides alone are generally too small to elicit a sufficient immune response, carrier proteins that contain several epitopes are used to stimulate T-helper cells, which subsequently facilitate the induction of the B-cell response. Multiple antigenic peptides (MAPs) are an alternative approach that can be used to raise anti-peptide antibodies. This approach has several advantages over the traditional methodologies including eliminating the conjugation step, which can be time consuming and also result in random product mixtures.
The immune system reacts to the entire peptide-protein conjugate; therefore, some antibodies will always be raised against the peptide, the linker, and the carrier protein. As such, it is important to use a conjugate during immunization that differs from any that might be used in the final assays. For example, without limiting the scope of the invention, KLH conjugates should be used to immunize for antibodies when BSA conjugates are used in the end-point assays. The most commonly used carrier proteins are as follows:
The antigenic peptide used to produce anti-IL4I1 antibodies of the invention, may be produced by any technique known in the art, such as the protocol below.
The antigenic peptide was coupled through a Ahx spacer and a cysteine to KLH for the priming and boosting injections in rabbit. The antigenic peptide coupled to BSA was used for ELISA screening.
Conjugation using cysteine residues.
A subcutaneous injection with 0.3 mg of the conjugate was administered to three rabbits on days 0, and boosts were performed with 0.15 mg of conjugate on days 21, 35, 49 and 63.
On day 0, the pre-immune serum from the rabbits was taken and store frozen as a blank when performing ELISA after immunization. Then, rabbits were primed with 300 ÎŒg of immunogen.
On day 61, animals were bled and antibody response tested by ELISA to verify the specific antibody production against the peptide of interest.
On day 63, a last boost with the conjugated peptide was realized and two weeks after a final bleed was performed to select the better producing rabbit and splenocytes removed and frozen.
After the selection of the better responding rabbit, its splenocytes were thawed and put in culture.
Subsequently, spleen cells from the selected rabbit were fused with rabbit myeloma 240E-W2 cells (property of Epitomics). Cells were cultured in plates with HAT medium for hybridoma selection. After a minimum of 7 days, the supernatants were harvested and screened for IL4I1 binding specificity by direct enzyme-linked immunosorbent assay (ELISA). Later, positive clones were expanded into 24-well plates and a secondary ELISA screen was performed to confirm the positive clones.
Ninety-one clones (hybridomas) were generated and were expanded into 24-well plates. Forty-three of them were selected on the basis of ELISA values as the best antibody producers and were screened by Western blot against HEK293 cells expressing or not recombinant human IL4I1. Sixteen of these were positive and were further tested by immunohistochemistry on human lymphoid tissues (reactive lymph nodes and human lymphomas).
The two best hybridomas were then chosen to be sub-cloned. Ten sub-clones were initially selected by an ELISA screen against the antigenic peptide and a measure of IgG concentration. Subsequently, they were tested for the recognition of the whole human IL4I1 protein by Western blot and immunohistochemistry. Two sub-clones were then chosen and expanded for large scale in vitro production of anti-IL4I1 antibodies.
The hybridoma culture protocol used in the present invention is well-known in the art. For example, hybridoma may be cultivated as below.
Hybridoma Growth Medium (240E media) with 1ĂHAT
Cellgro, cat #: 10-040-CM, RPMI 1640, 1Ă, with L-glutamine
Rabbit Hybridoma Supplement A (contains Gentamycin Sulfate)
2 vials (40 mls each)
55 ÎŒM 2-Mercaptoenthanol cell culture grade 1:1000 (1.24 ml) of 55 mM stock solution (Invitrogen, cat. #21985-023)
You can prepare this medium and store it at 4° C. for a couple of weeks. When taking out of the fridge and opening a new medium bottle please add freshly
1) 1ĂHAT (catalog number: MT-25-046-CI) 25 ml of 50Ă stock solution
2) GlutaMAX-I from GIBCO (Invitrogen), Cat #35050-061 (100Ă, liquid) 12.4 ml (Thaw supplement overnight in refrigerated conditions, 2° C.-8° C. Aseptically add the required volume to culture medium. Store remaining supplement at â5° C. to â20° C. GLUTAMAX supplement can be frozen and thawed repeatedly with no loss of potency.)
The antibodies of the present invention may be produced by any techniques known in the art, such as the protocol below.
Irvine Scientific IS MAB-CD (Cat #91104) supplemented with 1% antibiotic/antimycotic (from Cellgro Cat #30-004-CI: add 10 ml for 1 l medium), and 4% Glutamax (from Gibco Cat. #35050-061: add 40 ml for 1 l medium). DO NOT ADD SUPPLEMENT A.
To harvest the monoclonal antibody:
Healthy Hybridomas (round, shiny and homogeneous, mitotic cells. Some cells may show differential shape).
Formalin-fixed and paraffin-embedded lymphoid tissue and cell pellet sections (3 Όm for all) were stained for IL4I1 using clone A-3 at 1.56 Όg/mL or clone D-5 at 0.45 Όg/mL using an indirect immunoperoxidase method (EnVisionSystem; DakoCytomation) after antigen retrieval with EDTA buffer at pH 8 in a water bath at 98° C. for 30 minutes. Images were captured with a Zeiss Axioskop2 microscope (Zeiss, Oberkochen, Germany) and Neofluar 100/0.1 NA optical lenses (Zeiss). Photographs were taken with a DP70 Olympus camera (Olympus, Tokyo, Japan). Image acquisition was performed with Olympus DP Controller2002.
For single layer ELISA, 50 ΌL of conditioned media from HEK293 cells transfected to produce the recombinant human or mouse IL4I1 or transfected with empty vector were incubated overnight at 37° C. in a 96 well flat bottom plate. After extensive washes with Tris buffer saline solution (pH=7.5) containing 0.1% tween (TBST), plates were saturated with 5% bovine serum albumin (BSA) in TBST. Supernatants (1/6 dilution) from hybridoma clone A and clone D were then added for 2 h at 37° C. After washes with TBST, anti-rabbit-HRP antibodies were added (Sigma, dilution 1/160 000) and revelation was performed with Amplex Red substrate (excitation wavelength 544 nm/emission 590 nm) using an Optima plate reader (BMG Labtech).
For sandwich ELISA, 96 well flat bottom plates were saturated overnight with an anti-IL4I1 antibody (directed to the N-terminal region) produced by the inventors in hen. The next day, after extensive washes with TBST, the conditioned media were added for 2 h at 37° C. After washes with TBST, each clone (A-3 or D-5) was added at a dilution of 1:2000 and the revelation was performed as above.
HEK293 cells transfected with inducible hIL4I1 cDNA or empty vector were treated with tetracyclin for 48 h. After a PBS wash, cells were resuspended in 1Ă Laemmli buffer containing complete MiniÂź protease inhibitors and phosphatase inhibitors (Roche, France) and boiled for 5 min. Proteins were separated by SDS-PAGE and transferred to PVDF membranes. Supernatant for hybridoma clones A and D were used as primary antibodies, followed by anti-rabbit-HRP secondary antibodies. Revelation was performed using Luminata CrescendoÂź from Millipore (Guyancour, France). Images were captured with a CCD camera (Autochemi system, UVP, UK) and Labwork software.
Clone D was tested for its immunoprecipitation capacity of the recombinant human IL4I1 protein. HEK293 cells stably transfected with a vector expressing the human myc-tagged IL4I1 under the tetracycline operator or empty vector controls were used. IL4I1 expression was induced by 1 g/mL of tetracycline. IL4I1-expressing cells and control cells were lysed in a Tris buffer containing 0.1% triton x100 and complete MiniÂź protease inhibitors and phosphatase inhibitors (Roche, France). Lysates (300 ÎŒL) were immunoprecipitated overnight at 4° C. with 6 ÎŒL of the hybridoma supernatant of clone D, followed by 50 ÎŒL protein A/G agarose separation for 2 h at 4° C. After elution in 30 ÎŒL of Laemmli sample buffer, 15 ÎŒL of the immunoprecipitates and 101 ÎŒL of the initial lysates (inputs) were separated on a 10% SDS-PAGE and blotted onto PVDF. Blots were revealed with an anti-myc antibody (clone 9E10 from Sigma, dilution 1:5000) followed by revelation using an anti-mouse conjugated to HRP (from Sigma, dilution 1:80 000) and Luminata CrescendoÂź from Millipore. Images were captured with a CCD camera (Autochemi system, UVP, UK) and Labwork software.
Cells (5Ă106) were permeabilized using the FixPerm kit from eBioscience, according to manufacturer's instructions. Cells were then incubated at 4° C. for 30 minutes with increasing doses of purified IgG from clone D-5 or A-3 diluted in PBS contaning 1% FCS or a 0.05 ÎŒg of rabbit IgG (isotype control). After washing in PBS containg 1% FCS, cells were incubated with a secondary antibody recognizing the rabbit Fc portion coupled to Alexafluor 488 (Molecular Probes). Data were acquired on a Cyan flow cytometer (Dako) and analyzed using the FlowJo software.
The supernatants from the selected hybridomas A and D and/or purified IgG from the selected subclones derived from these hybridomas (A-3 and D-5) have been tested for their capacity to recognize the IL4I1 protein (mouse and/or human) by different techniques (see arrow in FIGS. 2A to 2 L). Both IgG A-3 and D-5 recognize the human IL4I1 enzyme produced by recombinant HEK cells and human lymph nodes after immunohistochemistry (FIG. 2 A to H). They are also able to recognize the murine protein by immunohistochemistry, although the A-3 clone seems to have a higher background (FIG. 2 I to L). Both clones recognize the denatured human IL4I1 protein in WB (FIG. 3A). Only clone D was tested for its ability to immunoprecipitate the human IL4I1 enzyme (FIG. 3B). The two clones have been tested in techniques that maintain the native structure of the protein, i. e. flow cytometry and ELISA (FIGS. 4, 5 & FIGS. 6A to 6C). In single layer ELISA (FIG. 4), both clones strongly recognize the human protein with similar efficiency. The murine protein is much less efficiently recognized, with the D clone slightly more efficient. The detection of the human protein has been also tested in sandwich ELISA using a hen polyclonal capture antibody against the N-terminal part of the protein (FIG. 5). In this assay, the sensitivity was superior with clone A-3 in comparison to clone D-5. Finally, clone A-3 had also a superior sensitivity in the detection of the human protein by flow cytometry (FIGS. 6 A & B). In contrast, the murine protein was only detected by clone D-5, but with poor sensitivity (FIG. 6 C).
| TABLE 8 |
| IL4I1 detection by single layer ELISA. Human (hIL4I1) and |
| mouse (mIL4I1) IL4I1 recombinant proteins were absorbed |
| on 96 well plates and revealed using clone A hybridoma |
| supernatant or clone D hybridoma supernatant (dilution |
| 1:6), followed by amplification with anti-rabbit HRP antibody |
| and revelation with a fluorometric substrate. |
| AB | Control | Human IL4I1 | Mouse IL4I1 |
| Control | 594 | 6737 | 1307 | 40 | 6837 | 24 |
| D | 647 | 653 | 23249 | 23180 | 4144 | 4718 |
| A | 1425 | 664 | 20771 | 20949 | 1219 | 2361 |
| TABLE 9 |
| Efficacy of clones to recognize IL4I1 in Western |
| blot (WB), immunohistochemistry (IHC), flow |
| cytometry (FC) and sandwich ELISA assays. |
| Human | Mouse |
| WB | IHC | FC | ELISA | WB | IHC | FC | ELISA |
| Clone A and/or subclone A-3 |
| ++ | ++ | ++ | ++ | ND | ++ | â | ++ |
| Clone D and/or subclone D-5 |
| ++ | ++ | â | ++ | ND | ++ | + | + |
| (++, validated; +, less sensitive; â, no specific detection; ND, not done). |
The results show that the antibody of the present invention and particularly the subclone AbA-3 works better on native epitopes and work less on mouse samples. The subclone AbD-5 works better on fully or partially denaturated epitopes but also in some native conditions
The two clones and subclones developed in the present invention present capacities that can be used in the detection of IL4I1 expression both in mouse and human samples. The utilization of these clones allows the identification of IL4I1-expressing cells in tissues by immunohistochemistry, the quantification of IL4I1 in biological fluids by ELISA, the numbering of IL4I1-expressing cells by flow cytometry.
Accordingly, their use may be developed in routine testing to diagnose and/or to classify patients according to their IL4I1 expression in tumor samples and/or biological fluids for prognosis or treatment purposes. They also represent good tools for preclinical studies of IL4I1 expression.
1. An isolated antibody specific to SEQ ID NO: 2, or a fragment or derivative of such an antibody having essentially the same antigen specificity.
2. The isolated antibody according to claim 1, comprising a heavy chain and light chain wherein the variable domain comprises:
a. a H-CDR1 having at least 80% or 85% identity with sequence set forth as SEQ ID NO:8,
b. a H-CDR2 having at least 80% or 85% identity with sequence set forth as SEQ ID NO:9, or SEQ ID NO:18
c. a H-CDR3 having at least 80% or 85% identity with sequence set forth as SEQ ID NO:10, or SEQ ID NO:19
d. a L-CDR1 having at least 80% or 85% identity with sequence set forth as SEQ ID NO: 5,
e. a L-CDR2 having at least 80% or 85% identity with sequence set forth as SEQ ID NO:6 or SEQ ID NO:14,
f. a L-CDR3 having at least 80% or 85% identity with sequence set forth as SEQ ID NO:7 or SEQ ID NO:15.
3. The isolated antibody according to claim 2, comprising:
a light chain wherein the variable domain CDR sequences are selected from the group consisting of SEQ ID NO:5 for L-CDR1, SEQ ID NO:6 or SEQ ID NO:14 for L-CDR2 and SEQ ID NO:7 or SEQ ID NO:15 for L-CDR3; and
a heavy chain wherein the variable domain CDR sequences are selected from the group consisting of SEQ ID NO:8 for H-CDR1, SEQ ID NO:9 or SEQ ID NO:18 for H-CDR2 and SEQ ID NO:10 or SEQ ID NO:19 for H-CDR3.
4. The isolated antibody according to claim 2, comprising:
a light chain wherein CDR sequences are selected from the group consisting of SEQ ID NO:5 for L-CDR1, SEQ ID NO:6 for L-CDR2 and SEQ ID NO:7 for L-CDR3; and
a heavy chain wherein the variable domain CDR sequences are selected from the group consisting of SEQ ID NO:8 for H-CDR1, SEQ ID NO:9 for H-CDR2 and SEQ ID NO:10 for H-CDR3.
5. The isolated antibody according to claim 2, comprising:
a light chain wherein CDR sequences are selected from the group consisting of SEQ ID NO:5 for L-CDR1, SEQ ID NO:14 for L-CDR2 and SEQ ID NO:15 for L-CDR3; and
a heavy chain wherein the variable domain CDR sequences are selected from the group consisting of SEQ ID NO:8 for H-CDR1, SEQ ID NO:18 for H-CDR2 and SEQ ID NO:19 for H-CDR3.
6. The isolated antibody according to claim 1, produced from the hybridoma cell available under CNCM deposit number 1-5355.
7. A method for in vitro or ex vivo histopathological classification or immunostaining of cancers comprising detecting a complex formed between the isolated antibody according to claim 1 and IL4I1 protein.
8. A method for producing the isolated antibody according to claim 1, comprising a step of immunizing an animal with peptide of SEQ ID NO: 2 as target antigen.
9. A hybridoma cell adapted to produce the isolated antibody according to claim 1.
10. The hybridoma cell according to claim 9, said hybridoma cell being that available under CNCM deposit number 1-5355.
11. A method for detecting or diagnosing an IL4I1-positive cancer in a subject, comprising the following steps:
a. contacting a sample from said subject with the isolated antibody according to claim 1, and
b. determining the presence or level of an antigen bound to said antibody, said presence or level being indicative of IL4I1 positive status in said subject.
12. A method of cancer treatment in a patient, said method comprising the following steps:
a. contacting a biological sample from said patient with the isolated antibody according to claim 1 to determine the presence or level of IL4I1 in said sample;
b. comparing said IL4I1 presence or level obtained in step a. with a reference value; said presence or level being indicative of IL4I1 positive status; and
c. determining from step b. a probability of said patient responding to IL4I1-positive cancer treatment via the administration of an inhibitor of IL4I1.
13. A method of treating a patient suffering from an IL4I1-positive cancer, said method comprising the steps of:
a. contacting a biological sample from said patient with the isolated antibody according to claim 1 to determine the presence or level of IL4I1 from a biological sample of said patient;
b. comparing IL4I1 presence or level obtained in step a. with a reference value; said presence or level being indicative of IL4I1 positive status;
c. determining from step b. a probability of said patient responding to 11411-positive cancer treatment via the administration of an inhibitor of IL4I1; and
d. administering to said patient an inhibitor of IL4I1 and/or an immune checkpoint inhibitor.
14. The method according to claim 11, wherein said cancer is selected from the group consisting of B-cell lymphoid malignancies, including follicular lymphoma, Hodgkin lymphoma, primary mediastinal B cell lymphoma, diffuse large B cell lymphoma, marginal zone lymphoma and chronic lymphoid leukemia, ovarian carcinomas, mesotheliomas, colon carcinomas, breast carcinomas, melanomas, glioblastomas and lung carcinomas, or any cancer intended to be treated by an immune checkpoint inhibitor.
15. The method according to claim 13, wherein said cancer is selected from the group consisting of B-cell lymphoid malignancies, including follicular lymphoma, Hodgkin lymphoma, primary mediastinal B cell lymphoma, diffuse large B cell lymphoma, marginal zone lymphoma and chronic lymphoid leukemia, ovarian carcinomas, mesotheliomas, colon carcinomas, breast carcinomas, melanomas, glioblastomas and lung carcinomas, or any cancer intended to be treated by an immune checkpoint inhibitor.
16. The method according to claim 11, wherein the presence of IL4I1 is determined by immunohistochemistry, immunohistology, flow cytometry and/or ELISA.
17. A device comprising the isolated antibody according to claim 1 immobilized on a support.
18. A kit comprising: the isolated antibody according to claim 1, or a device comprising said antibody immobilized on a support.
19. The kit according to claim 18 further comprising at least one reagent for performing or detecting an immune reaction.
20. The device of claim 17, wherein the support is a membrane, a slide, a microarray, a chip, a microbead or a quartz prism.