Patent application title:

GAG BINDING PROTEIN

Publication number:

US20110144305A1

Publication date:
Application number:

12/437,121

Filed date:

2009-05-07

Abstract:

A method is provided for introducing a GAG binding site into a protein comprising the steps:

    • identifying a region in a protein which is not essential for structure maintenance
    • introducing at least one basic amino acid into said site and/or deleting at least one bulky and/or acidic amino acid in said site,
      whereby said GAG binding site has a GAG binding affinity of Kd≦10 μM, preferably ≦1 μM, still preferred ≦0.1 μM, as well as modified GAG binding proteins.

Inventors:

Assignee:

Interested in similar patents?

Get notified when new applications in this technology area are published.

Classification:

C07K14/523 »  CPC main

Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans; Cytokines; Lymphokines; Interferons; Chemokines Beta-chemokines, e.g. RANTES, I-309/TCA-3, MIP-1alpha, MIP-1beta/ACT-2/LD78/SCIF, MCP-1/MCAF, MCP-2, MCP-3, LDCF-1, LDCF-2

A61P11/06 »  CPC further

Drugs for disorders of the respiratory system Antiasthmatics

A61P17/06 »  CPC further

Drugs for dermatological disorders Antipsoriatics

A61P19/02 »  CPC further

Drugs for skeletal disorders for joint disorders, e.g. arthritis, arthrosis

A61P19/10 »  CPC further

Drugs for skeletal disorders for bone diseases, e.g. rachitism, Paget's disease for osteoporosis

A61P25/00 »  CPC further

Drugs for disorders of the nervous system

A61P25/28 »  CPC further

Drugs for disorders of the nervous system for treating neurodegenerative disorders of the central nervous system, e.g. nootropic agents, cognition enhancers, drugs for treating Alzheimer's disease or other forms of dementia

A61P37/08 »  CPC further

Drugs for immunological or allergic disorders Antiallergic agents

A61P43/00 »  CPC further

Drugs for specific purposes, not provided for in groups -

C07K14/5421 »  CPC further

Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans; Cytokines; Lymphokines; Interferons; Interleukins [IL] IL-8

A61K38/00 »  CPC further

Medicinal preparations containing peptides

C07K14/54 IPC

Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans; Cytokines; Lymphokines; Interferons Interleukins [IL]

C07K14/52 IPC

Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans Cytokines; Lymphokines; Interferons

Description

This application is a divisional of U.S. application Ser. No. 11/422,169 filed on Jun. 5, 2006, which is a 371 of PCT/EP2004/013670 filed on Dec. 2, 2004. The entire contents of the above-identified applications are hereby incorporated by reference.

The present invention relates to methods and tools for the inhibition of the interaction of chemokines and their high-affinity receptors on leukocytes and methods for the therapeutic treatment of inflammatory diseases.

Chemokines, originally derived from chemoattractant cytokines, actually comprise more than 50 members and represent a family of small, inducible, and secreted proteins of low molecular weight (6-12 kDa in their monomeric form) that play a decisive role during immunosurveillance and inflammatory processes. Depending on their function in immunity and inflammation, they can be distinguished into two classes. Inflammatory chemokines are produced by many different tissue cells as well as by immigrating leukocytes in response to bacterial toxins and inflammatory cytokines like IL-1, TNF and interferons. Their main function is to recruit leukocytes for host defence and in the process of inflammation. Homing chemokines, on the other hand, are expressed constitutively in defined areas of the lymphoid tissues. They direct the traffic and homing of lymphocytes and dendritic cells within the immune system. These chemokines, as illustrated by BCA-1, SDF-1 or SLC, control the relocation and recirculation of lymphocytes in the context of maturation, differentiation, activation and ensure their correct homing within secondary lymphoid organs.

Despite the large number of representatives, chemokines show remarkably similar structural folds although the sequence homology varies between 20 to 70 percent. Chemokines consist of roughly 70-130 amino acids with four conserved cysteine residues. The cysteines form two disulphide bonds (Cys 1→Cys 3, Cys 2→Cys 4) which are responsible for their characteristic three-dimensional structure. Chemotactic cytokines consist of a short amino terminal domain (3-10 amino acids) preceding the first cysteine residue, a core made of β-strands and connecting loops found between the second and the fourth cysteine residue, as well as a carboxy-terminal α-helix of 20-60 amino acids. The protein core has a well ordered structure whereas the N- and C-terminal parts are disordered. As secretory proteins they are synthesised with a leader sequence of 20-25 amino acids which is cleaved off before release.

The chemokines have been subdivided into four families on the basis of the relative position of their cysteine residues in the mature protein. In the α-chemokine subfamily, the first two of the four cysteines are separated by a single amino acid (CXC), whereas in the β-chemokines the corresponding cysteine residues are adjacent to each other (CC). The α-chemokines can be further classified into those that contain the ELR sequence in the N-terminus, thereby being chemotactic for neutrophils (IL-8 for example), and those that lack the ELR motif and act on lymphocytes (I-TAC for example). Structurally the β-chemokines can be subdivided into two families: the monocyte-chemoattractant protein eotaxin family, containing the five monocyte chemoattractant proteins (MCP) and eotaxin which are approximately 65 percent identical to each other, and the remaining β-chemokines. As with the CXC-family, the N-terminal amino acids preceding the CC-residues are critical components for the biologic activity and leukocyte selectivity of the chemokines. The β-chemokines, in general, do not act on neutrophils but attract monocytes, eosinophils, basophils and lymphocytes with variable selectivity.

Only a few chemokines do not fit into the CC- or the CXC-family. Lymphotactin is so far the only chemokine which shows just two instead of the four characteristic cysteines in its primary structure, and is thus classified as γ- or C-chemokine. On the other hand, by concluding this classification, fractalkine has to be mentioned as the only representative of the δ- or CXXXC-subfamily with three amino acids separating the first two cysteines. Both of them, Lymphotaxin and fractalkine, induce chemotaxis of T-cells and natural killer cells.

Chemokines induce cell migration and activation by binding to specific cell surface, seven transmembrane-spanning (7TM) G-protein-coupled receptors on target cells. Eighteen chemokine receptors have been cloned so far including six CXC, ten CC, one CX3C and one XC receptor. Chemokine receptors are expressed on different types of leukocytes, some of them are restricted to certain cells (e.g. CXCR1 is restricted to neutrophils) whereas others are more widely expressed (e.g. CCR2 is expressed on monocytes, T cells, natural killer cells and basophils). Similar to chemokines, the receptors can be constitutively expressed on certain cells, whereas some are inducible. Some of them can even be down-regulated making the cells unresponsive to a certain chemokine but remaining responsive to another. Most receptors recognise more than one chemokine and vice versa but recognition is restricted to chemokines of the corresponding subfamily (see Table 1).

TABLE 1
Inflammatory
Chemokine Receptor Chemotactic for Diseases
CXC- IL-8 CXCR1 Neutrophils Acute respiratory distress
Chemokine CXCR2 syndrome [71];
(+ELR-motif) Bacterial pneumonia [72];
Rheumathoid
arthritis [73];
Inflammatory bowel
disease [74];
Psoriasis [75];
Bacterial meningitis [761
CC- MCP-1 CCR2 Basophils; Monocytes; Asthma [77];
Chemokine Activated T cells; Glomerulonephritis [78];
Dentritic cells; Natural Atheroscleosis [79];
killer cells Inflammatory bowel
disease [80];
Psoriasis [81];
Bacterial and viral
meningitis [82, 83]
RANTES CCR1 Eosinophils; Monocytes; Asthma [84];
Activated T cells; Glomerulonephritis [85]
Dentritic cells
CCR3 Eosinophils; Basophils;
Dentritic cells
CCR5 Monocytes; Activated T
cells; Dentritic cells;
Natural killer cells

Chemokines have two main sites of interaction with their receptors, one in the amino-terminal domain and the other within an exposed loop of the backbone that extends between the second and the third cysteine residue. Both sites are kept in close proximity by the disulphide bonds. The receptor recognises first the binding site within the loop region which appears to function as a docking domain. This interaction restricts the mobility of the chemokine thus facilitating the proper orientation of the amino-terminal domain. Studies have been performed with mutant chemokines that still bound effectively to their receptors but did not signal. These mutants were obtained by amino acid deletion or modification within the N-termini of, for example, IL-8, RANTES and MCP-1.

Multiple intracellular signalling pathways occur after receptor activation as a result of chemokine binding. Chemokines also interact with two types of nonsignalling molecules. One is the DARC receptor which is expressed on erythrocytes and on endothelial cells and which binds CC- as well as CXC-chemokines to prevent them from circulation. The second type are heparan sulphate glycosaminoglycans (GAGs) which are part of proteoglycans and which serve as co-receptors of chemokines. They capture and present chemokines on the surface of the homing tissue (e.g. endothelial cells) in order to establish a local concentration gradient. In an inflammatory response, such as in rheumatoid arthritis, leukocytes rolling on the endothelium in a selectin-mediated process are brought into contact with the chemokines presented by the proteoglycans on the cell surface. Thereby, leukocyte integrins become activated which leads to firm adherence and extravasation. The recruited leukocytes are activated by local inflammatory cytokines and may become desensitised to further chemokine signalling because of high local concentration of chemokines. For maintaining a tissue bloodstream chemokine gradient, the DARC receptor functions as a sink for surplus chemokines.

Heparan sulphate (HS) proteoglycans, which consist of a core protein with covalently attached glycosaminoglycan sidechains (GAGs), are found in most mammalian cells and tissues. While the protein part determines the localisation of the proteoglycan in the cell membrane or in the extracellular matrix, the glycosaminoglycan component mediates interactions with a variety of extracellular ligands, such as growth factors, chemokines and adhesions molecules. The biosynthesis of proteoglycans has previously been extensively reviewed. Major groups of the cell surface proteoglycans are the syndecan family of transmembrane proteins (four members in mammals) and the glypican family of proteins attached to the cell membrane by a glycosylphosphatidylinositol (GPI) tail (six members in mammals). While glypicans are expressed widely in the nervous system, in kidney and, to a lesser extent, in skeletal and smooth muscle, syndecan-1 is the major HSPG in epithelial cells, syndecan-2 predominates in fibroblasts and endothelial cells, syndecan-3 abounds in neuronal cells and syndecan-4 is widely expressed. The majority of the GAG chains added to the syndecan core proteins through a tetrasaccharide linkage region onto particular serines are HS chains. Although the amino acid sequences of the extracellular domains of specific syndecan types are not conserved among different species, contrary to the transmembrane and the cytoplasmic domains, the number and the positions of the GAG chains are highly conserved. The structure of the GAGs, however, is species-specific and is, moreover, dependent upon the nature of the HSPG-expressing tissue.

Heparan sulphate (HS) is the most abundant member of the glycosaminoglycan (GAG) family of linear polysaccharides which also includes heparin, chondroitin sulphate, dermatan sulphate and keratan sulphate. Naturally occurring HS is characterised by a linear chain of 20-100 disaccharide units composed of N-acetyl-D-glucosamine (GlcNAc) and D-glucuronic acid (GlcA) which can be modified to include N- and O-sulphation (6-O and 3-O sulphation of the glucosamine and 2-O sulphation of the uronic acid) as well as epimerisation of β-D-gluronic acid to α-L-iduronic acid (IdoA).

Clusters of N- and O-sulphated sugar residues, separated by regions of low sulphation, are assumed to be mainly responsible for the numerous protein binding and regulatory properties of HS. In addition to the electrostatic interactions of the HS sulphate groups with basic amino acids, van der Waals and hydrophobic interactions are also thought to be involved in protein binding. Furthermore, the presence of the conformationally flexible iduronate residues seems to favour GAG binding to proteins. Other factors such as the spacing between the protein binding sites play also a critical role in protein-GAG binding interactions: For example γ-interferon dimerisation induced by HS requires GAG chains with two protein binding sequences separated by a 7 kDa region with low sulphation. Additional sequences are sometimes required for full biological activity of some ligands: in order to support FGF-2 signal transduction, HS must have both the minimum binding sequence as well as additional residues that are supposed to interact with the FGF receptor.

Heparin binding proteins often contain consensus sequences consisting of clusters of basic amino acid residues. Lysine, arginine, asparagine, histidine and glutamine are frequently involved in electrostatic contacts with the sulphate and carboxyl groups on the GAG. The spacing of the basic amino acids, sometimes determined by the proteins 3-D structure, are assumed to control the GAG binding specificity and affinity. The biological activity of the ligand can also be affected by the kinetics of HS-protein interaction. Reducing the dimension of growth factor diffusion is one of the suggested HSPG functions for which the long repetitive character of the GAG chains as well as their relatively fast on and off rates of protein binding are ideally suited. In some cases, kinetics rather than thermodynamics drives the physiological function of HS-protein binding. Most HS ligands require GAG sequences of well-defined length and structure. Heparin, which is produced by mast cells, is structurally very similar to heparan sulphate but is characterised by higher levels of post-polymerisation modifications resulting in a uniformly high degree of sulphation with a relatively small degree of structural diversity. Thus, the highly modified blocks in heparan sulphate are sometimes referred to as “heparin-like”. For this reason, heparin can be used as a perfect HS analogue for protein biophysical studies as it is, in addition, available in larger quantities and therefore less expensive than HS. Different cell types have been shown to synthesise proteoglycans with different glycosaminoglycan structure which changes during pathogenesis, during development or in response to extracellular signals such as growth factors. This structural diversity of HSPGs leads to a high binding versatility emphasising the great importance of proteoglycans.

Since the demonstration that heparan sulphate proteoglycans are critical for FGF signalling, several investigations were performed showing the importance of chemokine-GAG binding for promoting chemokine activity. First, almost all chemokines studied to date appear to bind HS in vitro, suggesting that this represents a fundamental property of these proteins. Second, the finding that in vivo T lymphocytes secrete CC-chemokines as a complex with glycosaminoglycans indicates that this form of interaction is physiologically relevant. Furthermore, it is known that the association of chemokines with HS helps to stabilise concentration gradients across the endothelial surface thereby providing directional information for migrating leukocytes. HS is also thought to protect chemokines from proteolytic degradation and to induce their oligomerisation thus promoting local high concentrations in the vicinity of the G-coupled signalling receptors. The functional relevance of oligomerisation, however, remains controversial although all chemokines have a clear structural basis for multimerisation. Dimerisation through association of the β-sheets is observed for all chemokines of the CXC-family (e.g. IL-8), contrary to most members of the CC-chemokine family (e.g. RANTES), which dimerise via their N-terminal strands.

A wealth of data has been accumulated on the inhibition of the interaction of chemokines and their high-affinity receptors on leukocytes by low molecular weight compounds. However, there has been no breakthrough in the therapeutic treatment of inflammatory diseases by this approach.

Interleukin-8 (IL-8) is a key molecule involved in neutrophil attraction during chronic and acute inflammation. Several approaches have been undertaken to block the action of IL-8 so far, beginning with inhibition of IL-8 production by for example glucocorticoids, Vitamin D3, cyclosporin A, transforming growth factor β, interferons etc., all of them inhibiting IL-8 activity at the level of production of IL-8 mRNA. A further approach previously used is to inhibit the binding of IL-8 to its receptors by using specific antibodies either against the receptor on the leukocyte or against IL-8 itself in order to act as specific antagonists and therefore inhibiting the IL-8 activity.

The aim of the present invention is therefore to provide an alternative strategy for the inhibition or disturbance of the interaction of chemokines/receptors on leukocytes. Specifically the action of IL-8, RANTES or MCP-1 should be targetted by such a strategy.

Subject matter of the present invention is therefore a method to produce new GAG binding proteins as well as alternative GAG binding proteins which show a high(er) affinity to a GAG co-receptor (than the wild type). Such modified GAG binding proteins can act as competitors with wild-type GAG binding proteins and are able to inhibit or down-regulate the activity of the wild-type GAG binding protein, however without the side effects which occur with the known recombinant proteins used in the state of the art. The molecules according to the present invention do not show the above mentioned disadvantages. The present modified GAG binding proteins can be used in drugs for various therapeutical uses, in particular—in the case of chemokines—for the treatment of inflammation diseases without the known disadvantages which occur in recombinant chemokines known in the state of the art. The modification of the GAG binding site according to the present invention turned out to be a broadly applicable strategy for all proteins which activity is based on the binding event to this site, especially chemokines with a GAG site. The preferred molecules according to the present invention with a higher GAG binding affinity proved to be specifically advantageous with respect to their biological effects, especially with respect to their anti-inflammatory activity by their competition with wild type molecules for the GAG site.

Therefore, the present invention provides a method for introducing a GAG binding site into a protein characterised in that it comprises the steps:

    • identifying a region in a protein which is not essential for structure maintenance
    • introducing at least one basic amino acid into said site and/or deleting at least one bulky and/or acidic amino acid in said site,
      whereby said GAG binding site has a GAG binding affinity of Kd≦10 μM, preferably ≦1 μM, still preferred ≦0.1 μM. By introducing at least one basic amino acid and/or deleting at least one bulky and/or acidic amino acid in said region, a novel, improved “artificial” GAG binding site is introduced in said protein. This comprises the new, complete introduction of a GAG binding site into a protein which did not show a GAG binding activity before said modification. This also comprises the introduction of a GAG binding site into a protein which already showed GAG binding activity. The new GAG binding site can be introduced into a region of the protein which did not show GAG binding affinity as well as a region which did show GAG binding affinity. However, with the most preferred embodiment of the present invention, a modification of the GAG binding affinity of a given GAG binding protein is provided, said modified protein's GAG binding ability is increased compared to the wild-type protein. The present invention relates to a method of introducing a GAG binding site into a protein, a modified GAG binding protein as well as to an isolated DNA molecule, a vector, a recombinant cell, a pharmaceutical composition and the use of said modified protein.

BRIEF DESCRIPTION OF THE DRAWINGS

FIG. 1 shows a CD spectra.

FIG. 2 shows secondary structure contents of various mutants.

FIG. 3 shows graphics of results from fluorescence anisotropy tests of various mutants.

Figure shows graphics of results from fluorescence anisotropy tests of two mutants.

Figure shows the graphic of results from isothermal fluorescence titrations.

Figure shows the graphic of results from unfolding experiments of various mutants.

Figure shows chemotaxis index of IL-8 mutants.

Figure shows the results of the RANTES chemotaxis assay.

The term “introducing at least one basic amino acid” relates to the introduction of additional amino acids as well as the substitution of amino acids. The main purpose is to increase the relative amount of basic amino acids, preferably Arg, Lys, His, Asn and/or Gln, compared to the total amount of amino acids in said site, whereby the resulting GAG binding site should preferably comprise at least 3 basic amino acids, still preferred 4, most preferred 5 amino acids.

The GAG binding site is preferably at a solvent exposed position, e.g. at a loop. This will assure an effective modification.

Whether or not a region of a protein is essential for structure maintenance, can be tested for example by computational methods with specific programmes known to the person skilled in the art. After modification of the protein, the conformational stability is preferably tested in silico.

The term “bulky amino acid” refers to amino acids with long or sterically interfering side chains; these are in particular Trp, Ile, Leu, Phe, Tyr. Acidic amino acids are in particular Glu and Asp. Preferably, the resulting GAG binding site is free of bulky and acidic amino acids, meaning that all bulky and acidic amino acids are removed.

The GAG binding affinity is determined—for the scope of protection of the present application—over the dissociation constant Kd. One possibility is to determine the dissociation constant (Kd) values of any given protein by the structural change in ligand binding. Various techniques are well known to the person skilled in the art, e.g. isothermal fluorescence titrations, isothermal titration calorimetry, surface plasmon resonance, gel mobility assay, and indirectly by competition experiments with radioactively labelled GAG ligands. A further possibility is to predict binding regions by calculation with computational methods also known to the person skilled in the art, whereby several programmes may be used.

A protocol for introducing a GAG binding site into a protein is for example as follows:

    • Identify a region of the protein which is not essential for overall structural maintenance and which might be suitable for GAG binding
    • Design a new GAG binding site by introducing (replacement or insertion) basic Arg, Lys, His, Asp and Gln residues at any position or by deleting amino acids which interfere with GAG binding
    • Check the conformational stability of the resulting mutant protein in silico
    • Clone the wild-type protein cDNA (alternatively: purchase the cDNA)
    • Use this as template for PCR-assisted mutagenesis to introduce the above mentioned changes into the amino acid sequence
    • Subclone the mutant gene into a suitable expression system (prokaryotic or eukaryotic dependent upon biologically required post-translational modifications)
    • Expression, purification and characterisation of the mutant protein in vitro
    • Criterion for an introduced GAG binding affinity: KdGAG(mutant)<10 μM.

Examples of said engineered proteins with new GAG binding sites are for example the Fc part of IgG as well as the complement factors C3 and C4 modified as follows:

Fc: (439)KSLSLS(444) −> KSKKLS (SEQ ID NOS 1 & 2)
C3: (1297)WIASHT(1302) −> WKAKHK (SEQ ID NOS 3 & 4)
C4: (1)MLDAERLK(8) −> MKKAKRLK (SEQ ID NOS 5 & 6)

A further aspect of the present invention is a protein obtainable by the inventive method as described above. The inventive protein therefore comprises a—compared to the wild-type protein—new GAG binding site as defined above and will therefore act as competitor with natural GAG binding proteins, in particular since the GAG binding affinity of the inventive protein is very high, e.g. Kd≦10 μM.

A further aspect of the present invention is a modified GAG binding protein, whereby a GAG binding region in said protein is modified by substitution, insertion, and/or deletion of at least one amino acid in order to increase the relative amount of basic amino acids in said GAG binding region, and/or reduce the amount of bulky and/or acidic amino acids in said GAG binding region, preferably at a solvent exposed position, and in that the GAG binding affinity of said protein is increased compared to the GAG binding affinity of a respective wild-type protein.

It has been surprisingly shown that by increasing the relative amount of basic amino acids, in particular Arg, Lys, His, Asn and Gln, in the GAG binding region, the modified GAG binding protein shows increased GAG binding affinity compared to the wild-type proteins, in particular when the relative amount of basic amino acids is increased at a solvent exposed position, since a positively charged area on the protein surface has shown to enhance the binding affinity. Preferably, at least 3, still preferred 4, most preferred 5, basic amino acids are present in the GAG binding region.

The term “GAG binding protein” relates to any protein which binds to a GAG co-receptor. Whether or not a protein binds to a GAG co-receptor can be tested with the help of known protocols as mentioned above. Hileman et al. (BioEssays 20 (1998), 156-167) disclose consensus sites in glycosaminoglycan binding proteins. The information disclosed in this article is also useful as starting information for the present invention. The term “protein” makes clear that the molecules provided by the present invention are at least 80 amino acids in length. This is required for making them suitable candidates for the present anti-inflammation strategy. Smaller molecules interacting with a GAG binding site and being physiologically or pathologically relevant due to such an interaction are not known and therefore not relevant for the present invention. Preferably, the molecules according to the present invention are composed of at least 90, at least 100, at least 120, at least 150, at least 200, at least 300, at least 400 or at least 500 amino acid residues.

In the scope of the present application the term “GAG binding region” is defined as a region which binds to GAG with a dissociation constant (Kd-value) of under 100 μM, preferably under 50 μM, still preferred under 20 μM, as determined by isothermal fluorescence titration (see examples below).

Any modifications mentioned in the present application can be carried out with known biochemical methods, for example site-directed mutagenesis. It should also be noted that molecular cloning of GAG binding sites is, of course, prior art (see e.g. WO96/34965 A, WO 92/07935 A, Jayaraman et al. (FEBS Letters 482 (2000), 154-158), WO02/20715 A, Yang et al. (J. Cell. Biochem. 56 (1994), 455-468), wherein molecular shuffling or de novo syntesis of GAG regions are described; Butcher et al., (FEBS Letters 4009 (1997), 183-187) (relates to artificial peptides, not proteins); Jinno-Oue et al, (J. Virol. 75 (2001), 12439-12445) de novo synthesis)).

The GAG binding region can be modified by substitution, insertion and/or deletion. This means that a non-basic amino acid may be substituted by a basic amino acid, a basic amino acid may be inserted into the GAG binding region or a non-basic amino acid may be deleted. Furthermore, an amino acid which interferes with GAG binding, preferably all interfering amino acids binding is deleted. Such amino acids are in particular bulky amino acids as described above as well as acidic amino acids, for example Glu and Asp. Whether or not an amino acid interferes with GAG binding may be examined with for example mathematical or computational methods. The result of any of these modifications is that the relative amount of basic amino acids in said GAG binding region is increased, whereby “relative” refers to the amount of basic amino acids in said GAG binding region compared to the number of all amino acids in said GAG binding region. Furthermore, amino acids which interfere sterically or electrostatically with GAG binding are deleted.

Whether or not an amino acid is present in a solvent exposed position, can be determined for example with the help of the known three dimensional structure of the protein or with the help of computational methods as mentioned above.

Whether or not the GAG binding affinity of said modified protein is increased compared to the GAG binding affinity of the respective wild-type protein, can be determined as mentioned above with the help of, for example, fluorescence titration experiments which determine the dissociation constants. The criterion for improved GAG binding affinity will be Kd (mutant)<Kd (wild-type), preferably by at least 100%. Specifically improved modified proteins have—compared with wild-type Kd—a GAG binding affinity which is higher by a factor of minimum 5, preferably of minimum 10, still preferred of minimum 100. The increased GAG binding affinity will therefore preferably show a Kd of under 10 μM, preferred under 1 μM, still preferred under 0.1 μM.

By increasing the GAG binding affinity the modified protein will act as a specific antagonist and will compete with the wild-type GAG binding protein for the GAG binding.

Preferably, at least one basic amino acid selected from the group consisting of Arg, Lys, and His is inserted into said GAG binding region. These amino acids are easily inserted into said GAG binding region, whereby the term “inserted” relates to an insertion as such as well as substituting any non-basic amino acid with arginine, lysine or histidine. Of course, it is possible to insert more than one basic amino acid whereby the same basic amino acid may be inserted or also a combination of two or three of the above mentioned amino acids.

Still preferred, the protein is a chemokine, preferably IL-8, RANTES or MCP-1. Chemokines are known to have a site of interaction with co-receptor GAG whereby this chemokine binding is often a condition for further receptor activation as mentioned above. Since chemokines are often found in inflammatory diseases, it is of major interest to block the chemokine receptor activation. Such chemokines are preferably IL-8, RANTES or MCP-1, which are well characterised molecules and of which the GAG binding regions are well known (see, for example, Lortat-Jacob et al., PNAS 99 (3) (2002), 1229-1234). By increasing the amount of basic amino acids in the GAG binding region of these chemokines, their binding affinity is increased and therefore the wild-type chemokines will bind less frequently or not at all, depending on the concentration of the modified protein in respect to the concentration of the wild-type protein.

According to an advantageous aspect, said GAG binding region is a C terminal α-helix. A typicial chemical monomer is organised around a triple stranded anti-parallel β-sheet overlaid by a C-terminal α-helix. It has been shown that this C-terminal α-helix in chemokines is to a major part involved in the GAG binding, so that modification in this C-terminal α-helix in order to increase the amount of basic amino acids results in a modified chemokine with an increased GAG binding affinity.

Advantageously, positions 17, 21, 70, and/or 71 in IL-8 are substituted by Arg, Lys, His, Asn and/or Gln. Here it is possible that only one of these aforementioned sites is modified. However, also more than one of these sites may be modified as well as all, whereby all modifications may be either Arg or Lys or His or Asn or Gln or a mixture of those. In IL-8 these positions have shown to highly increase the GAG binding affinity of IL-8 and therefore these positions are particularly suitable for modifications.

Preferably the increased binding affinity is an increased binding affinity to heparan sulphate and/or heparin. Heparan sulphate is the most abundant member of the GAG family of linear polysaccharides which also includes heparin. Heparin is structurally very similar to heparan sulphate characterised by higher levels of post-polymerisation modifications resulting in a uniformly high degree of sulphation with a relatively small degree of structural diversity. Therefore, the highly modified blocks in heparan sulphate are sometimes referred to as heparin-like and heparin can be used as a heparan sulphate analogue for protein biophysical studies. In any case, both, heparan sulphate and heparin are particularly suitable.

Still preferred, a further biologically active region is modified thereby inhibiting or down-regulating a further biological activity of said protein. This further biological activity is known for most GAG binding proteins, for example for chemokines. This will be the binding region to a receptor, for example to the 7TM receptor. The term “further” defines a biologically active region which is not the GAG binding region which, however, binds to other molecules, cells or receptors and/or activates them. By modifying this further biologically active region the further biological activity of this protein is inhibited or down-regulated and thereby a modified protein is provided which is a strong antagonist to the wild-type protein. This means that on the one hand the GAG binding affinity is higher than in the wild-type GAG binding protein, so that the modified protein will to a large extent bind to the GAG instead of the wild-type protein. On the other hand, the further activity of the wild-type protein which mainly occurs when the protein is bound to GAG, is inhibited or down-regulated, since the modified protein will not carry out this specific activity or carries out this activity to a lesser extent. With this modified protein an effective antagonist for wild-type GAG binding proteins is provided which does not show the side effects known from other recombinant proteins as described in the state of the art. This further biologically active region can for example be determined in vitro by receptor competition assays (using fluorescently labelled wt chemokines, calcium influx, and cell migration (performed on native leukocytes or on 7TM stably-transfected cell lines). Examples of such further biologically active regions are, in addition to further receptor binding sites (as in the growth factor family), enzymatic sites (as in hydrolases, lyases, sulfotransferases, N-deacetylases, and copolymerases), protein interaction sites (as in antithrombin III), and membrane binding domains (as in the herpes simplex virus gD protein). With this preferred embodiment of double-modified proteins therefore dominant (concerning GAG binding) negative (concerning receptor) mutants are provided which are specifically advantageous with respect to the objectives set for the present invention.

Still preferred, said further biologically active region is modified by deletion, insertion, and/or substitution, preferably with alanine, a sterically and/or electrostatically similar residue. It is, of course, possible to either delete or insert or substitute at least one amino acid in said further biologically active region. However, it is also possible to provide a combination of at least two of these modifications or all three of them. By substituting a given amino acid with alanine or a sterically/electronically similar residue—“similar” meaning similar to the amino acid being substituted—the modified protein is not or only to a lesser extent modified sterically/electrostatically. This is particularly advantageous, since other activities of the modified protein, in particular the affinity to the GAG binding region, are not changed.

Advantageously, said protein is a chemokine and said further biological activity is leukocyte activation. As mentioned above, chemokines are involved in leukocyte attraction during chronic and acute inflammation. Therefore, by inhibiting or down-regulating leukocyte activation inflammation is decreased or inhibited which makes this particular modified protein an important tool for studying, diagnosing and treating inflammatory diseases.

According to an advantageous aspect, said protein is IL-8 and said further biologically active region is located within the first 10 N-terminal amino acids. The first N-terminal amino acids are involved in leukocyte activation, whereby in particular Glu-4, Leu-5 and Arg-6 were identified to be essential for receptor binding and activation. Therefore, either these three or even all first 10 N-terminal amino acids can be substituted or deleted in order to inhibit or down-regulate the receptor binding and activation.

A further advantageous protein is an IL-8 mutant with the first 6 N-terminal amino acids deleted. As mentioned above, this mutant will not or to a lesser extent bind and activate leukocytes, so that it is particularly suitable for studying, diagnosing and treating inflammatory diseases.

Preferably, said protein is an IL-8 mutant selected from the group consisting of del6F17RE70KN71R, del6F17RE70RN71K and del6E70KN71K. These mutants have shown to be particularly advantageous, since the deletion of the first 6 N-terminal amino acids inhibits or down-regulates receptor binding and activation. Furthermore, the two phenylalanines in position 17 and 21 were found to make first contact with the receptor on its N-terminal extracellular domain to facilitate the later activation of the receptor. In order to prevent any neutrophil contact, these two amino acids 17 and 21 are exchanged, whereby they are exchanged to basic amino acids, since they are in close proximity to the GAG binding motif of the C-terminal α-helix as can be seen on a three dimensional model of a protein. By exchanging the position 17 and/or 21 to either arginine or lysine the GAG binding affinity is therefore increased.

A further aspect of the present invention is an isolated polynucleic acid molecule which codes for the inventive protein as described above. The polynucleic acid may be DNA or RNA. Thereby the modifications which lead to the inventive modified protein are carried out on DNA or RNA level. This inventive isolated polynucleic acid molecule is suitable for diagnostic methods as well as gene therapy and the production of inventive modified protein on a large scale.

Still preferred, the isolated polynucleic acid molecule hybridises to the above defined inventive polynucleic acid molecule under stringent conditions. Depending on the hybridisation conditions complementary duplexes form between the two DNA or RNA molecules, either by perfectly being matched or also comprising mismatched bases (see Sambrook et al., Molecular Cloning: A laboratory manual, 2nd ed., Cold Spring Harbor, N.Y. 1989). Probes greater in length than about 50 nucleotides may accommodate up to 25 to 30% mismatched bases. Smaller probes will accommodate fewer mismatches. The tendency of a target and probe to form duplexes containing mismatched base pairs is controlled by the stringency of the hybridisation conditions which itself is a function of factors, such as the concentration of salt or formamide in the hybridisation buffer, the temperature of the hybridisation and the post-hybridisation wash conditions. By applying well-known principles that occur in the formation of hybrid duplexes conditions having the desired stringency can be achieved by one skilled in the art by selecting from among a variety of hybridisation buffers, temperatures and wash conditions. Thus, conditions can be selected that permit the detection of either perfectly matched or partially mismatched hybrid duplexes. The melting temperature (Tm) of a duplex is useful for selecting appropriate hybridisation conditions. Stringent hybridisation conditions for polynucleotide molecules over 200 nucleotides in length typically involve hybridising at a temperature 15-25° C. below the melting temperature of the expected duplex. For oligonucleotide probes over 30 nucleotides which form less stable duplexes than longer probes, stringent hybridisation usually is achieved by hybridising at 5 to 10° C. below the Tm. The Tm of a nucleic acid duplex can be calculated using a formula based on the percent G+C contained in the nucleic acids and that takes chain lengths into account, such as the formula Tm=81.5-16.6 (log [Na+)])+0.41 (% G+C)−(600/N), where N=chain length.

A further aspect of the present invention relates to a vector which comprises an isolated DNA molecule according to the present invention as defined above. The vector comprises all regulatory elements necessary for efficient transfection as well as efficient expression of proteins. Such vectors are well known in the art and any suitable vector can be selected for this purpose.

A further aspect of the present application relates to a recombinant cell which is stably transfected with an inventive vector as described above. Such a recombinant cell as well as any therefrom descendant cell comprises the vector. Thereby a cell line is provided which expresses the modified protein either continuously or upon activation depending on the vector.

A further aspect of the present invention relates to a pharmaceutical composition which comprises a protein, a polynucleic acid or a vector according to the present invention as defined above and a pharmaceutically acceptable carrier. Of course, the pharmaceutical composition may further comprise additional substances which are usually present in pharmaceutical compositions, such as salts, buffers, emulgators, colouring agents, etc.

A further aspect of the present invention relates to the use of the modified protein, a polynucleic acid or a vector according to the present invention as defined above in a method for inhibiting or supressing the biological activity of the respective wild-type protein. As mentioned above, the modified protein will act as an antagonist whereby the side effects which occur with known recombinant proteins will not occur with the inventive modified protein. In the case of chemokines this will be in particular the biological activity involved in inflammatory reactions.

Therefore, a further use of the modified protein, polynucleic acid or vector according to the present invention is in a method for producing a medicament for the treatment of an inflammatory condition. In particular, if the modified protein is a chemokine, it will act as antagonist without side effects and will be particularly suitable for the treatment of an inflammatory condition. Therefore, a further aspect of the present application is also a method for the treatment of an inflammatory condition, wherein a modified protein according to the present invention, the isolated polynucleic acid molecule or vector according to the present invention or a pharmaceutical composition according to the present invention is administered to a patient.

Preferably, the inflammatory condition is selected from a group comprising rheumatoid arthritis, psoriasis, osteoarthritis, asthma, Alzheimer's disease, and multiple sclerosis. Since the activation through chemokines can be inhibited with a modified protein according to the present invention, inflammatory reactions can be inhibited or down-regulated whereby the above mentioned inflammatory conditions can be prevented or treated.

The present invention is described in further detail with the help of the following examples and figures to which the invention is, however, not limited whereby FIG. 1 is a CD spectra; FIG. 2 shows secondary structure contents of various mutants; FIGS. 3 and 4 show graphics of results from fluorescence anisotropy tests of various mutants; FIG. 5 shows the graphic of results from isothermal fluorescence titrations; FIG. 6 shows the graphic of results from unfolding experiments of various mutants, FIG. 7 shows chemotaxis index of IL-8 mutants, and FIG. 8 shows the results of the RANTES chemotaxis assay.

EXAMPLES

Example 1

Generation of Recombinant IL-8 Genes and Cloning of the Mutants

Polymerase chain reaction (PCR) technique was used to generate the desired cDNAs for the mutants by introducing the mutations using sense and antisense mutagenesis primers. A synthetic plasmid containing the cDNA for wtIL-8 was used as template, Clontech Advantage®2 Polymerase Mix applied as DNA polymerase and the PCR reaction performed using a Mastergradient Cycler of Eppendorf. The mutagenesis primers used are summarised in the table below beginning with the forward sequences (5′ to 3′):

(SEQ ID NO: 7)
CACC ATG TGT CAG TGT ATA AAG ACA TAC TCC
(primer for the mutation Δ6)
(SEQ ID NO: 8)
CACC ATG TGT CAG TGT ATA AAG ACA TAC TCC AAA CCT
AGG CAC CCC AAA AGG ATA
(primer for the mutation Δ6 F17R F21R)

The reverse sequences are (5′ to 3′):

TTA TGA ATT CCT AGC CCT CTT (SEQ ID NO: 9)
(primer for the mutation E70R)
TTA TGA ATT CTT AGC CCT CTT (SEQ ID NO: 10)
(primer for the mutation E70K)
TTA TGA CTT CTC AGC CCT CTT (SEQ ID NO: 11)
(primer for the mutation N71K)
TTA TGA CTT CTT AGC CCT CTT (SEQ ID NO: 12)
(primer for the mutation E70K N71K)
TTA TGA CTT CCT AGC CCT CTT (SEQ ID NO: 13)
(primer for the mutation E70R N71K)
TTA TGA CCT CTT AGC CCT CTT (SEQ ID NO: 14)
(primer for the mutation E70K N71R)
TTA TGA CCT CCT AGC CCT CTT (SEQ ID NO: 15)
(primer for the mutation E70R N71R)

The PCR products were purified, cloned into the pCR®T7/NT-TOPO®TA (Invitrogen) vector and transformed into TOP10F competent E. coli (Invitrogen). As a next step a confirmation of the sequence was carried out by double-stranded DNA sequencing using a ABI PRISM CE1 Sequencer.

Example 2

Expression and Purification of the Recombinant Proteins

Once the sequences were confirmed, the constructs were transformed into calcium-competent BL21(DE3) E. coli for expression. Cells were grown under shaking in 1 l Lennox Broth (Sigma) containing 100 μg/ml Ampicillin at 37° C. until an OD600 of about 0.8 was reached. Induction of protein expression was accomplished by addition of isopropyl-β-D-thiogalactopyranoside (IPTG) to a final concentration of 1 mM. Four hours later the cells were harvested by centrifugation at 6000 g for 20 minutes. The cell pellet was then resuspended in a buffer containing 20 mM TRIS/HCl, 50 mM NaCl, pH 8, sonicated at 100 watts for 5×20 s and finally centrifuged again for 20 min at 10,000 g. Since the main fraction of the recombinant IL-8 proteins was found in inclusion bodies, denaturing conditions were chosen for further purification. So the cell pellet was resuspended in a buffer of 6M Gua/HCl and 50 mM MES, pH 6.5. The suspension was then stirred at 4° C. for 4 hours, followed by a dialysis step against 50 mM MES, pH 6.5. The resulting suspension was then centrifuged and filtered to be loaded on a strong cation exchange column (SP Sepharose® from Pharmacia Biotech). The elution was accomplished by a linear gradient from 0M-1M NaCl in a 50 mM MES buffer, pH 6.5 over 60 minutes. After lyophilisation of the fractions containing the desired protein, a second purification step was carried out by reversed-phase HPLC using a C18 column. In this case a non-linear gradient from 10%-90% Acetonitril was chosen to elute the desired protein. Refolding of the denatured protein was finally accomplished by the same cation exchange column under the same conditions as described above.

The protein was then checked for purity and identity by silver stain analysis in the first case and Western Blot analysis, using a specific monoclonal antibody against wtIL-8, in the second. Refolding of the proteins was also confirmed by Circular Dichroism (CD) measurements.

Example 3

Biophysical Characterisation of the Mutants

3.1 Circular Dicroism Measurements and Analysis

In order to investigate secondary structure changes of the mutant protein in the presence and absence of heparan sulphate (HS), CD spectroscopy was carried out. Measurements were recorded on a Jasco J-710 spectropolarimeter over a range of 195-250 nm, and a cell of 0.1 cm path length was used. Spectra of the protein solutions with a concentration of 5 μM were recorded with a response time of 1 s, step resolution of 0.2 nm, speed of 50 nm/min, band width of 1 nm and a sensitivity of 20 mdeg. Three scans were averaged to yield smooth spectra. The protein spectra were then background-corrected relating to the CD-signal either of the buffer itself or buffer/HS. Secondary structure analysis of the protein in the presence and absence of HS was finally accomplished using the programme SELCON.

Since a great number of amino acids were changed in a number of novel combinations, it was tried to find out the dimension of the resulting secondary structure changes by circular dichroism methods.

Different structures were obtained depending on the mutations introduced. Except for one mutant expressed (Δ6 F17R F21R E70K N71R) which didn't show any structure, all mutants exhibited measurable α-helices, β-sheets and loops. Compared to IL-8 wt only one mutant (Δ6 E70R) showed nearly similar structure whereas the others differed mainly in their α-helix which ranged from 17.2% to 45.2% out of the total structure. Nevertheless, this fact suggests that the overall structure of IL-8 wt was maintained despite many changes within the proteins sequence. This could not have been previously predicted. Having already found that heparan sulphate oligosaccharides only, and not heparin, were able to affect IL-8 wt secondary structure, attention was focused on the effects induced by unfractionated heparan sulphate. All examined mutants showed structural changes upon HS binding which can be seen as evidence of complex formation.

To demonstrate the structural changes upon introduced mutations and heparan sulphate addition, some of the data obtained are summarised in the graphs above and below.

3.2 Fluorescence Measurements

For studying concentration and ligand dependent quaternary structure changes fluorescence spectroscopy was performed. Due to its high sensitivity, requiring only nanogram quantities of protein, fluorescence technique was the method of choice for carrying out the desired investigations. Measurements were undertaken using a Perkin-Elmer (Beaconsfield, England) LS50B fluorometer.

3.3 Fluorescence Anisotropy

By recording the concentration dependent fluorescence anisotropy of the chemokine resulting from the extrinsic chromophore bisANS it was aimed to find out the dimerisation constant of the mutants. Measurements were performed in PBS starting with high concentrations (up to 4 μM protein) followed by stepwise dilution. For each data point, the anisotropy signal (r) recorded at 507 nm was averaged over 60 sec.

IL-8 oligomerisation has been reported to relevantly influence the proteins GAG binding properties. Set at monomeric concentration, IL-8 bound size defined oligosaccharides 1000-fold tighter than at dimeric concentration. Therefore, the oligomerisation properties of IL-8 mutants were investigated by fluorescence anisotropy. Since the IL-8 intrinsic fluorophore (Trp57) was not sensitive enough for all of the mutants, the extrinsic fluorophore bis-ANS was used for these measurements. Again, as already noticed for the secondary structure, the mutant Δ6 E70R showed high resemblance also in the oligomerisation constant (koligo=350 nM) to IL-8 wt (koligo=379 nM). The mutant with the highest koligo (koligo=460 nM), which therefore dimerised worst, was Δ6 F17RF21R E70RN71K. Previous studies identified the β-sheets to be mainly involved in the dimerisation process, a fact, which correlates with the results for this mutants' secondary structure, which showed a very low share of β-sheet of only 11.4%. The mutant with the lowest koligo (koligo=147 nM), was found to be Δ6 F17RF21R E70K, which again showed the highest share of β-sheet structure (29.8%) of all mutants investigated. Also the impact of heparan sulphate addition was observed. As for IL-8 wt, where heparan sulphate caused a shift of the oligomerisation constant to much higher levels (koligo=1.075 μM), this was also found for the IL-8 mutants investigated. Δ6 F17RF21R E70K shifted from 0.147 μM to 1.162 μM, and the mutant Δ6 E70R from 0.350 μM to 1.505 μM in the presence of heparan sulphate. Some of the results obtained are demonstrated in FIGS. 3 and 4, whereby FIG. 3 shows the dependence of the fluorescence anisotropy of IL-8 mutants in PBS on the chemokine concentration and FIG. 4 shows the dependence of the fluorescence anisotropy of Δ6 F17RF21R E70K in PBS on the chemokine concentration in the presence (ten fold excess) and absence of HS ((pc=10 xy excess) protein concentration).

3.4 Isothermal Fluorescence Titration (IFT) Experiments

Dissociation constants (Kd values) are a measure for the binding affinity of a ligand to a protein and therefore concentration-dependent change in the fluorescence emission properties of the protein (fluorescence quenching) upon ligand binding was used for the determination of Ed. Since these mutants contain an intrinsic tryptophan chromophore which is located at or near the proposed GAG binding site and therefore should be sensitive to structural changes upon ligand binding, IFT experiments seemed to be suitable for this kind of investigation. Fluorescence intensity titration was performed in PBS using a protein concentration of 700 nM. The emission of the protein solution upon excitation at 282 nm was recorded over a range of 300-400 nm following the addition of an aliquot of the respective GAG ligand and an equilibration period of 60 sec.

Binding to unfractionated heparin and heparan sulphate was investigated. The mutants were set at dimeric concentration to assure sufficient sensitivity. A quenching of Trp57 fluorescence intensity upon GAG binding was registered within a range of 25-35%. Significant improvement of ligand binding was observed, especially for heparin binding. Δ6 F17RN71R E70K (Kd=14 nM) and Δ6 F17RF21R N71K (Kd=14.6 nM) showed 2600-fold better binding, and Δ6 E70K N71K (Kd=74 nM) 1760-fold better binding compared to IL-8 wt (Kd=37 μM). Good results were also obtained for heparan sulphate binding. For Δ6 F17RN71R E70K a Kd of 107 nM was found, for Δ6 F17RF21R N71K the Kd was 95 nM and the mutant Δ6 E70K N71K showed a Kd of 34 nM. As IL-8 wt binds with a Kd of 4.2 μM, the Kds found for the mutants represent an extraordinary improvement in binding, see FIG. 5.

3.5 Unfolding Experiments

In order to obtain information about the proteins stability and whether this stability would be changed upon GAG ligand binding, unfolding experiments were undertaken. As mentioned above fluorescence techniques are very sensitive for observing quaternary structure changes and therefore are also the method of choice to investigate thermal structural changes of the protein. Measurements were undertaken as described for the IFT in which not the ligand concentration was changed but the temperature. Protein structure was observed at a concentration of 0.7 μM from temperatures of 15-85° C. in the absence and the presence of a 10 fold excess of heparan sulphate or heparin.

The emission maximum of the proteins ranged from 340 nm to 357 nm, values which are typical for a solvent exposed tryptophan residue. Beginning with the unfolding experiments at 15° C., the emission maximum of the mutants varied between 340 nm-351 nm. Compared to IL-8 wt, whose emission maximum was observed at 340 nm, this means slightly higher values. Upon an increase in temperature, the intensity of emission maximum decreased, accompanied by a shift of the maximum to either a higher or lower wavelength. The emission maximum of Δ6 E70R and Δ6 E70K N71K shifted from 352.5 nm-357 nm and 343 nm-345 nm, which is typical for a further exposure of the Trp57 residue to the solvent trough temperature increase, but interestingly the mutants Δ6 F17RN71R E70K and Δ6 F17RF21R E70R N71K showed a blue shift, ranging from 350 nm-343 nm and, less pronounced, from 350 nm-348 nm (see FIG. 6). By slowly decreasing the temperature, the process of unfolding was partially reversible regarding both the wavelength shift and changes of intensity. Addition of a 5 fold excess of heparan sulphate led to an increase of stability of the proteins, probably through complex formation. This could be observed on the one hand by a shift of the melting point to higher temperature, and on the other hand by a significantly less pronounced shift of emission maximum upon temperature increase.

Example 4

Cell-Based Assay of the Receptor-“Negative” Function of the Dominant-Negative IL-8 Mutants

In order to characterise the impaired receptor function of the IL-8 mutants with respect to neutrophil attraction, transfilter-based chemotaxis of neutrophils in response to IL-8 mutants was assayed in a microchemotaxis chamber equipped with a 5 μm PVP-free polycarbonate membrane.

Cell Preparation:

Briefly, a neutrophil fraction was prepared from freshly collected human blood. This was done by adding a 6% dextran solution to heparin-treated blood (1:2) which was then left for sedimentation for 45 min. The upper clear cell solution was collected and washed twice with HBSS w/o Ca and Mg. Cells were counted and finally diluted with HBSS at 2Mio/ml cell suspension, taking into account that only 60% of the counted cells were neutrophils.

Chemotaxis Assay:

IL-8 mutants were diluted at concentrations of 10 μg/ml, 1 μg/ml and 0.1 μg/ml and put in triplicates in the lower compartment of the chamber (26 μl per well). The freshly prepared neutrophils were seeded in the upper chamber (50 μl per well) and incubated for 30 minutes at 37° C. in a 5% CO2 humidified incubator. After incubation, the chamber was disassembled, the upper side of the filter was washed and wiped off and cells attached to the lower side were fixed with methanol and stained with Hemacolor solutions (Merck). Cells were then counted at 400× magnifications in 4 randomly selected microscopic fields per well. Finally, the mean of three independent experiments was plotted against the chemokine concentration. In FIG. 7, the chemotaxis index for various IL-8 mutants is shown. As expected, all mutants showed significantly decreased receptor binding activity.

Example 5

Generation of Recombinant RANTES Genes, Expression, Biophysical and Activity Characterisation of the Mutants

The concept of dominant-negative “GAG-masking” chemokine mutants was also employed to RANTES, a chemokine involved in type IV hypersensitivity reactions like transplant rejection, atopic dermatitis as well as in other inflammatory disorders like arthritis, progressive glomerulonephritis and inflammatory lung disease.

The receptor binding capability was impaired by introducing into the wt protein an initiating methionine residue. Expression of the wt RANTES in E. Coli lead to the retention of this methionine residue, which renders wt RANTES to a potent inhibitor of monocyte migration, the so-called Met-RANTES. Different mutations enhancing the GAG binding affinity were introduced via PCR-based site-directed mutagenesis methods.

By these means 9 RANTES mutants have so far been cloned, expressed and purified, Met-RANTES A22K, Met-RANTES H23K, Met-RANTES T43K, Met-RANTES N46R, Met-RANTES N46K, Met-RANTES Q48K, Met-RANTES A22K/N46R, Met-RANTES V49R/E66S and Met-RANTES 15LSLA18 V49R/E66S.

Isothermal fluorescence titration experiments were carried out to measure the relative affinity constants (Kd values) of the RANTES mutants for size defined heparin. As can be seen in the table all RANTES mutant proteins showed higher affinities for this heparin, with Met-RANTES A22K, Met-RANTES H23K, Met-RANTES T43K and Met-RANTES A22K/N46R showing the most promising results.

Kd in nM
Wt Rantes 456.2 ± 8.5 
Met-Rantes V49R/E66S 345.5 ± 21.7
Rantes 15LSLA18 V49R/66S 297.3 ± 14.1
Rantes N46R 367.7 ± 11.7
Rantes N46K 257.4 ± 10.2
Rantes H23K 202.5 ± 12.8
Rantes Q48K 383.4 ± 39.6
Rantes T43K 139.2 ± 30.1
Rantes A22K 202.1 ± 9.8 
Rantes A22K/N46R 164.0 ± 16.6

RANTES Chemotaxis Assay

RANTES mutant directed cell migration was investigated using the 48-well Boyden chamber system equipped with 5 μm PVP-coated polycarbonate membranes. RANTES and RANTES mutant dilutions in RPMI 1640 containing 20 mM HEPES pH 7.3 and 1 mg/ml BSA were placed in triplicates in the lower wells of the chamber. 50 μl of THP-1 cell suspensions (promonocytic cell line from the European collection of cell cultures) in the same medium at 2×106 cells/ml were placed in the upper wells. After a 2 h incubation period at 37° C. in 5% CO2 the upper surface of the filter was washed in HBSS solution. The migrated cells were fixed in methanol and stained with Hemacolor solution (Merck). Five 400× magnifications per well were counted and the mean of three independently conducted experiments was plotted against the chemokine concentration in FIG. 8. The error bars represent the standard error of the mean of the three experiments. Again, as in the case of the IL-8 mutants, all RANTES mutants showed significantly reduced receptor binding activity.

Example 6

Proteins with GAG Binding Regions

By bioinformatical and by proteomical means GAG binding proteins were characterised together with their GAG binding regions. In the following tables 2 and 3 chemokines are shown with their GAG binding regions (table 2) and examples of other proteins are given also with their GAG binding regions (table 3).

TABLE 2
Chemokines and their GAG binding domains
                                 CXC-chemokines
IL-8: 18HPK20, (R47) 60TVVEKFLKR68 (residues 60-68 of SEQ ID NO: 16)
(SEQ ID NO: 16)
SAKELRCQCIKTYSKPFHPKFIKELRVIESGPHCANTEIIVKLSDGRELCLDPKENWVQRVVEKFLKRAENS
MGSA/GROα: 19HPK21, 45KNGR48 (residues 45-48 of SEQ ID NO: 17),
60KKIIEK66 (residues 60-66 of SEQ ID NO: 17)
(SEQ ID NO: 17)
ASVATELRCQCLQTLQGIHPKNIQSVNVKSPGPHCAQTEVIATLKNGRKACLNPASPIVKKIIEKMLNSDKSN
MIP-2α/GROβ: 19HLK21, K45, 60KKIIEKMLK68 (residues 60-68 of SEQ ID NO: 18)
(SEQ ID NO: 18)
APLATELRCQCLQTLQGIHLKNIQSVKVKSPGPHCAQTEVIATLKNGQKACLNPASPMVKKIIEKMLKNGKSN
NAP-2: 15HPK18, 42KDGR45 (residues 42-45 of SEQ ID NO: 19), 57KKIVQK62
(residues 57-62 of SEQ ID NO: 19)
(SEQ ID NO: 19)
AELRCLCIKTTSGIHPKNIQSLEVIGKGTHCNQVEVIATLKDGRKICLDPDAPRIKKIVQKKLAGDESAD
PF-4: 20RPRH23 (residues 20-23 of SEQ ID NO: 20), 46KNGR49 (residues 46-49
of SEQ ID NO: 20), 61KKIIKK66 (residues 61-66 of SEQ ID NO: 20)
(SEQ ID NO: 20)
EAEEDGDLQCLCVKTTSQVRPRHITSLEVIKAGPHCPTAQLIATLKNGRKICLDLQAPLYKKIIKKLLES
SDF-1α: K1, 24KHLK27 (residues 24-27 of SEQ ID NO: 21), 41RLK43
(SEQ ID NO: 21)
KPVSLSYRCPCRFFESHVARANVKHLKILNTPNCALQIVARLKNNNRQVCIDPKLKWIQEYLEKALN
                                    CC-chemokines
RANTES: (17RPLPRAH23 (residues 17-23 of SEQ ID NO: 22)) 44RKNR47 (residues
44-47 of SEQ ID NO: 22)
(SEQ ID NO: 22)
SPYSSDTTPCCFAYIARPLPRAHIKEYFYTSGKCSNPAVVFVTRKNRQVCANPEKKWVREYINSLEMS
MCP-2: 18RKIPIQR24 (residues 18-24 of SEQ ID NO: 23), 46KRGK49 (residues 46-49
of SEQ ID NO: 23)
(SEQ ID NO: 23)
QPDSVSIPITCCFNVINRKIPIQRLESYTRITNIQCPKEAVIFKTKRGKEVCADPKERWVRDSMKHLDQIFQNLKP
MCP-3: 22KQR24, 47KLDK50 (residues 47-50 of SEQ ID NO: 24),
66KHLDKK71 (residues 66-71 of SEQ ID NO: 24)
(SEQ ID NO: 24)
QPVGINTSTTCCYRFINKKIPKQRLESYRRTTSSHCPREAVIFKTKLDKEICADPTQKWVQDFMKHLDKKTQTPKL
MIP-1α: R17, 44KRSR47 (residues 44-47 of SEQ ID NO: 25)
(SEQ ID NO: 25)
SLAADTPTACCFSYTSRQIPQNFIADYFETSSQCSKPGVIFLTKRSRQVCADPSEEWVQKYVSDLELSA
MIP-1β: R18, 45KRSK48 (residues 45-48 of SEQ ID NO: 26)
(SEQ ID NO: 26)
APMGSDPPTACCFSYTARKLPRNFVVDYYETSSLCSQPAVVFQTKRSKQVCADPSESWVQEYVYDLELN
MPIF-1: R18, 45KKGR48 (residues 45-48 of SEQ ID NO: 27)
(SEQ ID NO: 27)
MDRFHATSADCCISYTPRSIPCSLLESYFETNSECSKPGVIFLTKKGRRFCANPSDKQVQVCMRMLKLDTRIKTRKN
MIP-5/HCC-2: 40KKGR43 (residues 40-43 of SEQ ID NO: 28)
(SEQ ID NO: 28)
HFAADCCTSYISQSIPCSLMKSYFETSSECSKPGVIFLTKKGRQVCAKPSGPGVQDCMKKLKPYSI

TABLE 3
SEQ ID NO:
Peroxisome biogenesis factor 1 29 181 TRRAKE 186
30 367 QKKIRS 372
31 1263 PKRRKN 1268
32 181 TRRAKE 186
33 367 QKKIRS 372
34 1263 PKRRKN 1268
MLTK-beta 35 415 SKRRGKKV 422
36 312 ERRLKM 317
37 416 KRRGKK 421
38 312 ERRLKM 317
39 416 KRRGKK 421
BHLH factor Hes4 40 43 EKRRRARI 50
41 43 EKRRRA 48
42 43 EKRRRA 48
Protocadherin 11 43 867 MKKKKKKK 874
44 867 MKKKKK 872
45 867 MKKKKK 872
46 899 MKKKKKKK 906
47 899 MKKKKK 904
48 899 MKKKKK 904
catenin (cadherin-associated protein), 49 315 RRRLRS 320
delta 1 50 404 VRKLKG 409
51 460 LRKARD 465
52 545 RRKLRE 550
53 621 AKKGKG 626
54 787 AKKLRE 792
55 315 RRRLRS 320
56 404 VRKLKG 409
57 460 LRKARD 465
58 545 RRKLRE 550
59 621 AKKGKG 626
60 787 AKKLRE 792
Muscarinic acetylcholine receptor M5 61 221 EKRTKD 226
62 427 TKRKRV 432
63 514 WKKKKV 519
64 221 EKRTKD 226
65 427 TKRKRV 432
66 514 WKKKKV 519
Alpha-2A adrenergic receptor 67 147 PRRIKA 152
68 224 KRRTRV 229
69 147 PRRIKA 152
70 224 KRRTRV 229
IL-5 promoter REII-region-binding protein 71 440 TKKKTRRR 447
72 569 GKRRRRRG 576
73 38 ARKGKR 43
74 437 GKKTKK 442
75 444 TRRRRA 449
76 569 GKRRRR 574
77 38 ARKGKR 43
78 437 GKKTKK 442
79 444 TRRRRA 449
80 569 GKRRRR 574
Mitofusin 1 81 291 ARKQKA 296
82 395 KKKIKE 400
83 291 ARKQKA 296
84 395 KKKIKE 400
N-cym protein 85 71 VRRCKI 76
86 71 VRRCKI 76
Smad ubiquitination regulatory factor 1 87 672 ERRARL 677
88 672 ERRARL 677
CUG-BP and ETR-3 like factor 5 89 468 MKRLKV 473
90 475 LKRPKD 480
91 468 MKRLKV 473
92 475 LKRPKD 480
Ewings sarcoma EWS-Flil 93 347 QRKSKP 352
94 347 QRKSKP 352
NUF2R 95 455 LKRKMFKM 462
96 331 LKKLKT 336
97 347 VKKEKL 352
98 331 LKKLKT 336
99 347 VKKEKL 352
Kruppel-like zinc finger protein 100 22 EKRERT 27
GLIS2 101 22 EKRERT 27
FKSG32 202 15 LKRVRE 20
103 431 VRRGRI 436
104 15 LKRVRE 20
105 431 VRRGRI 436
BARH-LIKE 1 PROTEIN 106 175 LKKPRK 180
107 228 NRRTKW 233
108 175 LKKPRK 180
109 228 NRRTKW 233
Nucleolar GTP-binding protein 1 110 393 SRKKRERD 400
111 624 GKRKAGKK 631
112 48 MRKVKF 53
113 141 IKRQKQ 146
114 383 ARRKRM 388
115 393 SRKKRE 398
116 490 KKKLKI 495
117 543 ARRSRS 548
118 550 TRKRKR 555
119 586 VKKAKT 591
120 629 GKKDRR 634
121 48 MRKVKF 53
122 141 IKRQKQ 146
123 383 ARRKRM 388
124 393 SRKKRE 398
125 490 KKKLKI 495
126 543 ARRSRS 548
127 550 TRKRKR 555
128 586 VKKAKT 591
129 629 GKKDRR 634
EVG1 130 17 RRRPKT 22
131 138 ERKRKA 143
132 17 RRRPKT 22
133 138 ERKRKA 143
ASPL 134 282 PKKSKS 287
135 282 PKKSKS 287
Zinc transporter 1 136 477 EKKPRR 482
137 477 EKKPRR 482
Uveal autoantigen 138 603 EKKGRK 608
139 995 ERKFKA 1000
140 1023 VKKNKQ 1028
141 603 EKKGRK 608
142 995 ERKFKA 1000
143 1023 VKKNKQ 1028
RAB39 144 7 VRRDRV 12
145 7 VRRDRV 12
Down syndrome cell adhesion molecule 146 320 PRKVKS 325
147 387 VRKDKL 392
148 320 PRKVKS 325
149 387 VRKDKL 392
Protein-tyrosine phosphatase, non-receptor 150 139 GRKKCERY 146
type 12 151 59 VKKNRY 64
152 59 VKKNRY 64
WD-repeat protein 11 153 752 VRKIRF 757
154 752 VRKIRF 757
Gastric cancer-related protein 155 20 SRKRQTRR 27
VRG107 156 25 TRRRRN 30
157 25 TRRRRN 30
Early growth response protein 4 158 356 ARRKGRRG 363
159 452 EKKRHSKV 459
160 357 RRKGRR 362
161 357 RRKGRR 362
Vesicle transport-related protein 162 309 PKRKNKKS 316
163 226 DKKLRE 231
164 310 KRKNKK 315
165 355 VKRLKS 360
166 226 DKKLRE 231
167 310 KRKNKK 315
168 355 VKRLKS 360
UPF3X 169 140 AKKKTKKR 147
170 141 KKKTKK 146
171 217 ERRRRE 222
172 225 RKRQRE 230
173 233 RRKWKE 238
174 240 EKRKRK 245
175 296 DKREKA 301
176 373 RRRQKE 378
177 393 MKKEKD 398
178 426 VKRDRI 431
179 140 AKKKTKKRD 148
180 141 KKKTKK 146
181 217 ERRRRE 222
182 225 RKRQRE 230
183 233 RRKWKE 238
184 240 EKRKRK 245
185 296 DKREKA 301
186 373 RRRQKE 378
187 393 MKKEKD 398
188 426 VKRDRI 431
CGI-201 protein, type IV 189 49 ARRTRS 54
190 49 ARRTRS 54
RING finger protein 23 191 98 KRKIRD 103
192 98 KRKIRD 103
FKSG17 193 72 EKKARK 77
194 95 IRKSKN 100
195 72 EKKARK 77
196 95 IRKSKN 100
P83 197 681 ARKERE 686
198 681 ARKERE 686
Ovarian cancer-related protein 1 199 62 LKRDRF 67
200 62 LKRDRF 67
MHC class II transactivator CIITA 201 407 HRRPRE 412
202 741 PRKKRP 746
203 783 DRKQKV 788
204 407 HRRPRE 412
205 741 PRKKRP 746
206 783 DRKQKV 788
Platelet glycoprotein VI-2 207 275 SRRKRLRH 282
208 275 SRRKRL 280
209 275 SRRKRL 280
Ubiquitin-like 5 protein 210 11 GKKVRV 16
211 11 GKKVRV 16
Protein kinase D2 212 191 ARKRRL 196
213 191 ARKRRL 196
Homeobox protein GSH-2 214 202 GKRMRT 207
215 252 NRRVKH 257
216 202 GKRMRT 207
217 252 NRRVKH 257
ULBP3 protein 218 166 ARRMKE 171
219 201 HRKKRL 206
220 166 ARRMKE 171
221 201 HRKKRL 206
Type II iodothyronine deiodinase 222 87 SKKEKV 92
223 87 SKKEKV 92
224 299 SKRCKK 304
225 299 SKRCKK 304
Sperm antigen 226 160 LKKYKE 165
227 478 IKRLKE 483
228 160 LKKYKEKRT 168
229 160 LKKYKE 165
230 478 IKRLKE 483
UDP-GalNAc: polypeptide N- 231 4 ARKIRT 9
acetylgalactosaminyltransferase 232 44 DRRVRS 49
233 138 PRKCRQ 143
234 4 ARKIRT 9
235 44 DRRVRS 49
236 138 PRKCRQ 143
NCBE 237 62 HRRHRH 67
238 73 RKRDRE 78
239 1012 SKKKKL 1017
240 62 HRRHRH 67
241 73 RKRDRE 78
242 1012 SKKKKL 1017
WD repeat protein 243 372 LKKKEERL 379
244 384 EKKQRR 389
245 400 AKKMRP 405
246 384 EKKQRR 389
247 400 AKKMRP 405
Phosphodiesterase 11A 248 27 MRKGKQ 32
249 27 MRKGKQ 32
Probable cation-transporting ATPase 2 250 891 ERRRRPRD 898
251 306 SRKWRP 311
252 891 ERRRRP 896
253 306 SRKWRP 311
254 891 ERRRRP 896
HMG-box transcription factor TCF-3 255 420 GKKKKRKR 427
256 399 ARKERQ 404
257 420 GKKKKR 425
258 420 GKKKKRKRE 428
259 399 ARKERQ 404
260 420 GKKKKR 425
HVPS11 261 793 VRRYRE 798
262 793 VRRYRE 798
PIST 263 165 NKKEKM 170
264 165 NKKEKM 170
FYN-binding protein 265 473 KKREKE 478
266 501 KKKFKL 506
267 682 LKKLKK 687
268 696 RKKFKY 701
269 473 KKREKE 478
270 501 KKKFKL 506
271 682 LKKLKK 687
272 696 RKKFKY 701
C1orf25 273 620 GKKQKT 625
274 620 GKKQKT 625
C1orf14 275 441 LRRRKGKR 448
276 70 LRRWRR 75
277 441 LRRRKG 446
278 70 LRRWRR 75
279 441 LRRRKG 446
T-box transcription factor TBX3 280 144 DKKAKY 149
281 309 GRREKR 314
282 144 DKKAKY 149
283 309 GRREKR 314
Mitochondrial 39S ribosomal protein L47 284 121 AKRQRL 126
285 216 EKRARI 221
286 230 RKKAKI 235
287 121 AKRQRL 126
288 216 EKRARI 221
289 230 RKKAKI 235
CGI-203 290 33 VRRIRD 38
291 33 VRRIRD 38
Jagged1 292 1093 LRKRRK 1098
293 1093 LRKRRK 1098
Secretory carrier-associated 294 102 DRRERE 107
membrane protein 1 295 102 DRRERE 107
Vitamin D receptor-interacting 296 673 KKKKSSRL 680
protein complex component DRIP205 297 672 TKKKKS 677
298 954 QKRVKE 959
299 978 GKRSRT 983
300 995 PKRKKA 1000
301 1338 GKREKS 1343
302 1482 HKKHKK 1487
303 1489 KKKVKD 1494
304 672 TKKKKS 677
305 954 QKRVKE 959
306 978 GKRSRT 983
307 995 PKRKKA 1000
308 1338 GKREKS 1343
309 1482 HKKHKK 1487
310 1489 KKKVKD 1494
Secretory carrier-associated 311 100 ERKERE 105
membrane protein 2 312 100 ERKERE 105
Nogo receptor 313 420 SRKNRT 425
314 420 SRKNRT 425
FLAMINGO 1 315 169 GRRKRN 174
316 2231 ARRQRR 2236
317 169 GRRKRN 174
318 2231 ARRQRR 2236
CC-chemokine receptor 319 58 CKRLKS 63
320 58 CKRLKS 63
Prolactin regulatory element-binding protein 321 271 HKRLRQ 276
322 271 HKRLRQ 276
Kappa B and V(D)J recombination 323 17 PRKRLTKG 24
signal sequences binding protein 324 713 RKRRKEKS 720
325 903 PKKKRLRL 910
326 180 HKKERK 185
327 629 TKKTKK 634
328 712 LRKRRK 717
329 903 PKKKRL 908
330 1447 QKRVKE 1452
331 1680 SRKPRM 1685
332 180 HKKERK 185
333 629 TKKTKK 634
334 712 LRKRRK 717
335 903 PKKKRL 908
336 1447 QKRVKE 1452
337 1680 SRKPRM 1685
Breast cancer metastasis-suppressor 1 338 200 SKRKKA 205
339 229 IKKARA 234
340 200 SKRKKA 205
341 229 IKKARA 234
Forkhead box protein P3 342 414 RKKRSQRP 421
343 413 FRKKRS 418
344 413 FRKKRS 418
FAS BINDING PROTEIN 345 228 LKRKLIRL 235
346 391 RKKRRARL 398
347 358 ARRLRE 363
348 390 ERKKRR 395
349 629 CKKSRK 634
350 358 ARRLRE 363
351 390 ERKKRR 395
352 629 CKKSRK 634
Ubiquitin carboxyl-terminal hydrolase 12 353 228 HKRMKV 233
354 244 LKRFKY 249
355 228 HKRMKV 233
356 244 LKRFKY 249
KIAA0472 protein 357 110 HRKPKL 115
358 110 HRKPKL 115
PNAS-101 359 68 LKRSRP 73
360 106 PRKSRR 111
361 68 LKRSRP 73
362 106 PRKSRR 111
PNAS-26 363 118 DRRTRL 123
364 118 DRRTRL 123
Myelin transcription factor 2 365 176 GRRKSERQ 183
Sodium/potassium-transporting ATPase 366 47 SRRFRC 52
gamma chain 367 55 NKKRRQ 60
368 47 SRRFRC 52
369 55 NKKRRQ 60
Mdm4 protein 370 441 EKRPRD 446
371 464 ARRLKK 469
372 441 EKRPRD 446
373 464 ARRLKK 469
G antigen family D 2 protein 374 87 QKKIRI 92
375 87 QKKIRI 92
NipSnap2 protein 376 153 FRKARS 158
377 153 FRKARS 158
Stannin 378 73 ERKAKL 78
379 73 ERKAKL 78
Sodium bicarbonate cotransporter 380 973 EKKKKKKK 980
381 165 LRKHRH 170
382 666 LKKFKT 671
383 966 DKKKKE 971
384 973 EKKKKK 978
385 165 LRKHRH 170
386 666 LKKFKT 671
387 966 DKKKKE 971
388 973 EKKKKK 978
Myosin X 389 683 YKRYKV 688
390 828 EKKKRE 833
391 1653 LKRIRE 1658
392 1676 LKKTKC 1681
393 683 YKRYKV 688
394 828 EKKKRE 833
395 1653 LKRIRE 1658
396 1676 LKKTKC 1681
PNAS-20 397 21 RKRKSVRG 28
398 20 ERKRKS 25
399 20 ERKRKS 25
Pellino 400 36 RRKSRF 41
401 44 FKRPKA 49
402 36 RRKSRF 41
403 44 FKRPKA 49
Hyaluronan mediated motility receptor 404 66 ARKVKS 71
405 66 ARKVKS 71
Short transient receptor potential channel 7 406 753 FKKTRY 758
407 753 FKKTRY 758
Liprin-alpha2 408 825 PKKKGIKS 832
409 575 IRRPRR 580
410 748 LRKHRR 753
411 839 GKKEKA 844
412 875 DRRLKK 880
413 575 IRRPRR 580
414 748 LRKHRR 753
415 839 GKKEKA 844
416 875 DRRLKK 880
Transcription intermediary factor 1-alpha 417 904 DKRKCERL 911
418 1035 PRKKRLKS 1042
419 321 NKKGKA 326
420 1035 PRKKRL 1040
421 321 NKKGKA 326
422 1035 PRKKRL 1040
CARTILAGE INTERMEDIATE LAYER PROTEIN 423 719 QRRNKR 724
424 719 QRRNKR 724
UBX domain-containing protein 1 425 194 YRKIKL 199
426 194 YRKIKL 199
Arachidonate 12-lipoxygenase, 12R type 427 166 VRRHRN 171
428 233 WKRLKD 238
429 166 VRRHRN 171
430 233 WKRLKD 238
Hematopoietic PBX-interacting protein 431 159 LRRRRGRE 166
432 698 LKKRSGKK 705
433 159 LRRRRG 164
434 703 GKKDKH 708
435 159 LRRRRG 164
436 703 GKKDKH 708
NAG18 437 28 LKKKKK 33
438 28 LKKKKK 33
POU 5 domain protein 439 222 ARKRKR 227
440 222 ARKRKR 227
NRCAM PROTEIN 441 2 PKKKRL 7
442 887 SKRNRR 892
443 1185 IRRNKG 1190
444 1273 GKKEKE 1278
445 2 PKKKRL 7
446 887 SKRNRR 892
447 1185 IRRNKG 1190
448 1273 GKKEKE 1278
protocadherin gamma cluster 449 11 TRRSRA 16
450 11 TRRSRA 16
SKD1 protein 451 288 IRRRFEKR 295
452 251 ARRIKT 256
453 362 FKKVRG 367
454 251 ARRIKT 256
455 362 FKKVRG 367
ANTI-DEATH PROTEIN 456 58 HRKRSRRV 65
457 59 RKRSRR 64
458 59 RKRSRR 64
Centrin 3 459 14 TKRKKRRE 21
460 14 TKRKKR 19
461 14 TKRKKR 19
Ectonucleoside triphosphate 462 512 TRRKRH 517
diphosphohydrolase 3 463 512 TRRKRH 517
Homeobox protein prophet of PIT-1 464 12 PKKGRV 17
465 69 RRRHRT 74
466 119 NRRAKQ 124
467 12 PKKGRV 17
468 69 RRRHRT 74
469 119 NRRAKQ 124
PROSTAGLANDIN EP3 RECEPTOR 470 77 YRRRESKR 84
471 389 MRKRRLRE 396
472 82 SKRKKS 87
473 389 MRKRRL 394
474 82 SKRKKS 87
475 389 MRKRRL 394
Pituitary homeobox 3 476 58 LKKKQRRQ 65
477 59 KKKQRR 64
478 112 NRRAKW 117
479 118 RKRERS 123
480 59 KKKQRR 64
481 112 NRRAKW 117
482 118 RKRERS 123
HPRL-3 483 136 KRRGRI 141
484 136 KRRGRI 141
Advillin 485 812 MKKEKG 817
486 812 MKKEKG 817
Nuclear LIM interactor-interacting factor 1 487 32 GRRARP 37
488 109 LKKQRS 114
489 32 GRRARP 37
490 109 LKKQRS 114
Core histone macro-H2A.1 491 5 GKKKSTKT 12
492 114 AKKRGSKG 121
493 70 NKKGRV 75
494 132 AKKAKS 137
495 154 ARKSKK 159
496 302 DKKLKS 307
497 70 NKKGRV 75
498 132 AKKAKS 137
499 154 ARKSKK 159
500 302 DKKLKS 307
Villin-like protein 501 180 KRRRNQKL 187
502 179 EKRRRN 184
503 179 EKRRRN 184
BETA-FILAMIN 504 254 PKKARA 259
505 2002 ARRAKV 2007
506 254 PKKARA 259
507 2002 ARRAKV 2007
Tripartite motif protein TRIM31 508 290 LKKFKD 295
alpha 509 290 LKKFKD 295
Nuclear receptor co-repressor 1 510 106 SKRPRL 111
511 299 ARKQRE 304
512 330 RRKAKE 335
513 349 IRKQRE 354
514 412 QRRVKF 417
515 497 KRRGRN 502
516 580 RRKGRI 585
517 687 SRKPRE 692
518 2332 SRKSKS 2337
519 106 SKRPRL 111
520 299 ARKQRE 304
521 330 RRKAKE 335
522 349 IRKQRE 354
523 412 QRRVKF 417
524 497 KRRGRN 502
525 580 RRKGRI 585
526 687 SRKPRE 692
527 2332 SRKSKS 2337
BRAIN EXPRESSED RING FINGER PROTEIN 528 432 KRRVKS 437
529 432 KRRVKS 437
PB39 530 231 TKKIKL 236
531 231 TKKIKL 236
Sperm acrosomal protein 532 48 FRKRMEKE 55
533 24 RRKARE 29
534 135 KRKLKE 140
535 213 KKRLRQ 218
536 24 RRKARE 29
537 135 KRKLKE 140
538 213 KKRLRQ 218
VESICLE TRAFFICKING PROTEIN SEC22B 539 177 SKKYRQ 182
540 177 SKKYRQ 182
Nucleolar transcription factor 1 541 79 VRKFRT 84
542 102 GKKLKK 107
543 125 EKRAKY 130
544 147 SKKYKE 152
545 156 KKKMKY 161
546 240 KKRLKW 245
547 451 KKKAKY 456
548 523 EKKEKL 528
549 558 SKKMKF 563
550 79 VRKFRT 84
551 102 GKKLKK 107
552 125 EKRAKY 130
553 147 SKKYKE 152
554 156 KKKMKY 161
555 240 KKRLKW 245
556 451 KKKAKY 456
557 523 EKKEKL 528
558 558 SKKMKF 563
Plexin-B3 559 248 FRRRGARA 255
Junctophilin type3 560 626 QKRRYSKG 633
Plaucible mixed-lineage kinase protein 561 773 YRKKPHRP 780
562 312 ERRLKM 317
563 312 ERRLKM 317
fatty acid binding protein 4, adipocyte 564 78 DRKVKS 83
565 105 IKRKRE 110
566 78 DRKVKS 83
567 105 IKRKRE 110
exostoses (multiple) 1 568 78 SKKGRK 83
569 78 SKKGRK 83
DHHC-domain-containing cysteine-rich protein 570 64 HRRPRG 69
571 64 HRRPRG 69
Myb proto-oncogene protein 572 2 ARRPRH 7
573 292 EKRIKE 297
574 523 LKKIKQ 528
575 2 ARRPRH 7
576 292 EKRIKE 297
577 523 LKKIKQ 528
Long-chain-fatty-acid--CoA ligase 2 578 259 RRKPKP 264
579 259 RRKPKP 264
syntaxinlB2 580 260 ARRKKI 265
581 260 ARRKKI 265
Dachshund 2 582 162 ARRKRQ 167
583 516 QKRLKK 521
584 522 EKKTKR 527
585 162 ARRKRQ 167
586 516 QKRLKK 521
587 522 EKKTKR 527
DEAD/DEXH helicase DDX31 588 344 EKRKSEKA 351
589 760 TRKKRK 765
590 760 TRKKRK 765
Androgen receptor 591 628 ARKLKK 633
592 628 ARKLKK 633
Retinoic acid receptor alpha 593 364 RKRRPSRP 371
594 163 NKKKKE 168
595 363 VRKRRP 368
596 163 NKKKKE 168
597 363 VRKRRP 368
Kinesin heavy chain 598 340 WKKKYEKE 347
599 605 VKRCKQ 610
600 864 EKRLRA 869
601 605 VKRCKQ 610
602 864 EKRLRA 869
DIUBIQUITIN 603 30 VKKIKE 35
604 30 VKKIKE 35
BING1 PROTEIN 605 519 NKKFKM 524
606 564 ERRHRL 569
607 519 NKKFKM 524
608 564 ERRHRL 569
Focal adhesion kinase 1 609 664 SRRPRF 669
610 664 SRRPRF 669
EBN2 PROTEIN 611 20 TKRKKPRR 27
612 13 PKKDKL 18
613 20 TKRKKP 25
614 47 NKKNRE 52
615 64 LKKSRI 69
616 76 PKKPRE 81
617 493 SRKQRQ 498
618 566 VKRKRK 571
619 13 PKKDKL 18
620 20 TKRKKP 25
621 47 NKKNRE 52
622 64 LKKSRI 69
623 76 PKKPRE 81
624 493 SRKQRQ 498
625 566 VKRKRK 571
CO16 PROTEIN 626 33 ARRLRR 38
627 115 PRRCKW 120
628 33 ARRLRR 38
629 115 PRRCKW 120
KYNURENINE 3-MONOOXYGENASE 630 178 MKKPRF 183
631 178 MKKPRF 183
MLN 51 protein 632 4 RRRQRA 9
633 255 PRRIRK 260
634 407 ARRTRT 412
635 4 RRRQRA 9
636 255 PRRIRK 260
637 407 ARRTRT 412
MHC class II antigen 638 99 QKRGRV 104
MHC class II antigen 639 99 QKRGRV 104
Transforming acidic coiled-coil-containing 640 225 SRRSKL 230
protein 1 641 455 PKKAKS 460
642 225 SRRSKL 230
643 455 PKKAKS 460
Neuro-endocrine specific protein VGF 644 479 EKRNRK 484
645 479 EKRNRK 484
Organic cation transporter 646 230 GRRYRR 235
647 535 PRKNKE 540
648 230 GRRYRR 235
649 535 PRKNKE 540
DNA polymerase theta 650 215 KRRKHLKR 222
651 214 WKRRKH 219
652 220 LKRSRD 225
653 1340 GRKLRL 1345
654 1689 SRKRKL 1694
655 214 WKRRKH 219
656 220 LKRSRD 225
657 1340 GRKLRL 1345
658 1689 SRKRKL 1694
CDC45-related protein 659 169 MRRRQRRE 176
660 155 EKRTRL 160
661 170 RRRQRR 175
662 483 NRRCKL 488
663 155 EKRTRL 160
664 170 RRRQRR 175
665 483 NRRCKL 488
Chloride intracellular channel protein 2 666 197 AKKYRD 202
667 197 AKKYRD 202
Methyl-CpG binding protein 668 85 KRKKPSRP 92
669 83 SKKRKK 88
670 318 QKRQKC 323
671 354 YRRRKR 359
672 83 SKKRKK 88
673 318 QKRQKC 323
674 354 YRRRKR 359
Protein kinase C, eta type 675 155 RKRQRA 160
676 155 RKRQRA 160
Heterogeneous nuclear 677 71 LKKDRE 76
ribonucleoprotein H 678 169 LKKHKE 174
679 71 LKKDRE 76
680 169 LKKHKE 174
ORF2 681 11 SRRTRW 16
682 155 ERRRKF 160
683 185 LRRCRA 190
684 530 SRRSRS 535
685 537 GRRRKS 542
686 742 ERRAKQ 747
687 11 SRRTRW 16
688 155 ERRRKF 160
689 185 LRRCRA 190
690 530 SRRSRS 535
691 537 GRRRKS 542
692 742 ERRAKQ 747
F-box only protein 24 693 9 LRRRRVKR 16
694 9 LRRRRV 14
695 29 EKRGKG 34
696 9 LRRRRV 14
697 29 EKRGKG 34
Leucin rich neuronal protein 698 51 NRRLKH 56
699 51 NRRLKH 56
RER1 protein 700 181 KRRYRG 186
701 181 KRRYRG 186
Nephrocystin 702 3 ARRQRD 8
703 430 PKKPKT 435
704 557 NRRSRN 562
705 641 EKRDKE 646
706 3 ARRQRD 8
707 430 PKKPKT 435
708 557 NRRSRN 562
709 641 EKRDKE 646
Adenylate kinase isoenzyme 2, mitochondrial 710 60 GKKLKA 65
711 116 KRKEKL 121
712 60 GKKLKA 65
713 116 KRKEKL 121
Chlordecone reductase 714 245 AKKHKR 250
715 245 AKKHKR 250
Metaxin 2 716 166 KRKMKA 171
717 166 KRKMKA 171
Paired mesoderm homeobox protein1 718 89 KKKRKQRR 96
719 88 EKKKRK 93
720 94 QRRNRT 99
721 144 NRRAKF 149
722 88 EKKKRK 93
723 94 QRRNRT 99
724 144 NRRAKF 149
Ring finger protein 725 174 LKRKWIRC 181
726 8 TRKIKL 13
727 95 MRKQRE 100
728 8 TRKIKL 13
729 95 MRKQRE 100
Ataxin 7 730 55 PRRTRP 60
731 377 GRRKRF 382
732 704 GKKRKN 709
733 834 GKKRKC 839
734 55 PRRTRP 60
735 377 GRRKRF 382
736 704 GKKRKN 709
737 834 GKKRKC 839
Growth-arrest-specific protein 1 738 169 ARRRCDRD 176
SKAP55 protein 739 115 EKKSKD 120
740 115 EKKSKD 120
Serine palmitoyltransferase 1 741 232 PRKARV 237
742 232 PRKARV 237
Serine palmitoyltransferase 2 743 334 KKKYKA 339
744 450 RRRLKE 455
745 334 KKKYKA 339
746 450 RRRLKE 455
Synaptopodin 747 405 KRRQRD 410
748 405 KRRQRD 410
Alpha-tectorin 749 1446 TRRCRC 1451
750 2080 IRRKRL 2085
751 1446 TRRCRC 1451
752 2080 IRRKRL 2085
LONG FORM TRANSCRIPTION FACTOR C-MAF 753 291 QKRRTLKN 298
Usher syndrome type IIa protein 754 1285 MRRLRS 1290
755 1285 MRRLRS 1290
MSin3A associated polypeptide p30 756 95 QKKVKI 100
757 124 NRRKRK 129
758 158 LRRYKR 163
759 95 QKKVKI 100
760 124 NRRKRK 129
761 158 LRRYKR 163
Ig delta chain C region 762 142 KKKEKE 147
763 142 KKKEKE 147
THYROID HORMONE RECEPTOR-ASSOCIATED 764 383 AKRKADRE 390
PROTEIN COMPLEX COMPONENT TRAP100 765 833 KKRHRE 838
766 833 KKRHRE 838
P60 katanin 767 369 LRRRLEKR 376
768 326 SRRVKA 331
769 326 SRRVKA 331
Transcription factor jun-D 770 286 RKRKLERI 293
771 273 RKRLRN 278
772 285 CRKRKL 290
773 273 RKRLRN 278
774 285 CRKRKL 290
Sterol/retinol dehydrogenase 775 152 VRKARG 157
776 152 VRKARG 157
Glycogen [starch] synthase, liver 777 554 DRRFRS 559
778 578 SRRQRI 583
779 554 DRRFRS 559
780 578 SRRQRI 583
Estrogen-related receptor gamma 781 173 TKRRRK 178
782 353 VKKYKS 358
783 173 TKRRRK 178
784 353 VKKYKS 358
Neural retina-specific leucine zipper protein 785 162 QRRRTLKN 169
Cytosolic phospholipase A2-gamma 786 514 NKKKILRE 521
787 31 LKKLRI 36
788 218 FKKGRL 223
789 428 CRRHKI 433
790 31 LKKLRI 36
Cytosolic phospholipase A2-gamma 791 218 FKKGRL 223
792 428 CRRHKI 433
GLE1 793 415 AKKIKM 420
794 415 AKKIKM 420
Multiple exostoses type II protein 795 296 VRKRCHKH 303
EXT2.I 796 659 RKKFKC 664
797 659 RKKFKC 664
Cyclic-AMP-dependent transcription 798 86 EKKARS 91
factor ATF-7 799 332 GRRRRT 337
800 344 ERRQRF 349
801 86 EKKARS 91
802 332 GRRRRT 337
803 344 ERRQRF 349
Protein kinase/endoribonulcease 804 886 LRKFRT 891
805 886 LRKFRT 891
Transcription factor E2F6 806 23 RRRCRD 28
807 59 VKRPRF 64
808 98 VRKRRV 103
809 117 EKKSKN 122
810 23 RRRCRD 28
811 59 VKRPRF 64
812 98 VRKRRV 103
813 117 EKKSKN 122
MAP kinase-activating death domain protein 814 1333 IRKKVRRL 1340
815 160 KRRAKA 165
816 943 MKKVRR 948
817 1034 DKRKRS 1039
818 1334 RKKVRR 1339
819 1453 TKKCRE 1458
820 160 KRRAKA 165
821 943 MKKVRR 948
822 1034 DKRKRS 1039
823 1334 RKKVRR 1339
824 1453 TKKCRE 1458
Orphan nuclear receptor PXR 825 126 KRKKSERT 133
826 87 TRKTRR 92
827 125 IKRKKS 130
828 87 TRKTRR 92
829 125 IKRKKS 130
LENS EPITHELIUM-DERIVED GROWTH FACTOR 830 149 RKRKAEKQ 156
831 286 KKRKGGRN 293
832 145 ARRGRK 150
833 178 PKRGRP 183
834 285 EKKRKG 290
835 313 DRKRKQ 318
836 400 LKKIRR 405
837 337 VKKVEKKRE 345
838 145 ARRGRK 150
839 178 PKRGRP 183
840 285 EKKRKG 290
841 313 DRKRKQ 318
842 400 LKKIRR 405
LIM homeobox protein cofactor 843 255 TKRRKRKN 262
844 255 TKRRKR 260
845 255 TKRRKR 260
MULTIPLE MEMBRANE SPANNING RECEPTOR TRC8 846 229 WKRIRF 234
847 229 WKRIRF 234
Transcription factor SUPT3H 848 172 DKKKLRRL 179
849 169 MRKDKK 174
850 213 NKRQKI 218
851 169 MRKDKK 174
852 213 NKRQKI 218
GEMININ 853 50 KRKHRN 55
854 104 EKRRKA 109
855 50 KRKHRN 55
856 104 EKRRKA 109
Cell cycle-regulated factor p78 857 165 EKKKVSKA 172
858 124 IKRKKF 129
859 188 TKRVKK 193
860 381 DRRQKR 386
861 124 IKRKKF 129
862 188 TKRVKK 193
863 381 DRRQKR 386
lymphocyte antigen 6 complex, locus D 864 61 QRKGRK 66
865 85 ARRLRA 90
866 61 QRKGRK 66
867 85 ARRLRA 90
Delta 1-pyrroline-5-carboxylate synthetase 868 455 LRRTRI 460
869 455 LRRTRI 460
B CELL LINKER PROTEIN BLNK 870 36 IKKLKV 41
871 36 IKKLKV 41
B CELL LINKER PROTEIN BLNK-S 872 36 IKKLKV 41
873 36 IKKLKV 41
fetal Alzheimer antigen 874 5 ARRRRKRR 12
875 16 PRRRRRRT 23
876 93 WKKKTSRP 100
877 5 ARRRRK 10
878 16 PRRRRR 21
879 26 PRRPRI 31
880 35 TRRMRW 40
881 5 ARRRRK 10
882 16 PRRRRR 21
883 26 PRRPRI 31
884 35 TRRMRW 40
Transient receptor potential channel 885
4 zeta splice variant 505 CKKKMRRK 512
886 506 KKKMRR 511
887 676 HRRSKQ 681
888 506 KKKMRR 511
889 676 HRRSKQ 681
Myofibrillogenesis regulator MR-2 890 65 RKRGKN 70
891 65 RKRGKN 70
SH2 domain-containing phosphatase 892 269 IKKRSLRS 276
anchor protein 2c 893 394 SKRPKN 399
immunoglobulin superfamily, member 3 894 394 SKRPKN 399
Meis (mouse) homolog 3 895 112 PRRSRR 117
896 120 WRRTRG 125
897 112 PRRSRR 117
898 120 WRRTRG 125
Deleted in azoospermia 2 899 105 GKKLKL 110
900 114 IRKQKL 119
901 105 GKKLKL 110
902 114 IRKQKL 119
Centaurin gamma3 903 543 NRKKHRRK 550
904 544 RKKHRR 549
905 544 RKKHRR 549
Pre-B-cell leukemia transcription factor-1 906 233 ARRKRR 238
907 286 NKRIRY 291
908 233 ARRKRR 238
909 286 NKRIRY 291
60S ribosomal protein L13a 910 112 DKKKRM 117
911 158 KRKEKA 163
912 167 YRKKKQ 172
913 112 DKKKRM 117
914 158 KRKEKA 163
915 167 YRKKKQ 172
WD40-and FYVE-domain containing protein 3 916 388 IKRLKI 393
917 388 IKRLKI 393
LENG1 protein 918 34 RKRRGLRS 41
919 84 SRKKTRRM 91
920 1 MRRSRA 6
921 33 ERKRRG 38
922 85 RKKTRR 90
923 1 MRRSRA 6
924 33 ERKRRG 38
925 85 RKKTRR 90
MRIP2 926 375 NKKKHLKK 382
G protein-coupled receptor 927 430 EKKKLKRH 437
928 290 WKKKRA 295
929 395 RKKAKF 400
930 431 KKKLKR 436
931 290 WKKKRA 295
932 395 RKKAKF 400
933 431 KKKLKR 436
934 143 LKKFRQ 148
935 228 LRKIRT 233
936 143 LKKFRQ 148
937 228 LRKIRT 233
938 232 QKRRRHRA 239
939 232 QKRRRH 237
940 232 QKRRRH 237
Sperm ion channel 941 402 QKRKTGRL 409
A-kinase anchoring protein 942 2232 KRKKLVRD 2239
943 2601 EKRRRERE 2608
944 2788 EKKKKNKT 2795
945 370 RKKNKG 375
946 1763 SKKSKE 1768
947 2200 EKKVRL 2205
948 2231 LKRKKL 2236
949 2601 EKRRRE 2606
950 2785 EKKEKK 2790
951 1992 QKKDVVKRQ 2000
952 370 RKKNKG 375
953 1763 SKKSKE 1768
954 2200 EKKVRL 2205
955 2231 LKRKKL 2236
956 2601 EKRRRE 2606
957 2785 EKKEKK 2790
Lymphocyte-specific protein LSP1 958 315 GKRYKF 320
959 315 GKRYKF 320
similar to signaling lymphocytic 960 261 RRRGKT 266
activation molecule (H. sapiens) 961 261 RRRGKT 266
Dermatan-4-sulfotransferase-1 962 242 VRRYRA 247
963 242 VRRYRA 247
Moesin 964 291 MRRRKP 296
965 325 EKKKRE 330
966 291 MRRRKP 296
967 325 EKKKRE 330
A-Raf proto-oncogene 968 288 KKKVKN 293
serine/threonine-protein kinase 969 358 LRKTRH 363
970 288 KKKVKN 293
971 358 LRKTRH 363
Cytochrome P450 2C18 972 117 GKRWKE 122
973 117 GKRWKE 122
974 117 GKRWKE 122
975 156 LRKTKA 161
976 117 GKRWKE 122
977 156 LRKTKA 161
Protein tyrosine phosphatase, non-receptor 978 594 IRRRAVRS 601
type 3 979 263 FKRKKF 268
980 388 IRKPRH 393
981 874 VRKMRD 879
982 263 FKRKKF 268
983 388 IRKPRH 393
984 874 VRKMRD 879
similar to kallikrein 7 985
(chymotryptic, stratum corneum) 15 VKKVRL 20
986 15 VKKVRL 20
Hormone sensitive lipase 987 703 ARRLRN 708
988 703 ARRLRN 708
40S ribosomal protein S30 989 25 KKKKTGRA 32
990 23 EKKKKK 28
991 23 EKKKKK 28
Zinc finger protein 91 992 617 LRRHKR 622
993 617 LRRHKR 622
NNP-1 protein 994 320 NRKRLYKV 327
995 387 ERKRSRRR 394
996 432 QRRRTPRP 439
997 454 EKKKKRRE 461
998 29 VRKLRK 34
999 355 GRRQKK 360
1000 361 TKKQKR 366
1001 388 RKRSRR 393
1002 454 EKKKKR 459
1003 29 VRKLRK 34
1004 355 GRRQKK 360
1005 361 TKKQKR 366
1006 388 RKRSRR 393
1007 454 EKKKKR 459
Methionyl-tRNA synthetase 1008 725 WKRIKG 730
1009 725 WKRIKG 730
ELMO2 1010 560 NRRRQERF 567
Meningioma-expressed antigen 6/11 1011 432 RKRAKD 437
1012 432 RKRAKD 437
Inositol polyphosphate 4-phosphatase 1013
type I-beta 375 LRKKLHKF 382
1014 829 ARKNKN 834
1015 829 ARKNKN 834
1016 815 SKKRKN 820
1017 815 SKKRKN 820
C7ORF12 1018 40 SRRYRG 45
1019 338 HRKNKP 343
1020 40 SRRYRG 45
1021 338 HRKNKP 343
Rap guanine nucleotide exchange 1022 138 SRRRFRKI 145
factor 1023 1071 QRKKRWRS 1078
1024 1099 HKKRARRS 1106
1025 139 RRRFRK 144
1026 661 SKKVKA 666
1027 930 LKRMKI 935
1028 1071 QRKKRW 1076
1029 1100 KKRARR 1105
1030 1121 ARKVKQ 1126
1031 139 RRRFRK 144
1032 661 SKKVKA 666
1033 930 LKRMKI 935
1034 1071 QRKKRW 1076
1035 1100 KKRARR 1105
1036 1121 ARKVKQ 1126
Sigma 1C adaptin 1037 27 ERKKITRE 34
Alsin 1038 883 GRKRKE 888
1039 883 GRKRKE 888
NOPAR2 1040 14 LKRPRL 19
1041 720 VKREKP 725
1042 14 LKRPRL 19
1043 720 VKREKP 725
AT-binding transcription factor 1 1044 294 SKRPKT 299
1045 961 EKKNKL 966
1046 1231 NKRPRT 1236
1047 1727 DKRLRT 1732
1048 2032 QKRFRT 2037
1049 2087 EKKSKL 2092
1050 2317 QRKDKD 2322
1051 2343 PKKEKG 2348
1052 294 SKRPKT 299
1053 961 EKKNKL 966
1054 1231 NKRPRT 1236
1055 1727 DKRLRT 1732
1056 2032 QKRFRT 2037
1057 2087 EKKSKL 2092
1058 2317 QRKDKD 2322
1059 2343 PKKEKG 2348
Suppressin 1060 232 YKRRKK 237
1061 232 YKRRKK 237
Midline 1 protein 1062 100 TRRERA 105
1063 494 HRKLKV 499
1064 100 TRRERA 105
1065 494 HRKLKV 499
High mobility group protein 2a 1066 6PKKPKG11
1067 84GKKKKD89
1068 6PKKPKG11
1069 84GKKKKD89

This application claims priority to A 1952/2003 filed on Dec. 4, 2003, the entirety of which is hereby incorporated by reference.

Claims

1. A method of making a modified GAG binding protein by modifying a GAG binding site of the GAG binding protein, wherein the GAG binding site is modified by a method comprising the steps of:

a) identifying a region in the protein which is not essential for structure maintenance; and

b) introducing at least one basic amino acid into the site and/or deleting at least one bulky and/or acidic amino acid in the site;

whereby the GAG binding site has a GAG binding affinity of Kd≦10 μM.

2. A method according to claim 1, wherein the GAG binding site has a GAG binding affinity of ≦1 μM.

3. A method according to claim 1, wherein the GAG binding site has a GAG binding affinity of ≦0.1 μM.

4. A method according to claim 1, wherein the GAG binding affinity is higher by a factor of minimum 5 compared with wild-type GAG binding protein.

5. A method according to claim 1, wherein at least one basic amino acid selected from the group consisting of Arg, Lys, and His is inserted into the GAG binding region.

6. A method according to claim 1, wherein the protein is a chemokine, preferably IL-8, RANTES or MCP-1.

7. A method according to claim 6, wherein the GAG binding region is a C terminal a-helix.

8. A method according to claim 7, wherein positions 17, 21, 70, and/or 71 are substituted by Arg, Lys, His, Asn, and/or Gln.

9. A method according to claim 1, wherein the increased GAG binding affinity is an increased binding affinity to heparan sulfate and/or heparin.

10. A method according to claim 1, wherein a further biologically active region is modified thereby inhibiting or down-regulating a further biological activity of the protein.

11. A method according to claim 10, wherein the further biologically active region is modified by deletion, insertion, and/or substitution, preferably with alanine, a sterically and/or electrostatically similar residue.

12. A method according to claim 10, wherein the protein is a chemokine and the further biological activity is leukocyte activation.

13. A method according to claim 12, wherein the protein is IL-8 and the further biologically active region is located within the first 10 N-terminal amino acids.

14. A method according to claim 13, wherein the protein is a mutant with the first 6 N-terminal amino acids deleted.

15. A method according to claim 14, wherein the protein is a mutant, and wherein the protein is modified such that

Arg is at position 17, Lys is at position 70, and Arg is at position 71;

Arg is at position 17, Arg is at position 70, and Lys is at position 71;

or

Lys is at positions 70 and 71.

Resources

Images & Drawings included:

Sources:

Similar patent applications:

Recent applications in this class:

Recent applications for this Assignee: