US20200224221A1
2020-07-16
16/487,024
2018-02-22
The present invention relates to the field of genetic engineering. In particular, the present invention relates to a genome editing method with high efficiency and high specificity. More specifically, the present invention relates to a method for increasing the efficiency of site-directed modification of a target sequence in a genome of an organism by a high-specificity Cas9 nuclease variant.
Get notified when new applications in this technology area are published.
C12N15/902 » CPC main
Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor; Recombinant DNA-technology; Introduction of foreign genetic material using processes not otherwise provided for, e.g. co-transformation; Stable introduction of foreign DNA into chromosome using homologous recombination
C12N2310/3519 » CPC further
Structure or type of the nucleic acid; Chemical structure; Nature of the modification; Conjugate Fusion with another nucleic acid
C12N15/8213 » CPC further
Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor; Recombinant DNA-technology; Introduction of foreign genetic material using vectors; Vectors; Use of hosts therefor; Regulation of expression; Vectors or expression systems specially adapted for eukaryotic hosts for plant cells, e.g. plant artificial chromosomes (PACs); Methods for introducing genetic material into plant cells, e.g. DNA, RNA, stable or transient incorporation, tissue culture methods adapted for transformation Targeted insertion of genes into the plant genome by homologous recombination
C12N2310/20 » CPC further
Structure or type of the nucleic acid; Type of nucleic acid involving clustered regularly interspaced short palindromic repeats [CRISPRs]
C12N15/90 IPC
Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor; Recombinant DNA-technology; Introduction of foreign genetic material using processes not otherwise provided for, e.g. co-transformation Stable introduction of foreign DNA into chromosome
C12N9/22 » CPC further
Enzymes; Proenzymes; Compositions thereof ; Processes for preparing, activating, inhibiting, separating or purifying enzymes; Hydrolases (3) acting on ester bonds (3.1) Ribonucleases RNAses, DNAses
C12N15/113 » CPC further
Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor; Recombinant DNA-technology; DNA or RNA fragments; Modified forms thereof Non-coding nucleic acids modulating the expression of genes, e.g. antisense oligonucleotides
C12N15/82 IPC
Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor; Recombinant DNA-technology; Introduction of foreign genetic material using vectors; Vectors; Use of hosts therefor; Regulation of expression; Vectors or expression systems specially adapted for eukaryotic hosts for plant cells, e.g. plant artificial chromosomes (PACs)
This application is a U.S. National Phase of International Patent Application No. PCT/CN2018/076949, filed Feb. 22, 2018, which claims priority to Chinese Patent Application No. 201710089494.9, filed Feb. 20, 2017, both of which applications are herein incorporated by reference in their entireties.
This application contains a Sequence Listing which has been submitted in ASCII format via EFS-Web and is hereby incorporated by reference in its entirety. Said ASCII copy, created on Aug. 19, 2019, is named 245761_000084seqlist.txt, and is 102,206 bytes in size.
The present invention relates to the field of genetic engineering. In particular, the present invention relates to a genome editing method with high efficiency and high specificity. More specifically, the present invention relates to a method for increasing the efficiency of site-directed modification of a target sequence in a genome of an organism by a high-specificity Cas9 nuclease variant.
Clustered regularly interspaced short palindromic repeats and CRISPR associated system (CRISPR/Cas9) is the most popular tool for genome editing. In the system, Cas9 protein cleaves a specific DNA sequence under the guidance of a gRNA to create a double-strand break (DSB). DSB can activate intracellular repair mechanisms of non-homologous end joining (NHEJ) and homologous recombination (HR) to repair DNA damage in cells such that the specific DNA sequence is edited during the repair process. Currently, the most commonly used Cas9 protein is Cas9 derived from Streptococcus pyogenes (SpCas9). One disadvantage of the CRISPR/Cas9 genome editing system is its low specificity and off-target effect, which greatly limit the application thereof.
There remains a need in the art for a method and tool that allow for efficient, high-specific genome editing.
In one aspect, the present invention provides a genome editing system for site-directed modification of a target sequence in the genome of a cell, which comprises at least one selected from the following i) to iii):
i) a Cas9 nuclease variant, and an expression construct comprising a nucleotide sequence encoding a tRNA-guide RNA fusion;
ii) an expression construct comprising a nucleotide sequence encoding a Cas9 nuclease variant, and an expression construct comprising a nucleotide sequence encoding a tRNA-guide RNA fusion; and
iii) an expression construct comprising a nucleotide sequence encoding a Cas9 nuclease variant and a nucleotide sequence encoding a tRNA-guide RNA fusion;
wherein the Cas9 nuclease variant has higher specificity as compared with the wild-type Cas9 nuclease,
wherein the 5′ end of the guide RNA is linked to the 3′ end of the tRNA,
wherein the fusion is cleaved at the 5′ end of the guide RNA after being transcribed in the cell, thereby forming a guide RNA that does not carry extra nucleotide at the 5′ end.
In a second aspect, the present invention provides a genome editing system for site-directed modification of a target sequence in the genome of a cell, which comprises at least one selected from the following i) to iii):
i) a Cas9 nuclease variant, and an expression construct comprising a nucleotide sequence encoding a ribozyme-guide RNA fusion;
ii) an expression construct comprising a nucleotide sequence encoding a Cas9 nuclease variant, and an expression construct comprising a nucleotide sequence encoding a ribozyme-guide RNA fusion; and
iii) an expression construct comprising a nucleotide sequence encoding a Cas9 nuclease variant and a nucleotide sequence encoding a ribozyme-guide RNA fusion;
wherein the Cas9 nuclease variant has higher specificity as compared with the wild-type Cas9 nuclease,
wherein the 5′ end of the guide RNA is linked to the 3′ end of a first ribozyme,
wherein the first ribozyme is designed to cleave the fusion at the 5′ end of the guide RNA, thereby forming a guide RNA that does not carry extra nucleotide at the 5′ end.
In a third aspect, the present invention provides a method for genetically modifying a cell, comprising introducing the genome editing system of the present invention into the cell, whereby the Cas9 nuclease variant is targeted to a target sequence in the genome of the cell by the guide RNA, and results in substitution, deletion and/or addition of one or more nucleotides in the target sequence.
In a fourth aspect, the present invention provides a genetically modified organism, which comprises a genetically modified cell produced by the method of the present invention.
FIGS. 1A and 1B show the strategies for designing sgRNA for target sequences with different 5′ end nucleotides when using U3 or U6. A: by fusion with tRNA, sgRNA can be designed without considering the 5′ end nucleotide of the target sequence; B: precise cleavage of tRNA-sgRNA fusion.
FIG. 2 shows the editing efficiency of WT SpCas9 (wild type SpCas9), eSpCas9(1.0), eSpCas9(1.1), SpCas9-HF1 on targets of class (1).
FIG. 3 shows shows the editing efficiency of WT SpCas9 (wild type SpCas9), eSpCas9(1.0), eSpCas9(1.1), SpCas9-HF1 on targets of class (2).
FIG. 4 shows that the additional nucleotide at 5′ end of sgRNA affects the editing efficiency when U6 promoter is used.
FIGS. 5A and 5B show that for the OsMKK4 locus, tRNA-sgRNA can improve the editing efficiency and maintain high specificity as compared to sgRNA.
FIGS. 6A and 6B show that for the OsCDKB2 locus, the use of tRNA-sgRNA can increase the editing efficiency to the level of wild-type SpCas9, while maintaining high specificity.
FIGS. 7A and 7B show the editing specificity of Cas9 variant for mismatch between gRNA and target sequence. In FIG. 7A, the sequences listed are SEQ ID NOS: 23 and 65-83 in the order shown. In FIG. 7B, the sequences listed are also SEQ ID NOS: 23 and 65-83 in the order shown.
FIG. 8 shows tRNA-sgRNA improved the editing efficiency of eSpCas9(1.1) and SpCas9-HF1 to that of wild-type SpCas9 in human cells.
FIG. 9 shows the sequence structure of pUC57-U3-tRNA-sgRNA vector for tRNA-sgRNA fusion expression.
In the present invention, unless indicated otherwise, the scientific and technological terminologies used herein refer to meanings commonly understood by a person skilled in the art. Also, the terminologies and experimental procedures used herein relating to protein and nucleotide chemistry, molecular biology, cell and tissue cultivation, microbiology, immunology, all belong to terminologies and conventional methods generally used in the art. For example, the standard DNA recombination and molecular cloning technology used herein are well known to a person skilled in the art, and are described in details in the following references: Sambrook, J., Fritsch, E. F. and Maniatis, T., Molecular Cloning: A Laboratory Manual; Cold Spring Harbor Laboratory Press: Cold Spring Harbor, 1989. In the meantime, in order to better understand the present invention, definitions and explanations for the relevant terminologies are provided below.
“Cas9 nuclease” and “Cas9” can be used interchangeably herein, which refer to a RNA directed nuclease, including the Cas9 protein or fragments thereof (such as a protein comprising an active DNA cleavage domain of Cas9 and/or a gRNA binding domain of Cas9). Cas9 is a component of the CRISPR/Cas (clustered regularly interspaced short palindromic repeats and its associated system) genome editing system, which targets and cleaves a DNA target sequence to form a DNA double strand breaks (DSB) under the guidance of a guide RNA.
“guide RNA” and “gRNA” can be used interchangeably herein, which typically are composed of crRNA and tracrRNA molecules forming complexes through partial complement, wherein crRNA comprises a sequence that is sufficiently complementary to a target sequence for hybridization and directs the CRISPR complex (Cas9+crRNA+tracrRNA) to specifically bind to the target sequence. However, it is known in the art that single guide RNA (sgRNA) can be designed, which comprises the characteristics of both crRNA and tracrRNA.
As used herein, the terms “tRNA” and “transfer RNA” are used interchangeably to refer to small molecule RNAs that have the function of carrying and transporting amino acids. The tRNA molecule usually consists of a short chain of about 70-90 nucleotides folded into a clover shape. In eukaryotes, tRNA genes in the genome are transcribed into tRNA precursors, which are then processed into mature tRNA after excision of the 5′ and 3′ additional sequences by RNase P and RNase Z.
As used herein, the term “ribozyme” refers to an RNA molecule that has a catalytic function which participates in the cleavage and processing of RNA by catalyzing the transphosphate and phosphodiester bond hydrolysis reactions.
“Genome” as used herein encompasses not only chromosomal DNA present in the nucleus, but also organelle DNA present in the subcellular components (e.g., mitochondria, plastids) of the cell.
As used herein, “organism” includes any organism that is suitable for genomic editing. Exemplary organisms include, but are not limited to, mammals such as human, mouse, rat, monkey, dog, pig, sheep, cattle, cat; poultry such as chicken, duck, goose; plants including monocots and dicots such as rice, corn, wheat, sorghum, barley, soybean, peanut, Arabidopsis and the like.
“Genetically modified organism” or “genetically modified cell” means an organism or cell that contains an exogenous polynucleotide or modified gene or expression control sequence within its genome. For example, the exogenous polynucleotide is stably integrated into the genome of an organism or cell and inherited for successive generations. The exogenous polynucleotide can be integrated into the genome alone or as part of a recombinant DNA construct. The modified gene or expression control sequence is the sequence in the genome of the organism or cell that comprises single or multiple deoxynucleotide substitutions, deletions and additions.
The term “exogenous” with respect to sequence means a sequence that originates from a foreign species, or, if from the same species, is substantially modified from its native form in composition and/or genomic locus by deliberate human intervention.
“Polynucleotide”, “nucleic acid sequence”, “nucleotide sequence”, or “nucleic acid fragment” are used interchangeably to refer to a polymer of RNA or DNA that is single- or double-stranded, optionally containing synthetic, non-natural or altered nucleotide bases. Nucleotides (usually found in their 5′-monophosphate form) are referred to by their single letter designation as follows: “A” for adenylate or deoxyadenylate (for RNA or DNA, respectively), “C” for cytidylate or deoxycytidylate, “G” for guanylate or deoxyguanylate, “U” for uridylate, “T” for deoxythymidylate, “R” for purines (A or G), “Y” for pyrimidines (C or T), “K” for G or T, “H” for A or C or T, “I” for inosine, and “N” for any nucleotide.
“Polypeptide”, “peptide”, “amino acid sequence” and “protein” are used interchangeably herein to refer to a polymer of amino acid residues. The terms apply to amino acid polymers in which one or more amino acid residue is an artificial chemical analogue of a corresponding naturally occurring amino acid, as well as to naturally occurring amino acid polymers. The terms “polypeptide”, “peptide”, “amino acid sequence”, and “protein” are also inclusive of modifications including, but not limited to, glycosylation, lipid attachment, sulfation, gamma-carboxylation of glutamic acid residues, hydroxylation and ADP-ribosylation.
As used herein, an “expression construct” refers to a vector suitable for expression of a nucleotide sequence of interest in an organism, such as a recombinant vector. “Expression” refers to the production of a functional product. For example, the expression of a nucleotide sequence may refer to transcription of the nucleotide sequence (such as transcribe to produce an mRNA or a functional RNA) and/or translation of RNA into a protein precursor or a mature protein.
“Expression construct” of the invention may be a linear nucleic acid fragment, a circular plasmid, a viral vector, or, in some embodiments, an RNA that can be translated (such as an mRNA).
“Expression construct” of the invention may comprise regulatory sequences and nucleotide sequences of interest that are derived from different sources, or regulatory sequences and nucleotide sequences of interest derived from the same source, but arranged in a manner different than that normally found in nature.
“Regulatory sequence” or “regulatory element” are used interchangeably and refer to nucleotide sequences located upstream (5′ non-coding sequences), within, or downstream (3′ non-coding sequences) of a coding sequence, and which influence the transcription, RNA processing or stability, or translation of the associated coding sequence. Regulatory sequences may include, but are not limited to, promoters, translation leader sequences, introns, and polyadenylation recognition sequences.
“Promoter” refers to a nucleic acid fragment capable of controlling the transcription of another nucleic acid fragment. In some embodiments of the present invention, the promoter is a promoter capable of controlling the transcription of a gene in a cell, whether or not it is derived from the cell. The promoter may be a constitutive promoter or a tissue-specific promoter or a developmentally-regulated promoter or an inducible promoter.
“Constitutive promoter” refers to a promoter that may cause expression of a gene in most circumstances in most cell types. “Tissue-specific promoter” and “tissue-preferred promoter” are used interchangeably, and refer to a promoter that is expressed predominantly but not necessarily exclusively in one tissue or organ, but that may also be expressed in one specific cell or cell type. “Developmentally regulated promoter” refers to a promoter whose activity is determined by developmental events. “Inducible promoter” selectively expresses a DNA sequence operably linked to it in response to an endogenous or exogenous stimulus (environment, hormones, or chemical signals, and so on).
As used herein, the term “operably linked” means that a regulatory element (for example but not limited to, a promoter sequence, a transcription termination sequence, and so on) is associated to a nucleic acid sequence (such as a coding sequence or an open reading frame), such that the transcription of the nucleotide sequence is controlled and regulated by the transcriptional regulatory element. Techniques for operably linking a regulatory element region to a nucleic acid molecule are known in the art.
“Introduction” of a nucleic acid molecule (e.g., plasmid, linear nucleic acid fragment, RNA, etc.) or protein into an organism means that the nucleic acid or protein is used to transform a cell of the organism such that the nucleic acid or protein functions in the cell. As used in the present invention, “transformation” includes both stable and transient transformations. “Stable transformation” refers to the introduction of an exogenous nucleotide sequence into the genome, resulting in the stable inheritance of foreign genes. Once stably transformed, the exogenous nucleic acid sequence is stably integrated into the genome of the organism and any of its successive generations. “Transient transformation” refers to the introduction of a nucleic acid molecule or protein into a cell, performing its function without the stable inheritance of an exogenous gene. In transient transformation, the exogenous nucleic acid sequence is not integrated into the genome.
It has been reported that the Cas9 nuclease variant eSpCas9 (1.0) (K810A/K1003A/R1060A), eSpCas9(1.1) (K848A/K1003A/R1060A) of Feng Zhang et al., and the Cas9 nuclease variant SpCas9-HF1 (N497A/R661A/Q695A/Q926A) developed by J. Keith Joung et al., are capable of significantly reducing the off-target rate in genomic editing, and thus have high specificity. However, surprisingly, the present inventors found that these three Cas9 nuclease variants, while having high specificity, have a much lower gene editing efficiency compared to wild-type Cas9.
The present inventors have surprisingly found that by fusing the 5′ end of the guide RNA to a tRNA, the editing efficiency of the high-specificity Cas9 nuclease variant can be increased, even to the wild-type level, while maintaining the high specificity.
Not intended to be limited by any theory, it is believed that the editing efficiency reduction of high-specificity Cas9 nuclease variants is related to whether the transcription of guide RNA can be precisely initiated or not. In the art, commonly used promoters for producing guide RNA in vivo include for example U6 or U3 snRNA promoters, for which the transcription is driven by RNA polymerase III. U6 promoter needs to initiate transcription at G, and thus for the target sequences with the first nucleotide of A, C or T, an additional G will be present at 5′ end of sgRNA as transcribed. U3 promoter initiates transcription at A, and thus for the target sequences with the first nucleotide of G, C or T, an additional A will be present at 5′ end of sgRNA as transcribed. The inventors found that, the editing efficiency of high-specificity Cas9 nuclease variants is reduced in the case that an additional nucleotide is present at 5′ end of the sgRNA. By fusion transcription with a tRNA, due to the mechanism of precisely processing tRNA (precisely removing additional sequence of 5′ and 3′ of tRNA precursor to form mature tRNA), sgRNA without additional nucleotide at 5′ end can be readily obtained even using U6 or U3 promoters, without the need of considering the type of the first nucleotide of the target sequence. Thereby, the editing efficiency of high specificity Cas9 nuclease variants can be improved, and the selectable range of target sequences can be extended. In addition, not intended to be limited by any theory, fusion with tRNA can increase the expression level of sgRNA, which may also contribute to the improvement of editing efficiency of high-specificity Cas9 nuclease variants.
Therefore, the present invention provides a genome editing system for site-directed modification of a target sequence in the genome of a cell, which comprises at least one selected from the following i) to iii):
i) a Cas9 nuclease variant, and an expression construct comprising a nucleotide sequence encoding a tRNA-guide RNA fusion;
ii) an expression construct comprising a nucleotide sequence encoding a Cas9 nuclease variant, and an expression construct comprising a nucleotide sequence encoding a tRNA-guide RNA fusion; and
iii) an expression construct comprising a nucleotide sequence encoding a Cas9 nuclease variant and a nucleotide sequence encoding a tRNA-guide RNA fusion;
wherein the Cas9 nuclease variant has higher specificity as compared with the wild-type Cas9 nuclease,
wherein the 5′ end of the guide RNA is linked to the 3′ end of the tRNA,
wherein the fusion is cleaved at the 5′ end of the guide RNA after being transcribed in the cell, thereby forming a guide RNA that does not carry extra nucleotide at the 5′ end.
In some embodiments, the tRNA and the cell to be modified are from the same species.
In some specific embodiments, the tRNA is encoded by the following sequence: aacaaagcaccagtggtctagtggtagaatagtaccctgccacggtacagacccgggttcgattcccggctggtgca (SEQ ID NO:1).
The design of the tRNA-guide RNA fusion is within the skill of the person in the art. For example, reference can be made to Xie et al., PNAS, Mar. 17, 2015; vol. 112, no. 11, 3570-3575.
The present invention also considers the fusion of a guide RNA and a ribozyme. On the basis that it is found in the invention that the editing efficiency of high-specificity Cas9 nuclease variants is related to precise transcription initiation of sgRNA, by using the ability of ribozyme to cut RNA at specific site, it is possible to produce sgRNA without additional nucleotide at 5′ end by rational design of a fusion of RNA and ribozyme, so as to improve editing efficiency while maintain the high specificity.
Therefore, the invention also provides a genome editing system for site-directed modification of a target sequence in the genome of a cell, which comprises at least one selected from the following i) to iii):
i) a Cas9 nuclease variant, and an expression construct comprising a nucleotide sequence encoding a ribozyme-guide RNA fusion;
ii) an expression construct comprising a nucleotide sequence encoding a Cas9 nuclease variant, and an expression construct comprising a nucleotide sequence encoding a ribozyme-guide RNA fusion; and
iii) an expression construct comprising a nucleotide sequence encoding a Cas9 nuclease variant and a nucleotide sequence encoding a ribozyme-guide RNA fusion;
wherein the Cas9 nuclease variant has higher specificity as compared with the wild-type Cas9 nuclease,
wherein the 5′ end of the guide RNA is linked to the 3′ end of a first ribozyme,
wherein the first ribozyme is designed to cleave the fusion at the 5′ end of the guide RNA, thereby forming a guide RNA that does not carry extra nucleotide at the 5′ end.
In one embodiment, the 3′ end of the guide RNA is linked to the 5′ end of a second ribozyme, the second ribozyme is designed to cleave the fusion at the 3′ end of the guide RNA, thereby forming a guide RNA that does not carry extra nucleotide at the 3′ end.
The design of the first ribozyme or the second ribozyme is within the skill of the person in the art. For example, reference can be made to Gao et al., JIPB, April, 2014; Vol 56, Issue 4, 343-349.
In one specific embodiment, the first ribozyme is encoded by the following sequence: 5′-(N)6CTGATGAGTCCGTGAGGACGAAACGAGTAAGCTCGTC-3′ (SEQ ID NO:12), wherein N is independently selected from A, G, C, and T, and (N)6 refers to a sequence reversely complementary to the first 6 nucleotides at 5′ end of the guide RNA. In one specific embodiment, the second ribozyme is encoded by the following sequence: 5′ -GGCCGGCATGGTCCCAGCCTCCTCGCTGGCGCCGGCTGGGCAACATGCTTCGGCATGGC GAATGGGAC-3′ (SEQ ID NO:13).
The Cas9 nuclease variant in the invention that has higher specificity as compared with wild type Cas9 nuclease can be derived from Cas9 of various species, for example, derived from Cas9 of Streptococcus pyogenes (SpCas9, nucleotide sequence shown in SEQ ID NO:2, amino acid sequence shown in SEQ ID NO:3).
In some embodiments of the invention, the Cas9 nuclease variant is a variant of SEQ ID NO:2, which comprises an amino acid substitution at position 855 of SEQ ID NO:2. In some specific embodiments, the amino acid substitution at position 855 is K855A.
In some embodiments of the invention, the Cas9 nuclease variant is a variant of SEQ ID NO:2, which comprises amino acid substitutions at positions 810, 1003 and 1060 of SEQ ID NO:2. In some specific embodiments, the amino acid substitutions respectively are K810A, K1003A and R1060A.
In some embodiments of the invention, the Cas9 nuclease variant is a variant of SEQ ID NO:2, which comprises amino acid substitutions at positions 848, 1003 and 1060 of SEQ ID NO:2. In some specific embodiments, the amino acid substitutions respectively are K848A, K1003A and R1060A.
In some embodiments of the invention, the Cas9 nuclease variant is a variant of SEQ ID NO:2, which comprises amino acid substitutions at positions 611, 695 and 926 of SEQ ID NO:2. In some specific embodiments, the amino acid substitutions respectively are R611A, Q695A and Q926A.
In some embodiments of the invention, the Cas9 nuclease variant is a variant of SEQ ID NO:2, which comprises amino acid substitutions at positions 497, 611, 695 and 926 of SEQ ID NO:2. In some specific embodiments, the amino acid substitutions respectively are N497A, R611A, Q695A and Q926A.
In some specific embodiments of the invention, the Cas9 nuclease variant comprises an amino acid sequence as shown in SEQ ID NO:4 (eSpCas9(1.0)), SEQ ID NO:5 (eSpCas9(1.1)) or SEQ ID NO:6 (SpCas9-HF1).
In some embodiments of the invention, the Cas9 nuclease variant of the invention further comprises a nuclear localization sequence (NLS). In general, one or more NLSs in the Cas9 nuclease variant should have sufficient strength to drive the accumulation of the Cas9 nuclease variant in the nucleus of the cell in an amount sufficient for the genome editing function. In general, the strength of the nuclear localization activity is determined by the number and position of NLSs, and one or more specific NLSs used in the Cas9 nuclease variant, or a combination thereof.
In some embodiments of the present invention, the NLSs of the Cas9 nuclease variant of the invention may be located at the N-terminus and/or the C-terminus. In some embodiments, the Cas9 nuclease variant comprises about 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, or more NLSs. In some embodiments, the Cas9 nuclease variant comprises about 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, or more NLSs at or near the N-terminus. In some embodiments, the Cas9 nuclease variant comprises about 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, or more NLSs at or near the C-terminus. In some embodiments, the Cas9 nuclease variant comprises a combination of these, such as one or more NLSs at the N-terminus and one or more NLSs at the C-terminus. Where there are more than one NLS, each NLS may be selected as independent from other NLSs. In some preferred embodiments of the invention, the Cas9 nuclease variant comprises two NLSs, for example, the two NLSs are located at the N-terminus and the C-terminus, respectively.
In general, NLS consists of one or more short sequences of positively charged lysine or arginine exposed on the surface of a protein, but other types of NLS are also known in the art. Non-limiting examples of NLSs include KKRKV (nucleotide sequence 5′-AAGAAGAGAAAGGTC-3′ (SEQ ID NO: 14)), PKKKRKV (nucleotide sequence 5′-CCCAAGAAGAAGAGGAAGGTG-3′ (SEQ ID NO: 15) or CCAAAGAAGAAGAGGAAGGTT (SEQ ID NO: 16), or SGGSPKKKRKV (SEQ ID NO: 17) (nucleotide sequence 5′-TCGGGGGGGAGCCCAAAGAAGAAGCGGAAGGTG-3′) (SEQ ID NO: 18.
In some embodiments of the invention, the N-terminus of the Cas9 nuclease variant comprises an NLS with an amino acid sequence shown by PKKKRKV (SEQ ID NO: 19). In some embodiments of the invention, the C-terminus of the Cas9 nuclease variant comprises an NLS with an amino acid sequence shown by SGGSPKKKRKV (SEQ ID NO: 17).
In addition, the Cas9 nuclease variant of the present invention may also include other localization sequences, such as cytoplasmic localization sequences, chloroplast localization sequences, mitochondrial localization sequences, and the like, depending on the location of the DNA to be edited.
For obtaining effective expression in the target cell, in some embodiments of the invention, the nucleotide sequence encoding the Cas9 nuclease variant is codon-optimized for the organism where the cell to be genome-edited is from.
Codon optimization refers to a process of modifying a nucleic acid sequence for enhanced expression in the host cells of interest by replacing at least one codon (e.g. about or more than about 1, 2, 3, 4, 5, 10, 15, 20, 25, 50, or more codons) of the native sequence with codons that are more frequently or most frequently used in the genes of that host cell while maintaining the native amino acid sequence. Various species exhibit particular bias for certain codons of a particular amino acid. Codon bias (differences in codon usage between organisms) often correlates with the efficiency of translation of messenger RNA (mRNA), which is in turn believed to be dependent on, among other things, the properties of the codons being translated and the availability of particular transfer RNA (tRNA) molecules. The predominance of selected tRNAs in a cell is generally a reflection of the codons used most frequently in peptide synthesis. Accordingly, genes can be tailored for optimal gene expression in a given organism based on codon optimization. Codon usage tables are readily available, for example, at the “Codon Usage Database” available at www.kazusa.orjp/codon/ and these tables can be adapted in a number of ways. See Nakamura, Y., et al.“Codon usage tabulated from the international DNA sequence databases: status for the year 2000” Nucl. Acids Res. 28:292 (2000).
The organism, from which the cell that can be genome edited by the system of the invention is derived, includes but is not limited to, mammals such as human, mice, rat, monkey, dog, pig, sheep, cow and cat; poultry such as chicken, duck and goose; plants including monocotyledons and dicotyledons, e.g. rice, maize, wheat, sorghum, barley, soybean, peanut and Arabidopsis thaliana and the like.
In some specific embodiments of the invention, the codon-optimized nucleotide sequence encoding the Cas9 nuclease variant is as shown in SEQ ID NO:7 (eSpCas9(1.0)), SEQ ID NO:8 (eSpCas9(1.1)) or SEQ ID NO:9 (SpCas9-HF1).
In some embodiments of the invention, the guide RNA is a single guide RNA (sgRNA). Methods of constructing suitable sgRNAs according to a given target sequence are known in the art. See e.g., Wang, Y. et al. Simultaneous editing of three homoeoalleles in hexaploid bread wheat confers heritable resistance to powdery mildew. Nat. Biotechnol. 32, 947-951 (2014); Shan, Q. et al. Targeted genome modification of crop plants using a CRISPR-Cas system. Nat. Biotechnol. 31, 686-688 (2013); Liang, Z. et al. Targeted mutagenesis in Zea mays using TALENs and the CRISPR/Cas system. J Genet Genomics. 41, 63-68 (2014).
In some embodiments of the invention, the nucleotide sequence encoding the Cas9 nuclease variant and/or the nucleotide sequence encoding the guide RNA fusion are operatively linked to an expression regulatory element such as a promoter.
Examples of promoters that can be used in the present invention include but are not limited to polymerase (pol) I, pol II or pol III promoters. Examples of pol I promoters include chicken RNA pol I promoter. Examples of pol II promoters include but are not limited to cytomegalovirus immediate early(CMV) promoter, rous sarcoma virus long terminal repeat (RSV-LTR) promoter and simian virus 40 (SV40) immediate early promoter. Examples of pol III promoters include U6 and H1 promoter. Inducible promoter such as metalothionein promoter can be used. Other examples of promoters include T7 bacteriophage promoter, T3 bacteriophage promoter, β-galactosidase promoter and Sp6 bacteriophage promoter etc. When used for plants, promoters that can be used include but are not limited to cauliflower mosaic virus 35S promoter, maize Ubi-1 promoter, wheat U6 promoter, rice U3 promoter, maize U3 promoter and rice actin promoter etc.
In another aspect, the invention provides a method for genetically modifying a cell, comprising: introducing the genome editing system of the invention to the cell, thereby the Cas9 nuclease variant is targeted to the target sequence in the genome of the cell by the guide RNA, and results in substitution, deletion and/or addition of one or more nucleotides in the target sequence.
The design of the target sequence that can be recognized and targeted by a Cas9 and guide RNA complex is within the technical skills of one of ordinary skill in the art. In general, the target sequence is a sequence that is complementary to a leader sequence of about 20 nucleotides comprised in guide RNA, and the 3′-end of which is immediately adjacent to the protospacer adjacent motif (PAM) NGG.
For example, in some embodiments of the invention, the target sequence has the structure: 5′-Nx-NGG-3′, wherein N is selected independently from A, G, C, and T; X is an integer of 14≤X≤30; NX represents X contiguous nucleotides, and NGG is a PAM sequence. In some specific embodiments of the invention, X is 20.
In the present invention, the target sequence to be modified may be located anywhere in the genome, for example, within a functional gene such as a protein-coding gene or, for example, may be located in a gene expression regulatory region such as a promoter region or an enhancer region, and thereby accomplish the functional modification of said gene or accomplish the modification of a gene expression.
The substitution, deletion and/or addition in the target sequence of the cell can be detected by T7EI, PCR/RE or sequencing methods, see e.g., Shan, Q., Wang, Y., Li, J. & Gao, C. Genome editing in rice and wheat using the CRISPR/Cas system. Nat. Protoc. 9, 2395-2410 (2014).
In the method of the present invention, the genome editing system can be introduced into the cell by using various methods well known by the skilled in the art.
Methods for introducing the genome editing system of the present invention into the cell include, but are not limited to calcium phosphate transfection, protoplast fusion, electroporation, liposome transfection, microinjection, viral infection (such as a baculovirus, a vaccinia virus, an adenovirus and other viruses), particle bombardment, PEG-mediated protoplast transformation or agrobacterium-mediated transformation.
The cell which can be subjected to genome editing with the method of the present invention can be from, for example, mammals such as human, mouse, rat, monkey, dog, pig, sheep, cow and cat; poultry such as chicken, duck and goose; and plants including monocotyledons and dicotyledons such as rice, maize, wheat, sorghum, barley, soybean, peanut and Arabidopsis thaliana etc.
In some embodiments, the method of the present invention is performed in vitro. For example, the cell is an isolated cell. In some other embodiments, the method of the present invention can be performed in vivo. For example, the cell is a cell within an organism, and the system of the present invention can be introduced in-vivo into said cell by using, for example, a virus-mediated method. In some embodiments, the cell is a germ cell. In some implementations, the cell is a somatic cell.
In another aspect, the present invention further provides a genetically modified organism comprising a genetically modified cell produced by the method of the present invention.
The organism includes, but is not limited to mammals such as humans, mice, rats, monkeys, dogs, pigs, sheep, cows and cats; poultry such as chicken, ducks and geese; and plants including monocotyledons and dicotyledons such as rice, maize, wheat, sorghum, barley, soybean, peanuts and Arabidopsis thaliana.
SpCas9, eSpCas9(1.0), eSpCas9(1.1) and SpCas9-HF1 sequences were codon-optimized for rice. SpCas9, eSpCas9(1.0), eSpCas9(1.1) and SpCas9-HF1 were obtained by site-directed mutagenesis using Fast MultiSite Mutagenesis System (TransGen) with pJIT163-SpCas9 plasmid (SEQ ID NO:10) as the template.
sgRNA target sequences used in the experiments are showed in table 1 as follows:
| TABLE 1 |
| Target Gene and sgRNA Target Sequence |
| sgRNA | Target sequence | Oligo-F | Oligo-R |
| OsCDKB2 | AGGTCGGGGAGGGGA | GGCAAGGTCGGGGAGG | AAACGTACGTCCCCTCC |
| CGTACGGG (SEQ ID NO: | GGACGTAC (SEQ ID NO: | CCGACCT (SEQ ID NO: | |
| 20) | 21) | 22) | |
| OsMKK4 | GACGTCGGCGAGGAA | GGCAGACGTCGGCGAG | AAACAGGCCTTCCTCGC |
| GGCCTCGG (SEQ ID NO: | GAAGGCCT (SEQ IN NO: | CGACGTC (SEQ ID NO: | |
| 23) | 24) | 25) | |
| A1 | CATGGTGGGGAAAGCT | GGCACATGGTGGGGAAA | AAACTCCAAGCTTTCCC |
| TGGAGGG (SEQ ID NO: | GCTTGGA (SEQ ID NO: | CACCATG (SEQ ID NO: | |
| 26) | 27) | 28) | |
| A2 | CCGGACGACGACGTCG | GGCACCGGACGACGAC | AAACTCGTCGACGTCGT |
| ACGACGG (SEQ ID NO: | GTCGACGA (SEQ ID NO: | CGTCCGG (SEQ ID NO: | |
| 29) | 30) | 31) | |
| A3 | TTGAAGTCCCTTCTAGA | GGCATTGAAGTCCCTTCT | AAACCCATCTAGAAGGG |
| TGGAGG (SEQ ID NO: | AGATGG (SEQ ID NO: | ACTTCAA (SEQ ID NO: | |
| 32) | 33) | 34) | |
| A4 | ACTGCGACACCCAGAT | GGCAACTGCGACACCCA | AAACCGATATCTGGGTG |
| ATCGTGG (SEQ ID NO: | GATATCG (SEQ ID NO: | TCGCAGT (SEQ ID NO: | |
| 35) | 36) | 37) | |
| PDS | GTTGGTCTTTGCTCCTG | GGCAGTTGGTCTTTGCT | AAACCTGCAGGAGCAA |
| CAGAGG (SEQ ID NO: | CCTGCAG (SEQ ID NO: | AGACCAAC (SEQ ID NO: | |
| 38) | 39) | 40) | |
sgRNA expression vectors: pOsU3-CDKB2-sgRNA, pOsU3-MKK4-sgRNA, pOsU3-A1-sgRNA as well as pOsU3-A2-sgRNA, pOsU3-A3-sgRNA, pOsU3-A4-sgRNA and pOsU3-PDS-sgRNA are constructed on the basis of pOsU3-sgRNA(Addgene ID53063) as described previously (Shan, Q. et al. Targeted genome modification of crop plants using a CRISPR-Cas system. Nat. Biotechnol. 31, 686-688, 2013).
tRNA-sgRNA expression vectors are constructed on the basis of the pUC57-U3-tRNA-sgRNA vector (SEQ ID NO:11, FIG. 6). A linear vector is obtained after digestion of pUC57-U3-tRNA-sgRNA with BsaI, the corresponding oligo-F and oligo-R are annealed and connected into the linear vector, and the subsequent steps are similar to the construction of the sgRNA expression vectors.
| TABLE 2 |
| Target Genes and Oligonucleotide Sequences for Constructing tRNA-sgRNA |
| Expression Vectors |
| sgRNA | Target sequence | Oligo-F | Oligo-R |
| OsCDKB2 | AGGTCGGGGAGGGGA | TGCAAGGTCGGGGAGG | AAACGTACGTCCCCTCC |
| CGTACGGG (SEQ ID | GGACGTAC (SEQ ID NO: | CCGACCT (SEQ ID NO: | |
| NO: 20) | 41) | 22) | |
| OsMKK4 | GACGTCGGCGAGGAA | TGCAGACGTCGGCGAGG | AAACAGGCCTTCCTCGC |
| GGCCTCGG (SEQ ID | AAGGCCT (SEQ ID NO: | CGACGTC (SEQ ID NO: | |
| NO: 23) | 42) | 25) | |
| A1 | CATGGTGGGGAAAGCT | TGCACATGGTGGGGAAA | AAACTCCAAGCTTTCCC |
| TGGAGGG (SEQ ID NO: | GCTTGGA (SEQ ID NO: | CACCATG (SEQ ID NO: | |
| 26) | 43) | 28) | |
| A2 | CCGGACGACGACGTCG | TGCACCGGACGACGACG | AAACTCGTCGACGTCGT |
| ACGACGG (SEQ ID NO: | TCGACGA (SEQ ID NO: | CGTCCGG (SEQ ID NO: | |
| 29) | 44) | 31) | |
| A3 | TTGAAGTCCCTTCTAG | TGCATTGAAGTCCCTTCT | AAACCCATCTAGAAGGG |
| ATGGAGG (SEQ ID NO: | AGATGG (SEQ ID NO: 45) | ACTTCAA (SEQ ID NO: | |
| 32) | 34) | ||
| A4 | ACTGCGACACCCAGAT | TGCACTGCGACACCCAG | AAACCGATATCTGGGTG |
| ATCGTGG (SEQ ID NO: | ATATCG (SEQ ID NO: 46) | TCGCAGT (SEQ ID NO: | |
| 35) | 37) | ||
| PDS | GTTGGTCTTTGCTCCT | TGCAGTTGGTCTTTGCTC | AAACCTGCAGGAGCAA |
| GCAGAGG (SEQ ID NO: | CTGCAG (SEQ ID NO: 47) | AGACCAAC (SEQ ID NO: | |
| 38) | 40) | ||
Rice cultivar nipponbare is used in the research. Protoplasts transformation is performed as described below. Transformation is carried out with 10 μg of each plasmid by PEG-mediated transfection. Protoplasts were collected after 48 h and DNA was extracted for PCR-RE assay.
1) Leaf sheath of the seedlings were used for protoplasts isolation, and cut into about 0.5 mm wide with a sharp blade.
2) Immediately after incision, transfered into 0.6M Mannitol solution, and placed in the dark for 10 min.
3) Mannitol solution was removed by filtration, and the products were transfered into enzymolysis solution, and evacuated for 30 min.
4) Enzymolysis was performed for 5-6h in darkness with gently shaking (decolorization shaker, speed 10).
5) After enzymolysis completion, an equal volume of W5 was added, horizontal shake for 10s to release protoplasts.
6) Protoplasts were filtered into a 50 ml round bottom centrifuge tube with a 40 μm nylon membrane and washed with W5 solution.
7) 250 g horizontal centrifugation for 3 min to precipitate the protoplasts, the supernatant was discarded.
8) Protoplasts were resuspended by adding 10 ml W5, and then centrifuged at 250 g for 3 min, and the supernatant was discarded.
9) An appropriate amount of MMG solution was added to resuspend the protoplasts to a concentration of 2×106/ml.
Note: All the above steps were carried out at room temperature.
10) 10-20 μg plasmid, 200 μl protoplasts (about 4×105 cells), and 220 μl fresh PEG solution were added into a 2 ml centrifugal tube, mixed, and placed at room temperature in darkness for 10-20 minutes to induce transformation.
11) After the completion of the transformation, 880 μl W5 solution was slowly added, and the tubes were gently turned upside down for mixing, 250 g horizontal centrifuged for 3 min, and the supernatant was discarded.
12) The products were resuspended in 2 ml WI solution, transfered to a six-well plate, cultivated in room temperature (or 25° C.) in darkness. For protoplast genomic DNA extraction, the products need to be cultivated for 48 h.
Deep sequencing analysis is performed by reference to Liang, Z., Chen, K., Li, T., Zhang, Y., Wang, Y., Zhao, Q., Liu, J., Zhang, H., Liu, C., Ran, Y., et al. (2017). Efficient DNA-free genome editing of bread wheat using CRISPR/Cas9 ribonucleoprotein complexes. Nature Communications 8, 14261.
WT SpCas9, eSpCas9(1.0), eSpCas9(1.1) and SpCas9-HF1 were respectively constructed in a transient expression vector pJIT163, and the expressions of WT SpCas9, eSpCas9(1.0), eSpCas9(1.1) and SpCas9-HF1 are driven by a maize ubiquitin gene promoter. sgRNAs were constructed in the pOsU3-sgRNA vector, and the expression of sgRNAs is driven by OsU3 promoter. Rice protoplasts were transformed, and protoplast DNA was extracted for PCR-RE analysis to evaluate the mutation efficiency. Five target sites (A1, A2, A3, A4 and PDS, see FIG. 2 and FIG. 3) are selected to compare the difference of editing capacities of wild-type SpCas9 and eSpCas9(1.0), eSpCas9(1.1) and SpCas9-HF1.
The OsU3 promoter has to initiate transcription with the nucleotide A, and therefore, the design of the sgRNA expression vectors for the target sites can be divided into two conditions as follows:
(1) If the first nucleotide at the 5′ end of the desired sgRNA target sequence (20 bp) is any one of G/T/C, as the U3 promoter initiates transcription with an A, an additional A will be added to the 5′ end of the transcribed sgRNA, and furthermore, the transcribed sgRNA cannot completely match with the target sequence. sgRNA expression vector can be constructed as U3+AN20 in FIG. 1, while N20 is the target sequence, A is the additional nucleotide at 5′ end.
(2) If the first nucleotide at the 5′ end of the desired sgRNA target sequence (20 bp) is A, it can used by the U3 promoter for initiating transcription, and therefore no additional nucleotide will exist at the 5′ end of the transcribed sgRNA. sgRNA expression vector can be constructed as U3+AN19 in FIG. 1, while AN19 is the target sequence.
The selected target sites A1, A2, A3 and PDS belong to target sites of class (1), and target site A4 belongs to target sites of class (2).
The experiment results show (FIG. 2) that the editing efficiencies of eSpCas9(1.0), eSpCas9(1.1) and SpCas9-HF1 for the target sites of class (1) are extremely low. The difference of the editing efficiencies of eSpCas9(1.0), eSpCas9(1.1) and SpCas9-HF1 and the editing efficiency of WT SpCas9 is not significant for target sites of class (2). This shows that the additional nucleotide at the 5′ end of the sgRNA resulted from the transcription can reduce the editing efficiencies of eSpCas9(1.0), eSpCas9(1.1) and SpCas9-HF1.
Similar to OsU3 promoter, maize U6 promoter (TaU6) has to initiate transcription with the nucleotide G, and therefore, the design of the sgRNA expression vectors for the target sites can be divided into two conditions as follows:
(1) If the first nucleotide at the 5′ end of the desired sgRNA target sequence (20 bp) is any one of A/T/C, as the U6 promoter initiates transcription with a G, an additional G will be added to the 5′ end of the transcribed sgRNA, and furthermore, the transcribed sgRNA cannot completely match with the target sequence.
(2) If the first nucleotide at the 5′ end of the desired sgRNA target sequence (20 bp) is it can used by the U6 promoter for initiating transcription, and therefore no additional nucleotide will exist at the 5′ end of the transcribed sgRNA.
The OsPDS target site belongs to target sites of class (2). TaU6 promoter was used to drive the transcription of GN19 and GN20 sgRNAs against OsPDS target site, where GN20 can mimic the target sites of class (1), namely with an additional G at 5′ end of the sgRNA.
| TABLE 3 |
| Target gene and oligonucleotide sequences for construction of TaU6-sgRNA |
| expression vectors |
| sgRNA | Target sequence | Oligo-F | Oligo-R |
| OsPDS-GN19 | GTTGGTCTTTGCTCC | GGCGTTGGTCTTTGCTC | AAACCTGCAGGAGCAA |
| TGCAGAGG (SEQ ID | CTGCAG (SEQ ID NO: | AGACCAA (SEQ ID NO: | |
| NO. 38) | 48) | 40) | |
| OsPDS-GN20 | GTTGGTCTTTGCTCC | GGCGGTTGGTCTTTGCT | AAACCTGCAGGAGCAA |
| TGCAGAGG (SEQ ID | CCTGCAG (SEQ ID NO: | AGACCAAC (SEQ ID | |
| NO. 38) | 49) | NO: 40) | |
The results show (FIG. 2) that one additional G at 5′ end of the sgRNA significantly reduces the editing efficiency of eSpCas9(1.0), eSpCas9(1.1) and SpCas9-HF1.
According to the result of the Example 1, an important factor influencing the editing efficiencies of eSpCas9(1.0), eSpCas9(1.1) and SpCas9-HF1is weather the sgRNA is precisely initiated or not. According to previous report, fusion of a tRNA to the 5′ end of an sgRNA may up-regulate the expression of the sgRNA and result in precise cleavage at the 5′ end of the sgRNA, and thereby avoiding additional nucleotide at the 5′ end of the sgRNA. (See Xie K, Minkenberg B, Yang Y. Boosting CRISPR/Cas9 multiplex editing capability with the endogenous tRNA-processing system. Proc Natl Acad Sci USA. 2015 Mar. 17; 112(11):3570-5. doi: 10.1073/pnas.1420294112. Epub 2015 Mar. 2.)
sgRNA for each target site in Example 1 was fused to tRNA and expressed under the control of the OsU3 promoter. Experiments were performed by the method in Example 1 with tRNA-sgRNAs instead of sgRNAs. As shown in FIG. 2, for the target sites A1, A2, A3 and PDS, the editing efficiencies of eSpCas9(1.0), eSpCas9(1.1) and SpCas9-HF1 are significantly increased using tRNA-sgRNAs instead of sgRNAs.
A target site GACGTCGGCGAGGAAGGCCTCGG (SEQ ID NO: 23) in rice gene MKK4 was selected to design sgRNA and tRNA-sgRNA. This target site has two possible off-target sites as shown in FIG. 5. A vector for expressing sgRNA or tRNA-sgRNA and vectors for expressing WTSpCas9, eSpCas9(1.0), eSpCas9(1.1) and SpCas9-HF1 were respectively co-transformed into rice protoplasts. Two days after transformation, protoplast DNA was extracted, and genomic fragments of the target site and the off-target sites were amplified by using specific primers. Mutation rates of the three sites were analyzed by using second-generation sequencing technology.
The experiment result is shown in FIG. 5:
When sgRNAs were used, compared with WTSpCas9, eSpCas9(1.0), eSpCas9(1.1) and SpCas9-HF1 have extremely low off-target effect, but have significantly lower editing efficiencies.
When tRNA-sgRNAs were used, the editing efficiency of each group was increased, however, eSpCas9(1.0), eSpCas9(1.1) and SpCas9-HF1 can maintain relatively high specificity. Particularly for SpCas9-HF1, only extremely low-level mutation can be detected for both two off-target sites. Therefore, the combination of tRNA-sgRNA and SpCas9-HF1 is particularly suitable for genome editing with high efficiency and high specificity.
A target site AGGTCGGGGAGGGGACGTACGGG (SEQ ID NO: 20) in rice gene OsCDKB2 was selected to design sgRNA. This target site has three possible off-target sites as shown in FIG. 6. A vector for expressing sgRNA or tRNA-sgRNA and vectors for expressing WTSpCas9, eSpCas9(1.0), eSpCas9(1.1) and SpCas9-HF1 were respectively co-transformed into rice protoplasts. Two days after transformation, protoplast DNA was extracted, and genomic fragments of the target site and the off-target sites were amplified by using specific primers. Mutation rates of the four sites were analyzed by deep sequencing.
The experiment results are shown in FIG. 6. The editing efficiencies of eSpCas9(1.0), eSpCas9(1.1) and SpCas9-HF1 to the target sites are effectively increased by using tRNA-sgRNA instead of sgRNA. In particular, the editing efficiency of SpCas9-HF1 can be restored to a wild-type level, and high specificity can be maintained. As this target sequence starts with an A, by which the U3 promoter can precisely initiate transcription, the increased editing efficiency may result from the increased expression level of sgRNA due to the fusion with tRNA.
When designing sgRNA for a target site GACGTCGGCGAGGAAGGCCTCGG (SEQ ID NO: 23) in rice gene MKK4, mismatches of two adjacent bases were artificially introduced (purine for purine, and pyrimidine for pyrimidine). Edition under the condition that sgRNA cannot completely match with the target site was detected. It is considered as off-target if edition can be detected. The experiments were performed in a way similar to that in Example 3.1.
The experiment results were shown in FIG. 7. When tRNA-sgRNA is used, SpCas9 variants showed higher sensitivity to mismatches between gRNA and the target sequence (particularly the mismatch closer to either ends).
sgRNAs were designed against a target sequence GGTGAGTGAGTGTGTGCGTGTGG (SEQ ID NO: 50) within human VEGFA gene. U6:sgRNA-GN19 and U6:tRNA-sgRNA-N20 represent that the sgRNAs transcribed with U6 promoter are 20 nt in length and completely match the target sequence; U6:sgRNA-GN20 represents that the sgRNA transcribed with U6 promoter is 21 nt in length and contains an additional G at 5′ end.
The T7E1 assay results show (FIG. 8) that WT Cas9 exhibits similar editing efficiency when sgRNA transcribed with different strategies were used. However, the editing efficiency of eSpCas9(1.1) and SpCas9-HF1 were significantly reduced when the sgRNA contains an additional nucleotide at 5′end. And by using tRNA-sgRNA fusions, the editing efficiency of eSpCas9(1.1) and SpCas9-HF1 were increased to that of WT Cas9 or even higher.
With respect to editing specificity, WT Cas9 resulted in off-target editing in both sites off target1 and off target2. eSpCas9(1.1) and SpCas9-HF1 did not result in off-target editing when tRNA-sgRNA fusions were used.
| TABLE 4 |
| Target gene and oligonucleotide sequences for construction of sgRNA |
| expression vectors |
| sgRNA | Target sequence | Oligo-F | Oligo-R |
| VEGFA-GN19 | GGTGAGTGAGTGTGT | CACCGGTGAGTGAGTG | AAACCACGCACACACTC |
| GCGTGTGG (SEQ ID | TGTGCGTG (SEQ ID | ACTCACC (SEQ ID NO: | |
| NO: 50) | NO: 51) | 52) | |
| VEGFA-GN20 | GGTGAGTGAGTGTGT | CACCGGGTGAGTGAGT | AAACCACGCACACACTC |
| GCGTGTGG (SEQ ID | GTGTGCGTG (SEQ ID | ACTCACCC (SEQ ID NO: | |
| NO: 50) | NO: 53) | 54) | |
| VEGFA-tRNA- | GGTGAGTGAGTGTGT | CACCGaacaaagcaccagtggt | AAACCACGCACACACTC |
| N20 | GCGTGTGG (SEQ ID | ctagtggtagaatagtaccctgccac | ACTCACCtgcaccagccgggaat |
| NO: 50) | ggtacagacccgggttcgattcccg | cgaacccgggtctgtaccgtggcaggg | |
| gctggtgcaGGTGAGTGAG | tactattctaccactagaccactggtgctt | ||
| TGTGTGCGTG (SEQ | tgttC (SEQ ID NO: 56) | ||
| ID NO: 55) | |||
| Sequence listing | |
| tRNA encoding sequence | |
| SEQ ID NO: 1 | |
| aacaaagcaccagtggtctagtggtagaatagtaccctgccacggtacagacccgggttcgattcccggctggtgca | |
| SpCas9 nucleotide sequence | |
| SEQ ID NO: 2 | |
| atggcccctaagaagaagagaaaggtcggtattcacggcgttcctgcggcgatggacaagaagtatagtattggtct | |
| ggacattgggacgaattccgttggctgggccgtgatcaccgatgagtacaaggtcccttccaagaagtttaaggttc | |
| tggggaacaccgatcggcacagcatcaagaagaatctcattggagccctcctgttcgactcaggcgagaccgccgaa | |
| gcaacaaggctcaagagaaccgcaaggagacggtatacaagaaggaagaataggatctgctacctgcaggagatttt | |
| cagcaacgaaatggcgaaggtggacgattcgttctttcatagattggaggagagtttcctcgtcgaggaagataaga | |
| agcacgagaggcatcctatctttggcaacattgtcgacgaggttgcctatcacgaaaagtaccccacaatctatcat | |
| ctgcggaagaagcttgtggactcgactgataaggcggaccttagattgatctacctcgctctggcacacatgattaa | |
| gttcaggggccattttctgatcgagggggatcttaacccggacaatagcgatgtggacaagttgttcatccagctcg | |
| tccaaacctacaatcagctctttgaggaaaacccaattaatgcttcaggcgtcgacgccaaggcgatcctgtctgca | |
| cgcctttcaaagtctcgccggcttgagaacttgatcgctcaactcccgggcgaaaagaagaacggcttgttcgggaa | |
| tctcattgcactttcgttggggctcacaccaaacttcaagagtaattttgatctcgctgaggacgcaaagctgcagc | |
| tttccaaggacacttatgacgatgacctggataaccttttggcccaaatcggcgatcagtacgcggacttgttcctc | |
| gccgcgaagaatttgtcggacgcgatcctcctgagtgatattctccgcgtgaacaccgagattacaaaggccccgct | |
| ctcggcgagtatgatcaagcgctatgacgagcaccatcaggatctgacccttttgaaggctttggtccggcagcaac | |
| tcccagagaagtacaaggaaatcttctttgatcaatccaagaacggctacgctggttatattgacggcggggcatcg | |
| caggaggaattctacaagtttatcaagccaattctggagaagatggatggcacagaggaactcctggtgaagctcaa | |
| tagggaggaccttttgcggaagcaaagaactttcgataacggcagcatccctcaccagattcatctcggggagctgc | |
| acgccatcctgagaaggcaggaagacttctacccctttcttaaggataaccgggagaagatcgaaaagattctgacg | |
| ttcagaattccgtactatgtcggaccactcgcccggggtaattccagatttgcgtggatgaccagaaagagcgagga | |
| aaccatcacaccttggaacttcgaggaagtggtcgataagggcgcttccgcacagagcttcattgagcgcatgacaa | |
| attttgacaagaacctgcctaatgagaaggtccttcccaagcattccctcctgtacgagtatttcactgtttataac | |
| gaactcacgaaggtgaagtatgtgaccgagggaatgcgcaagcccgccttcctgagcggcgagcaaaagaaggcgat | |
| cgtggaccttttgtttaagaccaatcggaaggtcacagttaagcagctcaaggaggactacttcaagaagattgaat | |
| gcttcgattccgttgagatcagcggcgtggaagacaggtttaacgcgtcactggggacttaccacgatctcctgaag | |
| atcattaaggataaggacttcttggacaacgaggaaaatgaggatatcctcgaagacattgtcctgactcttacgtt | |
| gtttgaggatagggaaatgatcgaggaacgcttgaagacgtatgcccatctcttcgatgacaaggttatgaagcagc | |
| tcaagagaagaagatacaccggatggggaaggctgtcccgcaagcttatcaatggcattagagacaagcaatcaggg | |
| aagacaatccttgactttttgaagtctgatggcttcgcgaacaggaattttatgcagctgattcacgatgactcact | |
| tactttcaaggaggatatccagaaggctcaagtgtcgggacaaggtgacagtctgcacgagcatatcgccaaccttg | |
| cgggatctcctgcaatcaagaagggtattctgcagacagtcaaggttgtggatgagcttgtgaaggtcatgggacgg | |
| cataagcccgagaacatcgttattgagatggccagagaaaatcagaccacacaaaagggtcagaagaactcgaggga | |
| gcgcatgaagcgcatcgaggaaggcattaaggagctggggagtcagatccttaaggagcacccggtggaaaacacgc | |
| agttgcaaaatgagaagctctatctgtactatctgcaaaatggcagggatatgtatgtggaccaggagttggatatt | |
| aaccgcctctcggattacgacgtcgatcatatcgttcctcagtccttccttaaggatgacagcattgacaataaggt | |
| tctcaccaggtccgacaagaaccgcgggaagtccgataatgtgcccagcgaggaagtcgttaagaagatgaagaact | |
| actggaggcaacttttgaatgccaagttgatcacacagaggaagtttgataacctcactaaggccgagcgcggaggt | |
| ctcagcgaactggacaaggcgggcttcattaagcggcaactggttgagactagacagatcacgaagcacgtggcgca | |
| gattctcgattcacgcatgaacacgaagtacgatgagaatgacaagctgatccgggaagtgaaggtcatcaccttga | |
| agtcaaagctcgtttctgacttcaggaaggatttccaattttataaggtgcgcgagatcaacaattatcaccatgct | |
| catgacgcatacctcaacgctgtggtcggaacagcattgattaagaagtacccgaagctcgagtccgaattcgtgta | |
| cggtgactataaggtttacgatgtgcgcaagatgatcgccaagtcagagcaggaaattggcaaggccactgcgaagt | |
| atttcttttactctaacattatgaatttctttaagactgagatcacgctggctaatggcgaaatccggaagagacca | |
| cttattgagaccaacggcgagacaggggaaatcgtgtgggacaaggggagggatttcgccacagtccgcaaggttct | |
| ctctatgcctcaagtgaatattgtcaagaagactgaagtccagacgggcgggttctcaaaggaatctattctgccca | |
| agcggaactcggataagcttatcgccagaaagaaggactgggacccgaagaagtatggaggtttcgactcaccaacg | |
| gtggcttactctgtcctggttgtggcaaaggtggagaagggaaagtcaaagaagctcaagtctgtcaaggagctcct | |
| gggtatcaccattatggagaggtccagcttcgaaaagaatccgatcgattttctcgaggcgaagggatataaggaag | |
| tgaagaaggacctgatcattaagcttccaaagtacagtcttttcgagttggaaaacggcaggaagcgcatgttggct | |
| tccgcaggagagctccagaagggtaacgagcttgctttgccgtccaagtatgtgaacttcctctatctggcatccca | |
| ctacgagaagctcaagggcagcccagaggataacgaacagaagcaactgtttgtggagcaacacaagcattatcttg | |
| acgagatcattgaacagatttcggagttcagtaagcgcgtcatcctcgccgacgcgaatttggataaggttctctca | |
| gcctacaacaagcaccgggacaagcctatcagagagcaggcggaaaatatcattcatctcttcaccctgacaaacct | |
| tggggctcccgctgcattcaagtattttgacactacgattgatcggaagagatacacttctacgaaggaggtgctgg | |
| atgcaacccttatccaccaatcgattactggcctctacgagacgcggatcgacttgagtcagctcgggggggataag | |
| agaccagcggcaaccaagaaggcaggacaagcgaagaagaagaagtag | |
| SpCas9 amino acid sequence | |
| SEQ ID NO: 3 | |
| MAPKKKRKVGIHGVPAAMDKKYSIGLDIGTNSVGWAVITDEYKVPSKKFKVLGNTDRHSIKKNLIGALLFDSGETAE | |
| ATRLKRTARRRYTRRKNRICYLQEIFSNEMAKVDDSFFHRLEESFLVEEDKKHERHPIFGNIVDEVAYHEKYPTIYH | |
| LRKKLVDSTDKADLRLIYLALAHMIKFRGHFLIEGDLNPDNSDVDKLFIQLVQTYNQLFEENPINASGVDAKAILSA | |
| RLSKSRRLENLIAQLPGEKKNGLFGNLIALSLGLTPNFKSNFDLAEDAKLQLSKDTYDDDLDNLLAQIGDQYADLFL | |
| AAKNLSDAILLSDILRVNTEITKAPLSASMIKRYDEHHQDLTLLKALVRQQLPEKYKEIFFDQSKNGYAGYIDGGAS | |
| QEEFYKFIKPILEKMDGTEELLVKLNREDLLRKQRTFDNGSIPHQIHLGELHAILRRQEDFYPFLKDNREKIEKILT | |
| FRIPYYVGPLARGNSRFAWMTRKSEETITPWNFEEVVDKGASAQSFIERMTNFDKNLPNEKVLPKHSLLYEYFTVYN | |
| ELTKVKYVTEGMRKPAFLSGEQKKAIVDLLFKTNRKVTVKQLKEDYFKKIECFDSVEISGVEDRFNASLGTYHDLLK | |
| IIKDKDFLDNEENEDILEDIVLTLTLFEDREMIEERLKTYAHLFDDKVMKQLKRRRYTGWGRLSRKLINGIRDKQSG | |
| KTILDFLKSDGFANRNFMQLIHDDSLTFKEDIQKAQVSGQGDSLHEHIANLAGSPAIKKGILQTVKVVDELVKVMGR | |
| HKPENIVIEMARENQTTQKGQKNSRERMKRIEEGIKELGSQILKEHPVENTQLQNEKLYLYYLQNGRDMYVDQELDI | |
| NRLSDYDVDHIVPQSFLKDDSIDNKVLTRSDKNRGKSDNVPSEEVVKKMKNYWRQLLNAKLITQRKFDNLTKAERGG | |
| LSELDKAGFIKRQLVETRQITKHVAQILDSRMNTKYDENDKLIREVKVITLKSKLVSDFRKDFQFYKVREINNYHHA | |
| NDAYLNAVVGTALIKKYPKLESEFVYGDYKVYDVRKMIAKSEQEIGKATAKYFFYSNIMNFFKTEITLANGEIRKRP | |
| LIETNGETGEIVWDKGRDFATVRKVLSMPQVNIVKKTEVQTGGFSKESILPKRNSDKLIARKKDWDPKKYGGFDSPT | |
| VAYSVLVVAKVEKGKSKKLKSVKELLGITIMERSSFEKNPIDFLEAKGYKEVKKDLIIKLPKYSLFELENGRKRMLA | |
| SAGELQKGNELALPSKYVNFLYLASHYEKLKGSPEDNEQKQLFVEQHKHYLDEIIEQISEFSKRVILADANLDKVLS | |
| AYNKHRDKPIREQAENIIHLFTLTNLGAPAAFKYFDTTIDRKRYTSTKEVLDATLIHQSITGLYETRIDLSQLGGDK | |
| RPAATKKAGQAKKKK | |
| eSpCas9(1.0) amino acid sequence | |
| SEQ ID NO: 4 | |
| MAPKKKRKVGIHGVPAAMDKKYSIGLDIGTNSVGWAVITDEYKVPSKKFKVLGNTDRHSIKKNLIGALLFDSGETAE | |
| ATRLKRTARRRYTRRKNRICYLQEIFSNEMAKVDDSFFHRLEESFLVEEDKKHERHPIFGNIVDEVAYHEKYPTIYH | |
| LRKKLVDSTDKADLRLIYLALAHMIKFRGHFLIEGDLNPDNSDVDKLFIQLVQTYNQLFEENPINASGVDAKAILSA | |
| RLSKSRRLENLIAQLPGEKKNGLFGNLIALSLGLTPNFKSNFDLAEDAKLQLSKDTYDDDLDNLLAQIGDQYADLFL | |
| AAKNLSDAILLSDILRVNTEITKAPLSASMIKRYDEHHQDLTLLKALVRQQLPEKYKEIFFDQSKNGYAGYIDGGAS | |
| QEEFYKFIKPILEKMDGTEELLVKLNREDLLRKQRTFDNGSIPHQIHLGELHAILRRQEDFYPFLKDNREKIEKILT | |
| FRIPYYVGPLARGNSRFAWMTRKSEETITPWNFEEVVDKGASAQSFIERMTNFDKNLPNEKVLPKHSLLYEYFTVYN | |
| ELTKVKYVTEGMRKPAFLSGEQKKAIVDLLFKTNRKVTVKQLKEDYFKKIECFDSVEISGVEDRFNASLGTYHDLLK | |
| IIKDKDFLDNEENEDILEDIVLTLTLFEDREMIEERLKTYAHLFDDKVMKQLKRRRYTGWGRLSRKLINGIRDKQSG | |
| KTILDFLKSDGFANRNFMQLIHDDSLTFKEDIQKAQVSGQGDSLHEHIANLAGSPAIKKGILQTVKVVDELVKVMGR | |
| HKPENIVIEMARENQTTQKGQKNSRERMKRIEEGIKELGSQILKEHPVENTQLQNEALYLYYLQNGRDMYVDQELDI | |
| NRLSDYDVDHIVPQSFLKDDSIDNKVLTRSDKNRGKSDNVPSEEVVKKMKNYWRQLLNAKLITQRKFDNLTKAERGG | |
| LSELDKAGFIKRQLVETRQITKHVAQILDSRMNTKYDENDKLIREVKVITLKSKLVSDFRKDFQFYKVREINNYHHA | |
| NDAYLNAVVGTALIKKYPALESEFVYGDYKVYDVRKMIAKSEQEIGKATAKYFFYSNIMNFFKTEITLANGEIRKRP | |
| LIETNGETGEIVWDKGRDFATVRKVLSMPQVNIVKKTEVQTGGFSKESILPKRNSDKLIARKKDWDPKKYGGFDSPT | |
| VAYSVLVVAKVEKGKSKKLKSVKELLGITIMERSSFEKNPIDFLEAKGYKEVKKDLIIKLPKYSLFELENGRKRMLA | |
| SAGELQKGNELALPSKYVNFLYLASHYEKLKGSPEDNEQKQLFVEQHKHYLDEIIEQISEFSKRVILADANLDKVLS | |
| AYNKHRDKPIREQAENIIHLFTLTNLGAPAAFKYFDTTIDRKRYTSTKEVLDATLIHQSITGLYETRIDLSQLGGDK | |
| RPAATKKAGQAKKKK | |
| eSpCas9(1.1) amino acid sequence | |
| SEQ ID NO: 5 | |
| MAPKKKRKVGIHGVPAAMDKKYSIGLDIGTNSVGWAVITDEYKVPSKKFKVLGNTDRHSIKKNLIGALLFDSGETAE | |
| ATRLKRTARRRYTRRKNRICYLQEIFSNEMAKVDDSFFHRLEESFLVEEDKKHERHPIFGNIVDEVAYHEKYPTIYH | |
| LRKKLVDSTDKADLRLIYLALAHMIKFRGHFLIEGDLNPDNSDVDKLFIQLVQTYNQLFEENPINASGVDAKAILSA | |
| RLSKSRRLENLIAQLPGEKKNGLFGNLIALSLGLTPNFKSNFDLAEDAKLQLSKDTYDDDLDNLLAQIGDQYADLFL | |
| AAKNLSDAILLSDILRVNTEITKAPLSASMIKRYDEHHQDLTLLKALVRQQLPEKYKEIFFDQSKNGYAGYIDGGAS | |
| QEEFYKFIKPILEKMDGTEELLVKLNREDLLRKQRTFDNGSIPHQIHLGELHAILRRQEDFYPFLKDNREKIEKILT | |
| FRIPYYVGPLARGNSRFAWMTRKSEETITPWNFEEVVDKGASAQSFIERMTNFDKNLPNEKVLPKHSLLYEYFTVYN | |
| ELTKVKYVTEGMRKPAFLSGEQKKAIVDLLFKTNRKVTVKQLKEDYFKKIECFDSVEISGVEDRFNASLGTYHDLLK | |
| IIKDKDFLDNEENEDILEDIVLTLTLFEDREMIEERLKTYAHLFDDKVMKQLKRRRYTGWGRLSRKLINGIRDKQSG | |
| KTILDFLKSDGFANRNFMQLIHDDSLTFKEDIQKAQVSGQGDSLHEHIANLAGSPAIKKGILQTVKVVDELVKVMGR | |
| HKPENIVIEMARENQTTQKGQKNSRERMKRIEEGIKELGSQILKEHPVENTQLQNEKLYLYYLQNGRDMYVDQELDI | |
| NRLSDYDVDHIVPQSFLADDSIDNKVLTRSDKNRGKSDNVPSEEVVKKMKNYWRQLLNAKLITQRKFDNLTKAERGG | |
| LSELDKAGFIKRQLVETRQITKHVAQILDSRMNTKYDENDKLIREVKVITLKSKLVSDFRKDFQFYKVREINNYHHA | |
| NDAYLNAVVGTALIKKYPALESEFVYGDYKVYDVRKMIAKSEQEIGKATAKYFFYSNIMNFFKTEITLANGEIRKAP | |
| LIETNGETGEIVWDKGRDFATVRKVLSMPQVNIVKKTEVQTGGFSKESILPKRNSDKLIARKKDWDPKKYGGFDSPT | |
| VAYSVLVVAKVEKGKSKKLKSVKELLGITIMERSSFEKNPIDFLEAKGYKEVKKDLIIKLPKYSLFELENGRKRMLA | |
| SAGELQKGNELALPSKYVNFLYLASHYEKLKGSPEDNEQKQLFVEQHKHYLDEIIEQ1SEFSKRVILADANLDKVLS | |
| AYNKHRDKPIREQAENIIHLFTLTNLGAPAAFKYFDTTIDRKRYTSTKEVLDATLIHQSITGLYETRIDLSQLGGDK | |
| RPAATKKAGQAKKKK | |
| SpCas9-HF1 amino acid sequence | |
| SEQ ID NO: 6 | |
| MAPKKKRKVGIHGVPAAMDKKYSIGLDIGTNSVGWAVITDEYKVPSKKFKVLGNTDRHSIKKNLIGALLFDSGETAE | |
| ATRLKRTARRRYTRRKNRICYLQEIFSNEMAKVDDSFFHRLEESFLVEEDKKHERHPIFGNIVDEVAYHEKYPTIYH | |
| LRKKLVDSTDKADLRLIYLALAHMIKFRGHFLIEGDLNPDNSDVDKLFIQLVQTYNQLFEENPINASGVDAKAILSA | |
| RLSKSRRLENLIAQLPGEKKNGLFGNLIALSLGLTPNFKSNFDLAEDAKLQLSKDTYDDDLDNLLAQIGDQYADLFL | |
| AAKNLSDAILLSDILRVNTEITKAPLSASMIKRYDEHHQDLTLLKALVRQQLPEKYKEIFFDQSKNGYAGYIDGGAS | |
| QEEFYKFIKPILEKMDGTEELLVKLNREDLLRKQRTFDNGSIPHQIHLGELHAILRRQEDFYPFLKDNREKIEKILT | |
| FRIPYYVGPLARGNSRFAWMTRKSEETITPWNFEEVVDKGASAQSFIERMTAFDKNLPNEKVLPKHSLLYEYFTVYN | |
| ELTKVKYVTEGMRKPAFLSGEQKKAIVDLLFKTNRKVTVKQLKEDYFKKIECFDSVEISGVEDRFNASLGTYHDLLK | |
| IIKDKDFLDNEENEDILEDIVLTLTLFEDREMIEERLKTYAHLFDDKVMKQLKRRRYTGWGALSRKLINGIRDKQSG | |
| KTILDFLKSDGFANRNFMALIHDDSLTFKEDIQKAQVSGQGDSLHEHIANLAGSPAIKKGILQTVKVVDELVKVMGR | |
| HKPENIVIEMARENQTTQKGQKNSRERMKRIEEGIKELGSQILKEHPVENTQLQNEKLYLYYLQNGRDMYVDQELDI | |
| NRLSDYDVDHIVPQSFLKDDSIDNKVLTRSDKNRGKSDNVPSEEVVKKMKNYWRQLLNAKLITQRKFDNLTKAERGG | |
| LSELDKAGFIKRQLVETRAITKHVAQILDSRMNTKYDENDKLIREVKVITLKSKLVSDFRKDFQFYKVREINNYHHA | |
| NDAYLNAVVGTALIKKYPKLESEFVYGDYKVYDVRKMIAKSEQEIGKATAKYFFYSNIMNFFKTEITLANGEIRKAP | |
| LIETNGETGEIVWDKGRDFATVRKVLSMPQVNIVKKTEVQTGGFSKESILPKRNSDKLIARKKDWDPKKYGGFDSPT | |
| VYSVLVVAKVEKGKSKKLKSVKELLGITIMERSSFEKNPIDFLEAKGYKEVKKDLIIKLPKYSLFELENGRKRMLAS | |
| AGELQKGNELALPSKYVNFLYLASHYEKLKGSPEDNEQKQLFVEQHKHYLDEIIEQISEFSKRVILADANLDKVLSA | |
| YNKHRDKPIREQAENIIHLFTLTNLGAPAAFKYFDTTIDRKRYTSTKEVLDATLIHQSITGLYETRIDLSQLGGDKR | |
| PAATKKAGQAKKKK | |
| eSpCas9(1.0) codon-optimized nucleotide sequence | |
| SEQ ID NO: 7 | |
| atggcccctaagaagaagagaaaggtcggtattcacggcgttcctgcggcgatggacaagaagtatagtattggtct | |
| ggacattgggacgaattccgttggctgggccgtgatcaccgatgagtacaaggtcccttccaagaagtttaaggttc | |
| tggggaacaccgatcggcacagcatcaagaagaatctcattggagccctcctgttcgactcaggcgagaccgccgaa | |
| gcaacaaggctcaagagaaccgcaaggagacggtatacaagaaggaagaataggatctgctacctgcaggagatttt | |
| cagcaacgaaatggcgaaggtggacgattcgttctttcatagattggaggagagtttcctcgtcgaggaagataaga | |
| agcacgagaggcatcctatctttggcaacattgtcgacgaggttgcctatcacgaaaagtaccccacaatctatcat | |
| ctgcggaagaagcttgtggactcgactgataaggcggaccttagattgatctacctcgctctggcacacatgattaa | |
| gttcaggggccattttctgatcgagggggatcttaacccggacaatagcgatgtggacaagttgttcatccagctcg | |
| tccaaacctacaatcagctctttgaggaaaacccaattaatgcttcaggcgtcgacgccaaggcgatcctgtctgca | |
| cgcctttcaaagtctcgccggcttgagaacttgatcgctcaactcccgggcgaaaagaagaacggcttgttcgggaa | |
| tctcattgcactttcgttggggctcacaccaaacttcaagagtaattttgatctcgctgaggacgcaaagctgcagc | |
| tttccaaggacacttatgacgatgacctggataaccttttggcccaaatcggcgatcagtacgcggacttgttcctc | |
| gccgcgaagaatttgtcggacgcgatcctcctgagtgatattctccgcgtgaacaccgagattacaaaggccccgct | |
| ctcggcgagtatgatcaagcgctatgacgagcaccatcaggatctgacccttttgaaggctttggtccggcagcaac | |
| tcccagagaagtacaaggaaatcttctttgatcaatccaagaacggctacgctggttatattgacggcggggcatcg | |
| caggaggaattctacaagtttatcaagccaattctggagaagatggatggcacagaggaactcctggtgaagctcaa | |
| tagggaggaccttttgcggaagcaaagaactttcgataacggcagcatccctcaccagattcatctcggggagctgc | |
| acgccatcctgagaaggcaggaagacttctacccctttcttaaggataaccgggagaagatcgaaaagattctgacg | |
| ttcagaattccgtactatgtcggaccactcgcccggggtaattccagatttgcgtggatgaccagaaagagcgagga | |
| aaccatcacaccttggaacttcgaggaagtggtcgataagggcgcttccgcacagagcttcattgagcgcatgacaa | |
| attttgacaagaacctgcctaatgagaaggtccttcccaagcattccctcctgtacgagtatttcactgtttataac | |
| gaactcacgaaggtgaagtatgtgaccgagggaatgcgcaagcccgccttcctgagcggcgagcaaaagaaggcgat | |
| cgtggaccttttgtttaagaccaatcggaaggtcacagttaagcagctcaaggaggactacttcaagaagattgaat | |
| gcttcgattccgttgagatcagcggcgtggaagacaggtttaacgcgtcactggggacttaccacgatctcctgaag | |
| atcattaaggataaggacttcttggacaacgaggaaaatgaggatatcctcgaagacattgtcctgactcttacgtt | |
| gtttgaggatagggaaatgatcgaggaacgcttgaagacgtatgcccatctcttcgatgacaaggttatgaagcagc | |
| tcaagagaagaagatacaccggatggggaaggctgtcccgcaagcttatcaatggcattagagacaagcaatcaggg | |
| aagacaatccttgactttttgaagtctgatggcttcgcgaacaggaattttatgcagctgattcacgatgactcact | |
| tactttcaaggaggatatccagaaggctcaagtgtcgggacaaggtgacagtctgcacgagcatatcgccaaccttg | |
| cgggatctcctgcaatcaagaagggtattctgcagacagtcaaggttgtggatgagcttgtgaaggtcatgggacgg | |
| cataagcccgagaacatcgttattgagatggccagagaaaatcagaccacacaaaagggtcagaagaactcgaggga | |
| gcgcatgaagcgcatcgaggaaggcattaaggagctggggagtcagatccttaaggagcacccggtggaaaacacgc | |
| agttgcaaaatgaggccctctatctgtactatctgcaaaatggcagggatatgtatgtggaccaggagttggatatt | |
| aaccgcctctcggattacgacgtcgatcatatcgttcctcagtccttccttaaggatgacagcattgacaataaggt | |
| tctcaccaggtccgacaagaaccgcgggaagtccgataatgtgcccagcgaggaagtcgttaagaagatgaagaact | |
| actggaggcaacttttgaatgccaagttgatcacacagaggaagtttgataacctcactaaggccgagcgcggaggt | |
| ctcagcgaactggacaaggcgggcttcattaagcggcaactggttgagactagacagatcacgaagcacgtggcgca | |
| gattctcgattcacgcatgaacacgaagtacgatgagaatgacaagctgatccgggaagtgaaggtcatcaccttga | |
| agtcaaagctcgtttctgacttcaggaaggatttccaattttataaggtgcgcgagatcaacaattatcaccatgct | |
| catgacgcatacctcaacgctgtggtcggaacagcattgattaagaagtacccggcgctcgagtccgaattcgtgta | |
| cggtgactataaggtttacgatgtgcgcaagatgatcgccaagtcagagcaggaaattggcaaggccactgcgaagt | |
| atttcttttactctaacattatgaatttctttaagactgagatcacgctggctaatggcgaaatccggaaggcgcca | |
| cttattgagaccaacggcgagacaggggaaatcgtgtgggacaaggggagggatttcgccacagtccgcaaggttct | |
| ctctatgcctcaagtgaatattgtcaagaagactgaagtccagacgggcgggttctcaaaggaatctattctgccca | |
| agcggaactcggataagcttatcgccagaaagaaggactgggacccgaagaagtatggaggtttcgactcaccaacg | |
| gtggcttactctgtcctggttgtggcaaaggtggagaagggaaagtcaaagaagctcaagtctgtcaaggagctcct | |
| gggtatcaccattatggagaggtccagcttcgaaaagaatccgatcgattttctcgaggcgaagggatataaggaag | |
| tgaagaaggacctgatcattaagcttccaaagtacagtcttttcgagttggaaaacggcaggaagcgcatgttggct | |
| tccgcaggagagctccagaagggtaacgagcttgctttgccgtccaagtatgtgaacttcctctatctggcatccca | |
| ctacgagaagctcaagggcagcccagaggataacgaacagaagcaactgtttgtggagcaacacaagcattatcttg | |
| acgagatcattgaacagatttcggagttcagtaagcgcgtcatcctcgccgacgcgaatttggataaggttctctca | |
| gcctacaacaagcaccgggacaagcctatcagagagcaggcggaaaatatcattcatctcttcaccctgacaaacct | |
| tggggctcccgctgcattcaagtattttgacactacgattgatcggaagagatacacttctacgaaggaggtgctgg | |
| atgcaacccttatccaccaatcgattactggcctctacgagacgcggatcgacttgagtcagctcgggggggataag | |
| agaccagcggcaaccaagaaggcaggacaagcgaagaagaagaagtag | |
| eSpCas9(1.1) codon-optimized nucleotide sequence | |
| SEQ ID NO: 8 | |
| atggcccctaagaagaagagaaaggtcggtattcacggcgttcctgcggcgatggacaagaagtatagtattggtct | |
| ggacattgggacgaattccgttggctgggccgtgatcaccgatgagtacaaggtcccttccaagaagtttaaggttc | |
| tggggaacaccgatcggcacagcatcaagaagaatctcattggagccctcctgttcgactcaggcgagaccgccgaa | |
| gcaacaaggctcaagagaaccgcaaggagacggtatacaagaaggaagaataggatctgctacctgcaggagatttt | |
| cagcaacgaaatggcgaaggtggacgattcgttctttcatagattggaggagagtttcctcgtcgaggaagataaga | |
| agcacgagaggcatcctatctttggcaacattgtcgacgaggttgcctatcacgaaaagtaccccacaatctatcat | |
| ctgcggaagaagcttgtggactcgactgataaggcggaccttagattgatctacctcgctctggcacacatgattaa | |
| gttcaggggccattttctgatcgagggggatcttaacccggacaatagcgatgtggacaagttgttcatccagctcg | |
| tccaaacctacaatcagctctttgaggaaaacccaattaatgcttcaggcgtcgacgccaaggcgatcctgtctgca | |
| cgcctttcaaagtctcgccggcttgagaacttgatcgctcaactcccgggcgaaaagaagaacggcttgttcgggaa | |
| tctcattgcactttcgttggggctcacaccaaacttcaagagtaattttgatctcgctgaggacgcaaagctgcagc | |
| tttccaaggacacttatgacgatgacctggataaccttttggcccaaatcggcgatcagtacgcggacttgttcctc | |
| gccgcgaagaatttgtcggacgcgatcctcctgagtgatattctccgcgtgaacaccgagattacaaaggccccgct | |
| ctcggcgagtatgatcaagcgctatgacgagcaccatcaggatctgacccttttgaaggctttggtccggcagcaac | |
| tcccagagaagtacaaggaaatcttctttgatcaatccaagaacggctacgctggttatattgacggcggggcatcg | |
| caggaggaattctacaagtttatcaagccaattctggagaagatggatggcacagaggaactcctggtgaagctcaa | |
| tagggaggaccttttgcggaagcaaagaactttcgataacggcagcatccctcaccagattcatctcggggagctgc | |
| acgccatcctgagaaggcaggaagacttctacccctttcttaaggataaccgggagaagatcgaaaagattctgacg | |
| ttcagaattccgtactatgtcggaccactcgcccggggtaattccagatttgcgtggatgaccagaaagagcgagga | |
| aaccatcacaccttggaacttcgaggaagtggtcgataagggcgcttccgcacagagcttcattgagcgcatgacaa | |
| attttgacaagaacctgcctaatgagaaggtccttcccaagcattccctcctgtacgagtatttcactgtttataac | |
| gaactcacgaaggtgaagtatgtgaccgagggaatgcgcaagcccgccttcctgagcggcgagcaaaagaaggcgat | |
| cgtggaccttttgtttaagaccaatcggaaggtcacagttaagcagctcaaggaggactacttcaagaagattgaat | |
| gcttcgattccgttgagatcagcggcgtggaagacaggtttaacgcgtcactggggacttaccacgatctcctgaag | |
| atcattaaggataaggacttcttggacaacgaggaaaatgaggatatcctcgaagacattgtcctgactcttacgtt | |
| gtttgaggatagggaaatgatcgaggaacgcttgaagacgtatgcccatctcttcgatgacaaggttatgaagcagc | |
| tcaagagaagaagatacaccggatggggaaggctgtcccgcaagcttatcaatggcattagagacaagcaatcaggg | |
| aagacaatccttgactttttgaagtctgatggcttcgcgaacaggaattttatgcagctgattcacgatgactcact | |
| tactttcaaggaggatatccagaaggctcaagtgtcgggacaaggtgacagtctgcacgagcatatcgccaaccttg | |
| cgggatctcctgcaatcaagaagggtattctgcagacagtcaaggttgtggatgagcttgtgaaggtcatgggacgg | |
| cataagcccgagaacatcgttattgagatggccagagaaaatcagaccacacaaaagggtcagaagaactcgaggga | |
| gcgcatgaagcgcatcgaggaaggcattaaggagctggggagtcagatccttaaggagcacccggtggaaaacacgc | |
| agttgcaaaatgagaagctctatctgtactatctgcaaaatggcagggatatgtatgtggaccaggagttggatatt | |
| aaccgcctctcggattacgacgtcgatcatatcgttcctcagtccttccttgcggatgacagcattgacaataaggt | |
| tctcaccaggtccgacaagaaccgcgggaagtccgataatgtgcccagcgaggaagtcgttaagaagatgaagaact | |
| actggaggcaacttttgaatgccaagttgatcacacagaggaagtttgataacctcactaaggccgagcgcggaggt | |
| ctcagcgaactggacaaggcgggcttcattaagcggcaactggttgagactagacagatcacgaagcacgtggcgca | |
| gattctcgattcacgcatgaacacgaagtacgatgagaatgacaagctgatccgggaagtgaaggtcatcaccttga | |
| agtcaaagctcgtttctgacttcaggaaggatttccaattttataaggtgcgcgagatcaacaattatcaccatgct | |
| catgacgcatacctcaacgctgtggtcggaacagcattgattaagaagtacccggcgctcgagtccgaattcgtgta | |
| cggtgactataaggtttacgatgtgcgcaagatgatcgccaagtcagagcaggaaattggcaaggccactgcgaagt | |
| atttcttttactctaacattatgaatttctttaagactgagatcacgctggctaatggcgaaatccggaaggcgcca | |
| cttattgagaccaacggcgagacaggggaaatcgtgtgggacaaggggagggatttcgccacagtccgcaaggttct | |
| ctctatgcctcaagtgaatattgtcaagaagactgaagtccagacgggcgggttctcaaaggaatctattctgccca | |
| agcggaactcggataagcttatcgccagaaagaaggactgggacccgaagaagtatggaggtttcgactcaccaacg | |
| gtggcttactctgtcctggttgtggcaaaggtggagaagggaaagtcaaagaagctcaagtctgtcaaggagctcct | |
| gggtatcaccattatggagaggtccagcttcgaaaagaatccgatcgattttctcgaggcgaagggatataaggaag | |
| tgaagaaggacctgatcattaagcttccaaagtacagtcttttcgagttggaaaacggcaggaagcgcatgttggct | |
| tccgcaggagagctccagaagggtaacgagcttgctttgccgtccaagtatgtgaacttcctctatctggcatccca | |
| ctacgagaagctcaagggcagcccagaggataacgaacagaagcaactgtttgtggagcaacacaagcattatcttg | |
| acgagatcattgaacagatttcggagttcagtaagcgcgtcatcctcgccgacgcgaatttggataaggttctctca | |
| gcctacaacaagcaccgggacaagcctatcagagagcaggcggaaaatatcattcatctcttcaccctgacaaacct | |
| tggggctcccgctgcattcaagtattttgacactacgattgatcggaagagatacacttctacgaaggaggtgctgg | |
| atgcaacccttatccaccaatcgattactggcctctacgagacgcggatcgacttgagtcagctcgggggggataag | |
| agaccagcggcaaccaagaaggcaggacaagcgaagaagaagaagtag | |
| SpCas9-HF1 codon-optimized nucleotide sequence | |
| SEQ ID NO: 9 | |
| atggcccctaagaagaagagaaaggtcggtattcacggcgttcctgcggcgatggacaagaagtatagtattggtct | |
| ggacattgggacgaattccgttggctgggccgtgatcaccgatgagtacaaggtcccttccaagaagtttaaggttc | |
| tggggaacaccgatcggcacagcatcaagaagaatctcattggagccctcctgttcgactcaggcgagaccgccgaa | |
| gcaacaaggctcaagagaaccgcaaggagacggtatacaagaaggaagaataggatctgctacctgcaggagatttt | |
| cagcaacgaaatggcgaaggtggacgattcgttctttcatagattggaggagagtttcctcgtcgaggaagataaga | |
| agcacgagaggcatcctatctttggcaacattgtcgacgaggttgcctatcacgaaaagtaccccacaatctatcat | |
| ctgcggaagaagcttgtggactcgactgataaggcggaccttagattgatctacctcgctctggcacacatgattaa | |
| gttcaggggccattttctgatcgagggggatcttaacccggacaatagcgatgtggacaagttgttcatccagctcg | |
| tccaaacctacaatcagctctttgaggaaaacccaattaatgcttcaggcgtcgacgccaaggcgatcctgtctgca | |
| cgcctttcaaagtctcgccggcttgagaacttgatcgctcaactcccgggcgaaaagaagaacggcttgttcgggaa | |
| tctcattgcactttcgttggggctcacaccaaacttcaagagtaattttgatctcgctgaggacgcaaagctgcagc | |
| tttccaaggacacttatgacgatgacctggataaccttttggcccaaatcggcgatcagtacgcggacttgttcctc | |
| gccgcgaagaatttgtcggacgcgatcctcctgagtgatattctccgcgtgaacaccgagattacaaaggccccgct | |
| ctcggcgagtatgatcaagcgctatgacgagcaccatcaggatctgacccttttgaaggctttggtccggcagcaac | |
| tcccagagaagtacaaggaaatcttctttgatcaatccaagaacggctacgctggttatattgacggcggggcatcg | |
| caggaggaattctacaagtttatcaagccaattctggagaagatggatggcacagaggaactcctggtgaagctcaa | |
| tagggaggaccttttgcggaagcaaagaactttcgataacggcagcatccctcaccagattcatctcggggagctgc | |
| acgccatcctgagaaggcaggaagacttctacccctttcttaaggataaccgggagaagatcgaaaagattctgacg | |
| ttcagaattccgtactatgtcggaccactcgcccggggtaattccagatttgcgtggatgaccagaaagagcgagga | |
| aaccatcacaccttggaacttcgaggaagtggtcgataagggcgcttccgcacagagcttcattgagcgcatgacaG | |
| CCtttgacaagaacctgcctaatgagaaggtccttcccaagcattccctcctgtacgagtatttcactgtttataac | |
| gaactcacgaaggtgaagtatgtgaccgagggaatgcgcaagcccgccttcctgagcggcgagcaaaagaaggcgat | |
| cgtggaccttttgtttaagaccaatcggaaggtcacagttaagcagctcaaggaggactacttcaagaagattgaat | |
| gcttcgattccgttgagatcagcggcgtggaagacaggtttaacgcgtcactggggacttaccacgatctcctgaag | |
| atcattaaggataaggacttcttggacaacgaggaaaatgaggatatcctcgaagacattgtcctgactcttacgtt | |
| gtttgaggatagggaaatgatcgaggaacgcttgaagacgtatgcccatctcttcgatgacaaggttatgaagcagc | |
| tcaagagaagaagatacaccggatggggaGCCctgtcccgcaagcttatcaatggcattagagacaagcaatcaggg | |
| aagacaatccttgactttttgaagtctgatggcttcgcgaacaggaattttatgGCCctgattcacgatgactcact | |
| tactttcaaggaggatatccagaaggctcaagtgtcgggacaaggtgacagtctgcacgagcatatcgccaaccttg | |
| cgggatctcctgcaatcaagaagggtattctgcagacagtcaaggttgtggatgagcttgtgaaggtcatgggacgg | |
| cataagcccgagaacatcgttattgagatggccagagaaaatcagaccacacaaaagggtcagaagaactcgaggga | |
| gcgcatgaagcgcatcgaggaaggcattaaggagctggggagtcagatccttaaggagcacccggtggaaaacacgc | |
| agttgcaaaatgagaagctctatctgtactatctgcaaaatggcagggatatgtatgtggaccaggagttggatatt | |
| aaccgcctctcggattacgacgtcgatcatatcgttcctcagtccttccttaaggatgacagcattgacaataaggt | |
| tctcaccaggtccgacaagaaccgcgggaagtccgataatgtgcccagcgaggaagtcgttaagaagatgaagaact | |
| actggaggcaacttttgaatgccaagttgatcacacagaggaagtttgataacctcactaaggccgagcgcggaggt | |
| ctcagcgaactggacaaggcgggcttcattaagcggcaactggttgagactagaGCCatcacgaagcacgtggcgca | |
| gattctcgattcacgcatgaacacgaagtacgatgagaatgacaagctgatccgggaagtgaaggtcatcaccttga | |
| agtcaaagctcgtttctgacttcaggaaggatttccaattttataaggtgcgcgagatcaacaattatcaccatgct | |
| catgacgcatacctcaacgctgtggtcggaacagcattgattaagaagtacccgaagctcgagtccgaattcgtgta | |
| cggtgactataaggtttacgatgtgcgcaagatgatcgccaagtcagagcaggaaattggcaaggccactgcgaagt | |
| atttcttttactctaacattatgaatttctttaagactgagatcacgctggctaatggcgaaatccggaagagacca | |
| cttattgagaccaacggcgagacaggggaaatcgtgtgggacaaggggagggatttcgccacagtccgcaaggttct | |
| ctctatgcctcaagtgaatattgtcaagaagactgaagtccagacgggcgggttctcaaaggaatctattctgccca | |
| agcggaactcggataagcttatcgccagaaagaaggactgggacccgaagaagtatggaggtttcgactcaccaacg | |
| gtggcttactctgtcctggttgtggcaaaggtggagaagggaaagtcaaagaagctcaagtctgtcaaggagctcct | |
| gggtatcaccattatggagaggtccagcttcgaaaagaatccgatcgattttctcgaggcgaagggatataaggaag | |
| tgaagaaggacctgatcattaagcttccaaagtacagtcttttcgagttggaaaacggcaggaagcgcatgttggct | |
| tccgcaggagagctccagaagggtaacgagcttgctttgccgtccaagtatgtgaacttcctctatctggcatccca | |
| ctacgagaagctcaagggcagcccagaggataacgaacagaagcaactgtttgtggagcaacacaagcattatcttg | |
| acgagatcattgaacagatttcggagttcagtaagcgcgtcatcctcgccgacgcgaatttggataaggttctctca | |
| gcctacaacaagcaccgggacaagcctatcagagagcaggcggaaaatatcattcatctcttcaccctgacaaacct | |
| tggggctcccgctgcattcaagtattttgacactacgattgatcggaagagatacacttctacgaaggaggtgctgg | |
| atgcaacccttatccaccaatcgattactggcctctacgagacgcggatcgacttgagtcagctcgggggggataag | |
| agaccagcggcaaccaagaaggcaggacaagcgaagaagaagaagtag | |
| pJIT163-SpCas9 vector sequence | |
| SEQ ID NO: 10 | |
| gagctcggtacctgacccggtcgtgcccctctctagagataatgagcattgcatgtctaagttataaaaaattacca | |
| catattttttttgtcacacttgtttgaagtgcagtttatctatctttatacatatatttaaactttactctacgaat | |
| aatataatctatagtactacaataatatcagtgttttagagaatcatataaatgaacagttagacatggtctaaagg | |
| acaattgagtattttgacaacaggactctacagttttatctttttagtgtgcatgtgttctcctttttttttgcaaa | |
| tagcttcacctatataatacttcatccattttattagtacatccatttagggtttagggttaatggtttttatagac | |
| taatttttttagtacatctattttattctattttagcctctaaattaagaaaactaaaactctattttagttttttt | |
| atttaataatttagatataaaatagaataaaataaagtgactaaaaattaaacaaataccctttaagaaattaaaaa | |
| aactaaggaaacatttttcttgtttcgagtagataatgccagcctgttaaacgccgtcgacgagtctaacggacacc | |
| aaccagcgaaccagcagcgtcgcgtcgggccaagcgaagcagacggcacggcatctctgtcgctgcctctggacccc | |
| tctcgatcgagagttccgctccaccgttggacttgctccgctgtcggcatccagaaattgcgtggcggagcggcaga | |
| cgtgagccggcacggcaggcggcctcctcctcctctcacggcaccggcagctacgggggattcctttcccaccgctc | |
| cttcgctttcccttcctcgcccgccgtaataaatagacaccccctccacaccctctttccccaacctcgtgttgttc | |
| ggagcgcacacacacacaaccagatctcccccaaatccacccgtcggcacctccgcttcaaggtacgccgctcgtcc | |
| tccccccccccccctctctaccttctctagatcggcgttccggtccatggttagggcccggtagttctacttctgtt | |
| catgtttgtgttagatccgtgtttgtgttagatccgtgctgctagcgttcgtacacggatgcgacctgtacgtcaga | |
| cacgttctgattgctaacttgccagtgtttctctttggggaatcctgggatggctctagccgttccgcagacgggat | |
| cgatttcatgattttttttgtttcgttgcatagggtttggtttgcccttttcctttatttcaatatatgccgtgcac | |
| ttgtttgtcgggtcatcttttcatgcttttttttgtcttggttgtgatgatgtggtctggttgggcggtcgttctag | |
| atcggagtagaattaattctgtttcaaactacctggtggatttattaattttggatctgtatgtgtgtgccatacat | |
| attcatagttacgaattgaagatgatggatggaaatatcgatctaggataggtatacatgttgatgcgggttttact | |
| gatgcatatacagagatgctttttgttcgcttggttgtgatgatgtggtgtggttgggcggtcgttcattcgttcta | |
| gatcggagtagaatactgtttcaaactacctggtgtatttattaattttggaactgtatgtgtgtgtcatacatctt | |
| catagttacgagtttaagatggatggaaatatcgatctaggataggtatacatgttgatgtgggttttactgatgca | |
| tatacatgatggcatatgcagcatctattcatatgctctaaccttgagtacctatctattataataaacaagtatgt | |
| tttataattattttgatcttgatatacttggatgatggcatatgcagcagctatatgtggatttttttagccctgcc | |
| ttcatacgctatttatttgcttggtactgtttcttttgtcgatgctcaccctgttgtttggtgttacttctgcaaag | |
| cttccaccatggcgtgcaggtcgactctagaggatccccatggcccctaagaagaagagaaaggtcggtattcacgg | |
| cgttcctgcggcgatggacaagaagtatagtattggtctggacattgggacgaattccgttggctgggccgtgatca | |
| ccgatgagtacaaggtcccttccaagaagtttaaggttctggggaacaccgatcggcacagcatcaagaagaatctc | |
| attggagccctcctgttcgactcaggcgagaccgccgaagcaacaaggctcaagagaaccgcaaggagacggtatac | |
| aagaaggaagaataggatctgctacctgcaggagattttcagcaacgaaatggcgaaggtggacgattcgttctttc | |
| atagattggaggagagtttcctcgtcgaggaagataagaagcacgagaggcatcctatctttggcaacattgtcgac | |
| gaggttgcctatcacgaaaagtaccccacaatctatcatctgcggaagaagcttgtggactcgactgataaggcgga | |
| ccttagattgatctacctcgctctggcacacatgattaagttcaggggccattttctgatcgagggggatcttaacc | |
| cggacaatagcgatgtggacaagttgttcatccagctcgtccaaacctacaatcagctctttgaggaaaacccaatt | |
| aatgcttcaggcgtcgacgccaaggcgatcctgtctgcacgcctttcaaagtctcgccggcttgagaacttgatcgc | |
| tcaactcccgggcgaaaagaagaacggcttgttcgggaatctcattgcactttcgttggggctcacaccaaacttca | |
| agagtaattttgatctcgctgaggacgcaaagctgcagctttccaaggacacttatgacgatgacctggataacctt | |
| ttggcccaaatcggcgatcagtacgcggacttgttcctcgccgcgaagaatttgtcggacgcgatcctcctgagtga | |
| tattctccgcgtgaacaccgagattacaaaggccccgctctcggcgagtatgatcaagcgctatgacgagcaccatc | |
| aggatctgacccttttgaaggctttggtccggcagcaactcccagagaagtacaaggaaatcttctttgatcaatcc | |
| aagaacggctacgctggttatattgacggcggggcatcgcaggaggaattctacaagtttatcaagccaattctgga | |
| gaagatggatggcacagaggaactcctggtgaagctcaatagggaggaccttttgcggaagcaaagaactttcgata | |
| acggcagcatccctcaccagattcatctcggggagctgcacgccatcctgagaaggcaggaagacttctaccccttt | |
| cttaaggataaccgggagaagatcgaaaagattctgacgttcagaattccgtactatgtcggaccactcgcccgggg | |
| taattccagatttgcgtggatgaccagaaagagcgaggaaaccatcacaccttggaacttcgaggaagtggtcgata | |
| agggcgcttccgcacagagcttcattgagcgcatgacaaattttgacaagaacctgcctaatgagaaggtccttccc | |
| aagcattccctcctgtacgagtatttcactgtttataacgaactcacgaaggtgaagtatgtgaccgagggaatgcg | |
| caagcccgccttcctgagcggcgagcaaaagaaggcgatcgtggaccttttgtttaagaccaatcggaaggtcacag | |
| ttaagcagctcaaggaggactacttcaagaagattgaatgcttcgattccgttgagatcagcggcgtggaagacagg | |
| tttaacgcgtcactggggacttaccacgatctcctgaagatcattaaggataaggacttcttggacaacgaggaaaa | |
| tgaggatatcctcgaagacattgtcctgactcttacgttgtttgaggatagggaaatgatcgaggaacgcttgaaga | |
| cgtatgcccatctcttcgatgacaaggttatgaagcagctcaagagaagaagatacaccggatggggaaggctgtcc | |
| cgcaagcttatcaatggcattagagacaagcaatcagggaagacaatccttgactttttgaagtctgatggcttcgc | |
| gaacaggaattttatgcagctgattcacgatgactcacttactttcaaggaggatatccagaaggctcaagtgtcgg | |
| gacaaggtgacagtctgcacgagcatatcgccaaccttgcgggatctcctgcaatcaagaagggtattctgcagaca | |
| gtcaaggttgtggatgagcttgtgaaggtcatgggacggcataagcccgagaacatcgttattgagatggccagaga | |
| aaatcagaccacacaaaagggtcagaagaactcgagggagcgcatgaagcgcatcgaggaaggcattaaggagctgg | |
| ggagtcagatccttaaggagcacccggtggaaaacacgcagttgcaaaatgagaagctctatctgtactatctgcaa | |
| aatggcagggatatgtatgtggaccaggagttggatattaaccgcctctcggattacgacgtcgatcatatcgttcc | |
| tcagtccttccttaaggatgacagcattgacaataaggttctcaccaggtccgacaagaaccgcgggaagtccgata | |
| atgtgcccagcgaggaagtcgttaagaagatgaagaactactggaggcaacttttgaatgccaagttgatcacacag | |
| aggaagtttgataacctcactaaggccgagcgcggaggtctcagcgaactggacaaggcgggcttcattaagcggca | |
| actggttgagactagacagatcacgaagcacgtggcgcagattctcgattcacgcatgaacacgaagtacgatgaga | |
| atgacaagctgatccgggaagtgaaggtcatcaccttgaagtcaaagctcgtttctgacttcaggaaggatttccaa | |
| ttttataaggtgcgcgagatcaacaattatcaccatgctcatgacgcatacctcaacgctgtggtcggaacagcatt | |
| gattaagaagtacccgaagctcgagtccgaattcgtgtacggtgactataaggtttacgatgtgcgcaagatgatcg | |
| ccaagtcagagcaggaaattggcaaggccactgcgaagtatttcttttactctaacattatgaatttctttaagact | |
| gagatcacgctggctaatggcgaaatccggaagagaccacttattgagaccaacggcgagacaggggaaatcgtgtg | |
| ggacaaggggagggatttcgccacagtccgcaaggttctctctatgcctcaagtgaatattgtcaagaagactgaag | |
| tccagacgggcgggttctcaaaggaatctattctgcccaagcggaactcggataagcttatcgccagaaagaaggac | |
| tgggacccgaagaagtatggaggtttcgactcaccaacggtggcttactctgtcctggttgtggcaaaggtggagaa | |
| gggaaagtcaaagaagctcaagtctgtcaaggagctcctgggtatcaccattatggagaggtccagcttcgaaaaga | |
| atccgatcgattttctcgaggcgaagggatataaggaagtgaagaaggacctgatcattaagcttccaaagtacagt | |
| cttttcgagttggaaaacggcaggaagcgcatgttggcttccgcaggagagctccagaagggtaacgagcttgcttt | |
| gccgtccaagtatgtgaacttcctctatctggcatcccactacgagaagctcaagggcagcccagaggataacgaac | |
| agaagcaactgtttgtggagcaacacaagcattatcttgacgagatcattgaacagatttcggagttcagtaagcgc | |
| gtcatcctcgccgacgcgaatttggataaggttctctcagcctacaacaagcaccgggacaagcctatcagagagca | |
| ggcggaaaatatcattcatctcttcaccctgacaaaccttggggctcccgctgcattcaagtattttgacactacga | |
| ttgatcggaagagatacacttctacgaaggaggtgctggatgcaacccttatccaccaatcgattactggcctctac | |
| gagacgcggatcgacttgagtcagctcgggggggataagagaccagcggcaaccaagaaggcaggacaagcgaagaa | |
| gaagaagtaggggcgagctcgaattcgctgaaatcaccagtctctctctacaaatctatctctctctattttctcca | |
| taaataatgtgtgagtagtttcccgataagggaaattagggttcttatagggtttcgctcatgtgttgagcatataa | |
| gaaacccttagtatgtatttgtatttgtaaaatacttctatcaataaaatttctaattcctaaaaccaaaatccagt | |
| actaaaatccagatctcctaaagtccctatagatctttgtcgtgaatataaaccagacacgagacgactaaacctgg | |
| agcccagacgccgttcgaagctagaagtaccgcttaggcaggaggccgttagggaaaagatgctaaggcagggttgg | |
| ttacgttgactcccccgtaggtttggtttaaatatgatgaagtggacggaaggaaggaggaagacaaggaaggataa | |
| ggttgcaggccctgtgcaaggtaagaagatggaaatttgatagaggtacgctactatacttatactatacgctaagg | |
| gaatgcttgtatttataccctataccccctaataaccccttatcaatttaagaaataatccgcataagcccccgctt | |
| aaaaattggtatcagagccatgaataggtctatgaccaaaactcaagaggataaaacctcaccaaaatacgaaagag | |
| ttcttaactctaaagataaaagatctttcaagatcaaaactagttccctcacaccggagcatgcgatatcctcgaga | |
| gatctaggcgtaatcatggtcatagctgtttcctgtgtgaaattgttatccgctcacaattccacacaacatacgag | |
| ccggaagcataaagtgtaaagcctggggtgcctaatgagtgagctaactcacattaattgcgttgcgctcactgccc | |
| gctttccagtcgggaaacctgtcgtgccagctgcattaatgaatcggccaacgcgcggggagaggcggtttgcgtat | |
| tgggcgctcttccgcttcctcgctcactgactcgctgcgctcggtcgttcggctgcggcgagcggtatcagctcact | |
| caaaggcggtaatacggttatccacagaatcaggggataacgcaggaaagaacatgtgagcaaaaggccagcaaaag | |
| gccaggaaccgtaaaaaggccgcgttgctggcgtttttccataggctccgcccccctgacgagcatcacaaaaatcg | |
| acgctcaagtcagaggtggcgaaacccgacaggactataaagataccaggcgtttccccctggaagctccctcgtgc | |
| gctctcctgttccgaccctgccgcttaccggatacctgtccgcctttctcccttcgggaagcgtggcgctttctcaa | |
| tgctcacgctgtaggtatctcagttcggtgtaggtcgttcgctccaagctgggctgtgtgcacgaaccccccgttca | |
| gcccgaccgctgcgccttatccggtaactatcgtcttgagtccaacccggtaagacacgacttatcgccactggcag | |
| cagccactggtaacaggattagcagagcgaggtatgtaggcggtgctacagagttcttgaagtggtggcctaactac | |
| ggctacactagaaggacagtatttggtatctgcgctctgctgaagccagttaccttcggaaaaagagttggtagctc | |
| ttgatccggcaaacaaaccaccgctggtagcggtggtttttttgtttgcaagcagcagattacgcgcagaaaaaaag | |
| gatctcaagaagatcctttgatcttttctacggggtctgacgctcagtggaacgaaaactcacgttaagggattttg | |
| gtcatgagattatcaaaaaggatcttcacctagatccttttaaattaaaaatgaagttttaaatcaatctaaagtat | |
| atatgagtaaacttggtctgacagttaccaatgcttaatcagtgaggcacctatctcagcgatctgtctatttcgtt | |
| catccatagttgcctgactccccgtcgtgtagataactacgatacgggagggcttaccatctggccccagtgctgca | |
| atgataccgcgagacccacgctcaccggctccagatttatcagcaataaaccagccagccggaagggccgagcgcag | |
| aagtggtcctgcaactttatccgcctccatccagtctattaattgttgccgggaagctagagtaagtagttcgccag | |
| ttaatagtttgcgcaacgttgttgccattgctacaggcatcgtggtgtcacgctcgtcgtttggtatggcttcattc | |
| agctccggttcccaacgatcaaggcgagttacatgatcccccatgttgtgcaaaaaagcggttagctccttcggtcc | |
| tccgatcgttgtcagaagtaagttggccgcagtgttatcactcatggttatggcagcactgcataattctcttactg | |
| tcatgccatccgtaagatgcttttctgtgactggtgagtactcaaccaagtcattctgagaatagtgtatgcggcga | |
| ccgagttgctcttgcccggcgtcaatacgggataataccgcgccacatagcagaactttaaaagtgctcatcattgg | |
| aaaacgttcttcggggcgaaaactctcaaggatcttaccgctgttgagatccagttcgatgtaacccactcgtgcac | |
| ccaactgatcttcagcatcttttactttcaccagcgtttctgggtgagcaaaaacaggaaggcaaaatgccgcaaaa | |
| aagggaataagggcgacacggaaatgttgaatactcatactcttcctttttcaatattattgaagcatttatcaggg | |
| ttattgtctcatgagcggatacatatttgaatgtatttagaaaaataaacaaataggggttccgcgcacatttcccc | |
| gaaaagtgccacctgacgt | |
| pUC57-U3-tRNA-sgRNA vector sequence | |
| SEQ ID NO: 11 | |
| tcgcgcgtttcggtgatgacggtgaaaacctctgacacatgcagctcccggagacggtcacagcttgtctgtaagcg | |
| gatgccgggagcagacaagcccgtcagggcgcgtcagcgggtgttggcgggtgtcggggctggcttaactatgcggc | |
| atcagagcagattgtactgagagtgcaccagatgcggtgtgaaataccgcacagatgcgtaaggagaaaataccgca | |
| tcaggcgccattcgccattcaggctgcgcaactgttgggaagggcgatcggtgcgggcctcttcgctattacgccag | |
| ctggcgaaagggggatgtgctgcaaggcgattaagttgggtaacgccagggttttcccagtcacgacgttgtaaaac | |
| gacggccagtgcctgcaggtcgacgattaaggaatctttaaacatacgaacagatcacttaaagttcttctgaagca | |
| acttaaagttatcaggcatgcatggatcttggaggaatcagatgtgcagtcagggaccatagcacaagacaggcgtc | |
| ttctactggtgctaccagcaaatgctggaagccgggaacactgggtacgtcggaaaccacgtgatgtgaagaagtaa | |
| gataaactgtaggagaaaagcatttcgtagtgggccatgaagcctttcaggacatgtattgcagtatgggccggccc | |
| attacgcaattggacgacaacaaagactagtattagtaccacctcggctatccacatagatcaaagctgatttaaaa | |
| gagttgtgcagatgatccgtggcaacaaagcaccagtggtctagtggtagaatagtaccctgccacggtacagaccc | |
| gggttcgattcccggctggtgcaagagaccgatatcccatggctcgagggtctcggttttagagctagaaatagcaa | |
| gttaaaataaggctagtccgttatcaacttgaaaaagtggcaccgagtcggtgctttttttccacataatctctaga | |
| ggatccccggcgtaatcatggtcatagctgtttcctgtgtgaaattgttatccgctcacaattccacacaacatacg | |
| agccggaagcataaagtgtaaagcctggggtgcctaatgagtgagctaactcacattaattgcgttgcgctcactgc | |
| ccgctttccagtcgggaaacctgtcgtgccagctgcattaatgaatcggccaacgcgcggggagaggcggtttgcgt | |
| attgggcgctcttccgcttcctcgctcactgactcgctgcgctcggtcgttcggctgcggcgagcggtatcagctca | |
| ctcaaaggcggtaatacggttatccacagaatcaggggataacgcaggaaagaacatgtgagcaaaaggccagcaaa | |
| aggccaggaaccgtaaaaaggccgcgttgctggcgtttttccataggctccgcccccctgacgagcatcacaaaaat | |
| cgacgctcaagtcagaggtggcgaaacccgacaggactataaagataccaggcgtttccccctggaagctccctcgt | |
| gcgctctcctgttccgaccctgccgcttaccggatacctgtccgcctttctcccttcgggaagcgtggcgctttctc | |
| atagctcacgctgtaggtatctcagttcggtgtaggtcgttcgctccaagctgggctgtgtgcacgaaccccccgtt | |
| cagcccgaccgctgcgccttatccggtaactatcgtcttgagtccaacccggtaagacacgacttatcgccactggc | |
| agcagccactggtaacaggattagcagagcgaggtatgtaggcggtgctacagagttcttgaagtggtggcctaact | |
| acggctacactagaagaacagtatttggtatctgcgctctgctgaagccagttaccttcggaaaaagagttggtagc | |
| tcttgatccggcaaacaaaccaccgctggtagcggtggtttttttgtttgcaagcagcagattacgcgcagaaaaaa | |
| aggatctcaagaagatcctttgatcttttctacggggtctgacgctcagtggaacgaaaactcacgttaagggattt | |
| tggtcatgagattatcaaaaaggatcttcacctagatccttttaaattaaaaatgaagttttaaatcaatctaaagt | |
| atatatgagtaaacttggtctgacagttaccaatgcttaatcagtgaggcacctatctcagcgatctgtctatttcg | |
| ttcatccatagttgcctgactccccgtcgtgtagataactacgatacgggagggcttaccatctggccccagtgctg | |
| caatgataccgcgactcccacgctcaccggctccagatttatcagcaataaaccagccagccggaagggccgagcgc | |
| agaagtggtcctgcaactttatccgcctccatccagtctattaattgttgccgggaagctagagtaagtagttcgcc | |
| agttaatagtttgcgcaacgttgttgccattgctacaggcatcgtggtgtcacgctcgtcgtttggtatggcttcat | |
| tcagctccggttcccaacgatcaaggcgagttacatgatcccccatgttgtgcaaaaaagcggttagctccttcggt | |
| cctccgatcgttgtcagaagtaagttggccgcagtgttatcactcatggttatggcagcactgcataattctcttac | |
| tgtcatgccatccgtaagatgcttttctgtgactggtgagtactcaaccaagtcattctgagaatagtgtatgcggc | |
| gaccgagttgctcttgcccggcgtcaatacgggataataccgcgccacatagcagaactttaaaagtgctcatcatt | |
| ggaaaacgttcttcggggcgaaaactctcaaggatcttaccgctgttgagatccagttcgatgtaacccactcgtgc | |
| acccaactgatcttcagcatcttttactttcaccagcgtttctgggtgagcaaaaacaggaaggcaaaatgccgcaa | |
| aaaagggaataagggcgacacggaaatgttgaatactcatactcttcctttttcaatattattgaagcatttatcag | |
| ggttattgtctcatgagcggatacatatttgaatgtatttagaaaaataaacaaataggggttccgcgcacatttcc | |
| ccgaaaagtgccacctgacgtctaagaaaccattattatcatgacattaacctataaaaataggcgtatcacgaggc | |
| cctttcgtc | |
| sequence of 5′ end ribozyme | |
| SEQ ID NO: 12 | |
| NNNNNNCTGATGAGTCCGTGAGGACGAAACGAGTAAGCTCGTC | |
| sequence of 3′ end ribozyme | |
| SEQ ID NO: 13 | |
| GGCCGGCATGGTCCCAGCCTCCTCGCTGGCGCCGGCTGGGCAACATGCTTCGGCATGGCGAATGGGAC | |
| SEQ ID NO: 14 | |
| AAGAAGAGAAAGGTC | |
| SEQ ID NO: 15 | |
| CCCAAGAAGAAGAGGAAGGTG | |
| SEQ ID NO: 16 | |
| CCAAAGAAGAAGAGGAAGGTT | |
| SEQ ID NO: 17 | |
| SGGSPKKKRKV | |
| SEQ ID NO: 18 | |
| TCGGGGGGGAGCCCAAAGAAGAAGCGGAAGGTG | |
| SEQ ID NO: 19 | |
| PKKKRKV | |
| SEQ ID NO: 20 | |
| AGGTCGGGGAGGGGACGTACGGG | |
| SEQ ID NO: 21 | |
| GGCAAGGTCGGGGAGGGGACGTAC | |
| SEQ ID NO: 22 | |
| AAACGTACGTCCCCTCCCCGACCT | |
| SEQ ID NO: 23 | |
| GACGTCGGCGAGGAAGGCCTCGG | |
| SEQ ID NO: 24 | |
| GGCAGACGTCGGCGAGGAAGGCCT | |
| SEQ ID NO: 25 | |
| AAACAGGCCTTCCTCGCCGACGTC | |
| SEQ ID NO: 26 | |
| CATGGTGGGGAAAGCTTGGAGGG | |
| SEQ ID NO: 27 | |
| GGCACATGGTGGGGAAAGCTTGGA | |
| SEQ ID NO: 28 | |
| AAACTCCAAGCTTTCCCCACCATG | |
| SEQ ID NO: 29 | |
| CCGGACGACGACGTCGACGACGG | |
| SEQ ID NO: 30 | |
| GGCACCGGACGACGACGTCGACGA | |
| SEQ ID NO: 31 | |
| AAACTCGTCGACGTCGTCGTCCGG | |
| SEQ ID NO: 32 | |
| TTGAAGTCCCTTCTAGATGGAGG | |
| SEQ ID NO: 33 | |
| GGCATTGAAGTCCCTTCTAGATGG | |
| SEQ ID NO: 34 | |
| AAACCCATCTAGAAGGGACTTCAA | |
| SEQ ID NO: 35 | |
| ACTGCGACACCCAGATATCGTGG | |
| SEQ ID NO: 36 | |
| GGCAACTGCGACACCCAGATATCG | |
| SEQ ID NO: 37 | |
| AAACCGATATCTGGGTGTCGCAGT | |
| SEQ ID NO: 38 | |
| GTTGGTCTTTGCTCCTGCAGAGG | |
| SEQ ID NO: 39 | |
| GGCAGTTGGTCTTTGCTCCTGCAG | |
| SEQ ID NO: 40 | |
| AAACCTGCAGGAGCAAAGACCAAC | |
| SEQ ID NO: 41 | |
| TGCAAGGTCGGGGAGGGGACGTAC | |
| SEQ ID NO: 42 | |
| TGCAGACGTCGGCGAGGAAGGCCT | |
| SEQ ID NO: 43 | |
| TGCACATGGTGGGGAAAGCTTGGA | |
| SEQ ID NO: 44 | |
| TGCACCGGACGACGACGTCGACGA | |
| SEQ ID NO: 45 | |
| TGCATTGAAGTCCCTTCTAGATGG | |
| SEQ ID NO: 46 | |
| TGCACTGCGACACCCAGATATCG | |
| SEQ ID NO: 47 | |
| TGCAGTTGGTCTTTGCTCCTGCAG | |
| SEQ ID NO: 48 | |
| GGCGTTGGTCTTTGCTCCTGCAG | |
| SEQ ID NO: 49 | |
| GGCGGTTGGTCTTTGCTCCTGCAG | |
| SEQ ID NO: 50 | |
| GGTGAGTGAGTGTGTGCGTGTGG | |
| SEQ ID NO: 51 | |
| CACCGGTGAGTGAGTGTGTGCGTG | |
| SEQ ID NO: 52 | |
| AAACCACGCACACACTCACTCACC | |
| SEQ ID NO: 53 | |
| CACCGGGTGAGTGAGTGTGTGCGTG | |
| SEQ ID NO: 54 | |
| AAACCACGCACACACTCACTCACCC | |
| SEQ ID NO: 55 | |
| CACCGaacaaagcaccagtggtctagtggtagaatagtaccctgccacggtacagacccgggttcgattcccggctg | |
| gtgcaGGTGAGTGAGTGTGTGCGTG | |
| SEQ ID NO: 56 | |
| AAACCACGCACACACTCACTCACCtgcaccagccgggaatcgaacccgggtctgtaccgtggcagggtactattcta | |
| ccactagaccactggtgctttgttC | |
| SEQ ID NO: 57 | |
| NNNNNNNNNNNNNNNNNNNNTTTTTTT | |
| SEQ ID NO: 58 | |
| NNNNNNNNNNNNNNNNNNNTTTTTTT | |
| SEQ ID NO: 59 | |
| TGGAGTTGGTCTTTGCTCCTGCAGAGG | |
| SEQ ID NO: 60 | |
| GACGCCGGCGAGGAAGGCCTCGG | |
| SEQ ID NO: 61 | |
| GCAGTCGGAGAGGAAGGCCTGGG | |
| SEQ ID NO: 62 | |
| AGATCGGGGAGGGGACGTACGGG | |
| SEQ ID NO: 63 | |
| AGGTGGGGGAAGGGACGTACGGG | |
| SEQ ID NO: 64 | |
| AGATTGGGGAGGGCACGTACGGG | |
| SEQ ID NO: 65 | |
| AGCGTCGGCGAGGAAGGCCTCGG | |
| SEQ ID NO: 66 | |
| GGTGTCGGCGAGGAAGGCCTCGG | |
| SEQ ID NO: 67 | |
| GATATCGGCGAGGAAGGCCTCGG | |
| SEQ ID NO: 68 | |
| GACACCGGCGAGGAAGGCCTCGG | |
| SEQ ID NO: 69 | |
| GACGCTGGCGAGGAAGGCCTCGG | |
| SEQ ID NO: 70 | |
| GACGTTAGCGAGGAAGGCCTCGG | |
| SEQ ID NO: 71 | |
| GACGTCAACGAGGAAGGCCTCGG | |
| SEQ ID NO: 72 | |
| GACGTCGATGAGGAAGGCCTCGG | |
| SEQ ID NO: 73 | |
| GACGTCGGTAAGGAAGGCCTCGG | |
| SEQ ID NO: 74 | |
| GACGTCGGCAGGGAAGGCCTCGG | |
| SEQ ID NO: 75 | |
| GACGTCGGCGGAGAAGGCCTCGG | |
| SEQ ID NO: 76 | |
| GACGTCGGCGAAAAAGGCCTCGG | |
| SEQ ID NO: 77 | |
| GACGTCGGCGAGAGAGGCCTCGG | |
| SEQ ID NO: 78 | |
| GACGTCGGCGAGGGGGGCCTCGG | |
| SEQ ID NO: 79 | |
| GACGTCGGCGAGGAGAGCCTCGG | |
| SEQ ID NO: 80 | |
| GACGTCGGCGAGGAAAACCTCGG | |
| SEQ ID NO: 81 | |
| GACGTCGGCGAGGAAGATCTCGG | |
| SEQ ID NO: 82 | |
| GACGTCGGCGAGGAAGGTTTCGG | |
| SEQ ID NO: 83 | |
| GACGTCGGCGAGGAAGGCTCCGG | |
| SEQ ID NO: 84 | |
| GCTGAGTGAGTGTATGCGTGTGG | |
| SEQ ID NO: 85 | |
| TGTGGGTGAGTGTGTGCGTGAGG |
1. A genome editing system for site-directed modification of a target sequence in the genome of a cell, which comprises at least one selected from the following i) to iii):
i) a Cas9 nuclease variant, and an expression construct comprising a nucleotide sequence encoding a tRNA-guide RNA fusion;
ii) an expression construct comprising a nucleotide sequence encoding a Cas9 nuclease variant, and an expression construct comprising a nucleotide sequence encoding a tRNA-guide RNA fusion; and
iii) an expression construct comprising a nucleotide sequence encoding a Cas9 nuclease variant and a nucleotide sequence encoding a tRNA-guide RNA fusion;
wherein the Cas9 nuclease variant has higher specificity as compared with the wild-type Cas9 nuclease,
wherein the 5′ end of the guide RNA is linked to the 3′ end of the tRNA, wherein the fusion is cleaved at the 5′ end of the guide RNA after being transcribed in the cell, thereby forming a guide RNA that does not carry an extra nucleotide at the 5′ end.
2. A genome editing system for site-directed modification of a target sequence in the genome of a cell, which comprises at least one selected from the following i) to iii):
i) a Cas9 nuclease variant, and an expression construct comprising a nucleotide sequence encoding a ribozyme-guide RNA fusion;
ii) an expression construct comprising a nucleotide sequence encoding a Cas9 nuclease variant, and an expression construct comprising a nucleotide sequence encoding a ribozyme-guide RNA fusion; and
iii) an expression construct comprising a nucleotide sequence encoding a Cas9 nuclease variant and a nucleotide sequence encoding a ribozyme-guide RNA fusion;
wherein the Cas9 nuclease variant has higher specificity as compared with the wild-type Cas9 nuclease,
wherein the 5′ end of the guide RNA is linked to the 3′ end of a first ribozyme,
wherein the first ribozyme is designed to cleave the fusion at the 5′ end of the guide RNA, thereby forming a guide RNA that does not carry extra nucleotide at the 5′ end.
3. The system of claim 1, wherein the tRNA and the cell to be modified are derived from a same species.
4. The system of claim 1, wherein the tRNA is encoded by a sequence as shown in SEQ ID NO:1.
5. The system of claim 1, wherein the Cas9 nuclease variant is a variant of SEQ ID NO:2 and comprises an amino acid substitution at position 855 of SEQ ID NO:2, for example, the amino acid substitution is K855A.
6. The system of claim 1, wherein the Cas9 nuclease variant is a variant of the SEQ ID NO:2 and comprises amino acid substitutions at positions 810, 1003 and 1060 of SEQ ID NO:2, for example, the amino acid substitutions are K810A, K1003A and R1060A.
7. The system of claim 1, wherein the Cas9 nuclease variant is a variant of the SEQ ID NO:2 and comprises amino acid substitutions at positions 848, 1003 and 1060 of SEQ ID NO:2, for example, the amino acid substitutions are K848A, K1003A and R1060A.
8. The system of claim 1, wherein the Cas9 nuclease variant is a variant of the SEQ ID NO:2 and comprises amino acid substitutions at positions 611, 695 and 926 of SEQ ID NO:2, for example, the amino acid substitutions are R611A, Q695A and Q926A.
9. The system of claim 1, wherein the Cas9 nuclease variant is a variant of the SEQ ID NO:2 and comprises amino acid substitutions at positions 497, 611, 695 and 926 of SEQ ID NO:2, for example, the amino acid substitutions are N497A, R611A, Q695A and Q926A.
10. The system of claim 1, wherein the Cas9 nuclease variant comprises an amino acid sequence as shown in SEQ ID NO:4, SEQ ID NO:5 or SEQ ID NO:6.
11. The system of claim 1, wherein the nucleotide sequence encoding the Cas9 nuclease variant is codon-optimized for the organism from which the cell to be modified is derived.
12. The system of claim 1, wherein the guide RNA is a single guide RNA (sgRNA).
13. A method for genetically modifying a cell, comprising: introducing the system of claim 1 to the cell, and thereby the Cas9 nuclease variant is targeted to the target sequence in the genome of the cell by the guide RNA, and results in substitution, deletion and/or addition of one or more nucleotides in the target sequence.
14. The method of claim 13, wherein the cell is derived from mammals.
15. The method of claim 13, wherein the system is introduced into the cell by a method selected from: calcium phosphate transfection, protoplast fusion, electroporation, liposome transfection, microinjection, viral infection (such as a baculovirus, a vaccinia virus, an adenovirus and other viruses), particle bombardment, PEG-mediated protoplast transformation and agrobacterium-mediated transformation.
16. The method of claim 14, wherein the mammal is a human, a mouse, a rat, a monkey, a dog, a pig, a sheep, a cow or a cat, wherein the poultry is a chicken, a duck or a goose, and wherein the plant is rice, maize, wheat, sorghum, barley, soybean, peanut or Arabidopsis thaliana.