Patent application title:

SMYD INHIBITORS

Publication number:

US20190322660A1

Publication date:
Application number:

16/269,338

Filed date:

2019-02-06

Abstract:

The present disclosure provides carboxamides and sulfonamides having Formula (I): and the pharmacentically acceptable salts and solvates thereof, wherein A, Y, B, X, and Z are defined as set forth in the specification. The present disclosure is also directed to the use of compounds of Formula (I) to treat a disorder responsive to the blockade of SMYD proteins such as SMYD3 or SMYD2. Compounds of the present disclosure are especially useful for treating cancer.

Inventors:

Interested in similar patents?

Get notified when new applications in this technology area are published.

Classification:

C07D451/04 »  CPC main

Heterocyclic compounds containing 8-azabicyclo [3.2.1] octane, 9-azabicyclo [3.3.1] nonane, or 3-oxa-9-azatricyclo [3.3.1.0<2,4>] nonane ring systems, e.g. tropane or granatane alkaloids, scopolamine; Cyclic acetals thereof containing not further condensed 8-azabicyclo [3.2.1] octane or 3-oxa-9-azatricyclo [3.3.1.0<2,4>] nonane ring systems, e.g. tropane; Cyclic acetals thereof with hetero atoms directly attached in position 3 of the 8-azabicyclo [3.2.1] octane or in position 7 of the 3-oxa-9-azatricyclo [3.3.1.0<2,4>] nonane ring system

C07D213/81 »  CPC further

Heterocyclic compounds containing six-membered rings, not condensed with other rings, with one nitrogen atom as the only ring hetero atom and three or more double bonds between ring members or between ring members and non-ring members having three double bonds between ring members or between ring members and non-ring members having no bond between the ring nitrogen atom and a non-ring member or having only hydrogen or carbon atoms directly attached to the ring nitrogen atom with hetero atoms or with carbon atoms having three bonds to hetero atoms with at the most one bond to halogen, e.g. ester or nitrile radicals, directly attached to ring carbon atoms; Carbon atoms having three bonds to hetero atoms, with at the most one bond to halogen, e.g. ester or nitrile radicals Amides; Imides

C07D413/12 »  CPC further

Heterocyclic compounds containing two or more hetero rings, at least one ring having nitrogen and oxygen atoms as the only ring hetero atoms containing two hetero rings linked by a chain containing hetero atoms as chain links

C07D211/34 »  CPC further

Heterocyclic compounds containing hydrogenated pyridine rings, not condensed with other rings with only hydrogen or carbon atoms directly attached to the ring nitrogen atom having no double bonds between ring members or between ring members and non-ring members with hydrocarbon or substituted hydrocarbon radicals directly attached to ring carbon atoms with substituted hydrocarbon radicals attached to ring carbon atoms with hydrocarbon radicals, substituted by carbon atoms having three bonds to hetero atoms with at the most one bond to halogen, e.g. ester or nitrile radicals

C07D417/14 »  CPC further

Heterocyclic compounds containing two or more hetero rings, at least one ring having nitrogen and sulfur atoms as the only ring hetero atoms, not provided for by group containing three or more hetero rings

C07C271/18 »  CPC further

Derivatives of carbamic acids, i.e. compounds containing any of the groups , the nitrogen atom not being part of nitro or nitroso groups; Esters of carbamic acids having oxygen atoms of carbamate groups bound to acyclic carbon atoms with the nitrogen atoms of the carbamate groups bound to hydrogen atoms or to acyclic carbon atoms to carbon atoms of hydrocarbon radicals substituted by doubly-bound oxygen atoms

C07D205/04 »  CPC further

Heterocyclic compounds containing four-membered rings with one nitrogen atom as the only ring hetero atom not condensed with other rings having no double bonds between ring members or between ring members and non-ring members

C07D237/24 »  CPC further

Heterocyclic compounds containing 1,2-diazine or hydrogenated 1,2-diazine rings not condensed with other rings having three double bonds between ring members or between ring members and non-ring members with hetero atoms or with carbon atoms having three bonds to hetero atoms with at the most one bond to halogen, e.g. ester or nitrile radicals, directly attached to ring carbon atoms Carbon atoms having three bonds to hetero atoms with at the most one bond to halogen

C07D401/14 »  CPC further

Heterocyclic compounds containing two or more hetero rings, having nitrogen atoms as the only ring hetero atoms, at least one ring being a six-membered ring with only one nitrogen atom containing three or more hetero rings

C07D403/12 »  CPC further

Heterocyclic compounds containing two or more hetero rings, having nitrogen atoms as the only ring hetero atoms, not provided for by group containing two hetero rings linked by a chain containing hetero atoms as chain links

C07D403/14 »  CPC further

Heterocyclic compounds containing two or more hetero rings, having nitrogen atoms as the only ring hetero atoms, not provided for by group containing three or more hetero rings

C07D277/56 »  CPC further

Heterocyclic compounds containing 1,3-thiazole or hydrogenated 1,3-thiazole rings not condensed with other rings having two or three double bonds between ring members or between ring members and non-ring members with hetero atoms or with carbon atoms having three bonds to hetero atoms with at the most one bond to halogen, e.g. ester or nitrile radicals, directly attached to ring carbon atoms Carbon atoms having three bonds to hetero atoms with at the most one bond to halogen

C07D209/08 »  CPC further

Heterocyclic compounds containing five-membered rings, condensed with other rings, with one nitrogen atom as the only ring hetero atom condensed with one carbocyclic ring; Indoles; Hydrogenated indoles with only hydrogen atoms or radicals containing only hydrogen and carbon atoms, directly attached to carbon atoms of the hetero ring

C07D275/03 »  CPC further

Heterocyclic compounds containing 1,2-thiazole or hydrogenated 1,2-thiazole rings not condensed with other rings with hetero atoms or with carbon atoms having three bonds to hetero atoms with at the most one bond to halogen, e.g. ester or nitrile radicals, directly attached to ring carbon atoms

C07D263/34 »  CPC further

Heterocyclic compounds containing 1,3-oxazole or hydrogenated 1,3-oxazole rings not condensed with other rings having two or three double bonds between ring members or between ring members and non-ring members with hetero atoms or with carbon atoms having three bonds to hetero atoms with at the most one bond to halogen, e.g. ester or nitrile radicals, directly attached to ring carbon atoms

C07D261/10 »  CPC further

Heterocyclic compounds containing 1,2-oxazole or hydrogenated 1,2-oxazole rings not condensed with other rings having two or more double bonds between ring members or between ring members and non-ring members with hetero atoms or with carbon atoms having three bonds to hetero atoms with at the most one bond to halogen, e.g. ester or nitrile radicals, directly attached to ring carbon atoms

C07D249/04 »  CPC further

Heterocyclic compounds containing five-membered rings having three nitrogen atoms as the only ring hetero atoms not condensed with other rings 1,2,3-Triazoles; Hydrogenated 1,2,3-triazoles

C07D241/26 »  CPC further

Heterocyclic compounds containing 1,4-diazine or hydrogenated 1,4-diazine rings not condensed with other rings having three double bonds between ring members or between ring members and non-ring members with hetero atoms or with carbon atoms having three bonds to hetero atoms with at the most one bond to halogen, e.g. ester or nitrile radicals, directly attached to ring carbon atoms; Carbon atoms having three bonds to hetero atoms with at the most one bond to halogen, e.g. ester or nitrile radicals with nitrogen atoms directly attached to ring carbon atoms

C07D401/12 »  CPC further

Heterocyclic compounds containing two or more hetero rings, having nitrogen atoms as the only ring hetero atoms, at least one ring being a six-membered ring with only one nitrogen atom containing two hetero rings linked by a chain containing hetero atoms as chain links

C07D233/90 »  CPC further

Heterocyclic compounds containing 1,3-diazole or hydrogenated 1,3-diazole rings, not condensed with other rings having two double bonds between ring members or between ring members and non-ring members with hetero atoms or with carbon atoms having three bonds to hetero atoms with at the most one bond to halogen, e.g. ester or nitrile radicals, directly attached to ring carbon atoms Carbon atoms having three bonds to hetero atoms with at the most one bond to halogen, e.g. ester or nitrile radicals

C07D231/14 »  CPC further

Heterocyclic compounds containing 1,2-diazole or hydrogenated 1,2-diazole rings not condensed with other rings having two or three double bonds between ring members or between ring members and non-ring members with hetero atoms or with carbon atoms having three bonds to hetero atoms with at the most one bond to halogen, e.g. ester or nitrile radicals, directly attached to ring carbon atoms

C07D213/82 »  CPC further

Heterocyclic compounds containing six-membered rings, not condensed with other rings, with one nitrogen atom as the only ring hetero atom and three or more double bonds between ring members or between ring members and non-ring members having three double bonds between ring members or between ring members and non-ring members having no bond between the ring nitrogen atom and a non-ring member or having only hydrogen or carbon atoms directly attached to the ring nitrogen atom with hetero atoms or with carbon atoms having three bonds to hetero atoms with at the most one bond to halogen, e.g. ester or nitrile radicals, directly attached to ring carbon atoms; Carbon atoms having three bonds to hetero atoms, with at the most one bond to halogen, e.g. ester or nitrile radicals; Amides; Imides in position 3

Description

BACKGROUND OF THE INVENTION

Field of the Invention

The present disclosure provides carboxamides and sulfonamides as SMYD protein inhibitors, such as SMYD3 and SMYD2 inhibitors, and therapeutic methods of treating conditions and diseases wherein inhibition of SMYD proteins such SMYD3 and SMYD2 provides a benefit.

Background

Epigenetic regulation of gene expression is an important biological determinant of protein production and cellular differentiation and plays a significant pathogenic role in a number of human diseases. Epigenetic regulation involves heritable modification of genetic material without changing its nucleotide sequence. Typically, epigenetic regulation is mediated by selective and reversible modification (e.g., methylation) of DNA and proteins (e.g., histones) that control the conformational transition between transcriptionally active and inactive states of chromatin. These covalent modifications can be controlled by enzymes such as methyltransferases (e.g., SMYD proteins such as SMYD3 and SMYD2), many of which are associated with genetic alterations that can cause human disease, such as proliferative disorders. Thus, there is a need for the development of small molecules that are capable of inhibiting the activity of SMYD proteins such as SMYD3 and SMYD2.

BRIEF SUMMARY OF THE INVENTION

In one aspect, the present disclosure provides carboxamido and sulfonamide compounds represented by Formulae I-XVIII below, and the pharmaceutically acceptable salts and solvates thereof, collectively referred to herein as β€œCompounds of the Disclosure.”

In another aspect, the present disclosure provides a Compound of the Disclosure and one or more pharmaceutically acceptable carriers.

In another aspect, the present disclosure provides a method of inhibiting SMYD proteins, such as SMYD3 or SMYD2, or both, in a mammal, comprising administering to the mammal an effective amount of at least one Compound of the Disclosure.

In another aspect, the present disclosure provides methods for treating a disease, disorder, or condition, e.g., cancer, responsive to inhibition of SMYD proteins, such as SMYD3 or SMYD2, or both, comprising administering a therapeutically effective amount of a Compound of the Disclosure.

In another aspect, the present disclosure provides the use of Compounds of the Disclosure as inhibitors of SMYD3.

In another aspect, the present disclosure provides the use of Compounds of the Disclosure as inhibitors of SMYD2.

In another aspect, the present disclosure provides the use of Compounds of the Disclosure as inhibitors of SMYD proteins.

In another aspect, the present disclosure provides a pharmaceutical composition for treating a disease, disorder, or condition responsive to inhibition of SMYD proteins, such as SMYD3 or SMYD2, or both, wherein the pharmaceutical composition comprises a therapeutically effective amount of a Compound of the Disclosure in a mixture with one or more pharmaceutically acceptable carriers.

In another aspect, the present disclosure provides Compounds of the Disclosure for use in treating cancer in a mammal, e.g., breast, cervical, colon, kidney, liver, head and neck, skin, pancreatic, ovary, esophageal, lung, and prostate cancer.

In another aspect, the present disclosure provides a Compound of the Disclosure for use in the manufacture of a medicament for treating cancer in a mammal.

In another aspect, the present disclosure provides kit comprising a Compound of the Disclosure.

Additional embodiments and advantages of the disclosure will be set forth, in part, in the description that follows, and will flow from the description, or can be learned by practice of the disclosure. The embodiments and advantages of the disclosure will be realized and attained by means of the elements and combinations particularly pointed out in the appended claims.

It is to be understood that both the foregoing summary and the following detailed description are exemplary and explanatory only, and are not restrictive of the invention as claimed.)

DETAILED DESCRIPTION OF THE INVENTION

One aspect of the present disclosure is based on the use of Compounds of the Disclosure as inhibitors of SMYD proteins. In view of this property, the Compounds of the Disclosure are useful for treating diseases, disorders, or conditions, e.g., cancer, responsive to inhibition of SMYD proteins.

One aspect of the present disclosure is based on the use of Compounds of the Disclosure as inhibitors of SMYD3. In view of this property, the Compounds of the Disclosure are useful for treating diseases, disorders, or conditions, e.g., cancer, responsive to inhibition of SMYD3.

One aspect of the present disclosure is based on the use of Compounds of the Disclosure as inhibitors of SMYD2. In view of this property, the Compounds of the Disclosure are useful for treating diseases, disorders, or conditions, e.g., cancer, responsive to inhibition of SMYD2.

In one embodiment, Compounds of the Disclosure are compounds having Formula I:

and the pharmaceutically acceptable salts or solvates, e.g., hydrates, thereof, wherein:

A is selected from the group consisting of 1,2,3-triazolyl, 1,2,4-triazolyl, 1-imidazolyl, 1-isoquinolinyl, 1-pyrazolyl, 2-(1,2,3,4-tetrahydroquinolinyl), 2-benzo[d]imidazolyl, 2-benzo[d]thiazolyl, 2-chromenyl-4-one, 2-furanyl, 2-imidazo[1,2-b]pyridazinyl, 2-imidazolyl, 2-indolyl 2-naphthalenyl, 2-pyrazinyl, 2-pyridyl, 2 pyrimidinyl, 2-pyrrolidinyl, 2-pyrrolyl, 2-quinolinyl, 2-quinoxalinyl, 2-thiazolo[5,4-c]pyridinyl, 2-thiazolyl, 2-thiophenyl, 3-(1,2,3,4-tetrahydroisoquinoline), 3-(1,2,4-oxadiazolyl), 3-imidazo[1,2-a]pyrimidinyl, 3-indazolyl, 3-indolyl, 3-isothiazolyl, 3-pyrazolyl, 3-pyridazinyl, 3-pyridinyl-2-one, 3-pyridyl, 3-pyrrolo[3,2-b]pyridinyl, 3-quinolinyl, 4-(2,2-difluorobenzo[d][1,3]dioxelyl), 4-cyclohexanyl-1-amine, 4-imidazolyl, 4-indolinyl-2-one, 4-indolyl, 4-isothiazolyl, 4-oxazolyl, 4-piperidinyl, 4-pyrazolyl, 4-pyridyl, 4-quinolinyl, 5-(1,3-dihydro-2H-benzo[d]imidazolyl-2-one), 5-(1,3-dihydro-2H-pyrrolo[2,3-b]pyridinyl-2-one), 5-(1,3-dihydro-2H-pyrrolo[2,3-c]pyridinyl-2-one), 5-(2,2-difluorobenzo[d][1,3]dioxolyl), 5-(2,4-dihydro-3H-1,2,4-triazolyl-3-one), 5-4H-furo[3,2,-b]pyrrolyl 5-benzo[c][1,2,5]oxadiazolyl, 5-benzo[d][1,3]dioxolyl, 5-benzo[d]oxazolyl-2(3H)-one, 5-bicyclo[2.2.1]heptyl-2-one, 5-indolinyl-2,3-dione, 5-indolinyl-2-one, 5-indolyl, 5-isoindolinyl-1-one, 5-isoxazolyl, 5-pyrazolo[3,4-c]pyridinyl, 5-pyrazolyl, 5-pyrimidinyl, 5-thiazolyl, 6-(1,2,3,4-tetrahydronaphthalenyl), 6-(3,4-dihydroquinolinyl-2(1H)-one), 6-(3,4-dihydroquinoxalinyl-2(1H)-one), 6-(4,5-dihydropyridazinyl-3(2H)-one), 6-benzo[b][1,4]oxazolyl-3-one, 6-benzo[d]imidazolyl, 6-benzo[d]oxazolyl-2(3H)-one, 6-benzo[d]thiazolyl, 6-chromenyl-2-one, 6-imidazo[2,1-b]thiazole, 6-indazolyl, 6-indolinyl-2-one, 6-indolyl, 6-isoquinolinyl, 6-quinolinyl, 6-quinoxalinyl, 6-quinoxalinyl-2(1H)-one, 7-(3,4-dihydroquinolinyl-2(1H)-one), 7-(3,4-dihydroquinoxalin-2(1H)-one), 7-benzo[b][1,4]oxazinyl-3-one, 7-indolinyl-2-one, 7-quinolinyl, 8-benzo[b][1,4]oxazinyl-3-one, cyclopropanyl, phenyl, 4-(prop-1-en-1-yl)-imidazole, 1-butanyl-imidazole, sec-butyleyclopropane, 2-(ethylsulfonyl)propanyl, 1-isobutylpyrrolidine, 4-pyridyl 1-oxide, and 5-benzo[c][1,2,5]oxadiazolyl 1-oxide,

each of which is optionally substituted with one, two, or three substituents independently selected from the group consisting of halo, hydroxy, alkoxy, amino, alkylamino, dialkylamino, (amino)alkyl, (alkylamino)alkyl, (dialkylamino)alkyl, C1-6 alkyl, haloalkyl, hydroxyalkyl, (carboxamido)alkyl, (cycloalkyl)alkyl, optionally substituted C3-12 cycloalkyl, optionally substituted C6-14 aryl, optionally substituted 5- to 14-membered heteroaryl, optionally substituted 4- to 14-membered heterocyclo, aralkyl, β€”N(H)C(═O)R6, β€”C(═O)R7, and β€”S(═O)2R8;

Y is selected from the group consisting of β€”C(R5a)(R5b)C(═O)β€”, β€”C(═O)β€”, and β€”S(═O)2β€”;

B is selected from the group consisting of C1-10 alkylenyl, optionally substituted C3-12 cycloalkylenyl, optionally substituted C6-14 arylenyl, optionally substituted 4- to 14-membered heterocyclenyl, and β€”C(H)R1R2,

with the proviso that B is not optionally substituted pyrrolidinenyl;

X is selected from the group consisting of β€”N(R3)β€”, β€”S(═O)2β€”, β€”S(═O)2N(R3)β€”, β€”N(R3)S(═O)2β€”, β€”S(═O)2C(R4)(H)β€”, β€”C(═O)β€”, β€”C(═O)N(R3)β€”, β€”N(R3)C(═O)β€”, β€”C(═O)Oβ€”, β€”OC(═O)β€”,β€”C(═O)C(R4)(H)N(R3)β€”, β€”N(R3)C(═O)C(R4)(H)β€”, and β€”C(═O)C(R40(H)β€”; or X is absent, i.e., Z forms a bond with B;

Z is selected from the group consisting of hydrogen, optionally substituted C1-6 alkyl, fluoroalkyl, hydroxyalkyl, (amino)alkyl, (alkylamino)alkyl, (dialkylamino)alkyl, (cycloalkylamino)alkyl, (heterocyclo)alkyl, (cycloalkyl)alkyl, (amino(hydroxy)alkyl, (amino)(aryl)alkyl, (hydroxy)(aryl)alkyl, (aralkylamino)alkyl, (hydroxyalkylamino)alkyl, alkoxyalkyl, optionally substituted C6-14 aryl, optionally substituted 4- to 14-membered heterocyclo, optionally substituted 5- to 14-membered heteroaryl, optionally substituted C3-12 cycloalkyl, aralkyl, and (heteroaryl)alkyl; or

Z is β€”CH(R9a)(R9b);

R9a is selected from the group consisting of hydrogen, C1-6 alkyl, fluoroalkyl, hydroxyalkyl, (amino)alkyl, (alkylamino)alkyl, (dialkylamino)alkyl, alkoxyalkyl, optionally substituted C6-14 aryl, optionally substituted 4- to 14-membered heterocyclo, optionally substituted 5- to 14-membered heteroaryl, optionally substituted C3-12 cycloalkyl, aralkyl, and (heteroaryl)alkyl;

R9b is selected from the group consisting of optionally substituted C6-14 aryl, optionally substituted 4- to 14-membered heterocyclo, optionally substituted 5- to 14-membered heteroaryl, optionally substituted C3-12 cycloalkyl, aralkyl, and (heteroaryl)alkyl;

R1 is selected from the group consisting of hydrogen, C1-6 alkyl, (amino)alkyl, (alkylamino)alkyl, (dialkylamino)alkyl, hydroxyalkyl, alkoxyalkyl, aryloxyalkyl, optionally substituted C3-12 cycloalkyl, optionally substituted 4- to 14-membered heterocyclo, optionally substituted C6-14 aryl, aralkyl, and alkoxycarbonyl;

R2 is selected from the group consisting of C1-6 alkyl, optionally substituted C3-12 cycloalkyl, optionally substituted C6-14 aryl, optionally substituted 5- to 14-membered heteroaryl, optionally substituted 4- to 14-membered heterocyclo, and (heteroaryl)alkyl;

R3 is selected from the group consisting of hydrogen and C1-4 alkyl; and

R4 is selected from the group consisting of hydrogen, C1-4 alkyl, hydroxy, amino, alkylamino, dialkylamino, cycloalkylamino,(amino)alkyl, (alkylamino)alkyl, (dialkylamino)alkyl, and hydroxyalkyl.

R5a is selected from the group consisting of hydrogen and C1-4 alkyl;

R5b is selected from the group consisting of hydrogen, C1-4 alkyl, and 4- to 14-membered heterocyclo;

R6 is C1-4 alkyl,

R7 is C1-4 alkyl; and

R8 is selected from the group consisting of C1-4 alkyl, amino, alkylamino, and dialkylamino,

wherein β€”Xβ€”Z is attached to any available carbon or nitrogen atom of B, R1, or R2, e.g., when R2 is C1-6 alkyl, e.g., ethyl, a hydrogen atom of that ethyl group is replaced with β€”Xβ€”Z to give β€”CH2CH2β€”Xβ€”Z or

or

when R2 is optionally substituted C3-12 cycloalkyl, e.g., cyclohexyl, a hydrogen atom of the cyclohexyl group is replaced with β€”Xβ€”Z to give:

or

when R2 is optionally substituted 4- to 14-membered heterocyclo, e.g., piperidinyl, the hydrogen atom attached to the piperidinyl nitrogen atom is replaced with β€”Xβ€”Z to give:

or

when R2 is optionally substituted C6-14 aryl, e.g., phenyl, a hydrogen atom on that phenyl group is replaced with β€”Xβ€”Z to give:

In another embodiment, Compounds of the Disclosure are compounds having Formula I, and the pharmaceutically acceptable salts or solvates, e.g., hydrates, thereof, wherein Z is selected from the group consisting of hydrogen, optionally substituted C1-6 alkyl, fluoroalkyl, hydroxyalkyl, (amino)alkyl, (alkylamino)alkyl, (dialkylamino)alkyl, (cycloalkylamino)alkyl, (heterocyclo)alkyl, (cycloalkyl)alkyl, (amino)(hydroxy)alkyl, (amino)(aryl)alkyl, (hydroxy)(aryl)alkyl, (aralkylamino)alkyl, (hydroxyalkylamino)alkyl, alkoxyalkyl, optionally substituted C6-14 aryl, optionally substituted 4- to 14-membered heterocyclo, optionally substituted 5- to 14-membered heteroaryl, optionally substituted C3-12 cycloalkyl, aralkyl, and (heteroaryl)alkyl,

In another embodiment, Compounds of the Disclosure are compounds having Formula I, and the pharmaceutically acceptable salts or solvates, e.g., hydrates, thereof, wherein X is absent. In another embodiment, Compounds of the Disclosure are compounds having Formula I, and the pharmaceutically acceptable salts or solvates, e.g., hydrates, thereof, wherein X is absent; B is optionally substituted 4- or 6- to 14-membered heterocyclenyl and Z is selected from the group consisting of hydrogen, optionally substituted C1-6 alkyl, fluaroalkyl, hydroxyalkyl, optionally substituted C6-14 aryl, optionally substituted 4- to 14-membered heterocyclo, optionally substituted 5- to 14-membered heteroaryl, optionally substituted C3-12 cycloalkyl, aralkyl, and (heteroaryl)alkyl.

In another embodiment, Compounds of the Disclosure are compounds having Formula I, and the pharmaceutically acceptable salts or solvates, e.g., hydrates, thereof, wherein B is optionally substituted 4- or 6- to 14-membered heterocyclenyl; X is absent; and Z is β€”CH(R9a)(R9b).

In another embodiment, Compounds of the Disclosure are compounds having Formula I, and the pharmaceutically acceptable salts or solvates, e.g., hydrates, thereof, wherein B is optionally substituted 4- or 6- to 14-membered heterocylenyl; X is absent; and Z is β€”CH(R9a)(R9b), wherein:

R9a is selected from the group consisting of hydrogen, C1-6 alkyl, and optionally substituted C3-12 cycloalkyl; and

R9b is selected from the group consisting of optionally substituted C6-14 aryl, optionally substituted 5- to 14-membered heteroaryl, optionally substituted C3-12 cycloalkyl, aralkyl, and (heteroaryl)alkyl.

In another embodiment, Compounds of the Disclosure are compounds having Formula I, and the pharmaceutically acceptable salts or solvates, e.g., hydrates, thereof, wherein B is C1-10 alkylenyl. In another embodiment, X is selected from the group consisting of β€”N(R3)C(═O)C(R4)(H)β€” and β€”N(R3)C(═O)β€”. In another embodiment, Z is selected front the group consisting of C1-6 alkyl and (amino)alkyl.

In another embodiment, Compounds of the Disclosure are compounds having Formula I, and the pharmaceutically acceptable salts or solvates, e.g., hydrates, thereof, wherein B is optionally substituted C6-14 arylenyl. In another embodiment, B is divalent form of optionally substituted phenyl.

In another embodiment, Compounds of the Disclosure are compounds having Formula II:

and the pharmaceutically acceptable salts or solvates, e.g., hydrates, thereof, wherein X is absent and Z is (amino)alkyl; and A and Y are as defined above in connection with Formula I.

In another embodiment, Compounds of the Disclosure are compounds having Formula I, and the pharmaceutically acceptable salts or solvates, e.g., hydrates, thereof, wherein B is optionally substituted C3-12 cycloalkylenyl.

In another embodiment, Compounds of the Disclosure are compounds having Formula III, Formula IV, or Formula V:

and the pharmaceutically acceptable salts or solvates, e.g., hydrates, thereof, wherein R10a, R10b, R11a, and R11b are each independently selected from the group consisting of hydrogen and C1-4 alkyl; and A, Y, X, and Z are as defined above in connection with Formula I. In another embodiment, X is β€”N(R3)C(═O)β€” and Z is (amino)alkyl. In another embodiment, X is β€”N(R3)β€” and Z is hydrogen.

In another embodiment, Compounds of the Disclosure are compounds having Formula I, and the pharmaceutically acceptable salts or solvates, e.g., hydrates, thereof, wherein B is optionally substituted 4- to 14-membered heterocyclenyl.

In another embodiment, Compounds of the Disclosure are compounds having Formula VI, Formula VII, or Formula VIII:

and the pharmaceutically acceptable salts or solvates, e,g, hydrates, thereof, wherein R12a, R12b, R13a, and R13b are each independently selected from the group consisting of hydrogen and C1-4 alkyl; and A, Y, X, and Z are as defined above in connection with Formula I. In another embodiment, X is selected from the group consisting of β€”C(═O)C(R4)(H)β€”, β€”C(═O)β€”, and β€”S(═O)2β€”; and R4 is selected from the group consisting of hydrogen and amino. In another embodiment, Z is selected from the group consisting of (amino)alkyl, (alkylamino)alkyl, (dialkylamino)alkyl, (heterocyclo)alkyl, optionally substituted C3-12 cycloalkyl, optionally substituted C6-14 aryl, aralkyl, and (hetaroaryl)alkyl.

In another embodiment, Compounds of the Disclosure are compounds having Formula. VI, Formula, VII, or Formula VIII, and the pharmaceutically acceptable salts or solvates, e.g., hydrates, thereof, wherein R12a, R12b, R13a, and R13b are each independently selected from the group consisting of hydrogen and C1-4 alkyl; A is 5-indolinyl-2-one that is optionally substituted with one or two substituents selected from the group consisting of halo, hydroxy, alkoxy, amino, alkylamino, dialkylamino, (amino)alkyl, (alkylamino)alkyl, (dialkylamino)alkyl, C1-6 alkyl, haloalkyl, and hydroxyalkyl; Y is β€”C(═O)β€”; X is β€”S(═O)2β€”; and Z is as defined above in connection with Formula I. In another embodiment, A is 6-chloro-5-indolinyl-2-one, i.e.,

In another embodiment, Z is selected from the group consisting of (amino)alkyl, (alkylamino)alkyl, (dialkylamino)alkyl, (heterocyclo)alkyl, optionally substituted C3-12 cycloalkyl, optionally substituted C6-14 aryl, aralkyl, and (hetaroaryl)alkyl.

In another embodiment, Compounds of the Disclosure are compounds having Formula I, and the pharmaceutically acceptable salts or solvates, e.g., hydrates, thereof, wherein B is β€”C(H)R1R2. In this embodiment, a hydrogen atom of R1 and R2 is replaced with β€”Xβ€”Z.

In another embodiment, Compounds of the Disclosure are compounds having Formula IX, Formula X, or Formula XI:

and the pharmaceutically acceptable salts or solvates, e.g., hydrates, thereof. In another embodiment, R1 is selected from the group consisting of hydrogen, C1-6 alkyl, alkoxycarbonyl, and optionally substituted C6-14 aryl. In another embodiment, R1 is selected from the group consisting of hydrogen and methyl. In another embodiment, X is β€”C(═O)C(R4)(H)β€” and R4 is amino. In another embodiment, X is selected from the group consisting of:

In another embodiment, Z is C1-6 alkyl. In another embodiment, Z is methyl.

In another embodiment, Compounds of the Disclosure are compounds having any one of Formula I-XI, and the pharmaceutically acceptable salts or solvates, e.g., hydrates, thereof, wherein Y is β€”C(R5a)(R5b)C(═O)β€”. In another embodiment R5a and R5b are each independently selected from the group consisting of hydrogen and methyl.

In another embodiment, Compounds of the Disclosure are compounds having any one of Formula I-XI, and the pharmaceutically acceptable salts or solvates, e.g., hydrates, thereof, wherein Y is β€”S(═O)2β€”.

In another embodiment, Compounds of the Disclosure are compounds having any one of Formula I-XI, and the pharmaceutically acceptable salts or solvates, e.g., hydrates, thereof, wherein Y is β€”C(═O)β€”.

In another embodiment, Compounds of the Disclosure are compounds having any one of Formula I-XI, and the pharmaceutically acceptable salts or solvates, e.g., hydrates, thereof, wherein A is selected from the group consisting of 1,2,3-triazolyl, 1,24-triazolyl, 2-(1,2,3,4-tetrahydroquinolinyl), 2-indolyl, 2-thiazolyl, 3-(1,2,4-oxadiazolyl), 3-isothiazolyl, 5-(1,3-dihydro-2H-benzo[d]imidazolyl-2-one), 5-(1,3-dihydro-2H-pyrrolo[2,3- b]pyridinyl-2-one), 5-(1,3-dihydro-2H-pyrrolo[2,3-c]pyridinyl-2-one), 5-(2,2-difluorobenzo[d][1,3]dioxolyl), 5-benzo[d]oxazolyl-2(3H)-one, 5-indolinyl-2-one, 6-benzo[b][1,4]oxazinyl-3-one, and 6-isoquinolinyl.

In another embodiment, Compounds of the Disclosure are compounds having any one of Formula I-XI, and the pharmaceutically acceptable salts or solvates, e.g., hydrates, thereof, wherein A is 5-indolinyl-2-one.

In another embodiment, Compounds of the Disclosure are compounds having Formula XII:

and the pharmaceutically acceptable salts or solvates, e.g., hydrates, thereof, wherein:

A1 is selected from the group consisting of 1,2,3-triazolyl, 1,2,4 triazolyl, 1-imidazolyl, 1-isoquinolinyl, 1-pyrazolyl, 2-(1,2,3,1-tetrahydroquinolinyl), 2-benzo[d]imidazolyl, 2-benzo[d]thiazolyl, 2-chromenyl-4-one, 2-furanyl, 2-imidazo[1,2-b]pyridazinyl, 2-imidazolyl, 2-indolyl, 2-naphthalenyl, 2-pyrazinyl, 2-pyridyl, 2-pyrimidinyl, 2-pyrrolidinyl, 2-pyrrolyl, 2-quinolinyl, 2-quinoxalinyl, 2-thiazolo[5,4-c]pyridinyl, 2-thiazolyl, 2-thlophenyl, 3-(1,2,3,4-tetrahydroisoquinoline), 3-(1,2,4-oxadiazolyl), 3-imidazo[1,2-a]pyrimidinyl, 3-indazolyl, 3-indolyl, 3-isothiazolyl, 3-pyrazolyl, 3-pyridazinyl, 3-pyridinyl-2-one, 3-pyridyl, 3-pyrrolo[3,2-b]pyridinyl, 3-quinolinyl, 4-(2,2-difluorobenzo[d][1,3]dioxolyl), 4-cyclohexanyl-1-amine, 4-imidazolyl, 4-indolinyl-2-one, 4-indolyl, 4-isothiazolyl, 4-oxazolyl, 4-piperidinyl, 4-pyrazolyl, 4-pyridyl, 4-quinolinyl, 5-(1,3-dihydro-2H-benzo[d] imidazolyl-2-one), 5-(1,3-dihydro-2H-pyrrolo[2,3-b] pyridinyl-2-one), 5-(1,3-dihydro-2H-pyrrolo[2,3-c]pyridinyl-2-one), 5-(2,2-difluorobenzo[d][1,3]dioxolyl), 5(2,4-dihydro-3H-1,2,4-triazolyl-3-one), 5-4H-furo[3,2-b]pyrrolyl, 5-benzo[c][1,2,5]oxadiazolyl, 5-benzo[d][1,3]dioxolyl, 5-benzo[d]oxazolyl-2(3H)-one, 5-bicyclo[2.2.1]heptyl-2-one, 5-indolinyl-2,3-dione, 5-indolinyl-2-one, 5-indolyl, 5-isoindolinyl-1-one, 5-isoxazolyl, 5-pyrazolo[3,4-c]pyridinyl, 5-pyrazolyl, 5-pyrimidinyl, 5-thiazolyl, 6-(1,2,3,4-tetrahydronaphthalenyl), 6-(3,4-dihydroquinolinyl-2(1H)-one), 6-(3,4-dihydroquinoxalinyl-2(1H)-one), 6-(4,5-dihydropyridazinyl-3(2H)-one), 6-benzo[b][1,4]oxazinyl-3-one, 6-benzo[d]imidazolyl, 6-benzo[d]oxazolyl-2(3H)-one, 6-benzo[d]thiazolyl, 6-chromenyl-2-one, 6-imidazo[2,1-b]thiazole, 6-indazolyl, 6-indolinyl-2-one, 6-indolyl, 6-isoquinolinyl, 6-quinolinyl, 6-quinoxalinyl, 6-quinoxalinyl-2(1H)-one, 7-(3,4-dihydroquinolinyl-2(1H)-one), 7-(3,4-dihydroquinoxalin-2(1H)-one), 7-benzo[b][1,4]oxazinyl-3-one, 7-indolinyl-2-one, 7-quinolinyl, 8-benzo[b][1,4]oxazinyl-3-one, cyclopropanyl, phenyl, 4-(prop-1-en-1-yl)-imidazole, 1-butanyl-imidazole, sec-butyleyclopropane, 2-(ethylsulfonyl)propanyl, 1-isobutylpyrrolidine, 4-pyridyl 1-oxide, and 5-benzo[c][1,2,5]oxadiazolyl 1-oxide,

each of which is optionally substituted with one, two, or three substituents independently selected from the group consisting of halo, hydroxy, alkoxy, amino, alkylamino, dialkylamino, (amino)alkyl,(alkylamino)alkyl, (dialkylamino)alkyl, C1-6 alkyl, haloalkyl, hydroxyalkyl, (carboxamido)alkyl, (cycloalkyl)alkyl, optionally substituted C3-12 cycloalkyl, optionally substituted C6-14 aryl, optionally substituted 5- to 14-membered heteroaryl, optionally substituted 4- to 14-membered heterocyclo, and aralkyl;

B1 is selected from the group consisting of optionally substituted C3-12 cycloalkylenyl and optionally substituted 4- to 14-membered heterocyclenyl;

X1 is selected from the group consisting of β€”N(R3a)β€”, β€”S(═O)2β€”, β€”S(═O)2N(R3a)β€”, β€”N(R3a)S(═O)2C(R4a)(H)β€”, β€”C(═O)β€”, β€”C(═O)N(R3a)β€”, β€”N(R3a)C(═O)β€”, β€”C(═O)Oβ€”, β€”OC(═O)β€”,β€”C(═O)C(R4a)(H)N(R3a)β€”, β€”N(R3a)C(═O)C(R4a)(H)β€”, and β€”C(═O)C(R4a)(H)β€”; or X1 is absent, i.e., Z1 forms a bond with B1;

Z1 is selected from the group consisting of hydrogen, optionally substituted C1-6 alkyl, fluoroalkyl, hydroxyalkyl, (amino)alkyl, (alkylamino)alkyl, (dialkylamino)alkyl, (cycloalkylamino)alkyl, (heterocyclo)alkyl, (cycloalkyl)alkyl, (amino)(hydroxy)alkyl, (amino)(aryl)alkyl, (hydroxy)(aryl)alkyl, (aralkylamino)alkyl, (hydroxyalkylamino)alkyl, alkoxyalkyl, optionally substituted C6-14 aryl, optionally substituted 4- to 14-membered heterocyclo, optionally substituted 5- to 14-membered heteroaryl, optionally substituted C3-12 cycloalkyl, aralkyl, and (heteroaryl)alkyl;

R3a is selected from the group consisting of hydrogen and C1-4 alkyl; and

R4a is selected from the group consisting of hydrogen, C1-4 hydroxy, amino, alkylamino, and dialkylamino.

In another embodiment, Compounds of the Disclosure are compounds having Formula XII, or a pharmaceutically acceptable salt or hydrate thereof, wherein A1 is 5-indolinyl-2-one. In another embodiment, B1 is optionally substituted C3-12 cycloalkylenyl. In another embodiment, X1 is selected from the group consisting of β€”S(═O)2β€” and β€”C(═O)β€”. In another embodiment, Z1 is selected from the group consisting of (amino)alkyl, (alkylamino)alkyl, and (dialkylamino)alkyl.

In another embodiment, Compounds of the Disclosure are compounds having Formula XIII:

or a pharmaceutically acceptable salt or hydrate thereof, wherein

X2 is selected from the group consisting of β€”N(R3b)β€”, β€”S(═O)2β€”, β€”S(═O)2N(R3b)β€”, β€”N(R3b)S(═O)2β€”, β€”S(═O)2C(R4b)(H)β€”, β€”C(═O)β€”, β€”C(═O)N(R3b)β€”, β€”N(R3b)C(═O)β€”, β€”C(═O)Oβ€”, β€”OC(═O)β€”, β€”C(═O)C(R4b)(H)N(R3b)β€”, β€”N(R3b)C(═O)C(R4b)(H)β€”, and β€”C(═O)C(R4b)(H)β€”; or X is absent, i.e., Z2 forms a bond with the nitrogen atom;

Z2 is selected from the group consisting of hydrogen, optionally substituted C1-6 alkyl, fluoroalkyl, hydroxyalkyl, (amino)alkyl, (alkylamino)alkyl, (dialkylamino)alkyl, (cycloalkylamino)alkyl, (heterocyclo)alkyl, (cycloalkyl)alkyl, (amino)(hydroxy)alkyl, (amino)(aryl)alkyl, (hydroxy)(aryl)alkyl, (aralkylamino)alkyl, (hydroxyalkylamino)alkyl, alkoxyalkyl, optionally substituted C6-14 aryl, optionally substituted 4- to 14-membered heterocycle, optionally substituted 5- to 14-membered heteroaryl optionally substituted C3-12 cycloalkyl, aralkyl, and (heteroaryl)alkyl;

R1a is selected from the group consisting of hydrogen, C1-6 alkyl, and optionally substituted C6-14 aryl;

R3b is selected from the group consisting of hydrogen and C1-4 alkyl; and

R4b is selected from the group consisting of hydrogen, C1-4 alkyl, hydroxy, amino, alkylamino, and dialkylamino.

In another embodiment, Compounds of the Disclosure are compounds having Formula XIII, or a pharmaceutically acceptable salt or hydrate thereof, wherein X2 is selected from the group consisting of β€”S(═O)2β€” and β€”C(═O)β€”. In another embodiment, Z2 is selected from the group consisting of (amino)alkyl, (alkylamino)alkyl, and (dialkylamino)alkyl. In another embodiment, X2 is absent; and Z2 is hydrogen. In another embodiment, R1a is selected from the group consisting of hydrogen and methyl.

In another embodiment, Compounds of the Disclosure are compounds having Formula I, and the pharmaceutically acceptable salts or solvates, e.g., hydrates, thereof, wherein Y is β€”C(═O)β€” and A is selected from the group consisting of 5-indolinyl-2-one and 1,2,3-triazolyl.

In another embodiment, Compounds of the Disclosure are compounds having Formula XIV:

and the pharmaceutically acceptable salts or solvates, e.g., hydrates, thereof, wherein A, X, and Z are as defined above in connection with Formula I. In another embodiment, X is selected from the group consisting of β€”S(═O)2β€” and β€”S(═O)2C(R4)(H)β€”. In another embodiment, X is β€”S(═O)2β€”. In another embodiment, X is β€”S(═O)2CH2β€”. In another embodiment, Z is selected from the group consisting of optionally substituted C6-14 aryl, optionally substituted 4- to 14-membered heterocyclo, and optionally substituted C3-12 cycloalkyl. In another embodiment, Z is optionally substituted 4- to 14-membered heterocyclo. In another embodiment, Z is an optionally substituted piperidinyl, wherein the nitrogen atom is attached to X or the 4-carbon atom is attached to X. In another embodiment, A is 5-indolinyl-2-one that is optionally substituted with one or two substituents selected from the group consisting of halo, hydroxy, alkoxy, amino, alkylamino, dialkylamino, (amino)alkyl, (alkylamino)alkyl, (dialkylamino)alkyl, C1-6 alkyl, haloalkyl, and hydroxyalkyl. In another embodiment, A is 6-chloro-5-indolinyl-2-one, i.e.,

In another embodiment, a Compound of the Disclosure is N-((1R,3r,5S)-8-((4-(benzylamino)piperidin-1-yl)sulfonyl)-8-azabicyclo[3.2.1]octan-3-yl)-6-chloro-2-oxoindoline-5-carboxamide or 6-chloro-2-oxo-N-((1R,3r,5S)-8-(((1-(4,4,4-trifluorobutyl)piperidin-4-yl)methyl)sulfonyl)-8-azabicyclo[3.2.1]octan-3-yl)indoline-5-carboxamide, and the pharmaceutically acceptable salts or solvates, e.g., hydrates, thereof.

It will be understood by those of ordinary skill in the art that compounds having Formula XIV can be drawn in various ways, e.g.,

In another embodiment, Compounds of the Disclosure are compounds having Formula I, and the pharmaceutically acceptable salts or solvates, e.g., hydrates, thereof, wherein A is 1,2,3-triazolyl which may be optionally substituted with one substituent, and Y is β€”C(═O)β€”.

In another embodiment, Compounds of the Disclosure are compounds having having Formula XV:

and the pharmaceutically acceptable salts or solvates, e.g., hydrates, thereof, wherein:

R is selected from the group consisting of C1-6 alkyl and C3-12 cycloalkyl;

B is optionally substituted 4- or 6- to 14-membered heterocyclenyl, e.g., B is:

(wherein the nitrogen atom is attached to β€”Xβ€”Z); and

X and Z are as defined above in connection with Formula I. In another embodiment, X is absent. In another embodiment, Z is selected from the group consisting of hydrogen, C1-6 alkyl, C3-12 cycloalkyl, aralkyl, and (heteroaryl)alkyl, or Z is β€”CH(R9a)(R9b). In another embodiment, Z is selected from the group consisting of aralkyl and (heteroaryl)alkyl. In another embodiment, Z is (heteroaryl)alkyl that is substituted with an aralkyl, e.g.,

or (heteroaryl)alkyl, e.g.,

In another embodiment, Compounds of the Disclosure are compounds having having Formula XVI:

and the pharmaceutically acceptable salts or solvates, e.g., hydrates, thereof, wherein:

Rβ€³ is selected from the group consisting of C1-6 alkyl and C3-12 cycloalkyl;

B is optionally substituted 4- or 6- to 14-membered heterocyclenyl, e.g., B is:

(wherein the nitrogen atom is attached to β€”Xβ€”Z); and

X and Z are as defined above in connection with Formula I. In another embodiment, X is absent. In another embodiment, Z is selected from the group consisting of hydrogen, C1-6 alkyl, C3-12 cycloalkyl, aralkyl, and (heteroaryl)alkyl, or Z is β€”CH(R9a)(R9b). In another embodiment, Z is selected front the group consisting of aralkyl and (heteroaryl)alkyl. In another embodiment, Z is (heteroaryl)alkyl that is substituted with an aralkyl, e.g.,

or (heteroaryl)alkyl, e.g.,

In another embodiment, Compounds of the Disclosure are compounds having having Formula XVII:

and the pharmaceutically acceptable salts or solvates, e,g, hydrates, thereof, wherein A, X, and Z are as defined above in connection with Formula I. In another embodiment, X is absent. In another embodiment, Z is selected from the group consisting of hydrogen, C1-6 alkyl, C3-12 cycloalkyl, aralkyl, and (heteroaryl)alkyl, or Z is β€”CH(R9a)(R9b). In another embodiment, Z is selected from the group consisting of aralkyl and (heteroaryl)alkyl. In another embodiment, Z is aralkyl. In another embodiment, Z is (heteroaryl)alkyl. In another embodiment, Z is (heteroaryl)alkyl that is substituted with an aralkyl, e.g.,

or (heteroaryl)alkyl, e.g.,

In another embodiment, Compounds of the Disclosure are compounds having having Formula XVIII:

and the pharmaceutically acceptable salts or solvates, e.g., hydrates, thereof, wherein:

Rβ€²β€³ is selected from the group consisting of aralkyl and (heteroaryl)alkyl; and

A is as defined above in connection with Formula I. In another embodiment, A is selected from the group consisting of 1,2,3-triazolyl, 3-pyridazinyl, 2-pyridyl, and 2-imidazolyl, each of which is optionally substituted with one substituent selected from the group consisting of C1-6 alkyl and C3-6 cycloalkyl. In another embodiment, A is selected from the group consisting of:

In another embodiment, Rβ€²β€³ is aralkyl. In another embodiment, Rβ€²β€³ is (heteroaryl)alkyl. In another embodiment, Rβ€²β€³ is benzyl wherein the phenyl group is optionally substituted with one or two substituents, e.g., β€”CH2(4-Clβ€”Ph), β€”CH2(3-Clβ€”Ph), and β€”CH2(4-CF3β€”Ph).

In another embodiment, Compounds of the Disclosure are compounds of Table 1, and the pharmaceutically acceptable salts or solvates, e.g., hydrates, thereof, or different pharmaceutically acceptable salt thereof. The chemical names of the compounds of Table 1 are provided in Table 1A.

In another embodiment, Compounds of the Disclosure are compounds of Table 3, and the pharmaceutically acceptable salts or solvates, e.g., hydrates, thereof, or different pharmaceutically acceptable salt thereof. The chemical names of the compounds of Table 3 are provided in Table 3A.

In another embodiment, Compounds of the Disclosure are compounds of Table 4, and the pharmaceutically acceptable salts or solvates, e.g., hydrates, thereof, or different pharmaceutically acceptable salt thereof. The chemical names of the compounds of Table 4 are provided in Table 4A.

In another embodiment, Compounds of the Disclosure are compounds of Table 5, and the pharmaceutically acceptable salts or solvates, e.g., hydrates, thereof, or different pharmaceutically acceptable salt thereof.

In another embodiment, Compounds of the Disclosure are compounds of Table 6, and the pharmaceutically acceptable salts or solvates, e.g., hydrates, thereof, or different pharmaceutically acceptable salt thereof. The chemical names of the compounds of Table 6 are provided in Table 6A.

In another embodiment, Compounds of the Disclosure are compounds of Tables 1, 1A, 3, 3A, 4, 4A, 5, 6 and 6A, and the pharmaceutically acceptable salts or solvates, e.g., hydrates, thereof, or different pharmaceutically acceptable salt thereof.

In another embodiment, Compounds of the Disclosure are compounds selected from the group consisting of:

rel-N-{1-[(1S)-1-[2-chloro-3-(2-hydroxyethoxy)phenyl]ethyl]azetidin-3yl}-1-cyclopropyl-1H-1,2,3-triazole-4-carboxamide;

N-(1-((1-(4-chlorobenzyl)-1H-pyrazol-4-yl)methyl)azetidin-3-yl)-5-cyclopropylpyridazine-3-carboxamide;

N-(1-((1-(4-chlorobenzyl)-1H-pyrazol-4-yl)methyl)azetidin-3-yl)-4-cyclopropylpicolinamide;

N-(1-((1-(4-chlorobenzyl)-1H-pyrazol-4-yl)-methyl)azetidin-3-yl)-1-cyclopropyl-1H-1,2,3-triazole-4-carboxamide;

N-(1((1-(4-chlorobenzyl)-1H-pyrazol-4-yl)methyl)azetidin-3-yl)-4-cyclopropyl-1 H-imidazole-2-carboxamide; and

1-cyclopropyl-N-(1-((1-(4-methoxybenzyl)-1H-pyrazol-4-yl)methyl)azetidin-3-yl)-1H-1,2,3-triazole-4-carboxamide,

and the pharmaceutically acceptable salts or solvates, e.g., hydrates, thereof.

It should be appreciated that the Compounds of the Disclosure in certain embodiments are the free base, various salts, and hydrate forms, and are not limited to the particular salt listed in Tables 1 and 3-6.

TABLE 1
Cpd.
No. Structure Salt Form
 3 None
 4 None
 5 None
 6 None
 7
 8 None
 9 None
 10 None
 11 HCl
 12 None
 13 HCl
 14 HCl
 15 HCl
 16 HCl
 17 HCl
 18 TFA
 19 TFA
 20 TFA
 21 TFA
 22 TFA
 23 HCl
 24 HCl
 25 HCl
 26 HCl
 27 HCl
 28 HCl
 29 HCl
 30 HCl
 31 HCl
 32 HCl
 33 HCl
 34 HCl
 35 HCl
 36 HCl
 37 HCl
 38 None
 39 None
 40 HCl
 42 HCl
 43 HCl
 44 TFA
 45 TFA
 46 TFA
 47 HCl
 48 HCl
 49 HCl
 50 HCl
 51 TFA
 52 HCl
 53 HCl
 54 HCl
 55 HCl
 56 HCl
 57 HCl
 58 HCl
 59 HCl
 60 HCl
 61 HCl
 62 HCl
 63 HCl
 64 HCl
 65 HCl
 66 HCl
 67 HCl
 68 HCl
 69 TFA
 70 TFA
 71 TFA
 72 TFA
 73 HCl
 74 HCl
 75 HCl
 76 HCl
 77 HCl
 78 HCl
 79 HCl
 80 HCl
 81 TFA
 82 TFA
 83 TFA
 84 TFA
 85 HCl
 86 HCl
 87 HCl
 88 TFA
 89 TFA
 90 TFA
 91 TFA
 92 TFA
 93 HCl
 94 HCl
 95 HCl
 96 HCl
 97 HCl
 98 HCl
 99 TFA
100 HCl
101 HCl
102 HCl
103 TFA
104 TFA
105 TFA
106 TFA
107 TFA
108 HCl
109 HCl
110 HCl
111 HCl
112 TFA
113 HCl
114 TFA
115 TFA
116 TFA
117 TFA
118 TFA
119 HCl
120 TFA
121 HCOOH
122 TFA
123 TFA
125 TFA
126 TFA
127 TFA
129 TFA
130 TFA
131 HCOOH
132 TFA
133 TFA
134 TFA
135 TFA
136 HCl
137 HCl
138 HCl
139 HCl
140 HCl
141 HCl
142 HCl
143 HCl
144 HCl
145 HCl
146 HCl
147 HCl
148 HCl
149 HCl
150 HCl
151 HCl
152 HCl
153 HCl
154 HCl
155 HCl
156 HCl
157 HCl
158 HCl
159 HCl
160 HCl
161 HCl
162 HCl
163 HCl
164 HCl
165 HCl
166 HCl
167 HCl
168 HCl
169 TFA
170 TFA
171 TFA
172 TFA
173 TFA
174 TFA
175 TFA
176 HCOOH
177 TFA
178 TFA
179 HCl
180 HCl
181 None
182 None
183 None
184 HCl
185 TFA
186 TFA
187 HCl
188 HCl
189 HCl
190 HCl
191 HCl
192 HCl
193 HCl
194 HCl
195 HCl
196 TFA
197 TFA
198 TFA
199 HCl
200 TFA
201 TFA
202 HCl
203 HCl
204 HCl
205 HCl
206 HCl
207 HCl
208 TFA
209 HCl
210 HCl
211 TFA
212 TFA
213 TFA
214 TFA
215 HCl
216 TFA
217 TFA
218 TFA
219 TFA
220 TFA
221 TFA
222 TFA
223 TFA
224 TFA
225 TFA
226 TFA
227 TFA
228 TFA
229 HCl
230 HCl
231 HCl
232 HCl
233 HCl
234 HCl
235 HCl
236 TFA
237 TFA
238 TFA
239 TFA
241 TFA
242 None
243 TFA
244 HCl
245 HCl
246 HCl
247 TFA
248 None
249 TFA
250 TFA
251 HCl
252 HCl
253 TFA
254 TFA
255 TFA
256 TFA
257 TFA
258 TFA
259 TFA
260 TFA
261 TFA
262 HCl
263 TFA
264 HCl
265 TFA
266 TFA
267 TFA
268 TFA
269 HCl
270 HCl
271 HCl
272 HCl
273 TFA
274 TFA
275 TFA
276 TFA
277 TFA
278 TFA
279 TFA
280 TFA
281 HCl
283 HCl
284 TFA
285 HCl
286 TFA
287 TFA
288 None
289 None
290 None
291 None
292 None
293 None
294 HCl
295 TFA
296 HCl
297 HCl
298 HCl
299 TFA
300 TFA
301 TFA
302 TFA
303 HCl
304 HCl
305 TFA
306 TFA
307 TFA
308 HCl
309 TFA
310 TFA
311 TFA
312 TFA
313 TFA
314 TFA
315 TFA
316 TFA
317 HCl
318 HCl
319 TFA
320 None
321 HCl
322 None
323 TFA
324 TFA
325 HCl
326 HCl
327 HCl
328 None
329 HCl
330 HCl
331 HCl
332 HCl
333 None
334 None
335 None
336 None
337 None
338 TFA
339 None
340 HCl
341 TFA
342 TFA
343 TFA
344 HCl
345 HCl
346 HCl
347 HCl
348 TFA
349 TFA
350 TFA
351 HCl
352 HCl
353 HCl
354 HCl
355 HCl
356 HCl
357 None
358 TFA
359 TFA
360 None
361 TFA
362 TFA
363 TFA
364 TFA
365 TFA
366 TFA
367 TFA
368 HCl
369 HCl
370 TFA
371 TFA
372 TFA
373 TFA
374 TFA
375 TFA
376 TFA
378 HCl
379 TFA
380 None
381 TFA
382 TFA
383 TFA
384 TFA
385 TFA
386 TFA
387 TFA
388 None
389 TFA
390 HCl
391 TFA
392 TFA
393 TFA
394 None
395 HCl
396 TFA
397 TFA
398 TFA
399 HCl
400 HCl
401 TFA
402 TFA
403 TFA
404 None
405 None
406 TFA
407 TFA
408 TFA
409 HCl
410 HCl
411 HCl
412 TFA
413 TFA
414 TFA
415 TFA
416 TFA
417 TFA
418 TFA
419 TFA
420 TFA
421 TFA
422 TFA
423 TFA
424 TFA
425 TFA
426 TFA
427 TFA
428 TFA
429 TFA
430 HCl
431 TFA
432 TFA
433 HCl
434 HCl
435 HCl
436 TFA
437 None
438 TFA
439 HCl
440 HCl
441 TFA
442 HCl
443 HCl
444 TFA
445 TFA
446 TFA
447 TFA
448 TFA
449 TFA
450 None
451 TFA
452 TFA
453 TFA
454 TFA
455 None
456 TFA
457 TFA
458 None
459 TFA
460 TFA
461 TFA
462 TFA
463 TFA
464 HCl
465 TFA
466 TFA
467 TFA
468 TFA
469 TFA
470 TFA
471 HCl
472 None
473 TFA
474 TFA
475 TFA
476 TFA
477 TFA
478 TFA
479 TFA
480 TFA
481 TFA
482 TFA
483 TFA
484 None
485 None
486 TFA
487 TFA
488 TFA
489 TFA
490 TFA
491 TFA
492 None
493 TFA
494 None
495 None
496 TFA
497 TFA
498 TFA
499 TFA
500 TFA
501 TFA
502 TFA
503 TFA
504 TFA
505 TFA
506 TFA
507 TFA
508 TFA
509 TFA
510 TFA
511 HCl
512 TFA
513 None
514 None
515 TFA
516 None
517 None
518 None
519 TFA
520 TFA
521 None
522 None
523 HCl
525 HCl
527 TFA
528 TFA
529 TFA
530 TFA
531 TFA
532 TFA
533 TFA
534 None
535 None
536 None
537 None
538 TFA
539 None
540 TFA
541 TFA
542 None
543 TFA
544 TFA
545 TFA
546 TFA
547 None
548 TFA
549 TFA
550 TFA
551 TFA
552 TFA
553 TFA
554 TFA
555 TFA
556 TFA
557 HCl
558 HCl
559 HCl
560 TFA
561 TFA
562 TFA
563 HCl
564 HCl
565 TFA
566 TFA
567 HCl
568 HCl
569 HCl
570 HCl
571 HCl
572 TFA
573 HCl
574 TFA

TABLE 3
Cpd. No. Structure Salt Form
575 TFA
576 None
577 TFA
578 TFA
579 HCl
580 None
581 None
582 HCl
583 TFA
584 TFA
585 TFA
586 HCl
587 TFA
588 TFA
589 HCl
590 None
591 TFA
592 TFA
593 None
594 None
595 None
596 TFA
597 HCl
598 TFA
599 TFA
600 TFA
601 HCl
602 None
603 TFA
604 TFA
605 HCl
606 None
607 HCl
608 TFA
609 HCl
610 HCl
611 TFA
612 TFA
613 TFA
614 None
615 None
616 TFA
617 TFA
618 HCl
619 TFA
620 TFA
621 TFA
622 TFA
623 None
624 None
625 HCl
626 HCl
627 HCl
628 HCl
629 None
630 None
631 HCl
632 None
633 None
634 None
635 HCl
636 HCl
637 None
638 TFA
639 None
640 TFA
641 None
642 HCl
643 None
644 HCl

TABLE 4
Cpd. No. Structure Salt Form
645 None
646 None
647 None
648 None
649 None
650 None
651 None
652 None
657 None
659 None
660 None
661 None
662 None
663 None
664 None
665 None
666 None
667 None
668 None
669 None
670 None
671 None
672 None
673 None
674 None
675 None
676 None
677 None
678 None
679 None
680 None
681 None
682 None
683 None
684 None
685 None
686 None
687 None
688 None
689 None
690 None
691 None
692 None
693 None
694 None
695 None
696 None
697 None
698 None
699 None
700 None
701 None
702 None
703 None
704 None
705 None
706 None
707 None
708 None
709 None
710 None
711 None
712 None
713 None
714 None
715 None
716 None
717 None
718 None
719 None
720 None
721 None
722 None
723 None
724 None
725 None
726 None
727 None
728 None
729 None
730 None
731 None
732 None
733 None
734 None
735 None
736 None
737 None
738 None
739 None
740 None
741 None
742 None
743 None
744 None
745 None
746 None
747 None
748 None
749 None
750 None
751 None
752 None
753 None
754 None
755 None
756 None
757 None
758 None
759 None
760 None
761 None
762 None
763 None
764 None
765 None
766 None
767 None
768 None
769 None
770 None
771 None
772 None
773 None
774 None
775 None
776 None
777 None
778 None
779 None
780 None
781 None
782 None
783 None
784 None
785 None
786 None
787 None
788 None
789 None
790 None
791 None
792 None
793 None
794 None
795 None
796 None
797 None
798 None
799 None
800 None
801 None
802 None
803 None
804 None
805 None
806 None
807 None
808 None
809 None
810 None
811 None
812 None
813 None
814 None
815 None
816 None
817 None
818 None
819 None
820 None
821 None
822 None
823 None
824 None
825 None
826 None
827 None
828 None
829 None
830 None
831 None
832 None
833 None
834 None
835 None
836 None
837 None
838 None
839 None
840 None
841 None
842 None
843 None
844 None
845 None
846 None
847 None
848 None
849 None
850 None
851 None
852 None
853 None
854 None
855 None
856 None
857 None
858 None
859 None
860 None
861 None
862 None
863 None
864 None
865 None
866 None
867 None
868 None
869 None
913 None
914 None
915 None
916 None
917 None
918 None

TABLE 5
Cpd.
No. Structure Chemical Name
870 (R)-1-cyclopropyl-N-(1-(1- (2-methoxyphenyl)ethyl) azetidin-3-yl)-1H-1,2,3- triazole-4-carboxamide
871 1-cyclopropyl-N-(1-(5- methoxy-1,2,3,4- tetrahydronaphthalen-1- yl)azetidin-3-yl)-1H-1,2,3- triazole-4-carboxamide
872 1-cyclopropyl-N-(1-(1- methylpiperidin-2-yl)ethyl)- 1H-1,2,3-triazole-4- carboxamide
873 5-cyclopropyl-N-(1-(1- methylpiperidin-2- yl)ethyl)pyridazine-3- carboxamide
874 N-(1-(2-(4- (benzyloxy)phenyl)propan- 2-yl)azetidin-3-yl)-1- cyclopropyl-1H-1,2,3- triazole-4-carboxamide
875 N-(1-(1-(4- (benzyloxy)phenyl) cyclopropyl)azetidin-3-yl)- 1-cyclopropyl-1H-1,2,3- triazole-4-carboxamide
876 1-cyclopropyl-N-(1-(4-(1- hydroxy-2- phenylethyl)benzyl) azetidin-3-yl)-1H-1,2,3- triazole-4-carboxamide
877 1-cyclopropyl-N-(1-(4- (pyridin-3- ylmethoxy)benzyl)azetidin- 3-yl)-1H-1,2,3-triazole-4- carboxamide
878 N-(1-(4-((1,3,4-thiadiazol-2- yl)methoxy)benzyl)azetidin- 3-yl)-1-cyclopropyl-1H- 1,2,3-triazole-4-carboxamide
879 1-cyclopropyl-N-(1- isopropylazetidin-3-yl)-1H- imidazole-4-carboxamide
880 1-cyclopropyl-N-(3- (dimethylamino)propyl)-1H- 1,2,3-triazole-4-carboxamide
881 N-(1-(1-(4-(benzyloxy)-3- methoxyphenyl)ethyl)azetidin- 3-yl)-1-cyclopropyl-1H-1,2,3- triazole-4-carboxamide
882 N-(1-(1-(3-(2-chlorophenyl)- 1H-indazol-5- yl)ethyl)azetidin-3-yl)-1- cyclopropyl-1H-1,2,3- triazole-4-carboxamide
883 1-cyclopropyl-N-(1-(1-(5- methoxypyridin-2- yl)ethyl)azetidin-3-yl)-1H- 1,2,3-triazole-4-carboxamide
884 1-cyclopropyl-N-(1-(1-(2- methyl-2H-indazol-5- yl)ethyl)azetidin-3-yl)-1H- 1,2,3-triazole-4-carboxamide
885 5-cyclopropyl-N-(1-(1-(3- methoxyphenyl)ethyl)azetidin- 3-yl)pyridazine-3- carboxamide
886 N-(1-(1-(5-chloro-2- (difluoromethoxy)phenyl) ethyl)azetidin-3-yl)-1- cyclopropyl-1H-1,2,3- triazole-4-carboxamide
887 1-cyclopropyl-N-(1-(1-(4- (phenoxymethyl)phenyl) ethyl)azetidin-3-yl)-1H-1,2,3- triazole-4-carboxamide
888 N-(1-(1-(3-(2-aminoethoxy)-2- chlorophenyl)ethyl)azetidin-3- yl)-1-cyclopropyl-1H-1,2,3- triazole-4-carboxamide
889 N-(1-(1-(2-chloro-3-(2- (methylamino)ethoxy) phenyl)ethyl)azetidin-3-yl)- 1-cyclopropyl-1H-1,2,3- triazole-4-carboxamide
890 N-(1-(1-(2-chloro-3-(2- (dimethylamino)ethoxy) phenyl)ethyl)azetidin-3-yl)-1- cyclopropyl-1H-1,2,3- triazole-4-carboxamide
891 N-(1-(1-(2-chloro-3-(2- hydroxypropoxy)phenyl) ethyl)azetidin-3-yl)-1- cyclopropyl-1H-1,2,3- triazole-4-carboxamide
892 N-(1-(1-(2-chloro-3-(2- hydroxy-2- methylpropoxy)phenyl) ethyl)azetidin-3-yl)-1- cyclopropyl-1H-1,2,3- triazole-4-carboxamide
893 N-(1-(1-(2-chloro-3-(2,3- dihydroxypropoxy)phenyl) ethyl)azetidin-3-yl)-1- cyclopropyl-1H-1,2,3- triazole-4-carboxamide
894 N-(1-(1-(2-chloro-5- methoxyphenyl)ethyl) azetidin-3-yl)-1-cyclopropyl- 1H-1,2,3-triazole-4- carboxamide
895 N-(1-(1-(5-chloro-2- (trifluoromethyl)phenyl) ethyl)azetidin-3-yl)-1- cyclopropyl-1H-1,2,3- triazole-4-carboxamide
896 1-cyclopropyl-N-(1-(1-(4-((4- methylbenzyl)oxy)phenyl) ethyl)azetidin-3-yl)-1H-1,2,3- triazole-4-carboxamide
897 N-(1-(bicyclo[2.2.2]octan-1- ylmethyl)azetidin-3-yl)-1- cyclopropyl-1H-1,2,3- triazole-4-carboxamide
898 1-cyclopropyl-N-(1-((4- methoxybicyclo[2.2.2]octan- 1-yl)methyl)azetidin-3-yl)- 1H-1,2,3-triazole-4- carboxamide
899 1-cyclopropyl-N-(2,2- dimethyl-1-(1- phenylethyl)azetidin-3-yl)- 1H-1,2,3-triazole-4- carboxamide
900 1-cyclopropyl-N-(1- (piperidin-2-yl)ethyl)-1H- 1,2,3-triazole-4-carboxamide
901 5-cyclopropyl-N-(1- (piperidin-2- yl)ethyl)pyridazine-3- carboxamide
902 5-cyclopropyl-N-(8-methyl- 8-azabicyclo[3.2.1]octan-3- yl)pyridazine-3-carboxamide
903 1-cyclopropyl-N-(1-(1-(4- (2,2,2- trifluoroethoxy)phenyl) ethyl)azetidin-3-yl)-1H-1,2,3- triazole-4-carboxamide
904 1-cyclopropyl-N-(1-(1-(4- (piperidin-4- ylmethoxy)phenyl)ethyl) azetidin-3-yl)-1H-1,2,3- triazole-4-carboxamide
905 1-cyclopropyl-N-(1-(1-(6- oxo-1,6-dihydropyridin-3- yl)ethyl)azetidin-3-yl)-1H- 1,2,3-triazole-4-carboxamide
906 N-(1-(1-(5-chloro-2-(4- fluorophenoxy)phenyl) ethyl)azetidin-3-yl)-1- cyclopropyl-1H-1,2,3- triazole-4-carboxamide
907 N-(1-(1-(4-((4- acetamidobenzyl)oxy) phenyl)ethyl)azetidin-3-yl)-1- cyclopropyl-1H-1,2,3- triazole-4-carboxamide
908 1-cyclopropyl-N-(1-(1-(4- ((phenylamino)methyl) phenyl)ethyl)azetidin-3-yl)- 1H-1,2,3-triazole-4- carboxamide
909 1-cyclopropyl-N-(1-(2,2,2- trifluoro-1-(4- fluorophenyl)ethyl)azetidin- 3-yl)-1H-1,2,3-triazole-4- carboxamide
910 N-(1-(1-(4-chlorophenyl)- 2,2,2-trifluoroethyl)azetidin- 3-yl)-1-cyclopropyl-1H- 1,2,3-triazole-4-carboxamide
911 1-cyclopropyl-N-(1-(2,2,2- trifluoro-1-(m-tolyl)ethyl) azetidin-3-yl)-1H- 1,2,3-triazole-4-carboxamide
912 1-cyclopropyl-N-(1-(2,2,2- trifluoro-1-(3- fluorophenyl)ethyl)azetidin- 3-yl)-1H-1,2,3-triazole-4- carboxamide

TABLE 6
Cpd. Salt
No. Structure Form
919 none
920 none
921 none
922 none
923 none
924 none
925 none
926 none
927 none
928 none
929 none
930 none
931 none
932 none
933 none
934 none
935 none
936 none
937 none
938 none
939 none
940 none
941 none
942 none
943 none
944 none
945 none
946 none
947 none
948 none
949 none
950 none
951 none
952 none
953 none
954 none
955 none
956 none
957 none
958 none
959 none
960 none
961 none
962 none
963 none
964 none
965 none
966 none
967 none
968 none
969 none
970 none
971 none
972 none
973 none
974 none
975 none
976 none
977 none
978 none
979 none
980 none
981 none
982 none
983 none
984 none
985 none
986 none
987 none
988 none
989 none
990 none
991 none
992 none
993 none
994 none
995 none
996 none
997 none
998 none
999 none
1000 none
1001 none
1002 none
1003 none
1004 none
1005 none
1006 none
1007 none
1008 none
1009 none
1012 none
1017 none
1020 none
1021 none
1022 none
1023 none
1024 none
1025 none
1026 none
1028 none

TABLE 1A
SMYD3 SMYD3
Biochem Cell
Cpd. LCMS IC50 IC50
No. Chemical Name M + H (ΞΌM)* (ΞΌM)*
3 N-(1-((4- 403.2 >100
acetamidophenyl)sulfonyl)piperidin-4-
yl)nicotinamide
4 N-(1-((4- 403.2 >100
acetamidophenyl)sulfonyl)piperidin-4-
yl)isonicotinamide
5 N-(1-((4- 404.2 >100
acetamidophenyl)sulfonyl)piperidin-4-
yl)pyrazine-2-carboxamide
6 N-(1-((4- 392.3 >100
acetamidophenyl)sulfonyl)piperidin-4-yl)-
1H-pyrazole-3-carboxamide
7 N-(1-((4- 406.3 >100
acetamidophenyl)sulfonyl)piperidin-4-yl)-1-
methyl-1H-pyrazole-5-carboxamide
8 N-(1-((4- 406.3 >100
acetamidophenyl)sulfonyl)piperidin-4-yl)-1-
methyl-1H-pyrazole-4-carboxamide
9 N-(1-((4- 406.3 60.5
acetamidophenyl)sulfonyl)piperidin-4-yl)-1-
methyl-1H-imidazole-4-carboxamide
10 N-(1-((4- 433.2 16.98
acetamidophenyl)sulfonyl)piperidin-4-yl)-1-
cyclopropyl-1H-1,2,3-triazole-4-carboxamide
11 N-((1r,4r)-4-aminocyclohexyl)-1- 250 15.37
cyclopropyl-1H-1,2,3-triazole-4-carboxamide
12 N-(1-((4- 463 45.94
acetamidophenyl)sulfonyl)piperidin-4-yl)-1-
(cyclopropylmethyl)piperidine-4-
carboxamide
13 N-((1r,4r)-4-aminocyclohexyl)-1-ethyl-1H- 237.1 112.37
pyrazole-3-carboxamide
14 N-((1r,4r)-4-aminocyclohexyl)-3- 238.15 104.43
ethylisoxazole-5-carboxamide
15 N-((1r,4r)-4-aminocyclohexyl)-1-ethyl-1H- 237.1 56.59
imidazole-4-carboxamide
16 N-((1r,4r)-4-aminocyclohexyl)-2- NA 128.43
ethyloxazole-4-carboxamide
17 N-((1r,4r)-4-aminocyclohexyl)-5- 254.1 13.52
ethylisothiazole-3-carboxamide
18 N-((1r,4r)-4-aminocyclohexyl)-4- 247.1 125.3
ethylbenzamide
19 N-((1r,4r)-4-aminocyclohexyl)-3-oxo-3,4- 289.9 102.25
dihydro-2H-benzo[b][1,4]oxazine-7-
carboxamide
20 N-((1r,4r)-4-aminocyclohexyl)-3-oxo-3,4- 289.8 16.03
dihydro-2H-benzo[b][1,4]oxazine-6-
carboxamide
21 N-((1r,4r)-4-aminocyclohexyl)-3- 247.3 57.46
ethylbenzamide
22 N-((1r,4r)-4-aminocyclohexyl)-5- 247.9 31.29
ethylnicotinamide
23 3-acetyl-N-((1r,4r)-4- 261.2 91.55
aminocyclohexyl)benzamide
24 3-acetamido-N-((1r,4r)-4- 276.2 80.28
aminocyclohexyl)benzamide
25 N-((1r,4r)-4-aminocyclohexyl)-3- 290.2 84.27
propionamidobenzamide
26 N-((1r,4r)-4-aminocyclohexyl)-3- 248.9 86.01
(hydroxymethyl)benzamide
27 N-((1r,4r)-4-aminocyclohexyl)-1-ethyl-3- 251.2 101.58
methyl-1H-pyrazole-5-carboxamide
28 N-((1r,4r)-4-aminocyclohexyl)-3-methyl-1- 299.25 110.89
phenyl-1H-pyrazole-5-carboxamide
29 N-((1r,4r)-4-aminocyclohexyl)-1-benzyl-3- 313.2 13.99
methyl-1H-pyrazole-5-carboxamide
30 1-ethyl-3-methyl-N-(phenyl(piperidin-4- 327.15 69.19
yl)methyl)-1H-pyrazole-5-carboxamide
31 3-methyl-1-phenyl-N-(phenyl(piperidin-4- 375.2 56.66
yl)methyl)-1H-pyrazole-5-carboxamide
32 1-benzyl-3-methyl-N-(phenyl(piperidin-4- 389.25 91.27
yl)methyl)-1H-pyrazole-5-carboxamide
33 N-(4-(aminomethyl)phenyl)-6- 228.05 130.63
hydroxypyridazine-3-carboxamide (βˆ’NH2)
34 N-(4-(aminomethyl)phenyl)-1-methyl-3- 282.1 153.36
(trifluoromethyl)-1H-pyrazole-5- (βˆ’NH2)
carboxamide
35 N-(4-(aminomethyl)phenyl)-1-ethyl-3- 242.05 124.89
methyl-1H-pyrazole-5-carboxamide (βˆ’NH2)
36 N-(4-(aminomethyl)phenyl)-3-methyl-1- 290.15 123.93
phenyl-1H-pyrazole-5-carboxamide (βˆ’NH2)
37 N-((1r,4r)-4-aminocyclohexyl)-3-ethyl-1- 251.34 59.91
methyl-1H-pyrazole-5-carboxamide
38 N-((1r,4r)-4-aminocyclohexyl)-4- 248 20.5
ethylpicolinamide
39 2-oxo-N-(piperidin-4-yl)-1,2,3,4- 274.9 23.86
tetrahydroquinoxaline-6-carboxamide
40 N-((1r,4r)-4-aminocyclohexyl)-2- 274.1 2.84
oxoindoline-5-carboxamide
42 N-((1r,4r)-4-aminocyclohexyl)-2- 274.2 3.31
oxoindoline-5-carboxamide
43 N-((1r,4r)-4-aminocyclohexyl)-2- 287 60.36
hydroxyquinoxaline-6-carboxamide
44 2-oxo-N-(phenyl(piperidin-4- 350.25 14.08
yl)methyl)indoline-5-carboxamide
45 5-amino-N-(phenyl(piperidin-4-yl)methyl)- 300.25 137.24
1H-pyrazole-3-carboxamide
46 3-oxo-N-(piperidin-4-yl)-3,4- 272.9 63.74
dihydroquinoxaline-6-carboxamide
47 N-((1r,4r)-4-aminocyclohexyl)-2-oxo-2,3- 274.8 11.94
dihydro-1H-pyrrolo[2,3-b]pyridine-5-
carboxamide
48 3-amino-N-((1r,4r)-4-aminocyclohexyl)-1- 237.9 117.12
methyl-1H-pyrazole-5-carboxamide
49 N-(1-(L-tyrosyl)piperidin-4-yl)-2- 423.3 0.86
oxoindoline-5-carboxamide
50 2-oxo-N-(piperidin-4-yl)indoline-5- 260.2 12.15
carboxamide
51 N-(1-(L-tryptophyl)piperidin-4-yl)-2- 446.4 0.69
oxoindoline-5-carboxamide
52 N-(4-(aminomethyl)phenyl)-4-propionyl-1H- 272.2 107.67
pyrrole-2-carboxamide
53 N-((1r,4r)-4-aminocyclohexyl)-2- 239.3 121.58
butylcyclopropane-1-carboxamide
54 N-((1r,4r)-4-aminocyclohexyl)-5- 253.4 49.88
ethylthiophene-2-carboxamide
55 5-ethyl-N-(phenyl(piperidin-4- 329.2 116.27
yl)methyl)thiophene-2-carboxamide
56 N-(4-(aminomethyl)phenyl)-5- 261.1 138.14
ethylthiophene-2-carboxamide
57 N-((1r,4r)-4-aminocyclohexyl)-2-methyl-4H- 261.7 134.08
furo[3,2-b]pyrrole-5-carboxamide
58 2-methyl-N-(piperidin-4-yl)-4H-furo[3,2- 248.1 76.14
b]pyrrole-5-carboxamide
59 N-((1r,4r)-4-aminocyclohexyl)-2- 254.5 184.11
ethylthiazole-5-carboxamide
60 2-ethyl-N-(phenyl(piperidin-4- 330.3 149.92
yl)methyl)thiazole-5-carboxamide
61 N-(4-(aminomethyl)phenyl)-2-ethylthiazole- 261.9 113.72
5-carboxamide
62 N-((1r,4r)-4-aminocyclohexyl)-3- 225.6 155.29
cyclopropylbutanamide
63 3-cyclopropyl-N-(phenyl(piperidin-4- 301.3 131.22
yl)methyl)butanamide
64 4-acetyl-N-((1r,4r)-4-aminocyclohexyl)-1H- 250.2 134.14
pyrrole-2-carboxamide
65 4-acetyl-N-(piperidin-4-yl)-1H-pyrrole-2- 236 45.83
carboxamide
66 4-acetyl-N-(4-(aminomethyl)phenyl)-1H- 258.2 60.87
pyrrole-2-carboxamide
67 N-((1r,4r)-4-aminocyclohexyl)-3-hydroxy-1- 238.8 129.1
methyl-1H-pyrazole-5-carboxamide
68 2-oxo-N-(piperidin-4-yl)-2,3-dihydro-1H- 261 86.06
pyrrolo[2,3-b]pyridine-5-carboxamide
69 3-hydroxy-1-methyl-N-(piperidin-4-yl)-1H- 225 19.72
pyrazole-5-carboxamide
70 N-((1r,4r)-4-aminocyclohexyl)-3-oxo- 289 77.47
1,2,3,4-tetrahydroquinoxaline-6-carboxamide
71 N-((1r,4r)-4-aminocyclohexyl)-2- 274.2 89.26
oxoindoline-6-carboxamide
72 N-(1-(L-tyrosyl)piperidin-4-yl)-2- 423.5 35.48
oxoindoline-6-carboxamide
73 N-((1r,4r)-4-aminocyclohexyl)-2-oxo-2,3- 275.1 13.7
dihydro-1H-benzo[d]imidazole-5-
carboxamide
74 N-((1r,4r)-4-aminocyclohexyl)-2-oxo- NA 65.8
1,2,3,4-tetrahydroquinoline-6-carboxamide
75 6-amino-N-((1r,4r)-4-aminocyclohexyl)-2- 284.15 62.5
naphthamide
76 N-((1r,4r)-4-aminocyclohexyl)-2- 286.2 115.32
hydroxyquinoline-6-carboxamide
77 N-(phenyl(piperidin-4-yl)methyl)-4- 340.2 10.04
propionyl-1H-pyrrole-2-carboxamide
78 N-((1r,4r)-4-aminocyclohexyl)-2- 263.4 35.19
(ethylsulfonyl)propanamide
79 N-((1r,4r)-4-aminocyclohexyl)-5- 266 38.86
((dimethylamino)methyl)furan-2-
carboxamide
80 2-amino-N-(phenyl(piperidin-4- 301.4 97.11
yl)methyl)oxazole-4-carboxamide
81 N-(4-(aminomethyl)phenyl)-2-methyl-4H- 270.4 25.9
furo[3,2-b]pyrrole-5-carboxamide
82 N-(1-(L-tyrosyl)piperidin-4-yl)-1-methyl-2- 437.3 8.7
oxoindoline-5-carboxamide
83 N-(1-(L-tryptophyl)piperidin-4-yl)-1-methyl- 460.3 12.94
2-oxoindoline-5-carboxamide
84 N-((1r,4r)-4-aminocyclohexyl)-1-methyl-2- 288.2 16.66
oxoindoline-5-carboxamide
85 N-((1r,4r)-4-aminocyclohexyl)-8-methoxy-3- NA 184.09
oxo-3,4-dihydro-2H-benzo[b][1,4]oxazine-6-
carboxamide
86 N-(1-(1-(1-alanyl)piperidin-4-yl)ethyl)-2- 359.25 1.43
oxoindoline-5-carboxamide
87 N-(1-(1-(D-alanyl)piperidin-4-yl)ethyl)-2- 359.2 9.37
oxoindoline-5-carboxamide
88 N-(1-(L-tyrosyl)piperidin-4-yl)-1-methyl-2- 193.28
oxoindoline-6-carboxamide
89 N-((1r,4r)-4-aminocyclohexyl)-2-oxo-2,3- 258.89 140.17
dihydrobenzo[d]oxazole-5-carboxamide (βˆ’NH2)
90 N-((1r,4r)-4-aminocyclohexyl)-2-oxo-2,3- 276.15 9.76
dihydrobenzo[d]oxazole-6-carboxamide
91 N-((1r,4r)-4-aminocyclohexyl)-2-oxo- 288.15 89.47
1,2,3,4-tetrahydroquinoline-7-carboxamide
92 N-(1-(1-(L-alanyl)piperidin-4-yl)ethyl)-2- 373.2 49.95
oxo-1,2,3,4-tetrahydroquinoline-7-
carboxamide
93 N-(1-(1-(L-alanyl)piperidin-4-yl)ethyl)-2- 360.25 6.76
oxo-2,3-dihydro-1H-benzo[d]imidazole-5-
carboxamide
94 N-(1-(1-(L-alanyl)piperidin-4-yl)ethyl)-2- 361.25 3.94
oxo-2,3-dihydrobenzo[d]oxazole-6-
carboxamide
95 N-(1-(1-(L-alanyl)piperidin-4-yl)ethyl)-2- 372.3 149.61
oxo-2H-chromene-6-carboxamide
96 N-(1-(1-(L-alanyl)piperidin-4-yl)ethyl)-2- 373.3 192.59
oxo-1,2,3,4-tetrahydroquinoline-6-
carboxamide
97 N-(1-(1-(L-alanyl)piperidin-4-yl)ethyl)-6- 369.3 145.77
amino-2-naphthamide
98 N-(1-(1-(L-alanyl)piperidin-4-yl)ethyl)-8- 405.25 150.97
methoxy-3-oxo-3,4-dihydro-2H-
benzo[b][1,4]oxazine-6-carboxamide
99 N-(1-(1-(L-alanyl)piperidin-4-yl)ethyl)-3- 372.3 35.73
hydroxyquinoxaline-6-carboxamide
100 2-oxo-N-(piperidin-4-ylmethyl)indoline-5- 274.1 20.04
carboxamide
101 (S)-2-oxo-N-(pyrrolidin-3-ylmethyl)indoline- 260.1 25.36
5-carboxamide
102 N-((1-(L-tyrosyl)piperidin-4-yl)methyl)-2- 437.45 1.86
oxoindoline-5-carboxamide
103 N-((1-(L-tryptophyl)piperidin-4-yl)methyl)- 460.25 2.74
2-oxoindoline-5-carboxamide
104 ethyl 2-(1-(L-alanyl)piperidin-4-yl)-2-(2- 417.3 1.51
oxoindoline-5-carboxamido)acetate
105 N-((4-hydroxypiperidin-4-yl)methyl)-2- 290.2 40.39
oxoindoline-5-carboxamide
106 N-(4-aminobutyl)-2-oxoindoline-5- 248.2 13.42
carboxamide
107 (S)-N-(4-(2-aminopropanamido)butyl)-2- 319.3 13.95
oxoindoline-5-carboxamide
108 ethyl 5-(((1r,4r)-4-aminocyclohexyl)amino)- 257.3 92.19
5-oxopentanoate
109 2-methyl-N-(phenyl(piperidin-4-yl)methyl)- 330.5 79.04
3-(pyrrolidin-1-yl)propanamide
110 2-methyl-N-(phenyl(piperidin-4-yl)methyl)- 338.7 82.75
4H-furo[3,2-b]pyrrole-5-carboxamide
111 N-((1r,4r)-4-aminocyclohexyl)-2- 240.1 149.59
ethylpyrrolidine-2-carboxamide
112 N-((1-(L-alanyl)-4-hydroxypiperidin-4- 361.15 3.04
yl)methyl)-2-oxoindoline-5-carboxamide
113 N-((1-(L-alanyl)-4-fluoropiperidin-4- 363.25 3.86
yl)methyl)-2-oxoindoline-5-carboxamide
114 (R)-N-(4-(2-aminopropanamido)butyl)-2- 319.15 22.28
oxoindoline-5-carboxamide
115 N-((1r,4r)-4-aminocyclohexyl)-3-oxo-3,4- 290 61.18
dihydro-2H-benzo[b][1,4]oxazine-8-
carboxamide
116 N-((1r,4r)-4-aminocyclohexyl)-5- 296.13/298.13 51
bromonicotinamide
117 N-((1r,4r)-4-aminocyclohexyl)-5- 254.2 86.99
chloronicotinamide
118 N-((1r,4r)-4- 276.2 139.34
aminocyclohexyl)benzo[d]thiazole-6-
carboxamide
119 N-((1r,4r)-4-aminocyclohexyl)-2- 115.79
hydroxyquinoline-7-carboxamide
120 N-(1-(1-(L-alanyl)piperidin-4-yl)ethyl)-2- 371.2 86.89
hydroxyquinoline-7-carboxamide
121 N-((4-methylpiperidin-4-yl)methyl)-2- 288.15 65.69
oxoindoline-5-carboxamide
122 ethyl 2-(2-oxoindoline-5-carboxamido)-2- 346.3 42.26
(piperidin-4-yl)acetate
123 6-amino-N-((1r,4r)-4- 235 107.83
aminocyclohexyl)nicotinamide
125 N-((1r,4r)-4-aminocyclohexyl)-7-fluoro-2- 304.7 91.68
hydroxyquinoline-4-carboxamide
126 N-((1r,4r)-4-aminocyclohexyl)-2-chloro-5- 320.1 31.99
(4H-1,2,4-triazol-4-yl)benzamide
127 N-((1r,4r)-4-aminocyclohexyl)-4H-1,2,4- 210.1 16.44
triazole-3-carboxamide
129 N-((1r,4r)-4-aminocyclohexyl)-2-(pyridin-3- 234.1 >100
yl)acetamide
130 N-(4-(3-aminopropanamido)cyclohexyl)-2- 345.1 0.29
oxoindoline-5-carboxamide
131 ethyl 4-((2-oxoindoline-5- 346.2 56.28
carboxamido)methyl)piperidine-4-
carboxylate
132 ethyl 1-(L-alanyl)-4-((2-oxoindoline-5- 417.2 0.94
carboxamido)methyl)piperidine-4-
carboxylate
133 N-(((S)-1-(D-alanyl)pyrrolidin-3-yl)methyl)- 331.15 10.67
2-oxoindoline-5-carboxamide
134 N-(((S)-1-(L-alanyl)pyrrolidin-3-yl)methyl)- 331.15 10.2
2-oxoindoline-5-carboxamide
135 N-(((R)-1-(L-alanyl)pyrrolidin-3-yl)methyl)- 331.1 13.62
2-oxoindoline-5-carboxamide
136 N-((1r,4r)-4-(3- 372.2 >100
aminopropanamido)cyclohexyl)-4-(5-methyl-
1,2,4-oxadiazol-3-yl)benzamide
137 N-((1r,4r)-4-aminocyclohexyl)-4-(5-methyl- 301.1 46.61
1,2,4-oxadiazol-3-yl)benzamide
138 N-(1-(1-(L-alanyl)piperidin-4- 305.2 >100
yl)ethyl)isonicotinamide
139 N-((1r,4r)-4-(3- 291.2 >100
aminopropanamido)cyclohexyl)isonicotinamide
140 N-((1r,4r)-4- 220.2 >100
aminocyclohexyl)isonicotinamide
141 N-(1-(1-(L-alanyl)piperidin-4- 305.2 >100
yl)ethyl)nicotinamide
142 N-((1r,4r)-4-(3- 291.2 >100
aminopropanamido)cyclohexyl)nicotinamide
143 N-((1r,4r)-4-aminocyclohexyl)nicotinamide 220.2 >100
144 N-(1-(1-(L-alanyl)piperidin-4- 306.2 >100
yl)ethyl)pyrimidine-2-carboxamide
145 N-((1r,4r)-4-(3- 292.2 >100
aminopropanamido)cyclohexyl)pyrimidine-
2-carboxamide
146 N-(1-(1-(L-alanyl)piperidin-4- 348.2 >100
yl)ethyl)benzo[d][1,3]dioxole-5-carboxamide
147 N-((1r,4r)-4-(3- 334.2 98.15
aminopropanamido)cyclohexyl)benzo[d][1,3]
dioxole-5-carboxamide
148 N-((1r,4r)-4- 263.1 >100
aminocyclohexyl)benzo[d][1,3]dioxole-5-
carboxamide
149 N-(1-(1-(L-alanyl)piperidin-4-yl)ethyl)-3- 382.2 >100
(methylsulfonyl)benzamide
150 N-((1r,4r)-4-(3- 368.2 >100
aminopropanamido)cyclohexyl)-3-
(methylsulfonyl)benzamide
151 N-((1r,4r)-4-aminocyclohexyl)-3- 297.1 >100
(methylsulfonyl)benzamide
152 3-amino-N-((1r,4r)-4-(3- 307.2 >100
aminopropanamido)cyclohexyl)pyrazine-2-
carboxamide
153 3-amino-N-((1r,4r)-4- 236.2 >100
aminocyclohexyl)pyrazine-2-carboxamide
154 N-((1r,4r)-4-(3- 366.1 37.31
aminopropanamido)cyclohexyl)-[1,1β€²-
biphenyl]-4-carboxamide
155 N-((1r,4r)-4-aminocyclohexyl)-[1,1β€²- 295.1 79.21
biphenyl]-4-carboxamide
156 N-((1r,4r)-4-(3- 369.2 >100
aminopropanamido)cyclohexyl)-4-
sulfamoylbenzamide
157 N-(1-(1-(L-alanyl)piperidin-4-yl)ethyl)-5- 323.2 >100
fluoronicotinamide
158 N-((1r,4r)-4-(3- 309.2 >100
aminopropanamido)cyclohexyl)-5-
fluoronicotinamide
159 N-((1r,4r)-4-aminocyclohexyl)-5- 238.2 >100
fluoronicotinamide
160 N-((1r,4r)-4-aminocyclohexyl)-1H-indole-6- 258.2 >100
carboxamide
161 N-((1r,4r)-4-aminocyclohexyl)-1H- 259.2 >100
benzo[d]imidazole-6-carboxamide
162 N-(1-(1-(L-alanyl)piperidin-4- 355.2 >100
yl)ethyl)quinoline-2-carboxamide
163 N-((1r,4r)-4-(3- 341.2 >100
aminopropanamido)cyclohexyl)quinoline-2-
carboxamide
164 N-((1r,4r)-4-aminocyclohexyl)quinoline-2- 270.2 >100
carboxamide
165 N-((1r,4r)-4-(3- 341.2 15.52
aminopropanamido)cyclohexyl)isoquinoline-
6-carboxamide
166 N-((1r,4r)-4-aminocyclohexyl)isoquinoline- 270.2 20.7
6-carboxamide
167 N-(1-(1-(L-alanyl)piperidin-4-yl)ethyl)-2- 357.3 >100
(1H-indol-3-yl)acetamide
168 N-((1r,4r)-4-aminocyclohexy l)-2-(1H-indol- 272.2 >100
3-yl)acetamide
169 3-amino-N-((1r,4r)-4-(2-(6- 398.3 >100
methoxynaphthalen-2-
yl)propanamido)cyclohexyl)propanamide
170 N-((1r,4r)-4-aminocyclohexyl)-2-(6- 327.3 76.38
methoxynaphthalen-2-yl)propanamide
171 N-(1-(1-(L-alanyl)piperidin-4- 355.3 >100
yl)ethyl)isoquinoline-1-carboxamide
172 N-((1r,4r)-4-aminocyclohexyl)-1H-indazole- 259 >100
3-carboxamide
173 N-((1r,4r)-4-(3- 259.3 0.11
aminobutanamido)cyclohexyl)-2-
oxoindoline-5-carboxamide
174 N-((1r,4r)-4-(2-aminoacetamido)cyclohexyl)- 331.2 0.63
2-oxoindoline-5-carboxamide
175 N-((1r,4r)-4-(2- 345.3 0.42
aminopropanamido)cyclohexyl)-2-
oxoindoline-5-carboxamide
176 N-((1-(L-alanyl)-4-methylpiperidin-4- 359.1 3.52
yl)methyl)-2-oxoindoline-5-carboxamide
177 N-(((R)-1-(D-alanyl)pyrrolidin-3-yl)methyl)- 331.15 19.78
2-oxoindoline-5-carboxamide
178 N-(4-(3-amino-N- 359.3 3.4
methylpropanamido)cyclohexyl)-2-
oxoindoline-5-carboxamide
179 N-(1-(1-(L-alanyl)piperidin-4-yl)ethyl)-4-(5- 386.2 >100
methyl-1,2,4-oxadiazol-3-yl)benzamide
180 N-(1-(1-(L-alanyl)piperidin-4-yl)ethyl)-3,5- 322.3 >100
dimethyl-1H-pyrazole-4-carboxamide
181 N-((1r,4r)-4-(3- 308.2 >100
aminopropanamido)cyclohexyl)-3,5-
dimethyl-1H-pyrazole-4-carboxamide
182 N-((1r,4r)-4-aminocyclohexyl)-3,5-dimethyl- 237.1 >100
1H-pyrazole-4-carboxamide
183 N-(1-(1-(L-alanyl)piperidin-4-yl)ethyl)-2- 320.2 >100
methylpyrimidine-5-carboxamide
184 N-((1r,4r)-4-(3- 306.3 35.78
aminopropanamido)cyclohexyl)-2-
methylpyrimidine-5-carboxamide
185 N-(1-(1-(L-alanyl)piperidin-4-yl)ethyl)-5- 320.3 >100
methylpyrazine-2-carboxamide
186 N-((1r,4r)-4-aminocyclohexyl)-5- 235.2 >100
methylpyrazine-2-carboxamide
187 N-(1-(1-(L-alanyl)piperidin-4-yl)ethyl)-2- 320.3 >100
aminoisonicotinamide
188 N-(1-(1-(L-alanyl)piperidin-4-yl)ethyl)-3- 321.2 >100
aminopyrazine-2-carboxamide
189 N-(1-(1-(L-alanyl)piperidin-4-yl)ethyl)-[1,1β€²- 380.3 >100
biphenyl]-4-carboxamide
190 N-((1r,4r)-4-aminocyclohexyl)-4- 298.2 >100
sulfamoylbenzamide
191 N-(1-(1-(L-alanyl)piperidin-4-yl)ethyl)-6- 322.2 >100
hydroxypyridazine-3-carboxamide
192 N-((1r,4r)-4-aminocyclohexyl)-1H-indole-5- 258.2 >100
carboxamide
193 N-(1-(1-(L-alanyl)piperidin-4-yl)ethyl)-1H- 344.3 >100
benzo[d]imidazole-6-carboxamide
194 N-(1-(1-(L-alanyl)piperidin-4- 355.2 >100
yl)ethyl)isoquinoline-6-carboxamide
195 N-((1r,4r)-4-(2-(1H-indol-3- 343.2 >100
yl)acetamido)cyclohexyl)-3-
aminopropanamide
196 N-((1r,4r)-4-(3- 341.2 >100
aminopropanamido)cyclohexyl)isoquinoline-
1-carboxamide
197 N-((1r,4r)-4-aminocyclohexyl)isoquinoline- 270.2 >100
1-carboxamide
198 N-(1-(1-(L-alanyl)piperidin-4-yl)ethyl)-5- 361.2 41.66
fluoro-1H-indole-2-carboxamide
199 N-(1-(1-(L-alanyl)piperidin-4-yl)ethyl)-2- 371.3 >100
hydroxyquinoline-4-carboxamide
200 N-((1r,4r)-4-(3- 357.2 23.31
aminopropanamido)cyclohexyl)-2-
hydroxyquinoline-4-carboxamide
201 N-((1r,4r)-4-aminocyclohexyl)-2- 286.2 >100
hydroxyquinoline-4-carboxamide
202 N-(1-(1-(L-alanyl)piperidin-4-yl)ethyl)- 358.3 59
5,6,7,8-tetrahydronaphthalene-2-carboxamide
203 N-((1r,4r)-4-(3- 344.2 11.21
aminopropanamido)cyclohexyl)-5,6,7,8-
tetrahydronaphthalene-2-carboxamide
204 N-((1r,4r)-4-aminocyclohexyl)-5,6,7,8- 273.2 47.43
tetrahydronaphthalene-2-carboxamide
205 N-(1-(1-(L-alanyl)piperidin-4- 306.3 >100
yl)ethyl)pyrazine-2-carboxamide
206 N-(1-(1-(L-alanyl)piperidin-4-yl)ethyl)-2-(4- 336.2 >100
fluorophenyl)acetamide
207 3-amino-N-((1r,4r)-4-(2-(4- 322.2 >100
fluorophenyl)acetamido)cyclohexyl)propanamide
208 N-((1r,4r)-4-aminocyclohexyl)-2-(4- 251.2 >100
fluorophenyl)acetamide
209 4-((1-(1-(L-alanyl)piperidin-4- 321.2 >100
yl)ethyl)carbamoyl)pyridine 1-oxide
210 4-(((1r,4r)-4- 236.2 >100
aminocyclohexyl)carbamoyl)pyridine 1-
oxide
211 4-amino-N-((1r,4r)-4- 285.15 43.73
aminocyclohexyl)quinoline-6-carboxamide
212 N-(1-(1-(L-alanyl)piperidin-4-yl)ethyl)-4- 370.3 15.16
aminoquinoline-6-carboxamide
213 (R)-2-oxo-N-(pyrrolidin-3- 260.15 17.95
ylmethyl)indoline-5-carboxamide
214 N-(4-(2-amino-N- 345.3 1.25
methylacetamido)cyclohexyl)-2-oxoindoline-
5-carboxamide
215 N-((1r,4r)-4-(3- 306.1 >100
aminopropanamido)cyclohexyl)-5-
methylpyrazine-2-carboxamide
216 N-(1-(1-(L-alanyl)piperidin-4-yl)ethyl)-2-(4- 428.2 >100
bromo-3,5-dimethyl-1H-pyrazol-1-
yl)propanamide
217 N-(1-(1-(L-alanyl)piperidin-4-yl)ethyl)-5- 385.3 >100
methyl-1-phenyl-1H-1,2,3-triazole-4-
carboxamide
218 N-(1-(1-(L-alanyl)piperidin-4-yl)ethyl)-4-(3- 400.3 76.96
methyl-5-oxo-4,5-dihydro-1H-pyrazol-1-
yl)benzamide
219 N-(1-(1-(L-alanyl)piperidin-4-yl)ethyl)-1- 358.2 >100
methyl-1H-indazole-6-carboxamide
220 N-(1-(1-(L-alanyl)piperidin-4-yl)ethyl)-6- 384.2 >100
methoxy-2-naphthamide
221 N-(1-(1-(L-alanyl)piperidin-4-yl)ethyl)-2- 385.1 >100
methoxyquinoline-4-carboxamide
222 N-((1r,4r)-4-(3- 371 >100
aminopropanamido)cyclohexyl)-2-
methoxyquinoline-4-carboxamide
223 N-((1r,4r)-4-aminocyclohexyl)-2- 300 >100
methoxyquinoline-4-carboxamide
224 N-(1-(1-(L-alanyl)piperidin-4-yl)ethyl)-4- 372.2 >100
oxo-4H-chromene-2-carboxamide
225 N-(1-(1-(L-alanyl)piperidin-4-yl)ethyl)-4- 371.2 >100
hydroxyquinoline-2-carboxamide
226 N-(1-(1-(L-alanyl)piperidin-4-yl)ethyl)-4- 371.2 >100
(4H-1,2,4-triazol-4-yl)benzamide
227 N-(1-(1-(L-alanyl)piperidin-4-yl)ethyl)-4- 373.3 29.17
(pyrrolidin-1-yl)benzamide
228 N-(1-(1-(L-alanyl)piperidin-4- 361.2 >100
yl)ethyl)benzo[d]thiazole-6-carboxamide
229 N-(1-(1-(L-alanyl)piperidin-4-yl)ethyl)-5- 377.2 77.9
chloro-1H-indole-2-carboxamide
230 N-((1r,4r)-4-(3- 363.1 37.47
aminopropanamido)cyclohexyl)-5-chloro-
1H-indole-2-carboxamide
231 N-((1r,4r)-4-aminocyclohexyl)-5-chloro-1H- 292.1 91.53
indole-2-carboxamide
232 N-(1-(1-(L-alanyl)piperidin-4-yl)ethyl)-1H- 343.3 >100
indole-2-carboxamide
233 N-((1r,4r)-4-(3- 329.3 >100
aminopropanamido)cyclohexyl)-1H-indole-
2-carboxamide
234 N-((1r,4r)-4-aminocyclohexyl)-1H-indole-2- 258.2 >100
carboxamide
235 N-((1r,4r)-4-(3- 329.2 13.44
aminopropanamido)cyclohexyl)-1H-indole-
5-carboxamide
236 5-((1-(1-(L-alanyl)piperidin-4- 362.2 >100
yl)ethyl)carbamoyl)benzo[c][1,2,5]oxadiazole
1-oxide
237 N-(1-(1-(L-alanyl)piperidin-4- 346.2 >100
yl)ethyl)benzo[c][1,2,5]oxadiazole-5-
carboxamide
238 N-(1-(1-(L-alanyl)piperidin-4- 356.3 >100
yl)ethyl)quinoxaline-2-carboxamide
239 N-(1-(1-(L-alanyl)piperidin-4- 350.2 >100
yl)ethyl)imidazo[2,1-b]thiazole-6-
carboxamide
241 N-(1-(1-(L-alanyl)piperidin-4-yl)ethyl)-4- 336.3 82.88
(1H-imidazol-1-yl)butanamide
242 N-((1r,4r)-4-aminocyclohexyl)-5-fluoro-1H- 276 >100
indole-2-carboxamide
243 N-(1-(1-(L-alanyl)piperidin-4-yl)ethyl)-1H- 344.2 72.93
benzo[d]imidazole-2-carboxamide
244 N-(1-(1-(L-alanyl)piperidin-4-yl)ethyl)-1- 357.2 >100
methyl-1H-indole-2-carboxamide
245 N-((1r,4r)-4-(3- 343.3 >100
aminopropanamido)cyclohexyl)-1-methyl-
1H-indole-2-carboxamide
246 N-((1r,4r)-4-aminocyclohexyl)-1-methyl-1H- 272.2 >100
indole-2-carboxamide
247 N-(1-(1-(L-alanyl)piperidin-4-yl)ethyl)-4- 320.2 >100
aminonicotinamide
248 N-(1-(1-(L-alanyl)piperidin-4-yl)ethyl)-1H- 343.3 >100
indole-4-carboxamide
249 N-(1-(1-(L-alanyl)piperidin-4-yl)ethyl)-2- 321.2 65.86
hydroxyisonicotinamide
250 N-(1-(1-(L-alanyl)piperidin-4-yl)ethyl)-2- 321.2 >100
hydroxyisonicotinamide
251 N-((1r,4r)-4-aminocyclohexyl)picolinamide 220.1 >100
252 N-((1r,4r)-4-(3- 292.1 37.36
aminopropanamido)cyclohexyl)pyrazine-2-
carboxamide
253 N-(1-(1-(L-alanyl)piperidin-4-yl)ethyl)-1- 308.2 64.91
methyl-1H-imidazole-2-carboxamide
254 N-(1-(1-(L-alanyl)piperidin-4-yl)ethyl)-3- 319.3 >100
methylisonicotinamide
255 N-(1-(1-(L-alanyl)piperidin-4-yl)ethyl)-4- 319.3 73.38
methylnicotinamide
256 N-(1-(1-(L-alanyl)piperidin-4-yl)ethyl)-5- 319.3 61.59
methylnicotinamide
257 N-(1-(1-(L-alanyl)piperidin-4-yl)ethyl)-6- 319.3 >100
methylnicotinamide
258 N-(1-(1-(L-alanyl)piperidin-4-yl)ethyl)-3- 325.3 >100
methylisothiazole-4-carboxamide
259 N-(1-(1-(L-alanyl)piperidin-4-yl)ethyl)-1- 308.3 >100
methyl-1H-pyrazole-3-carboxamide
260 N-(1-(1-(L-alanyl)piperidin-4-yl)ethyl)-3- 364.3 >100
(tert-butyl)-1-methyl-1H-pyrazole-5-
carboxamide
261 N-(1-(1-(L-alanyl)piperidin-4-yl)ethyl)-6- 336.2 >100
methoxypyrazine-2-carboxamide
262 (1r,4S)-N-(1-(1-(L-alanyl)piperidin-4- 325.2 >100
yl)ethyl)-4-aminocyclohexane-1-
carboxamide
263 N-(1-(1-(L-alanyl)piperidin-4-yl)ethyl)-4- 406.2 >100
chloro-2-(trifluoromethyl)benzamide
264 4-(((1r,4r)-4-(3- 307.2 >100
aminopropanamido)cyclohexyl)carbamoyl)pyridine
1-oxide
265 N-(1-(1-(L-alanyl)piperidin-4-yl)ethyl)-6- 323.2 >100
fluoropicolinamide
266 N-(1-(1-(L-alanyl)piperidin-4-yl)ethyl)-2,2- 384.3 >100
difluorobenzo[d][1,3]dioxole-4-carboxamide
267 N-(1-(1-(L-alanyl)piperidin-4-yl)ethyl)-3- 323.2 >100
fluoroisonicotinamide
268 N-(1-(1-(L-alanyl)piperidin-4-yl)ethyl)-1H- 343.3 >100
indole-3-carboxamide
269 N-((1r,4r)-4-aminocyclohexyl)pyrimidine-2- 221.1 >100
carboxamide
270 N-((1r,4r)-4-(3- 308.2 >100
aminopropanamido)cyclohexyl)-6-
hydroxypyridazine-3-carboxamide
271 N-((1r,4r)-4-aminocyclohexyl)-6- 237.2 >100
hydroxypyridazine-3-carboxamide
272 N-((1r,4r)-4-(3- 329.2 37.25
aminopropanamido)cyclohexyl)-1H-indole-
6-carboxamide
273 N-((1r,4r)-4-aminocyclohexyl)-5-methyl-1- 300.1 >100
phenyl-1H-1,2,3-triazole-4-carboxamide
274 N-(1-(1-(L-alanyl)piperidin-4-yl)ethyl)-4,6- 349.3 >100
dimethyl-2-oxo-1,2-dihydropyridine-3-
carboxamide
275 N-((1r,4r)-4-aminocyclohexyl)-1-methyl-1H- 273 >100
indazole-6-carboxamide
276 N-((1r,4r)-4-aminocyclohexyl)-6-methoxy-2- 299.1 >100
naphthamide
277 N-((1r,4r)-4-aminocyclohexyl)-4-oxo-4H- 287 >100
chromene-2-carboxamide
278 N-((1r,4r)-4-aminocyclohexyl)-4-(4H-1,2,4- 286 >100
triazol-4-yl)benzamide
279 N-((1r,4r)-4-(3- 359.1 43.65
aminopropanamido)cyclohexyl)-4-
(pyrrolidin-1-yl)benzamide
280 N-((1r,4r)-4-aminocyclohexyl)-4-(pyrrolidin- 288.1 48.03
1-yl)benzamide
281 N-((1r,4r)-4-(3- 347 28.96
aminopropanamido)cyclohexyl)benzo[d]thiazole-
6-carboxamide
283 N-(1-(1-(L-alanyl)piperidin-4-yl)ethyl)-1H- 343.2 >100
indole-5-carboxamide
284 N-(1-(1-(L-alanyl)piperidin-4-yl)ethyl)-2,2- 384.2 >100
difluorobenzo[d][1,3]dioxole-5-carboxamide
285 N-((1r,4r)-4-aminocyclohexyl)-2,2- 299.2 69.12
difluorobenzo[d][1,3]dioxole-5-carboxamide
286 5-(((1r,4r)-4- 277.1 >100
aminocyclohexyl)carbamoyl)benzo[c][1,2,5]
oxadiazole 1-oxide
287 N-((1r,4r)-4- 261 >100
aminocyclohexyl)benzo[c][1,2,5]oxadiazole-
5-carboxamide
288 4-amino-N-((1r,4r)-4-(3- 306.1 >100
aminopropanamido)cyclohexyl)nicotinamide
289 4-amino-N-((1r,4r)-4- 235.2 >100
aminocyclohexyl)nicotinamide
290 N-((1r,4r)-4-(3- 329.2 >100
aminopropanamido)cyclohexyl)-1H-indole-
4-carboxamide
291 N-((1r,4r)-4-aminocyclohexyl)-1H-indole-4- 258.2 >100
carboxamide
292 N-((1r,4r)-4-aminocyclohexyl)-2- 236.2 >100
hydroxyisonicotinamide
293 N-((1r,4r)-4-aminocyclohexyl)-2- 236.1 >100
hydroxyisonicotinamide
294 N-((1r,4r)-4-(3- 307.2 >100
aminopropanamido)cyclohexyl)-6-
hydroxynicotinamide
295 N-((1r,4r)-4-aminocyclohexyl)-6- 236.2 >100
hydroxynicotinamide
296 N-(1-(1-(L-alanyl)piperidin-4- 305.2 >100
yl)ethyl)picolinamide
297 N-(4-(3- 291.2 44.24
aminopropanamido)cyclohexyl)picolinamide
298 N-((1r,4r)-4-aminocyclohexyl)pyrazine-2- 221.2 >100
carboxamide
299 N-(1-(1-(L-alanyl)piperidin-4-yl)ethyl)-3- 454.3 >100
(tert-butyl)-1-(3-methylbenzyl)-1H-pyrazole-
5-carboxamide
300 N-(1-(1-(L-alanyl)piperidin-4-yl)ethyl)-7- 357.2 >100
methyl-1H-indole-2-carboxamide
301 N-(1-(1-(L-alanyl)piperidin-4-yl)ethyl)-6- 335.2 >100
methoxypicolinamide
302 N-(1-(1-(L-alanyl)piperidin-4-yl)ethyl)-5- 336.2 >100
methoxypyrazine-2-carboxamide
303 (1r,4r)-4-amino-N-((1r,4r)-4-(3- 311.2 >100
aminopropanamido)cyclohexyl)cyclohexane-
1-carboxamide
304 (1r,4r)-4-amino-N-((1r,4r)-4- 240.1 >100
aminocyclohexyl)cyclohexane-1-
carboxamide
305 (2S,4S)-N-(1-(1-(L-alanyl)piperidin-4- 315.2 55.92
yl)ethyl)-4-fluoropyrrolidine-2-carboxamide
306 (3R)-N-(1-(1-(L-alanyl)piperidin-4-yl)ethyl)- 359.3 48.06
1,2,3,4-tetrahydroisoquinoline-3-
carboxamide
307 N-((1r,4r)-4-aminocyclohexyl)-2,2- 299 >100
difluorobenzo[d][1,3]dioxole-4-carboxamide
308 N-((1r,4r)-4-aminocyclohexyl)-3- 238.2 >100
fluoroisonicotinamide
309 N-(1-(1-(L-alanyl)piperidin-4- 311.2 >100
yl)ethyl)thiazole-5-carboxamide
310 N-(1-(1-(L-alanyl)piperidin-4-yl)ethyl)-5- 321.2 >100
hydroxypicolinamide
311 N-(1-(1-(L-alanyl)piperidin-4-yl)ethyl)-6- 324.2 >100
oxo-1,4,5,6-tetrahydropyridazine-3-
carboxamide
312 N-(1-(1-(L-alanyl)piperidin-4-yl)ethyl)-1H- 344.2 >100
indazole-3-carboxamide
313 N-(1-(1-(L-alanyl)piperidin-4-yl)ethyl)-2- 354.2 70.71
(3,5-difluorophenyl)acetamide
314 N-(1-(1-(L-alanyl)piperidin-4-yl)ethyl)-2- 319.2 >100
(pyridin-3-yl)acetamide
315 N-(1-(1-(L-alanyl)piperidin-4-yl)ethyl)-2- 320.3 >100
(pyrimidin-5-yl)acetamide
316 N-(1-(1-(L-alanyl)piperidin-4-yl)ethyl)-2- 308.2 >100
(1H-imidazol-1-yl)acetamide
317 N-((1r,4r)-4-(3- 336 >100
aminopropanamido)cyclohexyl)imidazo[2,1-
b]thiazole-6-carboxamide
318 N-((1r,4r)-4-aminocyclohexyl)imidazo[2,1- 265 >100
b]thiazole-6-carboxamide
319 N-((1r,4r)-4-aminocyclohexyl)imidazo[2,1- 265.2 >100
b]thiazole-6-carboxamide
320 N-((1r,4r)-4-aminocyclohexyl)-2- 235.1 >100
methylpyrimidine-5-carboxamide
321 2-amino-N-((1r,4r)-4-(3- 306.2 16.59
aminopropanamido)cyclohexyl)isonicotinamide
322 2-amino-N-((1r,4r)-4- 235.1 >100
aminocyclohexyl)isonicotinamide
323 N-(1-(1-(L-alanyl)piperidin-4-yl)ethyl)-4- 383 >100
sulfamoylbenzamide
324 N-((1r,4r)-4-aminocyclohexyl)-4,6-dimethyl- 264.1 >100
2-oxo-1,2-dihydropyridine-3-carboxamide
325 N-((1r,4r)-4-(3- 344.3 >100
aminopropanamido)cyclohexyl)-1-methyl-
1H-indazole-6-carboxamide
326 N-((1r,4r)-4-(3- 370.3 28
aminopropanamido)cyclohexyl)-6-methoxy-
2-naphthamide
327 N-((1r,4r)-4-(3- 358.2 >100
aminopropanamido)cyclohexyl)-4-oxo-4H-
chromene-2-carboxamide
328 N-((1r,4r)-4-aminocyclohexyl)-4- 286.2 >100
hydroxyquinoline-2-carboxamide
329 N-((1r,4r)-4-(3- 357.3 >100
aminopropanamido)cyclohexyl)-4-(4H-1,2,4-
triazol-4-yl)benzamide
330 N-((1r,4r)-4-(3- 370.2 7.49
aminopropanamido)cyclohexyl)-2,2-
difluorobenzo[d][1,3]dioxole-5-carboxamide
331 5-(((1r,4r)-4-(3- 348.2 85.12
aminopropanamido)cyclohexyl)car-
bamoyl)benzo[c][1,2,5]oxadiazole 1-oxide
332 N-((1r,4r)-4-(3- 332.2 >100
aminopropanamido)cyclohexyl)benzo[c][1,2,5]oxa-
diazole-5-carboxamide
333 N-((1r,4r)-4-aminocyclohexyl)-4-(1H- 251.1 >100
imidazol-1-yl)butanamide
334 N-(1-(1-(L-alanyl)piperidin-4-yl)ethyl)-2-(6- 412.3 34.86
methoxynaphthalen-2-yl)propanamide
335 N-((1r,4r)-4-(3- 347.2 >100
aminopropanamido)cyclohexyl)-5-fluoro-1H-
indole-2-carboxamide
336 N-((1r,4r)-4-aminocyclohexyl)-1H- 259.1 >100
benzo[d]imidazole-2-carboxamide
337 N-((1r,4r)-4-aminocyclohexyl)-1-methyl-1H- 223.1 >100
imidazole-2-carboxamide
338 (1r,4r)-N-(1-(1-(L-alanyl)piperidin-4- 320.3 >100
yl)ethyl)bicyclo[2.2.1]hept-5-ene-2-
carboxamide
339 N-((1r,4r)-4-aminocyclohexyl)-4- 234.1 >100
methylnicotinamide
340 N-((1r,4r)-4-(3- 440.3 >100
aminopropanamido)cyclohexyl)-3-(tert-
butyl)-1-(3-methylbenzyl)-1H-pyrazole-5-
carboxamide
341 N-((1r,4r)-4-aminocyclohexyl)-3-(tert-butyl)- 369.1 >100
1-(3-methylbenzyl)-1H-pyrazole-5-
carboxamide
342 N-((1r,4r)-4-(3- 343.2 37.68
aminopropanamido)cyclohexyl)-7-methyl-
1H-indole-2-carboxamide
343 N-((1r,4r)-4-aminocyclohexyl)-7-methyl-1H- 272.2 68.49
indole-2-carboxamide
344 N-((1r,4r)-4-(3- 305.1 36.4
aminopropanamido)cyclohexyl)-5-
methylnicotinamide
345 N-((1r,4r)-4-aminocyclohexyl)-5- 234.2 50.67
methylnicotinamide
346 N-((1r,4r)-4-aminocyclohexyl)-6- 234.1 >100
methylnicotinamide
347 N-((1r,4r)-4-(3- 311.2 >100
aminopropanamido)cyclohexyl)-3-
methylisothiazole-4-carboxamide
348 N-((1r,4r)-4-aminocyclohexyl)-3- 240.2 >100
methylisothiazole-4-carboxamide
349 N-((1r,4r)-4-(3- 294.2 >100
aminopropanamido)cyclohexyl)-1-methyl-
1H-pyrazole-3-carboxamide
350 N-((1r,4r)-4-aminocyclohexyl)-1-methyl-1H- 223.2 >100
pyrazole-3-carboxamide
351 N-((1r,4r)-4-(3- 350.3 >100
aminopropanamido)cyclohexyl)-3-(tert-
butyl)-1-methyl-1H-pyrazole-5-carboxamide
352 N-((1r,4r)-4-aminocyclohexyl)-3-(tert-butyl)- 279.3 >100
1-methyl-1H-pyrazole-5-carboxamide
353 N-((1r,4r)-4-(3- 321.2 >100
aminopropanamido)cyclohexyl)-6-
methoxypicolinamide
354 N-((1r,4r)-4-aminocyclohexyl)-6- 250.2 >100
methoxypicolinamide
355 N-((1r,4r)-4-(3- 322 >100
aminopropanamido)cyclohexyl)-6-
methoxypyrazine-2-carboxamide
356 N-((1r,4r)-4-aminocyclohexyl)-6- 251.2 >100
methoxypyrazine-2-carboxamide
357 N-(1-(1-(L-alanyl)piperidin-4-yl)ethyl)-5- 320.2 >100
aminopicolinamide
358 N-((1r,4r)-4-aminocyclohexyl)-4-chloro-2- 320.9 >100
(trifluoromethyl)benzamide
359 N-((1r,4r)-4-aminocyclohexyl)thiazole-5- 226.1 >100
carboxamide
360 N-((1r,4r)-4-aminocyclohexyl)-1H-indole-3- 258.1 >100
carboxamide
361 N-((1r,4r)-4-(3- 307.1 >100
aminopropanamido)cyclohexyl)-5-
hydroxypicolinamide
362 N-((1r,4r)-4-aminocyclohexyl)-2-(3,5- 269.2 >100
difluorophenyl)acetamide
363 3-amino-N-((1r,4r)-4-(2-(pyridin-3- 305.1 >100
yl)acetamido)cyclohexyl)propanamide
364 3-amino-N-((1r,4r)-4-(2-(pyrimidin-5- 306.2 >100
yl)acetamido)cyclohexyl)propanamide
365 N-((1r,4r)-4-aminocyclohexyl)-2-(pyrimidin- 235.2 >100
5-yl)acetamide
366 N-((1r,4r)-4-(2-(1H-imidazol-1- 294.1 >100
yl)acetamido)cyclohexyl)-3-
aminopropanamide
367 N-((1r,4r)-4- 276.1 >100
aminocyclohexyl)benzo[d]thiazole-2-
carboxamide
368 N-(1-(1-(L-alanyl)piperidin-4-yl)ethyl)-1H- 343.3 12.33
indole-6-carboxamide
369 N-((1r,4r)-4-(3- 330.1 65.22
aminopropanamido)cyclohexyl)-1H-
benzo[d]imidazole-5-carboxamide
370 N-(1-(1-(L-alanyl)piperidin-4-yl)ethyl)-4- 373.2 >100
methoxy-1H-indole-3-carboxamide
371 N-((1r,4r)-4-(3- 359.2 >100
aminopropanamido)cyclohexyl)-4-methoxy-
1H-indole-3-carboxamide
372 N-((1r,4r)-4-aminocyclohexyl)-4-methoxy- 288.1 >100
1H-indole-3-carboxamide
373 N-((1r,4r)-4-(3- 342.1 >100
aminopropanamido)cyclohexyl)quinoxaline-
2-carboxamide
374 N-((1r,4r)-4-(3- 330.3 86.56
aminopropanamido)cyclohexyl)-1H-
benzo[d]imidazole-2-carboxamide
375 N-((1r,4r)-4-(3- 322.2 >100
aminopropanamido)cyclohexyl)-4-(1H-
imidazol-1-yl)butanamide
376 N-((1r,4r)-4-(3- 307.2 >100
aminopropanamido)cyclohexyl)-2-
hydroxyisonicotinamide
378 N-(1-(1-(L-alanyl)piperidin-4-yl)ethyl)-6- 321.1 >100
hydroxynicotinamide
379 N-((1r,4r)-4-(3- 305.1 >100
aminopropanamido)cyclohexyl)-3-
methylisonicotinamide
380 N-((1r,4r)-4-aminocyclohexyl)-3- 234.1 >100
methylisonicotinamide
381 N-((1r,4r)-4-(3- 305.1 >100
aminopropanamido)cyclohexyl)-4-
methylnicotinamide
382 N-((1r,4r)-4-(3- 305.2 >100
aminopropanamido)cyclohexyl)-6-
methylnicotinamide
383 N-((1r,4r)-4-(3- 322.1 >100
aminopropanamido)cyclohexyl)-5-
methoxypyrazine-2-carboxamide
384 N-((1r,4r)-4-aminocyclohexyl)-5- 251 >100
methoxypyrazine-2-carboxamide
385 6-amino-N-((1r,4r)-4-(3- 306.2 >100
aminopropanamido)cyclohexyl)picolinamide
386 6-amino-N-((1r,4r)-4- 235.1 >100
aminocyclohexyl)picolinamide
387 N-(1-(1-(L-alanyl)piperidin-4-yl)ethyl)-6- 320.2 >100
aminonicotinamide
388 6-amino-N-((1r,4r)-4-(3- 306.2 >100
aminopropanamido)cyclohexyl)nicotinamide
389 N-((1r,4r)-4-aminocyclohexyl)-6- 238.2 >100
fluoropicolinamide
390 N-((1r,4r)-4-(3- 309.2 >100
aminopropanamido)cyclohexyl)-3-
fluoroisonicotinamide
391 N-((1r,4r)-4-(3- 329.1 >100
aminopropanamido)cyclohexyl)-1H-indole-
3-carboxamide
392 N-(1-(1-(L-alanyl)piperidin-4-yl)ethyl)-2- 319.2 >100
methylisonicotinamide
393 N-((1r,4r)-4-(3- 305.2 >100
aminopropanamido)cyclohexyl)-2-
methylisonicotinamide
394 N-((1r,4r)-4-aminocyclohexyl)-2- 234.1 >100
methylisonicotinamide
395 N-(1-(1-(L-alanyl)piperidin-4- 361.2 >100
yl)ethyl)benzo[d]thiazole-2-carboxamide
396 N-(1-(1-(L-alanyl)piperidin-4-yl)ethyl)-5- 325 10.61
methylthiazole-2-carboxamide
397 N-((1r,4r)-4-(3- 311 27.42
aminopropanamido)cyclohexyl)-5-
methylthiazole-2-carboxamide
398 N-((1r,4r)-4-aminocyclohexyl)-5- 240.1 >100
methylthiazole-2-carboxamide
399 N-(1-(1-(L-alanyl)piperidin-4-yl)ethyl)-2- 359.2 >100
oxoindoline-4-carboxamide
400 N-((1r,4r)-4-aminocyclohexyl)-2- 274.2 >100
oxoindoline-4-carboxamide
401 N-((1r,4r)-4-(3- 371.1 >100
aminopropanamido)cyclohexyl)-5-methyl-1-
phenyl-1H-1,2,3-triazole-4-carboxamide
402 N-((1r,4r)-4-(3- 335.2 >100
aminopropanamido)cyclohexyl)-4,6-
dimethyl-2-oxo-1,2-dihydropyridine-3-
carboxamide
403 N-((1r,4r)-4-aminocyclohexyl)-4-(3-methyl- 315.1 >100
5-oxo-4,5-dihydro-1H-pyrazol-1-
yl)benzamide
404 N-((1r,4r)-4-(3- 357.2 >100
aminopropanamido)cyclohexyl)-4-
hydroxyquinoline-2-carboxamide
405 N-((1r,4r)-4-aminocyclohexyl)quinoxaline-2- 271.2 >100
carboxamide
406 N-(1-(1-(L-alanyl)piperidin-4-yl)ethyl)-2- 358.2 >100
(1H-pyrrolo[3,2-b]pyridin-3-yl)acetamide
407 N-((1r,4r)-4-(2-(1H-pyrrolo[3,2-b]pyridin-3- 344.2 >100
yl)acetamido)cyclohexyl)-3-
aminopropanamide
408 N-((1r,4r)-4-aminocyclohexyl)-2-(1H- 273.2 >100
pyrrolo[3,2-b]pyridin-3-yl)acetamide
409 N-(1-(1-(L-alanyl)piperidin-4-yl)ethyl)-2- 321.2 70.41
hydroxynicotinamide
410 N-((1r,4r)-4-(3- 307.3 44.48
aminopropanamido)cyclohexyl)-2-
hydroxynicotinamide
411 N-((1r,4r)-4-aminocyclohexyl)-2- 236.2 >100
hydroxynicotinamide
412 N-((1r,4r)-4-(3- 294.1 >100
aminopropanamido)cyclohexyl)-1-methyl-
1H-imidazole-2-carboxamide
413 N-(l-(1-(L-alanyl)piperidin-4-yl)ethyl)-1- 308.1 >100
methyl-1H-pyrazole-5-carboxamide
414 N-((1r,4r)-4-(3- 294.1 >100
aminopropanamido)cyclohexyl)-1-methyl-
1H-pyrazole-5-carboxamide
415 N-((1r,4r)-4-aminocyclohexyl)-1-methyl-1H- 223.1 >100
pyrazole-5-carboxamide
416 (1R,4R)-N-((1r,4R)-4-(3- 306.1 >100
aminopropanamido)cyclohexyl)bicyclo[2.2.1]hept-
5-ene-2-carboxamide
417 (1r,4r)-N-((1r,4R)-4- 235.1 >100
aminocyclohexyl)bicyclo[2.2.1]hept-5-ene-2-
carboxamide
418 N-(1-(1-(L-alanyl)piperidin-4-yl)ethyl)-6- 320.3 >100
aminopicolinamide
419 N-(1-(1-(L-alanyl)piperidin-4-yl)ethyl)-4- 321.2 >100
aminopyrimidine-5-carboxamide
420 4-amino-N-((1r,4r)-4-(3- 307.2 >100
aminopropanamido)cyclohexyl)pyrimidine-
5-carboxamide
421 4-amino-N-((1r,4r)-4- 236.1 >100
aminocyclohexyl)pyrimidine-5-carboxamide
422 N-((1r,4r)-4-(3- 309.2 >100
aminopropanamido)cyclohexyl)-6-
fluoropicolinamide
423 N-((1r,4r)-4-aminocyclohexyl)-5- 236.2 >100
hydroxypicolinamide
424 N-((1r,4r)-4-aminocyclohexyl)-6-oxo- 239.1 >100
1,4,5,6-tetrahydropyridazine-3-carboxamide
425 N-((1r,4r)-4-(3- 330.1 37.49
aminopropanamido)cyclohexyl)-1H-
indazole-3-carboxamide
426 N-((1r,4r)-4-aminocyclohexyl)-2-(1H- 223.1 >100
imidazol-1-yl)acetamide
427 N-((1r,4r)-4-(3- 347.2 >100
aminopropanamido)cyclohexyl)benzo[d]thiazole-
2-carboxamide
428 (1r,4r)-4-amino-N-(2-oxoindolin-5- 274.1 30.6
yl)cyclohexane-1-carboxamide
429 N-((1r,4r)-4-aminocyclohexyl)-2- 310 14.5
oxoindoline-5-sulfonamide
430 N-((1r,4r)-4-(3- 345.2 >100
aminopropanamido)cyclohexyl)-2-
oxoindoline-4-carboxamide
431 3-amino-N-((1r,4r)-4-(2-(4-bromo-3,5- >100
dimethyl-1H-pyrazol-1-
yl)propanamido)cyclohexyl)propanamide
432 N-((1r,4r)-4-(3- 386.3 36.97
aminopropanamido)cyclohexyl)-4-(3-methyl-
5-oxo-4,5-dihydro-1H-pyrazol-1-
yl)benzamide
433 (2R,4S)-N-(1-(1-(L-alanyl)piperidin-4- 313.2 45.65
yl)ethyl)-4-hydroxypyrrolidine-2-
carboxamide
434 (2R,4S)-N-((1r,4r)-4-(3- 299.2 >100
aminopropanamido)cyclohexyl)-4-
hydroxypyrrolidine-2-carboxamide
435 (2R,4S)-N-((1r,4r)-4-aminocyclohexyl)-4- 228.1 >100
hydroxypyrrolidine-2-carboxamide
436 (R)-N-((1r,4r)-4-aminocyclohexyl)-1,2,3,4- 274.1 12.51
tetrahydroquinoline-2-carboxamide
437 5-amino-N-((1r,4r)-4-(3- 306.2 >100
aminopropanamido)cyclohexyl)picolinamide
438 5-amino-N-((1r,4r)-4- 235.2 >100
aminocyclohexyl)picolinamide
439 N-((1r,4r)-4-(3- 392.2 >100
aminopropanamido)cyclohexyl)-4-chloro-2-
(trifluoromethyl)benzamide
440 N-((1r,4r)-4-(3- 370.2 >100
aminopropanamido)cyclohexyl)-2,2-
difluorobenzo[d][1,3]dioxole-4-carboxamide
441 N-(1-(1-(L-alanyl)piperidin-4-yl)ethyl)-3,5- 386.1 37.45
dihydroxy-2-naphthamide
442 N-((1r,4r)-4-(3- 297.2 >100
aminopropanamido)cyclohexyl)thiazole-5-
carboxamide
443 3-amino-N-((1r,4r)-4-(2-(3,5- 340.2 >100
difluorophenyl)acetamido)cyclo-
hexyl)propanamide
444 5-acetamido-N-((1r,4r)-4- 277 >100
aminocyclohexyl)picolinamide
445 N-(1-(1-(L-alanyl)piperidin-4- 345 >100
yl)ethyl)imidazo[1,2-b]pyridazine-2-
carboxamide
446 N-((1r,4r)-4-(3- 331.1 >100
aminopropanamido)cyclohexyl)imidazo[1,2-
b]pyridazine-2-carboxamide
447 N-((1r,4r)-4-aminocyclohexyl)imidazo[1,2- 260 >100
b]pyridazine-2-carboxamide
448 N-((1r,4r)-4-aminocyclohexyl)-2-(2- 288.2 >100
oxoindolin-5-yl)acetamide
449 3-amino-N-((1r,4r)-4-((2-oxoindoline)-5- 381.1 >100
sulfonamido)cyclohexyl)propanamide
450 N-(1-(1-(L-alanyl)piperidin-4-yl)ethyl)-2- 389.2 25.37
methyl-3-oxo-3,4-dihydro-2H-
benzo[b][1,4]oxazine-6-carboxamide
451 N-((1r,4r)-4-(3- 375.2 9.9
aminopropanamido)cyclohexyl)-2-methyl-3-
oxo-3,4-dihydro-2H-benzo[b][1,4]oxazine-6-
carboxamide
452 N-((1r,4r)-4-aminocyclohexyl)-2-methyl-3- 304.2 39.15
oxo-3,4-dihydro-2H-benzo[b][1,4]oxazine-6-
carboxamide
453 N-((1r,4r)-4-((R)-3- 359.2 0.26 >40
aminobutanamido)cyclohexyl)-2-
oxoindoline-5-carboxamide
454 N-((1r,4r)-4-aminocyclohexyl)-2-(4-bromo- 342.9 >100
3,5-dimethyl-1H-pyrazol-1-yl)propanamide
455 N-((1r,4r)-4-aminocyclohexyl)-4-(1H-1,2,4- 286.2 >100
triazol-1-yl)benzamide
456 N-((1r,4r)-4-(3- 357.2 21.97
aminopropanamido)cyclohexyl)-2-
hydroxyquinoline-3-carboxamide
457 N-((1r,4r)-4-aminocyclohexyl)-2-(3- 301 >100
(trifluoromethyl)phenyl)acetamide
458 3-amino-N-((1r,4r)-4-aminocyclohexyl)-2- 299.1 >100
methylquinoline-4-carboxamide
459 (3R)-N-(4-aminocyclohexyl)-1,2,3,4- 274.1 >100
tetrahydroisoquinoline-3-carboxamide
460 N-((1r,4r)-4-aminocyclohexyl)-3,5- 301 20.71
dihydroxy-2-naphthamide
461 5-(2-(piperidin-4-yl)acetyl)octahydro-2H- 266.1 >100
pyrrolo[3,2-c]pyridin-2-one
462 N-(1-(1-(L-alanyl)piperidin-4-yl)ethyl)-5- 362.1 >100
acetamidopicolinamide
463 5-acetamido-N-((1r,4r)-4-(3- 348 >100
aminopropanamido)cyclohexyl)picolinamide
464 N-(1-(1-(L-alanyl)piperidin-4-yl)ethyl)-5- 336.2 32.68
cyclopropyl-1,2,4-oxadiazole-3-carboxamide
465 3-amino-N-((1r,4r)-4-(2-(2-oxoindolin-5- 359.2 38.81
yl)acetamido)cyclohexyl)propanamide
466 N-(1-(1-(L-alanyl)piperidin-4-yl)ethyl)-2-(2- 373.2 60
oxoindolin-5-yl)acetamide
467 (1r,4r)-4-(3-aminopropanamido)-N-(2- 345 4.46
oxoindolin-5-yl)cyclohexane-1-carboxamide
468 3-amino-N-(2,2-dimethyl-3-((2-oxoindoline)- 369.2 18.32
5-sulfonamido)propyl)propanamide
469 N-(1-(1-(L-alanyl)piperidin-4-yl)ethyl)-1- 359.2 >100
oxoisoindoline-5-carboxamide
470 N-((1r,4r)-4-aminocyclohexyl)-2,3- 288 7.46
dioxoindoline-5-carboxamide
471 N-((1r,4r)-4-(3- 345.2 0.61
aminopropanamido)cyclohexyl)-2-
oxoindoline-5-carboxamide
472 N-(1-(1-(L-alanyl)piperidin-4-yl)ethyl)-4- 371.3 >100
(1H-1,2,4-triazol-1-yl)benzamide
473 N-((1r,4r)-4-(3- 357.2 53.11
aminopropanamido)cyclohexyl)-4-(1H-1,2,4-
triazol-1-yl)benzamide
474 N-(1-(1-(L-alanyl)piperidin-4-yl)ethyl)-2- 371.2 22.09
hydroxyquinoline-3-carboxamide
475 N-((1r,4r)-4-aminocyclohexyl)-2- 286.2 22.16
hydroxyquinoline-3-carboxamide
476 N-(1-(1-(L-alanyl)piperidin-4-yl)ethyl)-2-(3- 386.1 51.13
(trifluoromethyl)phenyl)acetamide
477 3-amino-N-((1r,4r)-4-(2-(3- 372 22.78
(trifluoromethyl)phenyl)acetamido)cyclo-
hexyl)propanamide
478 3-amino-N-((1r,4r)-4-(3- 370.2 31.62
aminopropanamido)cyclohexyl)-2-
methylquinoline-4-carboxamide
479 N-((1r,4r)-4-(3- 372 5.02
aminopropanamido)cyclohexyl)-3,5-
dihydroxy-2-naphthamide
480 N-((1r,4r)-4-aminocyclohexyl)-3- 236.2 >100
hydroxypicolinamide
481 N-((1r,4r)-4-(3- 310.2 15.1
aminopropanamido)cyclohexyl)-6-oxo-
1,4,5,6-tetrahydropyridazine-3-carboxamide
482 (E)-N-((1r,4r)-4-(3- 306.1 71.06
aminopropanamido)cyclohexyl)-3-(1H-
imidazol-4-yl)acrylamide
483 5-(2-(1-(3-aminopropanoyl)piperidin-4- 337.2 10.25
yl)acetyl)octahydro-2H-pyrrolo[3,2-
c]pyridin-2-one
484 N-((1r,4r)-4-aminocyclohexyl)-5- 251.1 85.66
cyclopropyl-1,2,4-oxadiazole-3-carboxamide
485 N-((1r,4r)-4-(3- 322.1 12.92
aminopropanamido)cyclohexyl)-5-
cyclopropyl-1,2,4-oxadiazole-3-carboxamide
486 2-amino-N-(2,2-dimethyl-3-((2-oxoindoline)- 355 18.82
5-sulfonamido)propyl)acetamide
487 N-((1r,4r)-4-aminocyclohexyl)-1- 274.1 37.89
oxoisoindoline-5-carboxamide
488 N-(1-(1-(L-alanyl)piperidin-4-yl)ethyl)-2,3- 373.1 14.08
dioxoindoline-5-carboxamide
489 N-(1-(1-(L-alanyl)piperidin-4-yl)ethyl)-3- 384.3 31.62
amino-2-methylquinoline-4-carboxamide
490 N-(1-(1-(L-alanyl)piperidin-4-yl)ethyl)-6- 393.2 0.43 >40
chloro-2-oxoindoline-5-carboxamide
491 N-((1r,4r)-4-(3- 379.2 0.15 >40
aminopropanamido)cyclohexyl)-6-chloro-2-
oxoindoline-5-carboxamide
492 N-((1r,4r)-4-aminocyclohexyl)-6-chloro-2- 308.1 1.59
oxoindoline-5-carboxamide
493 N-((1r,4r)-4-aminocyclohexyl)-4- 237.1 >50
hydroxypyrimidine-5-carboxamide
494 (E)-N-(1-(1-(L-alanyl)piperidin-4-yl)ethyl)- 320.2 >100
3-(1H-imidazol-4-yl)acrylamide
495 (E)-N-((1r,4r)-4-aminocyclohexyl)-3-(1H- 235.1 >100
imidazol-4-yl)acrylamide
496 N-(1-(1-(L-alanyl)piperidin-4-yl)ethyl)-1H- 345.2 6.57
pyrazolo[3,4-c]pyridine-5-carboxamide
497 N-((1r,4r)-4-aminocyclohexyl)-1H- 260 35.73
pyrazolo[3,4-c]pyridine-5-carboxamide
498 N-(1-(1-(L-alanyl)piperidin-4-yl)ethyl)-6- 379 51
fluorobenzo[d]thiazole-2-carboxamide
499 N-((1r,4r)-4-(3- 365.2 86.27
aminopropanamido)cyclohexyl)-6-
fluorobenzo[d]thiazole-2-carboxamide
500 N-((1r,4r)-4-aminocyclohexyl)-6- 294.1 >100
fluorobenzo[d]thiazole-2-carboxamide
501 1-(2-amino-2-oxoethyl)-N-((1r,4r)-4- 267.2 50
aminocyclohexyl)-1H-1,2,3-triazole-4-
carboxamide
502 N-((1r,4r)-4-aminocyclohexyl)-1H- 209.1 >100
imidazole-2-carboxamide
503 N-((1r,4r)-4-(3- 345.2 >100
aminopropanamido)cyclohexyl)-1-
oxoisoindoline-5-carboxamide
504 N-((1r,4r)-4-(3- 359 5.38
aminopropanamido)cyclohexyl)-2,3-
dioxoindoline-5-carboxamide
505 N-((1r,4r)-4-(3- 345.2 16.1
aminopropanamido)cyclohexyl)-2-
oxoindoline-7-carboxamide
506 N-(4-aminocyclohexyl)-2-oxoindoline-7- 274.2 42.25
carboxamide
507 N-((1r,4r)-4-aminocyclohexyl)-1-methyl-1H- 224.2 >100
1,2,4-triazole-5-carboxamide
508 3-amino-N-((1r,4r)-4-aminocyclohexyl)-1H- 225 >50
1,2,4-triazole-5-carboxamide
509 N-(1-(1-(L-alanyl)piperidin-4-yl)ethyl)-4- 322.1 >50
hydroxypyrimidine-5-carboxamide
510 N-((1r,4r)-4-(3- 308.1 >50
aminopropanamido)cyclohexyl)-4-
hydroxypyrimidine-5-carboxamide
511 N-(1-(1-(L-alanyl)piperidin-4-yl)ethyl)-3- 321.1 >50
hydroxypicolinamide
512 N-((1r,4r)-4-(3- 307 >50
aminopropanamido)cyclohexyl)-3-
hydroxypicolinamide
513 N-(1-(1-(L-alanyl)piperidin-4-yl)ethyl)-5- 321.2 >50
hydroxynicotinamide
514 N-((1r,4r)-4-(3- 307.1 >50
aminopropanamido)cyclohexyl)-5-
hydroxynicotinamide
515 N-((1r,4r)-4-aminocyclohexyl)-5- 236.1 >50
hydroxynicotinamide
516 1-(2-amino-2-oxoethyl)-N-((1r,4r)-4-(3- 338.2 >50
aminopropanamido)cyclohexyl)-1H-1,2,3-
triazole-4-carboxamide
517 N-(4-aminocyclohexyl)-1H-imidazole-4- 209.2 >50
carboxamide
518 N-(4-(3-aminopropanamido)cyclohexyl)-1H- 280.2 >50
imidazole-2-carboxamide
519 N-((1r,4r)-4-(3- 343.2 >50
aminopropanamido)cyclohexyl)-2-methyl-
1H-indole-5-carboxamide
520 N-((1r,4r)-4-aminocyclohexyl)-2-methyl-1H- 272.2 >50
indole-5-carboxamide
521 N-((1r,4r)-4-aminocyclohexyl)-1H- 209.2 >50
imidazole-4-carboxamide
522 N-((1r,4r)-4-aminocyclohexyl)-2-methyl-1H- 223.2 >50
imidazole-5-carboxamide
523 N-(1-(1-(L-alanyl)piperidin-4-yl)ethyl)-4H- 295.1 >50
1,2,4-triazole-3-carboxamide
525 N-((1r,4r)-4-(3- 281.1 >50
aminopropanamido)cyclohexyl)-4H-1,2,4-
triazole-3-carboxamide
527 N-(1-(1-(L-alanyl)piperidin-4-yl)ethyl)-5- 328 >50
chloro-1H-pyrazole-3-carboxamide
528 N-((1r,4r)-4-(3- 314 >50
aminopropanamido)cyclohexyl)-5-chloro-
1H-pyrazole-3-carboxamide
529 N-((1r,4r)-4-(3- 331.2 4.45
aminopropanamido)cyclohexyl)-1H-
pyrazolo[3, 4-c]pyridine-5-carboxamide
530 N-((1r,4r)-4-(3- 297.1 >50
aminopropanamido)cyclohexyl)-5-oxo-4,5-
dihydro-1H-1,2,4-triazole-3-carboxamide
531 N-((1r,4r)-4-aminocyclohexyl)-5-oxo-4,5- 226.1 >50
dihydro-1H-1,2,4-triazole-3-carboxamide
532 N-((1r,4r)-4-(3- 348.1 >50
aminopropanamido)cyclohexyl)thiazolo[5,4-
c]pyridine-2-carboxamide
533 N-((1r,4r)-4-aminocyclohexyl)thiazolo[5,4- 277.1 >50
c]pyridine-2-carboxamide
534 N-(1-(1-(L-alanyl)piperidin-4-yl)ethyl)-1-(2- 352.2 >50
amino-2-oxoethyl)-1H-1,2,3-triazole-4-
carboxamide
535 N-((1r,4r)-4-aminocyclohexyl)-5-ethyl-1H- 238.1 >50
1,2,4-triazole-3-carboxamide
536 N-((1r,4r)-4-(3- 309.2 >50
aminopropanamido)cyclohexyl)-5-ethyl-4H-
1,2,4-triazole-3-carboxamide
537 N-((1r,4r)-4-(3- 280.2 >50
aminopropanamido)cyclohexyl)-1H-
imidazole-4-carboxamide
538 N-(1-(1-(L-alanyl)piperidin-4-yl)ethyl)-2- 357.2 >50
methyl-1H-indole-5-carboxamide
539 N-((1R,4r)-4-((1r,4R)-4-aminocyclohexane- 335.2 >50
1-carboxamido)cyclohexyl)-1H-1,2,4-
triazole-5-carboxamide
540 N-((1r,4r)-4-(4- 295.1 >50
aminobutanamido)cyclohexyl)-4H-1,2,4-
triazole-3-carboxamide
541 N-((1r,4r)-4-aminocyclohexyl)-5-chloro-1H- 244.1 >50
1,2,4-triazole-3-carboxamide
542 N-((1r,4r)-4-aminocyclohexyl)-5-methyl-1H- 223.1 >50
imidazole-4-carboxamide
543 N-((1r,4r)-4-(3- 295.1 >50
aminopropanamido)cyclohexyl)-5-methyl-
4H-1,2,4-triazole-3-carboxamide
544 N-((1r,4r)-4-aminocyclohexyl)-1-methyl-1H- 224.2 >50
1,2,4-triazole-3-carboxamide
545 N-((1r,4r)-4-aminocyclohexyl)-5-chloro-1H- 243.1 >50
pyrazole-3-carboxamide
546 N-(1-(1-(L-alanyl)piperidin-4-yl)ethyl)-5- 311.1 9.76
oxo-4,5-dihydro-1H-1,2,4-triazole-3-
carboxamide
547 N-(1-(2-(piperidin-4-yl)acetyl)piperidin-4- 321.2 >50
yl)-4H-1,2,4-triazole-3-carboxamide
548 N-((1r,4r)-4-aminocyclohexyl)-3-iodo-1H- 335.9 >50
1,2,4-triazole-5-carboxamide
549 N-(1-(1-(L-alanyl)piperidin-4-yl)ethyl)-3- 309.2 >50
methyl-1H-1,2,4-triazole-5-carboxamide
550 N-((1r,4r)-4-aminocyclohexyl)-5-methyl-1H- 224.1 14.71
1,2,4-triazole-3-carboxamide
551 N-(1-(1-(L-alanyl)piperidin-4- 362.2 >50
yl)ethyl)thiazolo[5,4-c]pyridine-2-
carboxamide
552 N-(1-(1-(L-alanyl)piperidin-4-yl)ethyl)-5- 339.2 6.44
ethylthiazole-2-carboxamide
553 N-((1r,4r)-4-(3- 325.2 25.61
aminopropanamido)cyclohexyl)-5-
ethylthiazole-2-carboxamide
554 N-((1r,4r)-4-aminocyclohexyl)-5- 254.1 >50
ethylthiazole-2-carboxamide
555 N-(1-((1r,4r)-4-aminocyclohexane-1- 321.1 >50
carbonyl)piperidin-4-yl)-4H-1,2,4-triazole-3-
carboxamide
556 N-(1-(3-aminopropanoyl)piperidin-4-yl)-4H- 267.2 >50
1,2,4-triazole-3-carboxamide
557 (Β±)-trans-N-(1-(4-aminocyclohexane-1- 344.1 >10
carbonyl)-2-methylpiperidin-4-yl)benzamide
558 (Β±)-cis-N-(1-(4-aminocyclohexane-1- 358.1 >10
carbonyl)-2-methylpiperidin-4-yl)benzamide (+Na)
559 N-((1r,4r)-4-aminocyclohexyl)-2-oxo-2,3- 275.1 3.49
dihydro-1H-pyrrolo[2,3-c]pyridine-5-
carboxamide
560 N-(1-(4-aminobutanoyl)piperidin-4-yl)-4H- 281.1 >10
1,2,4-triazole-3-carboxamide
561 N-((1r,4r)-4-aminocyclohexyl)-N-methyl- 224.1 >10
1H-1,2,4-triazole-5-carboxamide
562 N-((1r,4r)-4-aminocyclohexyl)-4-methyl-1H- 223.2 >10
imidazole-2-carboxamide
563 (Β±)-trans-N-(1-((3-aminopropyl)sulfonyl)-2- 340.05 >10
methylpiperidin-4-yl)benzamide
564 (Β±)-cis-N-(1-((3-aminopropyl)sulfonyl)-2- 340.05 >10
methylpiperidin-4-yl)benzamide
565 N-((1r,4r)-4-aminocyclohexyl)-6-bromo-2- 364 >10
hydroxyquinoline-3-carboxamide
566 N-((1r,4r)-4-(3- >10
aminopropanamido)cyclohexyl)-6-bromo-2-
hydroxyquinoline-3-carboxamide
567 (Β±)-cis-N-(1-(4-aminocyclohexane-1- 366.3 >10
carbonyl)-2-methylpiperidin-4-yl)benzamide (+Na)
568 (Β±)-cis-N-(1-((3-aminopropyl)sulfonyl)-2- 438.15 >10
methylpiperidin-4-yl)-[1,1β€²,-biphenyl]-4- (+Na)
carboxamide
569 (Β±)-cis-N-(1-((3-aminopropyl)sulfonyl)-2- 368.1 8.02
methylpiperidin-4-yl)-3-ethylbenzamide
570 (Β±)-cis-N-(1-((3-aminopropyl)sulfonyl)-2- 340.1 >10
methylpiperidin-4-yl)benzamide
571 (Β±)-trans-N-(1-(4-aminocyclohexane-1- 344.1 >10
carbonyl)-2-methylpiperidin-4-yl)benzamide
572 2-amino-N-((1r,4r)-4-aminocyclohexyl)-1H- 224.1 >10
imidazole-4-carboxamide
573 (Β±)-trans-N-(1-((3-aminopropyl)sulfonyl)-2- 368.2 >10
methylpiperidin-4-yl)-3-ethylbenzamide
574 N-((1r,4r)-4-aminocyclohexyl)imidazo[1,2- 260.1 >10
a]pyrimidine-3-carboxamide
*IC50 values are an average of n = 1 to n = 50

TABLE 3A
LCMS
M + H
or SMYD3
(M + Na) Biochem SMYD3
or IC50 cell IC50
Cpd. No. Chemical Name ((M βˆ’ NH2)) (ΞΌM)* (ΞΌM)*
575 N-((1R,3R,5S)-8-(((1r,4R)-4- 447 0.00044 2.17352
aminocyclohexyl)sulfonyl)-8-
azabicyclo[3.2.1]octan-3-yl)-2-
oxoindoline-5-carboxamide
576 N-((1R,3r,5S)-8-((4-aminopiperidin- 466 0.00049 0.52547
1-yl)sulfonyl)-8-
azabicyclo[3.2.1]octan-3-yl)-6-
fluoro-2-oxoindoline-5-carboxamide
577 N-((1R,3r,5S)-8-(((1- 461 0.00067 0.4806
methylpiperidin-4-
yl)methyl)sulfonyl)-8-
azabicyclo[3.2.1]octan-3-yl)-2-
oxoindoline-5-carboxamide
578 N-((1R,3r,5S)-8-((4-aminopiperidin- 448 0.00068 0.85408
1-yl)sulfonyl)-8-
azabicyclo[3.2.1]octan-3-yl)-2-
oxoindoline-5-carboxamide
579 N-((1R,3r,5S)-8-((4-aminopiperidin- 482 0.00081 1.12914
1-yl)sulfonyl)-8-
azabicyclo[3.2.1]octan-3-yl)-6-
chloro-2-oxoindoline-5-carboxamide
580 N-((2S,4S)-1-((4-aminopiperidin-1- 436 0.0009 1.63568
yl)sulfonyl)-2-methylpiperidin-4-yl)-
2-oxoindoline-5-carboxamide
581 N-((1R,3r,5S)-8-(((1-(3- 505 0.00095 1.67455
hydroxypropyl)piperidin-4-
yl)methyl)sulfonyl)-8-
azabicyclo[3.2.1]octan-3-yl)-2-
oxoindoline-5-carboxamide
582 N-((2S,4S)-1-((4-aminopiperidin-1- 470 0.00098 0.81381
yl)sulfonyl)-2-methylpiperidin-4-yl)-
6-chloro-2-oxoindoline-5-
carboxamide
583 N-((1R,3R,5S)-8-(((1r,4R)-4- 481 0.0011 1.50735
aminocyclohexyl)sulfonyl)-8-
azabicyclo[3.2.1]octan-3-yl)-6-
chloro-2-oxoindoline-5-carboxamide
584 N-((2S)-1-((4-(2-aminopropan-2- 471 0.00147 0.65295
yl)phenyl)sulfonyl)-2-
methylpiperidin-4-yl)-2-oxoindoline-
5-carboxamide
585 6-chloro-N-((1R,3r,5S)-8-(((1-(3- 539 0.00173 0.76375
hydroxypropyl)piperidin-4-
yl)methyl)sulfonyl)-8-
azabicyclo[3.2.1]octan-3-yl)-2-
oxoindoline-5-carboxamide
586 6-chloro-N-((1R,3r,5S)-8-((4- 496 0.00189 0.42454
(methylamino)piperidin-1-
yl)sulfonyl)-8-
azabicyclo[3.2.1]octan-3-yl)-2-
oxoindoline-5-carboxamide
587 N-((1R,3r,5S)-8-((4- 538 0.00198 0.07099
(benzylamino)piperidin-1-
yl)sulfonyl)-8-
azabicyclo[3.2.1]octan-3-yl)-2-
oxoindoline-5-carboxamide
588 N-((2S,4S)-1-((4-(2-aminopropan-2- 505 0.00198 0.35648
yl)phenyl)sulfonyl)-2-
methylpiperidin-4-yl)-6-chloro-2-
oxoindoline-5-carboxamide
589 N-((1R,3r,5S)-8-((4- 462 0.00213 0.98725
(methylamino)piperidin-1-
yl)sulfonyl)-8-
azabicyclo[3.2.1]octan-3-yl)-2-
oxoindoline-5-carboxamide
590 2-oxo-N-((1R,3r,5S)-8-((piperidin-3- 447 0.00214 0.76757
ylmethyl)sulfonyl)-8-
azabicyclo[3.2.1]octan-3-yl)indoline-
5-carboxamide
591 N-((1R,3R,5S)-8-(((1s,4S)-4- 447 0.00233 2.31394
aminocyclohexyl)sulfonyl)-8-
azabicyclo[3.2.1]octan-3-yl)-2-
oxoindoline-5-carboxamide
592 N-((1R,3r,5S)-8-((4- 572 0.00258 0.05357
(benzylamino)piperidin-1-
yl)sulfonyl)-8-
azabicyclo[3.2.1]octan-3-yl)-6-
chloro-2-oxoindoline-5-carboxamide
593 N-((1R,3r,5S)-8-((4- 476 0.00289 0.50002
(dimethylamino)piperidin-1-
yl)sulfonyl)-8-
azabicyclo[3.2.1]octan-3-yl)-2-
oxoindoline-5-carboxamide
594 6-chloro-N-((1R,3r,5S)-8-((4- 510 0.00346 0.30139
(dimethylamino)piperidin-1-
yl)sulfonyl)-8-
azabicyclo[3.2.1]octan-3-yl)-2-
oxoindoline-5-carboxamide
595 6-chloro-2-oxo-N-((1R,3r,5S)-8-(((1- 591 0.00354 0.03609
(4,4,4-trifluorobutyl)piperidin-4-
yl)methyl)sulfonyl)-8-
azabicyclo[3.2.1]octan-3-yl)indoline-
5-carboxamide
596 6-chloro-2-oxo-N-((1R,3r,5S)-8- 481 0.0036 2.66255
((piperidin-4-ylmethyl)sulfonyl)-8-
azabicyclo[3.2.1]octan-3-yl)indoline-
5-carboxamide
597 2-oxo-N-((1R,3r,5S)-8-((piperidin-4- 447 0.00398 3.43731
ylmethyl)sulfonyl)-8-
azabicyclo[3.2.1]octan-3-yl)indoline-
5-carboxamide
598 6-chloro-2-oxo-N-((1R,3S,5S)-8- 481 0.00412 1.26702
((((S)-piperidin-3-
yl)methyl)sulfonyl)-8-
azabicyclo[3.2.1]octan-3-yl)indoline-
5-carboxamide
599 N-((2S,4S)-2-methyl-1-((piperidin-4- 435 0.00442 9.48804
ylmethyl)sulfonyl)piperidin-4-yl)-2-
oxoindoline-5-carboxamide
600 6-chloro-2-oxo-N-((1R,3R,5S)-8- 481 0.00499 0.72841
((((R)-piperidin-3-
yl)methyl)sulfonyl)-8-
azabicyclo[3.2.1]octan-3-yl)indoline-
5-carboxamide
601 2-oxo-N-((1R,3r,5S)-8-((piperidin-4- 449 0.00521 4.54161
ylmethyl)sulfonyl)-8-
azabicyclo[3.2.1]octan-3-yl)-2,3-
dihydrobenzo[d]oxazole-6-
carboxamide
602 N-((1R,3r,5S)-8-((4-aminopiperidin- 528 0.00712 3.72505
1-yl)sulfonyl)-8-
azabicyclo[3.2.1]octan-3-yl)-6-
bromo-2-oxoindoline-5-carboxamide
603 N-((3S)-1-((4-aminopiperidin-1- 470 0.00853 2.67708
yl)sulfonyl)-3-methylpiperidin-4-yl)-
6-chloro-2-oxoindoline-5-
carboxamide
604 N-((1R,3r,5S)-8-((4-aminopiperidin- 496 0.01347 0.20704
1-yl)sulfonyl)-8-
azabicyclo[3.2.1]octan-3-yl)-6-
chloro-1-methyl-2-oxoindoline-5-
carboxamide
605 N-((2S,4S)-1-((4-aminopiperidin-1- 416 0.01544 0.20068
yl)sulfonyl)-2-methylpiperidin-4-yl)-
5-ethylisothiazole-3-carboxamide
606 N-((1R,3r,5S)-8-((4-aminopiperidin- 462 0.01561 1.79073
1-yl)sulfonyl)-8-
azabicyclo[3.2.1]octan-3-yl)-6-
methyl-2-oxoindoline-5-carboxamide
607 N-((2S,4S)-1-((4-aminopiperidin-1- (451) 0.01813 0.20535
yl)sulfonyl)-2-methylpiperidin-4-yl)-
5-cyclopropyl-1,3,4-thiadiazole-2-
carboxamide
608 N-((3R,4R)-1-((4-aminopiperidin-1- 470 0.02137 6.23686
yl)sulfonyl)-3-methylpiperidin-4-yl)-
6-chloro-2-oxoindoline-5-
carboxamide
609 N-((1R,3r,5S)-8-((4-aminopiperidin- 464 0.02365 3.70034
1-yl)sulfonyl)-8-
azabicyclo[3.2.1]octan-3-yl)-3-oxo-
3,4-dihydro-2H-
benzo[b][1,4]oxazine-6-carboxamide
610 N-((1R,3r,5S)-8-((4-aminopiperidin- 428 0.02378 0.21618
1-yl)sulfonyl)-8-
azabicyclo[3.2.1]octan-3-yl)-5-
ethylisothiazole-3-carboxamide
611 1-methyl-2-oxo-N-((1R,3r,5S)-8- 461 0.02593 3.91552
((piperidin-4-ylmethyl)sulfonyl)-8-
azabicyclo[3.2.1]octan-3-yl)indoline-
5-carboxamide
612 N-((1R,3r,5S)-8-((4-(2-aminopropan- 483 0.03068 2.53133
2-yl)phenyl)sulfonyl)-8-
azabicyclo[3.2.1]octan-3-yl)-2-
oxoindoline-5-carboxamide
613 N-((1R,3r,5S)-8-((4-(2-aminopropan- 517 0.03712 1.77071
2-yl)phenyl)sulfonyl)-8-
azabicyclo[3.2.1]octan-3-yl)-6-
chloro-2-oxoindoline-5-carboxamide
614 6-chloro-2-oxo-N-((1R,3r,5S)-8-((2- 481 0.04599 0.37965
(pyrrolidin-1-yl)ethyl)sulfonyl)-8-
azabicyclo[3.2.1]octan-3-yl)indoline-
5-carboxamide
615 2-oxo-N-((1R,3r,5S)-8-((2- 447 0.04974 0.76121
(pyrrolidin-1-yl)ethyl)sulfonyl)-8-
azabicyclo[3.2.1]octan-3-yl)indoline-
5-carboxamide
616 N-((1R,3r,5S)-8-((4-aminopiperidin- 423 0.0499 0.53953
1-yl)sulfonyl)-8-
azabicyclo[3.2.1]octan-3-yl)-5-
ethylpyridazine-3-carboxamide
617 6-chloro-1-methyl-2-oxo-N- 495 0.05233 2.95866
((1R,3r,5S)-8-((piperidin-4-
ylmethyl)sulfonyl)-8-
azabicyclo[3.2.1]octan-3-yl)indoline-
5-carboxamide
618 N-((1R,3r,5S)-8-((4-aminopiperidin- 441 0.05583 0.3477
1-yl)sulfonyl)-8-
azabicyclo[3.2.1]octan-3-yl)-5-
cyclopropyl-1,3,4-thiadiazole-2-
carboxamide
619 N-((2S,4S)-1-((4-aminopiperidin-1- 411 0.05959 0.46793
yl)sulfonyl)-2-methylpiperidin-4-yl)-
5-ethylpyridazine-3-carboxamide
620 2-oxo-N-(1-((piperidin-4- 421 0.06816 10
ylmethyl)sulfonyl)piperidin-4-
yl)indoline-5-carboxamide
621 N-(1-((3- 415 0.07749 6.83658
aminopropyl)sulfonyl)piperidin-4-
yl)-6-chloro-2-oxoindoline-5-
carboxamide
622 N-((1R,3r,5S)-8-((4- 472 0.13055 1.07968
aminocyclohexyl)sulfonyl)-8-
azabicyclo[3.2.1]octan-3-yl)-2,2-
difluorobenzo[d][1,3]dioxole-5-
carboxamide
623 N-((1R,3R,5S)-8-(((1r,4R)-4- 472 0.1358 0.89555
aminocyclohexyl)sulfonyl)-8-
azabicyclo[3.2.1]octan-3-yl)-2,2-
difluorobenzo[d][1,3]dioxole-5-
carboxamide
624 N-(1-((3- 381 0.15882 10
aminopropyl)sulfonyl)piperidin-4-
yl)-2-oxoindoline-5-carboxamide
625 (R)-2-methyl-3-oxo-N-((1R,3r,5S)-8- 477 0.18459 10
((piperidin-4-ylmethyl)sulfonyl)-8-
azabicyclo[3.2.1]octan-3-yl)-3,4-
dihydro-2H-benzo[b][1,4]oxazine-6-
carboxamide
626 N-((1R,3r,5S)-8-((4-aminopiperidin- 473 0.22228 2.96871
1-yl)sulfonyl)-8-
azabicyclo[3.2.1]octan-3-yl)-2,2-
difluorobenzo[d][1,3]dioxole-5-
carboxamide
627 N-((1R,3R,5S)-8-(((1r,4R)-4- 562 0.22495 1.54162
(benzylamino)cyclohexyl)sulfonyl)-
8-azabicyclo[3.2.1]octan-3-yl)-2,2-
difluorobenzo[d][1,3]dioxole-5-
carboxamide
628 2,2-difluoro-N-((1R,3r,5S)-8- 472 0.23189 3.62035
((piperidin-4-ylmethyl)sulfonyl)-8-
azabicyclo[3.2.1]octan-3-
yl)benzo[d][1,3]dioxole-5-
carboxamide
629 N-((2S,4R)-1-((4-aminopiperidin-1- (438) 0.32589 2.08253
yl)sulfonyl)-2-methylpiperidin-4-yl)-
5-ethylisothiazole-3-carboxamide
630 2,2-difluoro-N-((1R,3r,5S)-8-(((1- 486 0.3614 6.55362
methylpiperidin-4-
yl)methyl)sulfonyl)-8-
azabicyclo[3.2.1]octan-3-
yl)benzo[d][1,3]dioxole-5-
carboxamide
631 N-((2S,4R)-1-((4-aminopiperidin-1- (451) 0.4699 4.89772
yl)sulfonyl)-2-methylpiperidin-4-yl)-
5-cyclopropyl-1,3,4-thiadiazole-2-
carboxamide
632 N-((2S,4S)-1-((4- 471 0.52572 10
acetamidophenyl)sulfonyl)-2-
methylpiperidin-4-yl)-2-oxoindoline-
5-carboxamide
633 N-((1R,3r,5S)-8-((4-aminopiperidin- 423 0.52917 10
1-yl)sulfonyl)-8-
azabicyclo[3.2.1]octan-3-yl)-5-
cyclopropyl-1H-pyrazole-3-
carboxamide
634 N-((3R,4S)-1-((4-aminopiperidin-1- 470 0.52937 0.97208
yl)sulfonyl)-3-methylpiperidin-4-yl)-
6-chloro-2-oxoindoline-5-
carboxamide
635 3-ethyl-N-((1R,3r,5S)-8-((piperidin- 420 0.62038 10
4-ylmethyl)sulfonyl)-8-
azabicyclo[3.2.1]octan-3-
yl)benzamide
636 N-((1R,3r,5S)-8-((4-aminopiperidin- 464 0.81894 10
1-yl)sulfonyl)-8-
azabicyclo[3.2.1]octan-3-yl)-3-oxo-
3,4-dihydro-2H-
benzo[b][1,4]oxazine-7-carboxamide
637 N-((1R,3r,5S)-8-((4-aminopiperidin- 423 0.8386 10
1-yl)sulfonyl)-8-
azabicyclo[3.2.1]octan-3-yl)-1-
cyclopropyl-1H-pyrazole-4-
carboxamide
638 N-((1R,3R,5S)-8-((1r,4R)-4- 411 0.96185 10
aminocyclohexane-1-carbonyl)-8-
azabicyclo[3.2.1]octan-3-yl)-2-
oxoindoline-5-carboxamide
639 N-((2S,4S)-1-((4-aminopiperidin-1- 411 1.00072 10
yl)sulfonyl)-2-methylpiperidin-4-yl)-
1-cyclopropyl-1H-pyrazole-4-
carboxamide
640 N-((2S)-1-((1r,4S)-4- ((416)) 2.04146 10
aminocyclohexane-1-carbonyl)-2-
methylpiperidin-4-yl)-6-chloro-2-
oxoindoline-5-carboxamide
641 N-(1-((4- 491 5.93159 10
acetamidophenyl)sulfonyl)piperidin-
4-yl)-6-chloro-2-oxoindoline-5-
carboxamide
642 N-((2S,4S)-1-((1r,4S)-4- ((382)) 6.81095 10
aminocyclohexane-1-carbonyl)-2-
methylpiperidin-4-yl)-2-oxoindoline-
5-carboxamide
643 N-(1-((4- 457 16.85335 10
acetamidophenyl)sulfonyl)piperidin-
4-yl)-2-oxoindoline-5-carboxamide
644 N-((1R,3r,5S)-8-((4-aminopiperidin-   424.00 0.0185 0.25715
1-yl)sulfonyl)-8-
azabicyclo[3.2.1]octan-3-yl)-3-
cyclopropylisoxazole-5-carboxamide
*IC50 values are an average of n = 1 to n = 50

TABLE 4A
SMYD2
Biochem
Cpd. LCMS IC50
No. Chemical Name M + H (ΞΌM)*
645 5-cyclopropyl-N-[1-(propan-2-yl)azetidin-3- 261.2 0.74472
yl]pyridazine-3-carboxamide
646 5-cyclopropyl-N-{1-[(1S)-1-phenylethyl]azetidin-3- 323.2 0.51586
yl}pyridazine-3-carboxamide
647 5-cyclopropyl-N-{1-[(1R)-1-phenylethyl]azetidin-3- 323.2 7.80106
yl}pyridazine-3-carboxamide
648 N-{1-[(5-chloro-1-methyl-1H-imidazol-4- 347.2 7.32825
yl)methyl]azetidin-3-yl}-5-cyclopropylpyridazine-3-
carboxamide
649 5-cyclopropyl-N-{1-[1-(2,5- 391.1 0.14034
dichlorophenyl)ethyl]azetidin-3-yl}pyridazine-3-
carboxamide
650 5-cyclopropyl-N-(1-{1-[3-(2-hydroxyethoxy)-2- 413.2 0.31235
methoxyphenyl]ethyl}azetidin-3-yl)pyridazine-3-
carboxamide
651 N-(1-benzylazetidin-3-yl)-5-cyclopropylpyridazine- 309.2 0.54112
3-carboxamide
652 N-(1-{1-[2-chloro-3-(2- 417.2 0.04156
hydroxyethoxy)phenyl]ethyl}azetidin-3-yl)-5-
cyclopropylpyridazine-3-carboxamide
657 N-(azetidin-3-yl)-1-cyclopropyl-1H-1,2,3-triazole-4- 208.1 10.38816
carboxamide
659 1-cyclopropyl-N-(1-methylazetidin-3-yl)-1H-1,2,3- 222.1 2.8375
triazole-4-carboxamide
660 1-cyclopropyl-N-(1-propylazetidin-3-yl)-1H-1,2,3- 250.1 1.16661
triazole-4-carboxamide
661 1-cyclopropyl-N-(1-ethylazetidin-3-yl)-1H-1,2,3- 236.2 1.57571
triazole-4-carboxamide
662 1-cyclopropyl-N-[1-(propan-2-yl)azetidin-3-yl]-1H- 250.2 0.84606
1,2,3-triazole-4-carboxamide
663 1-cyclopropyl-N-[1-(propan-2-yl)azetidin-3-yl]-1H- 250.2 0.58519
1,2,3-triazole-4-carboxamide
664 1-cyclopropyl-N-(1-cyclopropylazetidin-3-yl)-1H- 248.1 1.48071
1,2,3-triazole-4-carboxamide
665 1-cyclopropyl-N-[1-(cyclopropylmethyl)azetidin-3- 262.2 1.99933
yl]-1H-1,2,3-triazole-4-carboxamide
666 1-cyclopropyl-N-[1-(oxetan-3-ylmethyl)azetidin-3- 278.2 6.06091
yl]-1H-1,2,3-triazole-4-carboxamide
667 1-cyclopropyl-N-[1-(2-methoxyethyl)azetidin-3-yl]- 266.2 2.45794
1H-1,2,3-triazole-4-carboxamide
668 1-cyclopropyl-N-[1-(2-methylpropyl)azetidin-3-yl]- 264.2 2.74698
1H-1,2,3-triazole-4-carboxamide
669 N-[1-(cyclobutylmethyl)azetidin-3-yl]-1- 276.2 1.61707
cyclopropyl-1H-1,2,3-triazole-4-carboxamide
670 1-cyclopropyl-N-[1-(2-hydroxyethyl)azetidin-3-yl]- 252.1 4.53271
1H-1,2,3-triazole-4-carboxamide
671 N-(1-benzylazetidin-3-yl)-1-cyclopropyl-1H-1,2,3- 298.1 4.20527
triazole-4-carboxamide
672 N-(1-benzylazetidin-3-yl)-1-cyclopropyl-1H-1,2,3- 298.2 1.55139
triazole-4-carboxamide
673 1-cyclopropyl-N-[1-(2-phenylethyl)azetidin-3-yl]- 312.2 1.55399
1H-1,2,3-triazole-4-carboxamide
674 1-cyclopropyl-N-[1-(2-hydroxy-1- 328.2 4.27205
phenylethyl)azetidin-3-yl]-1H-1,2,3-triazole-4-
carboxamide
675 1-cyclopropyl-N-[1-(1-phenylpropyl)azetidin-3-yl]- 326.2 0.49364
1H-1,2,3-triazole-4-carboxamide
676 N-{1-[1-(4-chlorophenyl)ethyl]azetidin-3-yl}-1- 346.2 2.18182
cyclopropyl-1H-1,2,3-triazole-4-carboxamide
677 1-cyclopropyl-N-{1-[1-(2,4- 348.2 2.86259
difluorophenyl)ethyl]azetidin-3-yl}-1H-1,2,3-
triazole-4-carboxamide
678 1-cyclopropyl-N-{1-[1-(2- 330.2 0.90683
fluorophenyl)ethyl]azetidin-3-yl}-1H-1,2,3-triazole-
4-carboxamide
679 1-cyclopropyl-N-{1-[1-(3- 342.2 1.45146
methoxyphenyl)ethyl]azetidin-3-yl}-1H-1,2,3-
triazole-4-carboxamide
680 1-cyclopropyl-N-(1-{1-[4- 380.2 >50.0
(trifluoromethyl)phenyl]ethyl}azetidin-3-yl)-1H-
1,2,3-triazole-4-carboxamide
681 N-{1-[1-(4-butoxyphenyl)ethyl]azetidin-3-yl}-1- 384.2 1.29111
cyclopropyl-1H-1,2,3-triazole-4-carboxamide
682 1-cyclopropyl-N-{1-[1-(2- 342.3 0.66494
methoxyphenyl)ethyl]azetidin-3-yl}-1H-1,2,3-
triazole-4-carboxamide
683 1-cyclopropyl-N-{1-[1-(2- 342.3 0.79678
methoxyphenyl)ethyl]azetidin-3-yl}-1H-1,2,3-
triazole-4-carboxamide
684 1-cyclopropyl-N-(1-{1-[2- 396.2 2.13234
(trifluoromethoxy)phenyl]ethyl}azetidin-3-yl)-1H-
1,2,3-triazole-4-carboxamide
685 1-cyclopropyl-N-{1-[1-(pyridin-2-yl)ethyl]azetidin- 313.1 3.56033
3-yl}-1H-1,2,3-triazole-4-carboxamide
686 1-cyclopropyl-N-[1-(3-methoxypropyl)azetidin-3- 280.1 3.76161
yl]-1H-1,2,3-triazole-4-carboxamide
687 1-cyclopropyl-N-{1-[1-(3,4- 348.2 2.89677
difluorophenyl)ethyl]azetidin-3-yl}-1H-1,2,3-
triazole-4-carboxamide
688 1-cyclopropyl-N-{1-[1-(3,4- 386.2 5.09675
dimethoxyphenyl)propan-2-yl]azetidin-3-yl}-1H-
1,2,3-triazole-4-carboxamide
689 1-cyclopropyl-N-{1-[1-(4-fluoro-2- 360.2 1.88646
methoxyphenyl)ethyl]azetidin-3-yl}-1H-1,2,3-
triazole-4-carboxamide
690 1-cyclopropyl-N-(1-{1-[2-methoxy-5- 410.2 7.98548
(trifluoromethyl)phenyl]ethyl}azetidin-3-yl)-1H-
1,2,3-triazole-4-carboxamide
691 N-{1-[1-(2H-1,3-benzodioxol-5-yl)ethyl]azetidin-3- 356.2 0.80698
yl}-1-cyclopropyl-1H-1,2,3-triazole-4-carboxamide
692 N-(1-{1-[4-(benzyloxy)phenyl]ethyl}azetidin-3-yl)- 418.2 0.17228
1-cyclopropyl-1H-1,2,3-triazole-4-carboxamide
693 N-(1-{1-[4-(benzyloxy)phenyl]ethyl}azetidin-3-yl)- 418.3 0.17574
1-cyclopropyl-1H-1,2,3-triazole-4-carboxamide
694 1-cyclopropyl-N-{1-[1-(4- 344.2 0.78735
fluorophenyl)propyl]azetidin-3-yl}-1H-1,2,3-
triazole-4-carboxamide
695 N-{1-[1-(3-chlorophenyl)ethyl]azetidin-3-yl}-1- 346.1 1.00761
cyclopropyl-1H-1,2,3-triazole-4-carboxamide
696 1-cyclopropyl-N-{1-[1-(2,5- 380.1 0.18717
dichlorophenyl)ethyl]azetidin-3-yl}-1H-1,2,3-
triazole-4-carboxamide
697 1-cyclopropyl-N-{1-[1-(2,5- 380.1 0.18937
dichlorophenyl)ethyl]azetidin-3-yl}-1H-1,2,3-
triazole-4-carboxamide
698 1-cyclopropyl-N-{1-[1-(3,4- 372.2 3.69446
dimethoxyphenyl)ethyl]azetidin-3-yl}-1H-1,2,3-
triazole-4-carboxamide
699 1-cyclopropyl-N-{1-[1-(pyrimidin-5- 314.2 9.54128
yl)ethyl]azetidin-3-yl}-1H-1,2,3-triazole-4-
carboxamide
700 1-cyclopropyl-N-(1-{1-[4- 394.2 2.66609
(trifluoromethyl)phenyl]propyl}azetidin-3-yl)-1H-
1,2,3-triazole-4-carboxamide
701 1-cyclopropyl-N-(1-{[3-(2- 372.2 8.02678
methoxyethoxy)phenyl]methyl}azetidin-3-yl)-1H-
1,2,3-triazole-4-carboxamide
702 1-cyclopropyl-N-(1-{1-[3-(2- 386.1 3.57947
methoxyethoxy)phenyl]ethyl}azetidin-3-yl)-1H-
1,2,3-triazole-4-carboxamide
703 1-(2-hydroxyethyl)-N-[1-(propan-2-yl)azetidin-3- 254.2 >50.0
yl]-1H-1,2,3-triazole-4-carboxamide
704 1-cyclopropyl-N-(1-{1-[3-(2- 372.2 0.64045
hydroxyethoxy)phenyl]ethyl}azetidin-3-yl)-1H-
1,2,3-triazole-4-carboxamide
705 1-cyclopropyl-N-[1-(1-{3-[2- 385.2 2.04485
(methylamino)ethoxy]phenyl}ethyl)azetidin-3-yl]-
1H-1,2,3-triazole-4-carboxamide
706 1-cyclopropyl-N-[1-(1-{3-[2- 399.2 2.1244
(dimethylamino)ethoxy]phenyl}ethyl)azetidin-3-yl]-
1H-1,2,3-triazole-4-carboxamide
707 1-cyclopropyl-N-[1-(3-hydroxypropyl)azetidin-3- 266.1 1.91172
yl]-1H-1,2,3-triazole-4-carboxamide
708 1-cyclopropyl-N-{1-[3- 293.2 >50.0
(dimethylamino)propyl]azetidin-3-yl}-1H-1,2,3-
triazole-4-carboxamide
709 1-cyclopropyl-N-{1-[(1S)-1-phenylethyl]azetidin-3- 312.2 0.37665
yl}-1H-1,2,3-triazole-4-carboxamide
710 N-{1-[1-(2-chloro-4-fluorophenyl)ethyl]azetidin-3- 364.1 0.34116
yl}-1-cyclopropyl-1H-1,2,3-triazole-4-carboxamide
711 1-cyclopropyl-N-{1-[1-(3- 344.2 1.00729
fluorophenyl)propyl]azetidin-3-yl}-1H-1,2,3-
triazole-4-carboxamide
712 N-(1-{1-[4-chloro-3- 414.2 7.35557
(trifluoromethyl)phenyl]ethyl}azetidin-3-yl)-1-
cyclopropyl-1H-1,2,3-triazole-4-carboxamide
713 N-[1-(4-chloro-5-methoxy-2,3-dihydro-1H-inden-1- 388.1 2.88746
yl)azetidin-3-yl]-1-cyclopropyl-1H-1,2,3-triazole-4-
carboxamide
714 N-{1-[1-(3-chloro-5-fluorophenyl)ethyl]azetidin-3- 364.1 2.12503
yl}-1-cyclopropyl-1H-1,2,3-triazole-4-carboxamide
715 1-cyclopropyl-N-{1-[1-(pyrimidin-2- 314.2 1.9389
yl)ethyl]azetidin-3-yl}-1H-1,2,3-triazole-4-
carboxamide
716 1-cyclopropyl-N-{1-[1-(1,3-thiazol-2- 319.1 30.73955
yl)ethyl]azetidin-3-yl}-1H-1,2,3-triazole-4-
carboxamide
717 1-cyclopropyl-N-(1-{[1-(2-methoxyethyl)-1H- 346.3 3.05744
pyrazol-4-yl]methyl}azetidin-3-yl)-1H-1,2,3-
triazole-4-carboxamide
718 1-cyclopropyl-N-{1-[1-(dimethyl-1,3-thiazol-5- 347.2 2.95156
yl)ethyl]azetidin-3-yl}-1H-1,2,3-triazole-4-
carboxamide
719 N-[1-(5-chloro-2,3-dihydro-1H-inden-1-yl)azetidin- 358.2 4.40844
3-yl]-1-cyclopropyl-1H-1,2,3-triazole-4-
carboxamide
720 1-cyclopropyl-N-{1-[(1R)-1-phenylethyl]azetidin-3- 312.2 23.25339
yl}-1H-1,2,3-triazole-4-carboxamide
721 1-cyclopropyl-N-{1-[(1R)-1-phenylpropyl]azetidin- 326.2 4.80835
3-yl}-1H-1,2,3-triazole-4-carboxamide
722 1-cyclopropyl-N-{1-[(1S)-1-phenylpropyl]azetidin- 326.3 0.19827
3-yl}-1H-1,2,3-triazole-4-carboxamide
723 1-(2-aminoethyl)-N-[1-(propan-2-yl)azetidin-3-yl]- 253.2 >50.0
1H-1,2,3-triazole-4-carboxamide
724 1-cyclopropyl-N-{1-[1-(4-methoxypyridin-2- 343.2 1.27222
yl)ethyl]azetidin-3-yl}-1H-1,2,3-triazole-4-
carboxamide
725 1-cyclopropyl-N-{1-[1-(3-methoxypyridin-2- 343.2 1.02479
yl)ethyl]azetidin-3-yl}-1H-1,2,3-triazole-4-
carboxamide
726 1-cyclopropyl-N-(1-{[3- 355.2 10.70724
(methylcarbamoyl)phenyl]methyl}azetidin-3-yl)-
1H-1,2,3-triazole-4-carboxamide
727 N-{1-[(3-carbamoylphenyl)methyl]azetidin-3-yl}-1- 341.1 7.29596
cyclopropyl-1H-1,2,3-triazole-4-carboxamide
728 1-cyclopropyl-N-(1-{1-[4-(morpholin-4- 397.2 0.75494
yl)phenyl]ethyl}azetidin-3-yl)-1H-1,2,3-triazole-4-
carboxamide
729 1-cyclopropyl-N-{1-[2,2,2-trifluoro-1-(3- 396.2 >50.0
methoxyphenyl)ethyl]azetidin-3-yl}-1H-1,2,3-
triazole-4-carboxamide
730 1-cyclopropyl-N-{1-[1-(3- 404.2 3.04417
phenoxyphenyl)ethyl]azetidin-3-yl}-1H-1,2,3-
triazole-4-carboxamide
731 N-{1-[cyclobutyl(phenyl)methyl]azetidin-3-yl}-1- 352.2 1.51599
cyclopropyl-1H-1,2,3-triazole-4-carboxamide
732 1-cyclopropyl-N-{1-[1-(4-fluoro-3- 360.2 2.58965
methoxyphenyl)ethyl]azetidin-3-yl}-1H-1,2,3-
triazole-4-carboxamide
733 1-cyclopropyl-N-{1-[(1-methyl-1H-imidazol-4- 302.2 6.80081
yl)methyl]azetidin-3-yl}-1H-1,2,3-triazole-4-
carboxamide
734 1-cyclopropyl-N-(1-{[3-(2- 358.2 2.30886
hydroxyethoxy)phenyl]methyl}azetidin-3-yl)-1H-
1,2,3-triazole-4-carboxamide
735 1-cyclopropyl-N-[1-({3-[2- 371.2 2.33404
(methylamino)ethoxy]phenyl}methyl)azetidin-3-yl]-
1H-1,2,3-triazole-4-carboxamide
736 1-cyclopropyl-N-[1-({3-[2- 385.2 2.80792
(dimethylamino)ethoxy]phenyl}methyl)azetidin-3-
yl]-1H-1,2,3-triazole-4-carboxamide
737 N-(1-{1-[3-(benzyloxy)phenyl]ethyl}azetidin-3-yl)- 418.3 0.71843
1-cyclopropyl-1H-1,2,3-triazole-4-carboxamide
738 1-cyclopropyl-N-[1-(5-methoxy-1,2,3,4- 368.3 5.82879
tetrahydronaphthalen-1-yl)azetidin-3-yl]-1H-1,2,3-
triazole-4-carboxamide
739 1-cyclopropyl-N-{1-[1-(4- 404.2 1.07309
phenoxyphenyl)ethyl]azetidin-3-yl}-1H-1,2,3-
triazole-4-carboxamide
740 1-cyclopropyl-N-[1-(5-fluoro-2,3-dihydro-1H-inden- 342.2 6.96336
1-yl)azetidin-3-yl]-1H-1,2,3-triazole-4-carboxamide
741 1-cyclopropyl-N-(1-{1-[2- 380.2 1.00727
(trifluoromethyl)phenyl]ethyl}azetidin-3-yl)-1H-
1,2,3-triazole-4-carboxamide
742 1-cyclopropyl-N-{1-[1-(2,6- 348.2 2.84963
difluorophenyl)ethyl]azetidin-3-yl}-1H-1,2,3-
triazole-4-carboxamide
743 1-cyclopropyl-N-{1-[1-(2,3- 380.2 0.48846
dichlorophenyl)ethyl]azetidin-3-yl}-1H-1,2,3-
triazole-4-carboxamide
744 1-cyclopropyl-N-[1-(4,5-dimethoxy-2,3-dihydro- 384.2 23.71632
1H-inden-1-yl)azetidin-3-yl]-1H-1,2,3-triazole-4-
carboxamide
745 1-cyclopropyl-N-{1-[1-(pyrazin-2-yl)ethyl]azetidin- 314.1 7.44095
3-yl}-1H-1,2,3-triazole-4-carboxamide
746 1-cyclopropyl-N-{1-[1-(2,5- 348.2 7.77636
difluorophenyl)ethyl]azetidin-3-yl}-1H-1,2,3-
triazole-4-carboxamide
747 1-cyclopropyl-N-{1-[1-(4- 330.2 1.92161
fluorophenyl)ethyl]azetidin-3-yl}-1H-1,2,3-triazole-
4-carboxamide
748 1-cyclopropyl-N-(1-{1-[3- 380.2 2.80977
(trifluoromethyl)phenyl]ethyl}azetidin-3-yl)-1H-
1,2,3-triazole-4-carboxamide
749 1-cyclopropyl-N-{1-[2,2,2-trifluoro-1-(4- 396.1 0.56478
methoxyphenyl)ethyl]azetidin-3-yl}-1H-1,2,3-
triazole-4-carboxamide
750 1-cyclopropyl-N-{1-[1-(2-hydroxy-6- 358.2 1.27817
methoxyphenyl)ethyl]azetidin-3-yl}-1H-1,2,3-
triazole-4-carboxamide
751 1-cyclopropyl-N-{1-[1-(1,3-thiazol-2- 333.2 20.98439
yl)propyl]azetidin-3-yl}-1H-1,2,3-triazole-4-
carboxamide
752 1-cyclopropyl-N-[1-(2-methoxy-1- 342.2 6.09419
phenylethyl)azetidin-3-yl]-1H-1,2,3-triazole-4-
carboxamide
753 1-cyclopropyl-N-[1-({3- 341.3 15.98565
[(methylamino)methyl]phenyl}methyl)azetidin-3-
yl]-1H-1,2,3-triazole-4-carboxamide
754 N-(1-{[3-(aminomethyl)phenyl]methyl}azetidin-3- 327.2 7.33653
yl)-1-cyclopropyl-1H-1,2,3-triazole-4-carboxamide
755 1-cyclopropyl-N-[1-(1-phenylcyclopropyl)azetidin- 324.2 30.45617
3-yl]-1H-1,2,3-triazole-4-carboxamide
756 1-cyclopropyl-N-[1-({1-[2-(methylamino)ethyl]-2- 362.3 17.04064
oxopyrrolidin-3-yl}methyl)azetidin-3-yl]-1H-1,2,3-
triazole-4-carboxamide
757 1-cyclopropyl-N-[1-(2-phenylpropan-2-yl)azetidin- 326.2 3.8847
3-yl]-1H-1,2,3-triazole-4-carboxamide
758 1-cyclopropyl-N-(1-{[4-(methylamino)oxan-2- 335.3 >50.0
yl]methyl}azetidin-3-yl)-1H-1,2,3-triazole-4-
carboxamide
759 1-cyclopropyl-N-[1-(1-phenylpropan-2-yl)azetidin- 326.2 1.39034
3-yl]-1H-1,2,3-triazole-4-carboxamide
760 1-cyclopropyl-N-{1-[1-(4-fluorophenyl)-2- 358.2 3.27451
methylpropyl]azetidin-3-yl}-1H-1,2,3-triazole-4-
carboxamide
761 1-cyclopropyl-N-{1-[1-(1H-indazol-3- 352.2 3.21089
yl)ethyl]azetidin-3-yl}-1H-1,2,3-triazole-4-
carboxamide
762 1-cyclopropyl-N-[1-(7-methoxy-2,3-dihydro-1H- 354.3 7.97221
inden-1-yl)azetidin-3-yl]-1H-1,2,3-triazole-4-
carboxamide
763 1-cyclopropyl-N-{1-[1-(2,3- 372.2 0.08855
dimethoxyphenyl)ethyl]azetidin-3-yl}-1H-1,2,3-
triazole-4-carboxamide
764 1-cyclopropyl-N-{1-[1-(2,3- 372.2 0.09346
dimethoxyphenyl)ethyl]azetidin-3-yl}-1H-1,2,3-
triazole-4-carboxamide
765 1-cyclopropyl-N-{1-[(3-oxo-2,3-dihydro-1H- 353.1 10.21303
isoindol-5-yl)methyl]azetidin-3-yl}-1H-1,2,3-
triazole-4-carboxamide
766 1-cyclopropyl-N-[1-(2,2,2-trifluoro-1- 366.2 >50.0
phenylethyl)azetidin-3-yl]-1H-1,2,3-triazole-4-
carboxamide
767 1-cyclopropyl-N-{1-[1-(2,3-dihydro-1,4- 370.1 0.57587
benzodioxin-6-yl)ethyl]azetidin-3-yl}-1H-1,2,3-
triazole-4-carboxamide
768 1-cyclopropyl-N-{1-[1-(2,6- 372.3 1.68248
dimethoxyphenyl)ethyl]azetidin-3-yl}-1H-1,2,3-
triazole-4-carboxamide
769 1-cyclopropyl-N-{1-[1-(2,6- 380.1 1.19872
dichlorophenyl)ethyl]azetidin-3-yl}-1H-1,2,3-
triazole-4-carboxamide
770 1-(2,2-difluorocyclopropyl)-N-[1-(propan-2- 286.2 4.19117
yl)azetidin-3-yl]-1H-1,2,3-triazole-4-carboxamide
771 1-cyclopropyl-N-[1-(1-{3- 355.2 4.98252
[(methylamino)methyl]phenyl}ethyl)azetidin-3-yl]-
1H-1,2,3-triazole-4-carboxamide
772 1-cyclopropyl-N-(1-{[3-(hydroxymethyl)-2- 358.2 10.81324
methoxyphenyl]methyl}azetidin-3-yl)-1H-1,2,3-
triazole-4-carboxamide
773 1-cyclopropyl-N-[1-(2-methanesulfonyl-1- 390.1 >50.0
phenylethyl)azetidin-3-yl]-1H-1,2,3-triazole-4-
carboxamide
774 1-cyclopropyl-N-{1-[1-(3-oxo-3,4-dihydro-2H-1,4- 383.2 1.61549
benzoxazin-6-yl)ethyl]azetidin-3-yl}-1H-1,2,3-
triazole-4-carboxamide
775 N-(1-{1-[2-chloro-3-(2- 406.2 0.04944
hydroxyethoxy)phenyl]ethyl}azetidin-3-yl)-1-
cyclopropyl-1H-1,2,3-triazole-4-carboxamide
776 1-cyclopropyl-N-(1-{1-[3-(2-hydroxyethoxy)-2- 402.2 0.34533
methoxyphenyl]ethyl}azetidin-3-yl)-1H-1,2,3-
triazole-4-carboxamide
777 1-cyclopropyl-N-{1-[(3-methoxy-1-methyl-1H- 332.2 5.61969
pyrazol-4-yl)methyl]azetidin-3-yl}-1H-1,2,3-
triazole-4-carboxamide
778 rel-N-{1-[(1R)-1-[4- 418.2 0.08453
(benzyloxy)phenyl]ethyl]azetidin-3-yl}-1-
cyclopropyl-1H-1,2,3-triazole-4-carboxamide
779 rel-1-cyclopropyl-N-{1-[(1R)-1-(2,5- 380.1 0.10953
dichlorophenyl)ethyl]azetidin-3-yl}-1H-1,2,3-
triazole-4-carboxamide
780 rel-1-cyclopropyl-N-{1-[(1R)-1-(2- 342.3 0.3468
methoxyphenyl)ethyl]azetidin-3-yl}-1H-1,2,3-
triazole-4-carboxamide
781 1-cyclopropyl-N-[1-(3-phenyloxetan-3-yl)azetidin- 340.2 >50.0
3-yl]-1H-1,2,3-triazole-4-carboxamide
782 1-cyclopropyl-N-(1-{[1-(2-phenylethyl)-1H- 392.4 2.61584
imidazol-4-yl]methyl}azetidin-3-yl)-1H-1,2,3-
triazole-4-carboxamide
783 1-cyclopropyl-N-{1-[1-(3- 369.1 3.13518
acetamidophenyl)ethyl]azetidin-3-yl}-1H-1,2,3-
triazole-4-carboxamide
784 N-{1-[(5-chloro-1-methyl-1H-imidazol-4- 336.2 21.02524
yl)methyl]azetidin-3-yl}-1-cyclopropyl-1H-1,2,3-
triazole-4-carboxamide
785 1-cyclopropyl-N-{1-[1-(1H-imidazol-4- 302.2 2.594
yl)ethyl]azetidin-3-yl}-1H-1,2,3-triazole-4-
carboxamide
786 1-cyclopropyl-N-{1-[cyclopropyl(4- 356.1 1.70115
fluorophenyl)methyl]azetidin-3-yl}-1H-1,2,3-
triazole-4-carboxamide
787 1-cyclopropyl-N-[1-(2-methyl-1- 340.3 1.42952
phenylpropyl)azetidin-3-yl]-1H-1,2,3-triazole-4-
carboxamide
788 rel-N-{1-[(1R)-1-[4- 0.4137
(benzyloxy)phenyl]ethyl]azetidin-3-yl}-1-
cyclopropyl-1H-1,2,3-triazole-4-carboxamide
789 rel-1-cyclopropyl-N-{1-[(1R)-1-(2,5- 31.57011
dichlorophenyl)ethyl]azetidin-3-yl}-1H-1,2,3-
triazole-4-carboxamide
790 rel-1-cyclopropyl-N-{1-[(1R)-1-(2- 28.78884
methoxyphenyl)ethyl]azetidin-3-yl}-1H-1,2,3-
triazole-4-carboxamide
791 1-cyclopropyl-N-{1-[1-(pyridin-2- 327.1 2.47462
yl)propyl]azetidin-3-yl}-1H-1,2,3-triazole-4-
carboxamide
792 N-{1-[(1-benzyl-1H-pyrazol-4-yl)methyl]azetidin-3- 378.2 0.01635
yl}-1-cyclopropyl-1H-1,2,3-triazole-4-carboxamide
793 1-cyclopropyl-N-[1-(6-methoxy-1,2,3,4- 368.2 9.91987
tetrahydronaphthalen-1-yl)azetidin-3-yl]-1H-1,2,3-
triazole-4-carboxamide
794 N-(1-{[3-(aminomethyl)-2- 357.3 32.30456
methoxyphenyl]methyl}azetidin-3-yl)-1-
cyclopropyl-1H-1,2,3-triazole-4-carboxamide
795 N-{1-[(1-benzyl-1H-imidazol-4-yl)methyl]azetidin- 378.3 7.14819
3-yl}-1-cyclopropyl-1H-1,2,3-triazole-4-
carboxamide
796 N-(1-{1-[2-(benzyloxy)phenyl]ethyl}azetidin-3-yl)- 418.2 0.4215
1-cyclopropyl-1H-1,2,3-triazole-4-carboxamide
797 1-cyclopropyl-N-(1-{1-[4-(1H-imidazol-1- 378.1 1.56764
yl)phenyl]ethyl}azetidin-3-yl)-1H-1,2,3-triazole-4-
carboxamide
798 1-cyclopropyl-N-{1-[1-(2- 344.2 0.42506
fluorophenyl)propyl]azetidin-3-yl}-1H-1,2,3-
triazole-4-carboxamide
799 1-cyclopropyl-N-[2,2-dimethyl-1-(propan-2- 278.2 9.59545
yl)azetidin-3-yl]-1H-1,2,3-triazole-4-carboxamide
800 N-(1-{1-[4-(benzyloxy)-2- 448.3 0.96532
methoxyphenyl]ethyl}azetidin-3-yl)-1-cyclopropyl-
1H-1,2,3-triazole-4-carboxamide
801 1-cyclopropyl-N-{1-[1-(2,4- 372.3 1.05608
dimethoxyphenyl)ethyl]azetidin-3-yl}-1H-1,2,3-
triazole-4-carboxamide
802 N-(1-{[4-(benzyloxy)phenyl]methyl}azetidin-3-yl)- 404.2 0.08341
1-cyclopropyl-1H-1,2,3-triazole-4-carboxamide
803 N-{1-[1-(2-chloro-3-methoxyphenyl)ethyl]azetidin- 376.2 0.06945
3-yl}-1-cyclopropyl-1H-1,2,3-triazole-4-
carboxamide
804 rel-1-cyclopropyl-N-{1-[(1R)-1-(2,3- 372.2 0.04426
dimethoxyphenyl)ethyl]azetidin-3-yl}-1H-1,2,3-
triazole-4-carboxamide
805 rel-1-cyclopropyl-N-{1-[(1S)-1-(2,3- 42.35178
dimethoxyphenyl)ethyl]azetidin-3-yl}-1H-1,2,3-
triazole-4-carboxamide
806 1-cyclopropyl-N-(1-{[1-(2-phenylethyl)-1H-pyrazol- 392.2 0.97043
4-yl]methyl}azetidin-3-yl)-1H-1,2,3-triazole-4-
carboxamide
807 5-cyclopropyl-N-(1-{[1-(2-phenylethyl)-1H-pyrazol- 403.2 0.52752
4-yl]methyl}azetidin-3-yl)pyridazine-3-carboxamide
808 1-cyclopropyl-N-[1-(propan-2-yl)piperidin-3-yl]- 278.2 19.78446
1H-1,2,3-triazole-4-carboxamide
809 N-{1-[(1-benzyl-1H-imidazol-5-yl)methyl]azetidin- 378.3 >50.0
3-yl}-1-cyclopropyl-1H-1,2,3-triazole-4-
carboxamide
810 1-cyclopropyl-N-(1-{[1-(2-phenylethyl)-1H- 392.3 9.28801
imidazol-5-yl]methyl}azetidin-3-yl)-1H-1,2,3-
triazole-4-carboxamide
811 N-{1-[(3-chloro-1-methyl-1H-pyrazol-4- 336.1 1.2247
yl)methyl]azetidin-3-yl}-1-cyclopropyl-1H-1,2,3-
triazole-4-carboxamide
812 1-cyclopropyl-N-[1-({2-methoxy-3- 371.2 41.20464
[(methylamino)methyl]phenyl}methyl)azetidin-3-
yl]-1H-1,2,3-triazole-4-carboxamide
813 1-cyclopropyl-N-{1-[1-(4-fluorophenyl)-2- 346.2 15.19205
hydroxyethyl]azetidin-3-yl}-1H-1,2,3-triazole-4-
carboxamide
814 5-cyclopropyl-N-(1-ethylazetidin-3-yl)pyridazine-3- 247.2 0.59765
carboxamide
815 5-cyclopropyl-N-[1-(propan-2-yl)piperidin-3- 289.2 18.67277
yl]pyridazine-3-carboxamide
816 N-(1-{1-[4-(benzyloxy)phenyl]-2,2,2- 472.3 >50.0
trifluoroethyl}azetidin-3-yl)-1-cyclopropyl-1H-
1,2,3-triazole-4-carboxamide
817 N-(1-{1-[4-(benzyloxy)-2- 452.2 0.10155
chlorophenyl]ethyl}azetidin-3-yl)-1-cyclopropyl-
1H-1,2,3-triazole-4-carboxamide
818 1-cyclopropyl-N-(1-{[4-(3- 386.3 3.00034
methoxypropoxy)phenyl]methyl}azetidin-3-yl)-1H-
1,2,3-triazole-4-carboxamide
819 1-cyclopropyl-N-(1-{[4-(2,3- 388.2 1.99348
dihydroxypropoxy)phenyl]methyl}azetidin-3-yl)-
1H-1,2,3-triazole-4-carboxamide
820 N-(5-hydroxy-3-oxo-3,4-dihydro-2H-1,4- 320 >50.0
benzoxazin-7-yl)-3-(methylamino)cyclohexane-1-
carboxamide
821 1-cyclopropyl-N-{1-[1-(4- 342.3 0.78452
methoxyphenyl)ethyl]azetidin-3-yl}-1H-1,2,3-
triazole-4-carboxamide
822 1-cyclopropyl-N-(1-{[4-(2- 372.3 1.96551
hydroxypropoxy)phenyl]methyl}azetidin-3-yl)-1H-
1,2,3-triazole-4-carboxamide
823 1-cyclopropyl-N-(1-{[4-(3- 372.2 3.21621
hydroxypropoxy)phenyl]methyl}azetidin-3-yl)-1H-
1,2,3-triazole-4-carboxamide
824 1-cyclopropyl-N-{1-[(4- 314.1 0.88212
hydroxyphenyl)methyl]azetidin-3-yl}-1H-1,2,3-
triazole-4-carboxamide
825 5-cyclopropyl-N-(1-methylazetidin-3-yl)pyridazine- 233.2 0.39067
3-carboxamide
826 1-cyclopropyl-N-{1-[(4- 328.2 1.83875
methoxyphenyl)methyl]azetidin-3-yl}-1H-1,2,3-
triazole-4-carboxamide
827 1-cyclopropyl-N-(1-{[4-(2- 358.3 1.37605
hydroxyethoxy)phenyl]methyl}azetidin-3-yl)-1H-
1,2,3-triazole-4-carboxamide
828 1-cyclopropyl-N-(1-{[4-(pyridin-4- 405.2 1.03298
ylmethoxy)phenyl]methyl}azetidin-3-yl)-1H-1,2,3-
triazole-4-carboxamide
829 1-cyclopropyl-N-[1-(1-{4-[2-(morpholin-4-yl)-2- 455.3 0.71252
oxoethoxy]phenyl}ethyl)azetidin-3-yl]-1H-1,2,3-
triazole-4-carboxamide
830 1-cyclopropyl-N-(1-{[4-(2- 372.3 2.06713
methoxyethoxy)phenyl]methyl}azetidin-3-yl)-1H-
1,2,3-triazole-4-carboxamide
831 rel-N-{1-[(1S)-1-[2-chloro-3-(2- 406.2 0.05775
hydroxyethoxy)phenyl]ethyl]azetidin-3-yl}-1-
cyclopropyl-1H-1,2,3-triazole-4-carboxamide
832 rel-N-{1-[(1R)-1-[2-chloro-3-(2- 406.2 14.28102
hydroxyethoxy)phenyl]ethyl]azetidin-3-yl}-1-
cyclopropyl-1H-1,2,3-triazole-4-carboxamide
833 N-{1-[(3-chloro-1-methyl-1H-pyrazol-4- 347.1 0.94017
yl)methyl]azetidin-3-yl}-5-cyclopropylpyridazine-3-
carboxamide
834 1-cyclopropyl-N-[2-(dimethylamino)ethyl]-1H- 224.3 >50.0
1,2,3-triazole-4-carboxamide
835 1-cyclopropyl-N-[1-(1-{2-methoxy-3- 385.3 0.77956
[(methylamino)methyl]phenyl}ethyl)azetidin-3-yl]-
1H-1,2,3-triazole-4-carboxamide
836 N-(1-{1-[4-(benzyloxy)phenyl]ethyl}azetidin-3-yl)- 429.3 0.02651
5-cyclopropylpyridazine-3-carboxamide
837 N-{1-[(1S)-1-(3-chlorophenyl)propyl]azetidin-3-yl}- 360.3 0.33977
1-cyclopropyl-1H-1,2,3-triazole-4-carboxamide
838 5-cyclopropyl-N-(1-{[1-(2-phenylethyl)-1H- 403.3 0.49607
imidazol-4-yl]methyl}azetidin-3-yl)pyridazine-3-
carboxamide
839 N-[1-(azetidin-3-yl)ethyl]-5-cyclopropylpyridazine- 247.2 18.24266
3-carboxamide
840 5-cyclopropyl-N-{1-[1-(propan-2-yl)azetidin-3- 289.2 36.83929
yl]ethyl}pyridazine-3-carboxamide
841 5-cyclopropyl-N-{1-[(1S)-1-(2- 353.3 5.00737
methoxyphenyl)ethyl]azetidin-3-yl}pyridazine-3-
carboxamide
842 5-cyclopropyl-N-{1-[(1R)-1-(2- 353.3 0.18913
methoxyphenyl)ethyl]azetidin-3-yl}pyridazine-3-
carboxamide
843 (Β±)-cis-N-(1-{[3- 382.2 1.15555
(benzyloxy)cyclobutyl]methyl}azetidin-3-yl)-1-
cyclopropyl-1H-1,2,3-triazole-4-carboxamide
844 1-cyclopropyl-N-[1-(1-{4-[2-oxo-2-(piperidin-1- 453.3 1.54771
yl)ethoxy]phenyl}ethyl)azetidin-3-yl]-1H-1,2,3-
triazole-4-carboxamide
845 N-{1-[1-(2-chloro-4-methoxyphenyl)ethyl]azetidin- 376.2 0.08798
3-yl}-1-cyclopropyl-1H-1,2,3-triazole-4-
carboxamide
846 1-cyclopropyl-N-(1-{[4-(1,3-thiazol-4- 411.2 1.08508
ylmethoxy)phenyl]methyl}azetidin-3-yl)-1H-1,2,3-
triazole-4-carboxamide
847 N-[1-(1-{4-[(3- 452.2 0.27389
chlorophenyl)methoxy]phenyl}ethyl)azetidin-3-yl]-
1-cyclopropyl-1H-1,2,3-triazole-4-carboxamide
848 N-[1-(1-{4-[(4- 452.2 0.06933
chlorophenyl)methoxy]phenyl}ethyl)azetidin-3-yl]-
1-cyclopropyl-1H-1,2,3-triazole-4-carboxamide
849 1-cyclopropyl-N-(1-{[4-(pyridin-2- 405.1 2.66119
ylmethoxy)phenyl]methyl}azetidin-3-yl)-1H-1,2,3-
triazole-4-carboxamide
850 1-cyclopropyl-N-(1-{1-[4-(piperidin-3- 425.2 3.32842
ylmethoxy)phenyl]ethyl}azetidin-3-yl)-1H-1,2,3-
triazole-4-carboxamide
851 N-{1-[1-(2-chloro-3-methoxyphenyl)ethyl]azetidin- 387.2 0.07206
3-yl}-5-cyclopropylpyridazine-3-carboxamide
852 (Β±)-trans-N-(1-{[3- 382.3 0.98162
(benzyloxy)cyclobutyl]methyl}azetidin-3-yl)-1-
cyclopropyl-1H-1,2,3-triazole-4-carboxamide
853 1-cyclopropyl-N-(1-{1-[4-(2- 432.3 0.77613
phenylethoxy)phenyl]ethyl}azetidin-3-yl)-1H-1,2,3-
triazole-4-carboxamide
854 1-cyclopropyl-N-{1-[1-(4-{[4- 475.3 0.96536
(methylcarbamoyl)phenyl]methoxy}phenyl)ethyl]azetidin-
3-yl}-1H-1,2,3-triazole-4-carboxamide
855 1-cyclopropyl-N-[1-(1-{4-[(4- 448.3 0.15904
methoxyphenyl)methoxy]phenyl}ethyl)azetidin-3-
yl]-1H-1,2,3-triazole-4-carboxamide
856 5-cyclopropyl-N-{1-[1-(4- 353.2 0.60267
methoxyphenyl)ethyl]azetidin-3-yl}pyridazine-3-
carboxamide
857 1-cyclopropyl-N-[1-(1-{4-[2- 399.2 1.97865
(dimethylamino)ethoxy]phenyl}ethyl)azetidin-3-yl]-
1H-1,2,3-triazole-4-carboxamide
858 1-cyclopropyl-N-[1-(1-{4-[3- 413.2 4.79409
(dimethylamino)propoxy]phenyl}ethyl)azetidin-3-
yl]-1H-1,2,3-triazole-4-carboxamide
859 N-{1-[1-(2-chlorophenyl)ethyl]azetidin-3-yl}-1- 346.2 0.16007
cyclopropyl-1H-1,2,3-triazole-4-carboxamide
860 N-{1-[1-(5-chloro-2-methoxyphenyl)ethyl]azetidin- 376.2 2.79163
3-yl}-1-cyclopropyl-1H-1,2,3-triazole-4-
carboxamide
861 5-cyclopropyl-N-{1-[1-(2,3- 383.2 0.12148
dimethoxyphenyl)ethyl]azetidin-3-yl}pyridazine-3-
carboxamide
862 N-(1-{1-[4-(benzylamino)phenyl]ethyl}azetidin-3- 417.3 0.334
yl)-1-cyclopropyl-1H-1,2,3-triazole-4-carboxamide
863 N-{1-[1-(4-benzamidophenyl)ethyl]azetidin-3-yl}-1- 431.3 1.73815
cyclopropyl-1H-1,2,3-triazole-4-carboxamide
864 1-cyclopropyl-N-(1-{1-[4-(2,2- 398.3 3.14078
dimethylpropoxy)phenyl]ethyl}azetidin-3-yl)-1H-
1,2,3-triazole-4-carboxamide
865 1-cyclopropyl-N-{1-[1-(5-methoxypyrimidin-2- 344.2 1.6379
yl)ethyl]azetidin-3-yl}-1H-1,2,3-triazole-4-
carboxamide
866 N-{1-[(1S)-1-(3-chlorophenyl)propyl]azetidin-3-yl}- 371.2 0.35518
5-cyclopropylpyridazine-3-carboxamide
867 5-cyclopropyl-N-[3- 249.2 >50.0
(dimethylamino)propyl]pyridazine-3-carboxamide
868 N-(1-{1-[4-(benzyloxy)-3- 452.2 0.92507
chlorophenyl]ethyl}azetidin-3-yl)-1-cyclopropyl-
1H-1,2,3-triazole-4-carboxamide
869 5-cyclopropyl-N-[2- 235.2 21.10972
(dimethylamino)ethyl]pyridazine-3-carboxamide
913 5-cyclopropyl-N-[1-(propan-2-yl)azetidin-3-yl]-1H- 249.2 1.69797
imidazole-2-carboxamide
914 5-cyclopropyl-N-{1-[(1S)-1-phenylethyl]azetidin-3- 311.2 0.72872
yl}-1H-imidazole-2-carboxamide
915 5-cyclopropyl-N-{1-[(1R)-1-phenylethyl]azetidin-3- 311.2 >50.0
yl}-1H-imidazole-2-carboxamide
916 5-cyclopropyl-N-[1-(propan-2-yl)piperidin-4- 289.3 29.10492
yl]pyridazine-3-carboxamide
917 5-cyclopropyl-N-(1-methylpiperidin-4- 261.2 >50.0
yl)pyridazine-3-carboxamide
918 5-cyclopropyl-N-(1-methylpiperidin-3- 261.3 >50.0
yl)pyridazine-3-carboxamide
*IC50 values are an average of n = 1 to n = 50

TABLE 6A
SMYD2
Biochem
LCMS IC50
Cpd. No. Chemical Name M + H (ΞΌM)*
919 1-cyclopropyl-N-(1-isopropylazetidin-3-yl)-1H- 249.2 4.6
imidazole-4-carboxamide
920 N-(1-(1-(3-(2-chlorophenyl)-1H-indazol-5- 462.2 >50
yl)ethyl)azetidin-3-yl)-1-cyclopropyl-1H-1,2,3-
triazole-4-carboxamide
921 1-cyclopropyl-N-(3-(dimethylamino)propyl)-1H- 238.3 5.4
1,2,3-triazole-4-carboxamide
922 1-cyclopropyl-N-(1-(1-(4- 417.2 0.65
((phenylamino)methyl)phenyl)ethyl)azetidin-3-yl)-
1H-1,2,3-triazole-4-carboxamide
923 1-cyclopropyl-N-(1-(1-(5-methoxypyridin-2- 343.3 2.7
yl)ethyl)azetidin-3-yl)-1H-1,2,3-triazole-4-
carboxamide
924 1-cyclopropyl-N-(1-((6-(phenylamino)pyridin-3- 390.2
yl)methyl)azetidin-3-yl)-1H-1,2,3-triazole-4-
carboxamide
925 1-cyclopropyl-N-(1-(1-(4-(piperidin-4- 425.3 4.3
ylmethoxy)phenyl)ethyl)azetidin-3-yl)-1H-1,2,3-
triazole-4-carboxamide
926 N-(1-((6-(benzylamino)pyridin-3-yl)methyl)azetidin- 404.2
3-yl)-1-cyclopropyl-1H-1,2,3-triazole-4-carboxamide
927 N-(1-((1-(4-chlorobenzyl)-1H-pyrazol-4- 411.2 0.011
yl)methyl)azetidin-3-yl)-4-cyclopropyl-1H-
imidazole-2-carboxamide
928 5-cyclopropyl-N-(1-(4-((1-methyl-1H-pyrazol-4- 419.3 0.61
yl)methoxy)benzyl)azetidin-3-yl)pyridazine-3-
carboxamide
929 N-(1-((1-(4-chlorobenzyl)-1H-pyrazol-4- 423.2 0.0012
yl)methyl)azetidin-3-yl)-5-cyclopropylpyridazine-3-
carboxamide
930 N-(1-((1-(4-chlorobenzyl)-1H-pyrazol-4- 422.7 0.0033
yl)methyl)azetidin-3-yl)-4-cyclopropylpicolinamide
931 N-(1-((1-benzyl-1H-1,2,3-triazol-4- 379.3 11.1
yl)methyl)azetidin-3-yl)-1-cyclopropyl-1H-1,2,3-
triazole-4-carboxamide
932 1-cyclopropyl-N-(1-((1-(4-methoxybenzyl)-1H- 408.2 0.028
pyrazol-4-yl)methyl)azetidin-3-yl)-1H-1,2,3-triazole-
4-carboxamide
933 N-(1-((1-benzyl-1H-pyrazol-4-yl)methyl)azetidin-3- 389.2 0.0078
yl)-5-cyclopropylpyridazine-3-carboxamide
934 5-cyclopropyl-N-(1-(1-(3- 353.2 0.69
methoxyphenyl)ethyl)azetidin-3-yl)pyridazine-3-
carboxamide
935 1-cyclopropyl-N-(1-(1-(2-methyl-2H-indazol-5- 366.2 1.6
yl)ethyl)azetidin-3-yl)-1H-1,2,3-triazole-4-
carboxamide
936 N-(1-((1-(benzo[d]thiazol-5-ylmethyl)-1H-pyrazol-4- 435.2 0.080
yl)methyl)azetidin-3-yl)-1-cyclopropyl-1H-1,2,3-
triazole-4-carboxamide
937 1-cyclopropyl-N-(1-((1-((4-methyloxazol-2- 383.2 0.12
yl)methyl)-1H-pyrazol-4-yl)methyl)azetidin-3-yl)-
1H-1,2,3-triazole-4-carboxamide
938 N-(1-(1-(2-chloro-5-methoxyphenyl)ethyl)azetidin- 376.2 0.13
3-yl)-1-cyclopropyl-1H-1,2,3-triazole-4-carboxamide
939 N-(1-(1-(4-(benzyloxy)-3- 448.3 3.6
methoxyphenyl)ethyl)azetidin-3-yl)-1-cyclopropyl-
1H-1,2,3-triazole-4-carboxamide
940 N-(1-((1H-pyrazol-4-yl)methyl)azetidin-3-yl)-1- 288.2 7.7
cyclopropyl-1H-1,2,3-triazole-4-carboxamide
941 1-cyclopropyl-N-(1-((1-(4-(methylthio)benzyl)-1H- 424.2 0.028
pyrazol-4-yl)methyl)azetidin-3-yl)-1H-1,2,3-triazole-
4-carboxamide
942 N-(1-((1-(2-chlorobenzyl)-1H-pyrazol-4- 412.1 0.11
yl)methyl)azetidin-3-yl)-1-cyclopropyl-1H-1,2,3-
triazole-4-carboxamide
943 1-cyclopropyl-N-(1-((1-(4-(trifluoromethyl)benzyl)- 446.2 0.014
1H-pyrazol-4-yl)methyl)azetidin-3-yl)-1H-1,2,3-
triazole-4-carboxamide
944 1-cyclopropyl-N-(1-((1-(oxazol-2-ylmethyl)-1H- 369.2 0.92
pyrazol-4-yl)methyl)azetidin-3-yl)-1H-1,2,3-triazole-
4-carboxamide
945 1-cyclopropyl-N-(1-((1-(thiazol-4-ylmethyl)-1H- 385.2 1.2
pyrazol-4-yl)methyl)azetidin-3-yl)-1H-1,2,3-triazole-
4-carboxamide
946 1-cyclopropyl-N-(1-((1-ethyl-1H-pyrazol-4- 316.2 2.0
yl)methyl)azetidin-3-yl)-1H-1,2,3-triazole-4-
carboxamide
947 N-(1-((1-(4-(tert-butyl)benzyl)-1H-pyrazol-4- 434.3 0.056
yl)methyl)azetidin-3-yl)-1-cyclopropyl-1H-1,2,3-
triazole-4-carboxamide
948 N-(1-((1-(cyclohexylmethyl)-1H-pyrazol-4- 384.3 0.36
yl)methyl)azetidin-3-yl)-1-cyclopropyl-1H-1,2,3-
triazole-4-carboxamide
949 1-cyclopropyl-N-(1-((1-((tetrahydro-2H-pyran-4- 386.2 2.4
yl)methyl)-1H-pyrazol-4-yl)methyl)azetidin-3-yl)-
1H-1,2,3-triazole-4-carboxamide
950 1-cyclopropyl-N-(1-((1-((tetrahydrofuran-3- 372.3 2.0
yl)methyl)-1H-pyrazol-4-yl)methyl)azetidin-3-yl)-
1H-1,2,3-triazole-4-carboxamide
951 1-cyclopropyl-N-(1-((1-(4-fluorobenzyl)-1H-pyrazol- 396.2 0.022
4-yl)methyl)azetidin-3-yl)-1H-1,2,3-triazole-4-
carboxamide
952 1-cyclopropyl-N-(1-(1-(1-methyl-1H-indazol-5- 366.2 1.63
yl)ethyl)azetidin-3-yl)-1H-1,2,3-triazole-4-
carboxamide
953 N-(1-(4-((1H-pyrazol-1-yl)methyl)benzyl)azetidin-3- 378.3 5.6
yl)-1-cyclopropyl-1H-1,2,3-triazole-4-carboxamide
954 N-(1-(4-((1H-pyrazol-1-yl)methyl)benzyl)azetidin-3- 389.3 2.4
yl)-5-cyclopropylpyridazine-3-carboxamide
955 N-(1-((1-benzyl-1H-pyrazol-4-yl)methyl)azetidin-3- 378.2 0.073
yl)-5-cyclopropylisoxazole-3-carboxamide
956 N-(1-(1-(2-chloro-3-(2-hydroxy-2- 434.2 2.6
methylpropoxy)phenyl)ethyl)azetidin-3-yl)-1-
cyclopropyl-1H-1,2,3-triazole-4-carboxamide
957 1-cyclopropyl-N-(1-(1-(4-((4- 448.3 0.16
methoxybenzyl)oxy)phenyl)ethyl)azetidin-3-yl)-1H-
1,2,3-triazole-4-carboxamide
958 5-cyclopropyl-N-(1-(1-(4- 353.2 0.60
methoxyphenyl)ethyl)azetidin-3-yl)pyridazine-3-
carboxamide
959 1-cyclopropyl-N-(1-(1-(4-(2- 399.2 2.0
(dimethylamino)ethoxy)phenyl)ethyl)azetidin-3-yl)-
1H-1,2,3-triazole-4-carboxamide
960 1-cyclopropyl-N-(1-(1-(4- 432.3 0.78
phenethoxyphenyl)ethyl)azetidin-3-yl)-1H-1,2,3-
triazole-4-carboxamide
961 4-cyclopropyl-N-(1-isopropylazetidin-3- 260.2 1.3
yl)picolinamide
962 4-cyclopropyl-N-(1-(1-(2,5- 390.1 0.48
dichlorophenyl)ethyl)azetidin-3-yl)picolinamide
963 1-cyclopropyl-N-(1-(1-(4-((4- 475.3 0.97
(methylcarbamoyl)benzyl)oxy)phenyl)ethyl)azetidin-
3-yl)-1H-1,2,3-triazole-4-carboxamide
964 N-(1-(1-(2-chloro-3-(2- 416.2 10.5
hydroxyethoxy)phenyl)ethyl)azetidin-3-yl)-4-
cyclopropylpicolinamide
965 N-(1-(1-(2-chloro-3-methoxyphenyl)ethyl)azetidin- 387.2 0.072\
3-yl)-5-cyclopropylpyridazine-3-carboxamide
966 N-(1-((1-benzyl-1H-pyrazol-4-yl)methyl)azetidin-3- 388.3 0.013
yl)-4-cyclopropylpicolinamide
967 N-(1-(4-(benzyloxy)benzyl)azetidin-3-yl)-4- 414.2 0.15
cyclopropylpicolinamide
968 1-cyclopropyl-N-(1-(1-(4-(2,2,2- 410.2 1.7
trifluoroethoxy)phenyl)ethyl)azetidin-3-yl)-1H-1,2,3-
triazole-4-carboxamide
969 rac-N-(1-(((1r,3r)-3- 382.3 0.98
(benzyloxy)cyclobutyl)methyl)azetidin-3-yl)-1-
cyclopropyl-1H-1,2,3-triazole-4-carboxamide
970 N-(1-(1-(5-chloro-2- 412.2 5.1
(difluoromethoxy)phenyl)ethyl)azetidin-3-yl)-1-
cyclopropyl-1H-1,2,3-triazole-4-carboxamide
971 1-cyclopropyl-N-(1-(1-(4-((4- 432.3 0.088
methylbenzyl)oxy)phenyl)ethyl)azetidin-3-yl)-1H-
1,2,3-triazole-4-carboxamide
972 1-cyclopropyl-N-(1-(4-(pyridin-3- 405.3 1.3
ylmethoxy)benzyl)azetidin-3-yl)-1H-1,2,3-triazole-4-
carboxamide
973 N-(1-(1-(2-chloro-3-(2,3- 436.2 >50
dihydroxypropoxy)phenyl)ethyl)azetidin-3-yl)-1-
cyclopropyl-1H-1,2,3-triazole-4-carboxamide
974 1-cyclopropyl-N-(1-(1-(4- 418.3 0.87
(phenoxymethyl)phenyl)ethyl)azetidin-3-yl)-1H-
1,2,3-triazole-4-carboxamide
975 N-(1-(1-(2-chloro-3-(2- 419.3 5.4
(methylamino)ethoxy)phenyl)ethyl)azetidin-3-yl)-1-
cyclopropyl-1H-1,2,3-triazole-4-carboxamide
976 N-(1-(1-(5-chloro-2- 414.2 1.8
(trifluoromethyl)phenyl)ethyl)azetidin-3-yl)-1-
cyclopropyl-1H-1,2,3-triazole-4-carboxamide
977 N-(1-(1-(2-chloro-3-(2- 433.2 7.5
(dimethylamino)ethoxy)phenyl)ethyl)azetidin-3-yl)-
1-cyclopropyl-1H-1,2,3-triazole-4-carboxamide
978 N-(1-(1-(2-chloro-3-(2- 420.2 1.1
hydroxypropoxy)phenyl)ethyl)azetidin-3-yl)-1-
cyclopropyl-1H-1,2,3-triazole-4-carboxamide
979 1-cyclopropyl-N-(1-(1-methylpiperidin-2-yl)ethyl)- 278.2 >50
1H-1,2,3-triazole-4-carboxamide
980 N-(1-(2-(4-(benzyloxy)phenyl)propan-2-yl)azetidin- 432.3 0.99
3-yl)-1-cyclopropyl-1H-1,2,3-triazole-4-carboxamide
981 5-cyclopropyl-N-(1-(1-methylpiperidin-2- 289.2 >50
yl)ethyl)pyridazine-3-carboxamide
982 1-cyclopropyl-N-(1-((1-(3-methoxybenzyl)-1H- 408.3 0.169
pyrazol-4-yl)methyl)azetidin-3-yl)-1H-1,2,3-triazole-
4-carboxamide
983 1-cyclopropyl-N-(1-(4-(1-hydroxy-2- 418.2 1.39
phenylethyl)benzyl)azetidin-3-yl)-1H-1,2,3-triazole-
4-carboxamide
984 rac-1-cyclopropyl-N-((R)-2,2-dimethyl-1-((R)-1- 340.2 18.9
phenylethyl)azetidin-3-yl)-1H-1,2,3-triazole-4-
carboxamide
985 N-(1-((1-(4-chlorobenzyl)-1H-pyrazol-4- 412.2 0.0039
yl)methyl)azetidin-3-yl)-1-cyclopropyl-1H-1,2,3-
triazole-4-carboxamide
986 N-(1-((1-benzyl-1H-pyrazol-4-yl)methyl)azetidin-3- 377.3 >50
yl)-5-cyclopropyl-1H-imidazole-2-carboxamide
987 N-(1-((1-(3-chlorobenzyl)-1H-pyrazol-4- 412.2 0.024
yl)methyl)azetidin-3-yl)-1-cyclopropyl-1H-1,2,3-
triazole-4-carboxamide
988 N-(1-(4-((1,3,4-thiadiazol-2- 412.2 1.9
yl)methoxy)benzyl)azetidin-3-yl)-1-cyclopropyl-1H-
1,2,3-triazole-4-carboxamide
989 N-(1-(1-(5-chloro-2-(4- 456.2 >50.0
fluorophenoxy)phenyl)ethyl)azetidin-3-yl)-1-
cyclopropyl-1H-1,2,3-triazole-4-carboxamide
990 1-cyclopropyl-N-(1-(1-(4-(piperidin-3- 425.2 3.3
ylmethoxy)phenyl)ethyl)azetidin-3-yl)-1H-1,2,3-
triazole-4-carboxamide
991 1-cyclopropyl-N-(1-((1-(thiazol-2-ylmethyl)-1H- 385.2 0.76
pyrazol-4-yl)methyl)azetidin-3-yl)-1H-1,2,3-triazole-
4-carboxamide
992 1-cyclopropyl-N-(1-(4-(pyridin-2- 405.1 2.7
ylmethoxy)benzyl)azetidin-3-yl)-1H-1,2,3-triazole-4-
carboxamide
993 1-cyclopropyl-N-(1-((1-(4-methylbenzyl)-1H- 392.3 0.016
pyrazol-4-yl)methyl)azetidin-3-yl)-1H-1,2,3-triazole-
4-carboxamide
994 1-cyclopropyl-N-(1-(1-(6-oxo-1,6-dihydropyridin-3- 329.2 5.4
yl)ethyl)azetidin-3-yl)-1H-1,2,3-triazole-4-
carboxamide
995 1-cyclopropyl-N-(1-((1-(2-methoxybenzyl)-1H- 408.2 1.3
pyrazol-4-yl)methyl)azetidin-3-yl)-1H-1,2,3-triazole-
4-carboxamide
996 N-(1-(1-(4-((4- 452.2 0.069
chlorobenzyl)oxy)phenyl)ethyl)azetidin-3-yl)-1-
cyclopropyl-1H-1,2,3-triazole-4-carboxamide
997 N-(1-(1-(4-((3- 452.2 0.27
chlorobenzyl)oxy)phenyl)ethyl)azetidin-3-yl)-1-
cyclopropyl-1H-1,2,3-triazole-4-carboxamide
998 1-cyclopropyl-N-(1-((1-isobutyl-1H-pyrazol-4- 343.4 2.4
yl)methyl)azetidin-3-yl)-1H-1,2,3-triazole-4-
carboxamide
999 1-cyclopropyl-N-(1-(4-(thiazol-4- 411.2 1.1
ylmethoxy)benzyl)azetidin-3-yl)-1H-1,2,3-triazole-4-
carboxamide
1000 1-cyclopropyl-N-(1-(piperidin-2-yl)ethyl)-1H-1,2,3- 264.1 >50
triazole-4-carboxamide
1001 N-(1-((1-(cyclobutylmethyl)-1H-pyrazol-4- 356.2 1.4
yl)methyl)azetidin-3-yl)-1-cyclopropyl-1H-1,2,3-
triazole-4-carboxamide
1002 N-(1-(1-(2-chloro-4-methoxyphenyl)ethyl)azetidin- 376.2 0.088
3-yl)-1-cyclopropyl-1H-1,2,3-triazole-4-carboxamide
1003 5-cyclopropyl-N-(1-(piperidin-2-yl)ethyl)pyridazine- 275.2 19.0
3-carboxamide
1004 1-cyclopropyl-N-(1-(1-(4-(2-oxo-2-(piperidin-1- 453.3 1.5
yl)ethoxy)phenyl)ethyl)azetidin-3-yl)-1H-1,2,3-
triazole-4-carboxamide
1005 4-cyclopropyl-N-(1-(1-(2,3- 381.9 0.13
dimethoxyphenyl)ethyl)azetidin-3-yl)picolinamide
1006 1-cyclopropyl-N-(1-((1-(cyclopropylmethyl)-1H- 342.2 1.7
pyrazol-4-yl)methyl)azetidin-3-yl)-1H-1,2,3-triazole-
4-carboxamide
1007 N-(1-((1-benzyl-1H-pyrazol-4-yl)methyl)azetidin-3- 395.1 0.072
yl)-5-cyclopropyl-1,3,4-thiadiazole-2-carboxamide
1008 rac-N-(1-(((1s,3s)-3- 382.2 1.2
(benzyloxy)cyclobutyl)methyl)azetidin-3-yl)-1-
cyclopropyl-1H-1,2,3-triazole-4-carboxamide
1009 N-(1-(1-(3-(2-aminoethoxy)-2- 405.3 5.7
chlorophenyl)ethyl)azetidin-3-yl)-1-cyclopropyl-1H-
1,2,3-triazole-4-carboxamide
1012 N-(1-((1-(4-chlorobenzyl)-1H-pyrazol-4- 411.1
yl)methyl)azetidin-3-yl)-1-cyclopropyl-1H-
imidazole-4-carboxamide
1017 1-cyclopropyl-N-(1-((1-((1-methyl-1H-pyrazol-4- 382.2
yl)methyl)-1H-pyrazol-4-yl)methyl)azetidin-3-yl)-
1H-1,2,3-triazole-4-carboxamide
1020 N-(1-(1-(4-((4- 475.3 0.95
acetamidobenzyl)oxy)phenyl)ethyl)azetidin-3-yl)-1-
cyclopropyl-1H-1,2,3-triazole-4-carboxamide
1021 N-(1-((1-benzyl-1H-pyrazol-4-yl)methyl)azetidin-3- 379.2 0.065
yl)-5-cyclopropyl-1,3,4-oxadiazole-2-carboxamide
1022 N-(1-((1-benzyl-1H-pyrazol-4-yl)methyl)azetidin-3- 377.2 0.073
yl)-1-cyclopropyl-1H-imidazole-4-carboxamide
1023 5-cyclopropyl-N-((1R,3s,5S)-8-methyl-8- 287.2 6.3
azabicyclo[3.2.1]octan-3-yl)pyridazine-3-
carboxamide
1024 5-cyclopropyl-N-((1R,3r,5S)-8-methyl-8- 287.2 >50
azabicyclo[3.2.1]octan-3-yl)pyridazine-3-
carboxamide
1025 1-cyclopropyl-N-(1-(4-((1-methyl-1H-pyrazol-4- 408.3 1.2
yl)methoxy)benzyl)azetidin-3-yl)-1H-1,2,3-triazole-
4-carboxamide
1026 rac-1-cyclopropyl-N-((R)-2,2-dimethyl-1-((S)-1- 340.3 0.91
phenylethyl)azetidin-3-yl)-1H-1,2,3-triazole-4-
carboxamide
1028 N-(1-((1-(4-chlorobenzyl)-1H-pyrazol-4- 413.2
yl)methyl)azetidin-3-yl)-5-cyclopropyl-1,3,4-
oxadiazole-2-carboxamide
*IC50 values are an average of n = 1 to n = 50

In another embodiment, a Compound of the Disclosure is a compound having Formulae I-XVIII, provided that the compound is not N-(1-((4-acetamidophenyl)sulfonyl)piperidin-4-yl)benzamide:

In some embodiments, the disclosure relates to pharmaceutical compositions comprising N-(1-((4-acetamidophenyl)sulfonyl)piperidin-4-yl)benzamide and a pharmaceutically acceptable carier.

In some embodiments, the disclosure relates to a method of inhibiting SMYD proteins, such as SMYD3 or SMYD2, or both, in a subject, comprising administering to a subject in need thereof an effective amount of N-(1-((4-acetamidophenyl) sulfonyl)piperidin-4-yl)benzamide.

Definitions

For the purpose of the present disclosure, the terms used in connection with A or A1 have the chemical structures set forth in Table 2, each of which may be optionally substituted with one or more substituents, e.g., 1, 2, 3, 4, or 5 substituents, depending on the nature of the group and the number of available positions. For example, when A or A1 is 2-furanyl there are three carbon atoms for available for substitution. When A or A1 is 2-naphthalenyl there are seven carbon atoms available for substitution. Substitution may occur at any available carbon or nitrogen atom. Optional substituents include, but are not limited to, halo, hydroxy, alkoxy, amino, alkylamino, dialkylamino, (amino)alkyl, (alkylamino)alkyl, (dialkylamino)alkyl, C1-6 alkyl, haloalkyl, hydroxyalkyl, (carboxamido)alkyl, (cycloalkyl)alkyl, optionally substituted C3-12 cycloalkyl, optionally substituted C6-14 aryl, optionally substituted 5- to 14-membered heteroaryl, optionally substituted 4- to 14-membered heterocyclo, or aralkyl.

TABLE 2
A or A1 Chemical structure
1,2,3-triazolyl
1,2,4-triazolyl
1-imidazolyl
1-isoquinolinyl
1-pyrazolyl
2-(1,2,3,4- tetrahydroquinolinyl)
2-benzo[d]imidazolyl
2-benzo[d]thiazolyl
2-chromenyl-4-one
2-furanyl
2-imidazo[1,2-b]pyridazinyl
2-imidazolyl
2-indolyl
2-naphthalenyl
2-pyrazinyl
2-pyridyl
2-pyrimidinyl
2-pyrrolidinyl
2-pyrrolyl
2-quinolinyl
2-quinoxalinyl
2-thiazolo[5,4-c]pyridinyl
2-thiazolyl
2-thiophenyl
3-(1,2,3,4- tetrahydroisoquinoline)
3-(1,2,4-oxadiazolyl)
3-imidazo[1,2-a]pyrimidinyl
3-indazolyl
3-indolyl
3-isothiazolyl
3-pyrazolyl
3-pyridazinyl
3-pyridinyl-2-one
3-pyridyl
3-pyrrolo[3,2-b]pyridinyl
3-quinolinyl
4-(2,2- difluorobenzo[d][1,3]dioxolyl)
4-cyclohexanyl-1-amine
4-imidazolyl
4-indolinyl-2-one
4-indolyl
4-isothiazolyl
4-oxazolyl
4-piperidinyl
4-pyrazolyl
4-pyridyl
4-quinolinyl
5-(1,3-dihydro-2H- benzo[d]imidazolyl-2-one)
5-(1,3-dihydro-2H-pyrrolo[2,3- b]pyridinyl-2-one)
5-(1,3-dihydro-2H-pyrrolo[2,3- c]pyridinyl-2-one)
5-(2,2- difluorobenzo[d][1,3]dioxolyl)
5-(2,4-dihydro-3H-1,2,4- triazolyl-3-one)
5-4H-furo[3,2-b]pyrrolyl
5-benzo[c][1,2,5]oxadiazolyl
5-benzo[d][1,3]dioxolyl
5-benzo[d]oxazolyl-2(3H)-one
5-bicyclo[2.2.1]heptyl-2-ene
5-indolinyl-2,3-dione
5-indolinyl-2-one
5-indolyl
5-isoindolinyl-1-one
5-isoxazolyl
5-pyrazolo[3,4-c]pyridinyl
5-pyrazolyl
5-pyrimidinyl
5-thiazolyl
6-(1,2,3,4- tetrahydronaphthalenyl)
6-(3,4-dihydroquinolinyl- 2(1H)-one)
6-(3,4-dihydroquinoxalinyl- 2(1H)-one)
6-(4,5-dihydropyridazinyl- 3(2H)-one)
6-benzo[b][1,4]oxazinyl-3-one
6-benzo[d]imidazolyl
6-benzo[d]oxazolyl-2(3H)-one
6-benzo[d]thiazolyl
6-chromenyl-2-one
6-imidazo[2,1-b]thiazole
6-indazolyl
6-indolinyl-2-one
6-indolyl
6-isoquinolinyl
6-quinolinyl
6-quinoxalinyl
6-quinoxalinyl-2(1H)-one
7-(3,4-dihydroquinolinyl- 2(1H)-one)
7-(3,4-dihydroquinoxalin- 2(1H)-one)
7-benzo[b][1,4]oxazinyl- 3-one
7-indolinyl-2-one
7-quinolinyl
8-benzo[b][1,4]oxazinyl-3-one
cyclopropanyl
phenyl
4-(prop-1-en-1-yl)-imidazole
1-butanyl-imidazole
sec-butylcyclopropane
2-(ethylsulfonyl)propanyl
1-isobutylpyrrolidine
4-pyridyl 1-oxide
5-benzo[c][1,2,5]oxadiazolyl 1-oxide

For the purpose of the present disclosure, the term β€œalkyl” as used by itself or as part of another group refers to a straight- or branched-chain aliphatic hydrocarbon containing one to twelve carbon atoms (i.e., C1-12 alkyl) or the number of carbon atoms designated (i.e., a C1 alkyl such as methyl, a C2 alkyl such as ethyl, a C3 alkyl such as propyl or isopropyl, etc.). In one embodiment, the alkyl group is chosen from a straight chain C1-10 alkyl group. In another embodiment, the alkyl group is chosen from a branched chain C3-10 alkyl group. In another embodiment, the alkyl group is chosen from a straight chain C1-6 alkyl group. In another embodiment, the alkyl group is chosen front a branched chain C3-6 alkyl group. In another embodiment, the alkyl group is chosen from a straight chain C1-4 alkyl group. In another embodiment, the alkyl group is chosen from a branched chain C3-4 alkyl group. In another embodiment, the alkyl group is chosen from a straight or branched chain C3-4 alkyl group. In another embodiment, the alkyl group is partially or completely deuterated, i.e., one or more hydrogen atoms of the alkyl group are replaced with deuterium atoms. Non-limiting exemplary C1-10 alkyl groups include methyl (including -CD3), ethyl, propyl, isopropyl, butyl, sec-butyl, tert-butyl, iso-butyl, 3-pentyl, hexyl, heptyl, octyl, nonyl, and decyl. Non-limiting exemplary C1-4 alkyl groups include methyl, ethyl, propyl, isopropyl, butyl, sec-butyl, tert-butyl, and iso-butyl.

For the purpose of the present disclosure, the term β€œoptionally substituted alkyl” as used by itself or as part of another group means that the alkyl as defined above is either unsubstituted or substituted with one, two, or three substituents independently chosen from nitro, haloalkoxy, aryloxy, aralkyloxy, alkylthio, sulfonamido, alkylcarbonyl, arylcarbonyl, alkylsulfonyl, arylsulfonyl, ureido, guanidino, carboxy, alkoxycarbonyl, and carboxyalkyl. In one embodiment, the alkyl is a C1-6 alkyl. In another embodiment, the alkyl is a C1-4 alkyl. In one embodiment, the optionally substituted alkyl is substituted with two substituents. In another embodiment, the optionally substituted alkyl is substituted with one substituent. Non limiting exemplary optionally substituted alkyl groups include β€”CH2CH2NO2, β€”CH2CH2CO2H, β€”CH2CH2SO2CH3, β€”CH2CH2COPh, and β€”CH2C6H11.

For the purpose of the present disclosure, the term β€œalkylenyl” as used herein by itself or part of another group refers to a divalent form of an alkyl group as defined above. In one embodiment, the alkylenyl is a divalent form of a C1-6 alkyl. In one embodiment, the alkylenyl is a divalent form of a C1-4 alkyl. Non-limiting exemplary alkylenyl groups include β€”CH2CH2β€”, β€”CH2CH2CH2β€”, β€”CH2CH(CH3)CH2β€”, and β€”CH2C(CH3)2CH2β€”.

For the purpose of the present disclosure, the term β€œcycloalkyl” as used by itself or as part of another group refers to saturated and partially unsaturated (containing one or two double bonds) cyclic aliphatic hydrocarbons containing one to three rings having from three to twelve carbon atoms (i.e., C3-12 cycloalkyl) or the number of carbons designated. In one embodiment, the cycloalkyl group has two rings. In one embodiment, the cycloalkyl group has one ring. In another embodiment, the cycloalkyl group is chosen from a cycloalkyl group. In another embodiment, the cycloalkyl group is chosen from a C3-6 cycloalkyl group. Non-limiting exemplary cycloalkyl groups include cyclopropyl, cyclobutyl, cyclopentyl, cyclohexyl, cycloheptyl, cyclooctyl, norbomyl, decalin, adamantyl, cyclohexenyl, spiro[3.3]heptanc, and bicyclo[3.3.1]nonane.

For the purpose of the present disclosure, the term β€œoptionally substituted cycloalkyl” as used by itself or as part of another group means that the cycloalkyl as defined above is either unsubstituted or substituted with one, two, or three substituents independently chosen from halo, nitro, cyano, hydroxy, amino, alkylamino, dialkylamino, cycloalkylamino, haloalkyl, hydroxyalkyl, alkoxy, haloalkoxy, aryloxy, aralkyl, aralkyloxy, alkylthio, carboxamido, sulfonamido alkylcarbonyl, arylcarbonyl, alkylsulfonyl, arylsulfonyl, ureido, guanidino, carboxy, carboxyalkyl, alkyl, optionally substituted cycloalkyl, alkenyl, alkynyl, optionally substituted aryl, optionally substituted heteroaryl, optionally substituted heterocyclo, alkoxyalkyl, (amino)alkyl, hydroxyalkylamino, (alkylamino)alkyl, (dialkylamino)alkyl, (cyano)alkyl, (carboxamido)alkyl, mercaptoalkyl, (heterocyclo)alkyl, or (hetcroaryl)alkyl. In one embodiment, the optionally substituted cycloalkyl is substituted with two substituents. In another embodiment, the optionally substituted cycloalkyl is substituted with one substituent. In one embodiment, the optionally substituted cycloalkyl is an (amino)cycloalkyl. For the purpose of the present disclosure, the term β€œ(amino)cycloalkyl” as used by itself or as part of another group means that the optionally substituted cycloalkyl as defined above is substituted with one amino or alkylamino group, and optionally one or two additional substituents. In one embodiment, the optionally substituted cycloalkyl is an (amino)cyclohexyl. For the purpose of the present disclosure, the term β€œ(amino)cyclohexyl” as used by itself or as part of another group means that the optionally substituted cycloalkyl as defined above is a cyclohexyl group substituted with one amino or alkylamino group, and optionally one or two additional substituents. Non-limiting exemplary optionally substituted cycloalkyl groups include:

Non-limiting exemplary (amino)cycloalkyl groups include:

Non-limiting exemplary (amino)cyclohexyl groups include:

For the purpose of the present disclosure, the term β€œoptionally substituted cyclohexyl” as used by itself or as part of another group means that the optionally substituted cycloalkyl as defined above is an optionally substituted cyclohexyl group.

For the purpose of the present disclosure, the term β€œcycloalkylenyl” as used herein by itself or part of another group refers to a divalent form of an optionally substituted cycloalkyl group as defined above. In one embodiment, the cycloalkylenyl is a β€œcyclohexylenyl.” The term β€œcyclohexylenyl” as used herein by itself or part of another group refers to a divalent form of an optionally substituted cyclohexyl group. Non-limiting exemplary cycloalkylenyl groups include:

For the purpose of the present disclosure, the term β€œ1,4-cyclohexylenyl” as used herein by itself or part of another group refers to a cyclohexylenyl as defined above wherein the and 4-positions of the cyclohexyl ring are substituted. Non limiting exemplary 1,4-cyclohexylenyl groups include:

For the purpose of the present disclosure, the term β€œ(cycloalkylenyl)alkyl” as used herein by itself or part of another group refers to an alkyl group substituted with a divalent form of an optionally substituted cycloalkyl group. In one embodiment, the cycloalkylenyl is a divalent for of optionally substituted cyclohexyl. In one embodiment, the alkyl is C1-4 alkyl. Non-limiting exemplary (cycloalkylenyl)alkyl groups include:

For the purpose of the present disclosure, the term β€œcycloalkenyl” as used by itself or part of another group refers to a partially unsaturated cycloalkyl group as defined above. In one embodiment, the cycloalkenyl has one carbon-to-carbon double bond. In another embodiment, the cycloalkenyl group is chosen from a C4-8 cycloalkenyl group, Exemplary cycloalkenyl groups include cyclopentenyl and cyclohexenyl.

For the purpose of the present disclosure, the term β€œoptionally substituted. cycloalkenyl” as used by itself or as part of another group means that the cycloalkenyl as defined above is either unsubstituted or substituted with one, two, or three substituents independently chosen from halo, nitro, cyano, hydroxy, amino, alkylamino, dialkylamino, haloalkyl, monohydroxyalkyl, dihydroxyalkyl, alkoxy, haloalkoxy, aryloxy, aralkyloxy, alkylthio, carboxamido, sulfonamido, alkylcarbonyl, arylcarbonyl, alkylsulfonyl, arylsulfonyl, ureido, guanidino, carboxy, carboxyalkyl, alkyl, optionally substituted cycloalkyl, alkenyl, alkynyl, optionally substituted aryl, optionally substituted heteroaryl, optionally substituted heterocyclo, alkoxyalkyl, (amino)alkyl, hydroxyalkylamino, (alkylamino)alkyl, (dialkyamino)alkyl, (cyano)alkyl, (carboxamido)alkyl, mercaptoalkyl, (heterocyclo)alkyl, and (heteroaryl)alkyl. In one embodiment, the optionally substituted cycloalkenyl is substituted with two substituents, In another embodiment, the optionally substituted cycloalkenyl is substituted with one substituent. In another etnbodiment, the cycloalkenyl is unsubstituted.

For the purpose of the present disclosure, the term β€œalkenyl” as used by itself or as part of another group refers to an alkyl group as defined above containing one, two or three carbon-to-carbon double bonds. In one embodiment, the alkenyl group is chosen from a C2-6 alkenyl group. In another embodiment, the alkenyl group is chosen from a C2-4 alkenyl group. Non-limiting exemplary alkenyl groups include ethenyl, propenyl, isopropenyl, butenyl, sec-butenyl, pentenyl, and hexenyl.

For the purpose of the present disclosure, the term β€œoptionally substituted alkenyl” as used herein by itself or as part of another group means the alkenyl as defined above is either unsubstituted or substituted with one, two or three substituents independently chosen from halo, nitro, cyano, hydroxy, amino, alkylamino, dialkylamino, haloalkyl, hydroxyalkyl, alkoxy, haloalkoxy, aryloxy, aralkyloxy, alkylthio, carboxamido, sulfonamido, alkylcarbonyl, arylcarbonyl, alkylsulfonyl, arylsulfonyl, ureido, guanidino, carboxy, carboxyalkyl, alkyl, optionally substituted cycloalkyl, alkenyl, alkynyl, optionally substituted aryl, optionally substituted heteroaryl, or optionally substituted heterocyclo.

For the purpose of the present disclosure, the term β€œalkynyl” as used by itself or as part of another group refers to an alkyl group as defined above containing one to three carbon-to-carbon triple bonds. In one embodiment, the alkynyl has one carbon-to-carbon triple bond. In one embodiment, the alkynyl group is chosen from a C2-6 alkynyl group. In another embodiment, the alkynyl group is chosen from a C2-4 alkynyl group. Non-limiting exemplary alkynyl groups include ethynyl, propynyl, butynyl, 2-butynyl, pentynyl, and hexynyl groups.

For the purpose of the present disclosure, the term β€œoptionally substituted alkynyl” as used herein by itself or as part of another group means the alkynyl as defined above is either unsubstituted or substituted with one, two or three substituents independently chosen from halo, nitro, cyano, hydroxy, amino, alkylamino, dialkylamino, haloalkyl, hydroxyalkyl, alkoxy, haloalkoxy, aryloxy, aralkyloxy, alkylthio, carboxamido, sulfonamido, alkylcarbonyl, arylcarbonyl, alkylsulfonyl, arylsulfonyl, ureido, guanidino, carboxy, carboxyalkyl, alkyl, cycloalkyl, alkenyl, alkynyl, aryl, heteroaryl, or heterocyclo.

For the purpose of the present disclosure, the term β€œhaloalkyl” as used by itself or as part of another group refers to an alkyl group substituted by one or more fluorine, chlorine, bromine and/or iodine atoms. In one embodiment, the alkyl group is substituted by one, two, or three fluorine and/or chlorine atoms. In another embodiment, the haloalkyl group is chosen from a C1-4 haloalkyl group. Non-limiting exemplary haloalkyl groups include fluoromethyl, difluoromethyl, trifluoromethyl, pentafluoroethyl, 1,1-difluoroethyl, 2,2-difluoroethyl, 2,2,2-trifluoroethyl, 3,3,3-trifluoropropyl, 4,4,4-trifluorobutyl, and trichloromethyl groups.

For the purpose of the present disclosure, the term β€œfluoroalkyl” as used by itself or as part of another group refers to an alkyl group substituted by one or more fluorine atoms. In one embodiment, the alkyl group is substituted by one, two, or three fluorine atoms. In another embodiment, the fluoroalkyl group is chosen from a C1-4 fluoroalkyl group. Non-limiting exemplary fluoroalkyl groups include fluoromethyl, difluoromethyl, trifluoromethyl, pentafluoroethyl, 1,1-difluoroethyl, 2,2-difluoroethyl, 2,2,2-trifluoroethyl, 3,3,3-trifluoropropyl, and 4,4,4-trifluorobutyl.

For the purpose of the present disclosure, the term β€œhydroxyalkyl” as used by itself or as part of another group refers to an alkyl group substituted with one or more, e.g., one, two, or three, hydroxy groups. In one embodiment, the hydroxyalkyl group is a monohydroxyalkyl group, i.e., substituted with one hydroxy group. In another embodiment, the hydroxyalkyl group is a dihydroxyalkyl group, i.e., substituted with two hydroxy groups. In another embodiment, the hydroxyalkyl group is chosen from a C1-4 hydroxyalkyl group. Non-limiting exemplary hydroxyalkyl groups include hydroxymethyl, hydroxyethyl, hydroxypropyl and hydroxybutyl groups, such as 1-hydroxyethyl, 2-hydroxyethyl, 1,2-dihydroxyethyl, 2-hydroxypropyl, 3-hydroxypropyl, 3-hydroxybutyl, 4-hydroxybutyl, 2-hydroxy-1-methylpropyl, and 1,3-dihydroxyprop-2-yl.

For the purpose of the present disclosure, the term β€œalkoxy” as used by itself or as part of another group refers to an optionally substituted alkyl, optionally substituted cycloalkyl, optionally substituted alkenyl or optionally substituted alkynyl attached to a terminal oxygen atom. In one embodiment, the alkoxy group is chosen from a C1-4 alkoxy group. In another embodiment, the alkoxy group is chosen from a C1-4 alkyl attached to a terminal oxygen atom, e.g., methoxy, ethoxy, tert-butoxy, β€”OCH2C═CH, β€”OCH2C═CCH3, and β€”OCH2CH2CH2C═CH.

For the purpose of the present disclosure, the term β€œalkylthio” as used by itself or as part of another group refers to a sulfur atom substituted by an optionally substituted alkyl group. In one embodiment, the alkylthio group is chosen from a C1-4 alkylthio group. Non-limiting exemplary alkylthio groups include β€”SCH3, and β€”SCH2CH3.

For the purpose of the present disclosure, the term β€œalkoxyalkyl” as used by itself or as part of another group refers to an alkyl group substituted with an alkoxy group. Non-limiting exemplary alkoxyalkyl groups include methoxymethyl, methoxyethyl, methoxypropyl, methoxybutyl, ethoxymethyl, ethoxyethyl, ethoxypropyl, ethoxybutyl, propoxymethyl, iso-propoxymethyl, propoxyethyl, propoxypropyl, butoxymethyl, tert-butoxymethyl, isobutoxymethyl, sec-butoxmethyl, pentyloxymethyl, β€”CH2OCH2C═CH and β€”CH2OCH2CH2CH2C═CH.

For the purpose of the present disclosure, the term β€œhaloalkoxy” as used by itself or as part of another group refers to a haloalkyl attached to a terminal oxygen atom. Non-limiting exemplary haloalkoxy groups include fluoromethoxy, difluoromethoxy, trifluoromethoxy, and 2,2,2-trifluoroethoxy.

For the purpose of the present disclosure, the term β€œheteroalkyl” as used by itself or part of another group refers to a stable straight or branched chain hydrocarbon radical containing 1 to 10 carbon atoms and at least two heteroatoms, which can be the same or different, selected from O, N, or S, wherein: 1) the nitrogen atom(s) and sulfur atom(s) can optionally be oxidized; and/or 2) the nitrogen atom(s) can optionally be quatemized. The heteroatoms can be placed at any interior position of the heteroalkyl group or at a position at which the heteroalkyl group is attached to the remainder of the molecule. In one embodiment, the heteroalkyl group contains two oxygen atoms. In one embodiment, the heteroalkyl contains one oxygen and one nitrogen atom, e.g., a (hydroxyalkylamino)alkyl group, e.g., β€”CH2N(CH3)CH2CH2CH2OH. In one embodiment, the heteroalkyl contains two nitrogen atoms. Non-limiting exemplary heteroalkyl groups include β€”CH2OCH2CH2OCH3, β€”OCH2CH2OCH2CH2OCH3, β€”CH2NHCH2CH2OCH2, β€”OCH2CH2NH2, β€”NHCH2CH2N(H)CH3, β€”NHCH2CH2OCH3, β€”CH2OCH2CH2NH2, β€”CH2OCH2CH2N(H)CH2CH3, and β€”OCH2CH2OCH3.

For the purpose of the present disclosure, the term β€œaryl” as used by itself or as part of another group refers to a monocyclic or bicyclic aromatic ring system having from six to fourteen carbon atoms (i.e., C6-14 aryl). Non-limiting exemplary aryl groups include phenyl (abbreviated as β€œPh”), naphthyl, phenanthryl, anthracyl, indenyl, azulenyl, biphenyl, biphenylenyl, and fluorenyl groups. In one embodiment, the aryl group is chosen from phenyl or naphthyl. In one embodiment, the aryl group is phenyl.

For the purpose of the present disclosure, the term β€œoptionally substituted aryl” as used herein by itself or as part of another group means that the aryl as defined above is either unsubstituted or substituted with one to five substituents independently selected from the group consisting of halo, nitro, cyano, hydroxy, amino, alkylamino, dialkylamino, aralkylamino, haloalkyl, hydroxyalkyl, alkoxy, haloalkoxy, aryloxy, heteroaryloxy, aralkyl, aralkyloxy, (aralkyloxy)alkyl, alkylthio, carboxamido, sulfonamido, alkylcarbonyl, arylcarbonyl, alkylsulfonyl, arylsulfonyl, ureido, guanidino, carboxy, carboxyalkyl, heteroalkyl, optionally substituted alkyl, optionally substituted cycloalkyl, alkenyl, alkynyl, optionally substituted aryl, optionally substituted heteroaryl, optionally substituted heterocyclo, (C1-4 haloalkoxy)alkyl, alkoxyalkyl, (amino)alkyl, hydroxyalkylamino, (alkylamino)alkyl, (dialkylamino)alkyl, (cyano)alkyl, (carboxamido)alkyl, (carboxamido)alkyl-Oβ€”, mercaptoalkyl, (heterocyclo)alkyl, (heterocyclo)alkyl-Oβ€”, (cycloalkylamino)alkyl, (hydroxyalkylamino)alkyl, (amino)(heteroaryl)alkyl, (heterocycloamino)alkyl (amino)(hydroxy)alkyl, (heteroaryl)alkyl, (heteroaryl)alkyl-Oβ€”, β€”N(R43)(R44), β€”CH2N(R43)(R44), β€”CH2N(H)C(═O)β€”R45, and β€”N(H)C(═O)β€”R45, wherein R43 is hydrogen, C1-4 alkyl, optionally substituted aryl, or optionally substituted heteroaryl; R44 is alkoxyalkyl, (heterocyclo)alkyl, (amino)alkyl, (alkylamino)alkyl, aralkyl, or (dialkylamino)alkyl; and R45 is alkyl, alkoxyalkyl, (heterocyclo)alkyl, (amino)alkyl, (alkylamino)alkyl, (dialkylamino)alkyl, optionally substituted aryl, optionally substituted heteroaryl, aralkyl, or (heteroaryl)alkyl. In another embodiment, the optionally substituted aryl is substituted with one to five substituents independently selected from the group consisting of halo, nitro, cyano, hydroxy, amino, alkylamino, dialkylamino, haloalkyl, hydroxyalkyl, alkoxy, haloalkoxy, aryloxy, heteroaryloxy, aralkyl aralkyloxy, (aralkyloxy)alkyl, alkylthio, carboxamido, sulfonamido, alkylcarbonyl, arylcarbonyl, alkylsulfonyl, arylsulfonyl, ureido, guanidino, carboxy, carboxyalkyl, heteroalkyl, optionally substituted alkyl, optionally substituted cycloalkyl, alkenyl, alkynyl optionally substituted aryl, optionally substituted heteroaryl, optionally substituted heterocyclo, (C1-4 haloalkoxy)alkyl, alkoxyalkyl, (amino)alkyl, hydroxyalkylamino, (alkylamino)alkyl, (dialkylamino)alkyl, (cyano)alkyl, (carboxamido)alkyl, mercaptoalkyl, (heterocyclo)alkyl, (cycloalkylamino)alkyl, (hydroxyalkylamino)alkyl, (amino)(heteroaryl)alkyl, (heterocycloamino)alkyl (amino)(hydroxy)alkyl, (heteroaryl)alkyl, β€”N(R43)(R44), β€”CH2N(H)C(═O)β€”R45, and β€”N(H)C(═O)β€”R45.

In one embodiment, the optionally substituted aryl is an optionally substituted. phenyl. In one embodiment, the optionally substituted phenyl has four substituents. In another embodiment, the optionally substituted phenyl has three substituents. In another embodiment, the optionally substituted phenyl has two substituents. In another embodiment, the optionally substituted phenyl has one substituent. In another embodiment, the optionally substituted phenyl has at least one amino, alkylamino, dialkylamino, (amino)alkyl, (alkylamino)alkyl, (dialkylamino)alkyl, (amino)(heteroaryl)alkyl, or (amino)(hydroxy)alkyl substituent. Non-limiting exemplary substituted aryl groups include 2-methylphenyl, 2-methoxyphenyl, 2-fluorophenyl, 2-chlorophenyl, 2-bromophenyl, 3-methylphenyl, 3-methoxyphenyl, 3-fluorophenyl, 3-chlorophenyl, 4-methylphenyl, 4-ethylphenyl, 4-methoxyphenyl, 4-fluorophenyl, 4-chlorophenyl, 2,6-di-fluorophenyl, 2,6-di-chlorophenyl, 2-methyl, 3-methoxyphenyl, 2-ethyl, 3-methoxyphenyl, 3,4-di-methoxyphenyl, 3,5-di-fluorophertyl 3,5-di-methylphenyl, 3,5-dimethoxy, 4-methylphenyl, 2-fluoro-3-chlorophenyl, 3-chloro-4-fluorophenyl, and 2-phenylpropan-2-arnine. The term optionally substituted aryl is meant to include aryl groups having fused optionally substituted cycloalkyl and fused optionally substituted heterocyclo rings. Examples include:

For the purpose of the present disclosure, the term β€œarylenyl” as used herein by itself or part of another group refers to a divalent form of an optionally substituted aryl group as defined above. In one embodiment, the arylenyl is a divalent form of an optionally substituted phenyl. In one embodiment, the arylenyl is a divalent form of phenyl. Non-limiting exemplary alkylenyl groups include:

For the purpose of the present disclosure, the term β€œaryloxy” as used by itself or as part of another group refers to an optionally substituted aryl attached to a terminal oxygen atom. A non-limiting exemplary aryloxy group is PhOβ€”.

For the purpose of the present disclosure, the term β€œheteroaryloxy” as used by itself or as part of another group refers to an optionally substituted heteroaryl attached to a terminal oxygen atom.

For the purpose of the present disclosure, the term β€œaralkyloxy” or β€œarylalkyloxy” as used by itself or as part of another group refers to an aralkyl group attached to a terminal oxygen atom. A non-limiting exemplary aralkyloxy group is PhCH2Oβ€”.

For the purpose of the present disclosure, the term β€œ(aralkyloxy)alkyl” as used by itself or as part of another group refers to an alkyl group substituted with an aralkyloxy group. In one embodiment, the alkyl is a C1-4 alkyl. Non-limiting exemplary β€œ(aralkyloxy)alkyl” groups include β€”CH2OCH2(3-Fβ€”Ph) and β€”CH2OCH2CH2CH2(2-OMe-Ph).

For the purpose of the present disclosure, the term β€œheteroaryl” or β€œheteroaromatic” refers to monocyclic and bicyclic aromatic ring systems having 5 to 14 ring atoms (i.e., a 5- to 14-membered heteroaryl) and 1, 2, 3, or 4 heteroatoms independently chosen from oxygen, nitrogen, or sulfur. In one embodiment, the heteroaryl has three hoteroatoms. In another embodiment, the heteroaryl has two heteroatoms. In another embodiment, the heteroaryl has one heteroatom. In one embodiment, the heteroaryl has 5 ring atoms, e.g., thienyl, a 5-membered heteroaryl having four carbon atoms and one sulfur atom. In another embodiment, the heteroaryl has 6 ring atoms, e.g., pyridyl, a 6-membered heteroaryl having five carbon atoms and one nitrogen atom. Non-limiting exemplary heteroaryl groups include thienyl, benzo[b]thienyl, naphtho[2,3-b]thienyl, thianthrenyl, fitryl, benzofuryl, pyranyl, isobenzofuranyl, benzooxazonyl, chromenyl, xanthenyl, 2H-pyrrolyl, pyrrolyl, imidazolyl, pyrazolyl, pyridyl, pyrazinyl, pyrimidinyl, pyridazinyl, isoindolyl, 3H-indolyl, indolyl, indazolyl, purinyl, isoquinolyl, quinolyl, phthalazinyl, naphthyridinyl, cinnolinyl, quinazolinyl, pyridinyl, 4aH-carbazolyl, carbazolyl, Ξ²-carbolinyl, phenanthridinyl, acridinyl, pyrimidinyl, phenanthrolinyl, phenazinyl, thiazolyl, isothiazolyl, phenothiazolyl, isoxazolyl, furazanyl, and phenoxazinyl. In one embodiment, the heteroaryl is chosen from thienyl (e.g., thien-2-yl and thien-3-yl), furyl (e.g., 2-furyl and 3-furyl), pyrrolyl (e.g., 1H-pyrrol-2-yl and 1H-pyrrol-3-yl), imidazolyl (e.g., 2H-imidazol-2-yl and 2H-imidazol-4-yl), pyrazolyl (e.g., 1H-pyrazol-3-yl, 1H-pyrazol-4-yl, and 1H-pyrazol-5-yl), pyridyl (e.g., pyridin-2-yl, pyridin-3-yl, and pyridin-4-yl), pyrimidinyl (e.g., pyrimidin-2-yl, pyrimidin-4-yl, and pyrimidin-5-yl), thiazolyl (e.g., thiazol-2-yl, thiazol-4-yl, and thiazol-5-yl), isothiazolyl isothiazol-3-yl, isothiazol-4-yl, and isothiazol-5-yl), oxazolyl (e.g., oxazol-2-yl, oxazol-4-yl, and oxazol-5-yl) and isoxazolyl (e.g., isoxazol-3-yl, isoxazol-4-yl, and isoxazol-5-yl). The term β€œheteroaryl” is also meant to include possible N-oxides. Exemplary N-oxides include pyridyl N-oxide.

For the purpose of the present disclosure, the term β€œoptionally substituted heteroaryl” as used by itself or as part of another group means that the heteroaryl as defined above is either unsubstituted or substituted with one to four substituents, e.g., one or two substituents, independently chosen from halo, nitro, cyano, hydroxy, amino, alkylamino, dialkylamino, haloalkyl, hydroxyalkyl, alkoxy, haloalkoxy, aralkyl, aryloxy, aralkyloxy, alkylthio, carboxamido, sulfonamido, alkylcarbonyl, arylcarbonyl, alkylsulfonyl, arylsulfonyl, ureido, guanidino, carboxy, carboxyalkyl, alkyl, optionally substituted cycloalkyl, alkenyl, alkynyl, optionally substituted aryl, optionally substituted heteroaryl, optionally substituted heterocyclo, alkoxyalkyl, (amino)alkyl, hydroxyalkylamino, (alkylamino)alkyl, (dialkylamino)alkyl, (cyano)alkyl, (carboxamido)alkyl, mercaptoalkyl, (heterocyclo)alkyl, (heteroaryl)alkyl, β€”N(R43)(R44), or β€”N(H)C(═O)β€”R45, wherein R43 is hydrogen or C1-4 alkyl, R44 is alkoxyalkyl, (heterocyclo)alkyl, (amino)alkyl, (alkylamino)alkyl, or (dialkylamino)alkyl; and R45 is alkyl, optionally substituted aryl, or optionally substituted heteroaryl. In one embodiment, the optionally substituted heteroaryl has one substituent. In one embodiment, the substituent is amino, alkylamino, dialkylamino, (amino)alkyl, hydroxyalkylamino, (alkylamino)alkyl, (dialkylamino)alkyl, (heterocyclo)alkyl, β€”N(R43)(R44), or β€”N(H)C(═O)β€”R45. In another embodiment, the substituent is aralkyl or (heteroaryl)alkyl. Examples include:

In one embodiment, the optionally substituted is an optionally substituted pyridyl, i.e., 2-, 3-, or 4-pyridyl. Any available carbon or nitrogen atom can be substituted. The term optionally substituted heteroaryl is meant to include heteroaryl groups having fused optionally substituted cycloalkyl and fused optionally substituted heterocyclo rings. Examples include:

For the purpose of the present disclosure, the term β€œheteroarylenyl” as used herein by itself or part of another group refers to a divalent form of an optionally substituted heteroaryl group as defined above. In one embodiment, the heteroarylenyl is a divalent form of an optionally substituted pyridyl. Non-limiting exemplary heteroarylenyl groups include:

For the purpose of the present disclosure, the term β€œheterocycle” or β€œheterocyclo” as used by itself or as part of another group refers to saturated and partially unsaturated (e.g., containing one or two double bonds) cyclic groups containing one, two, or three rings having from three to fourteen ring members (i.e., a 3- to 14-membered heterocyclo) and at least one heteroatom. Each heteroatom is independently selected from the group consisting of oxygen, sulfur, including sulfoxide and sulfone, and/or nitrogen atoms, which can be quaternized. The term β€œheterocyclo” is meant to include cyclic ureido groups such as imidazolidinyl 2 one, cyclic amide groups such as Ξ²-lactam, Ξ³-lactam, Ξ΄-lactam and Ξ΅-lactam, and cyclic carbamate groups such as oxazolidinyl-2-one. The term β€œheterocyclo” is also meant to include groups having fused optionally substituted aryl groups, e.g., indolinyl, indolinyl-2-one, benzo[d]oxazolyl-2(3H)-one. In one embodiment, the heterocyclo group is chosen from a 4-, 5-, 6-, 7- or 8-membered cyclic group containing one ring and one or two oxygen and/or nitrogen atoms. In one embodiment, the heterocyclo group is chosen from a 5- or 6-membered cyclic group containing one ring and one or two nitrogen atoms. In one embodiment, the heterocyclo group is chosen from a 8-, 9-, 10-, 11-, or 12-membered cyclic group containing two rings and one or two nitrogen atoms. The heterocyclo can be optionally linked to the rest of the molecule through a carbon or nitrogen atom. Non-limiting exemplary heterocyclo groups include 2-oxopyrrolidin-3-yl, 2-imidazolidinone, piperidinyl, morpholinyl, piperazinyl, pyrrolidinyl, 8-azabicyclo[3.2,1]octane (nortropane), 6-azaspiro[2.5]octane, 6-azaspiro[3,4]octane, indolinyl, indolinyl-2-one, 1,3-dihydro-2H-benzo[d]imidazol-2-one.

For the purpose of the present disclosure, the term β€œoptionally substituted. heterocyclo” as used herein by itself or part of another group means the heterocyclo as defined above is either unsubstituted or substituted with one to four substituents independently selected from halo, nitro, cyano, hydroxy, amino, alkylamino, dialkylamino, aralkylamino, haloalkyl, hydroxyalkyl, alkoxy, haloalkoxy, aryloxy, aralkyl, aralkyloxy, alkylthio, carboxamido, sulfonamido, alkylcarbonyl, arylcarbonyl, alkylsulfanyl, arylsulfonyl, ureido, guanidino, carboxy, carboxyalkyl, alkyl, cycloalkyl, alkenyl, alkynyl, aryl, heteroaryl, heterocyclo, alkoxyalkyl, (amino)alkyl, hydroxyalkylamino, (alkylamino)alkyl, (dialkylamino)alkyl, (cyano)alkyl, (carboxamido)alkyl, mercaptoalkyl, (heterocyclo)alkyl, and (heteroaryl)alkyl. Substitution may occur on airy available carbon or nitrogen atom, and may form a spirocycle. In another embodiment, the optionally substituted heterocyclo is substituted. Wish one to four substituents independently selected from halo, nitro, cyano, hydroxy, amino, alkylamino, dialkylamino, haloalkyl, hydroxyalkyl, alkoxy, haloalkoxy, aryloxy, aralkyl, aralkyloxy, alkylthio, carboxamido, sulfonamido, alkylcarbonyl, arylcarbonyl, alkylsulfonyl, arylsulfonyl, ureido, guanidino, carboxy, carboxyalkyl, alkyl, cycloalkyl, alkenyl, alkynyl, aryl, heteroaryl, heterocyclo, alkoxyalkyl, (amino)alkyl, hydroxyalkylamino, (alkylamino)alkyl, (dialkylamino)alkyl, (cyano)alkyl, (carboxamido)alkyl, mercaptoalkyl, (heterocyclo)alkyl, and (heteroaryl)alkyl. In one embodiment, the optionally substituted heterocyclo is substituted with at least one amino, alkylamino, or dialkylamino group. Non-limiting exemplary optionally substituted heterocyclo groups include:

For the purpose of the present disclosure, the term β€œheterocyclenyl” as used herein by itself or part of another group refers to a divalent form of an optionally substituted heterocycle group as defined above. In one embodiment, the heterocyclenyl is a divalent form of an optionally substituted azetidine. In one embodiment, the heterocyclenyl is a divalent form of an optionally substituted piperidinyl. Non-limiting exemplary heterocyclenyl groups include:

For the purpose of the present disclosure, the term β€œoptionally substituted pyrrolidinyl” as used by itself or as part of another group means that the optionally substituted heterocyclo as defined above is an optionally substituted pyrrolidinyl group.

For the purpose of the present disclosure, the term β€œoptionally substituted pyrrolidinenyl” as used herein by itself or part of another group refers to a divalent form of an optionally substituted pyrrolidinyl group as defined above. Non-limiting exemplary optionally substituted pyrrolidinenyl groups include:

For the purpose of the present disclosure, the tern β€œamino” as used by itself or as part of another group refers to β€”NH2.

For the purpose of the present disclosure, the term β€œalkylamino” as used by itself or as part of another group refers to β€”NHR21, wherein R22 is C1-6 alkyl. In one embodiment, R22 is C1-4 alkyl. Non-limiting exemplary alkylamino groups include β€”N(H)CH3 and β€”N(H)CH2CH3.

For the purpose of the present disclosure, the term β€œdialkylamino” as used by itself or as part of another group refers to β€”NR23aR23b, wherein R23a and R23b are each independently C1-6 alkyl. In one embodiment, R23a and R23b are each independently C1-4 alkyl. Non-limiting exemplary dialkylamino groups include β€”N(CH3)2 and β€”N(CH3)CH2CH(CH3)2.

For the purpose of the present disclosure, the term β€œhydroxyalkylamino” as used by itself or as part of another group refers to β€”NR24a r24b, wherein R24a is hydrogen or C1-4 alkyl, and R24b is hydroxyalkyl. Non-limiting exemplary hydroxyalkylamino groups include β€”N(H)CH2CH2OH, β€”N(H)CH2CH2CH2OH, β€”N(CH3)CH2CH2OH, and β€”N(CH3)CH2CH2CH2OH.

For the purpose of the present disclosure, the term β€œ(hydroxyalkylamino)alkyl” as used by itself or as part of another group refers to an alkyl group substituted with an hydroxyalkylamino group. In one embodiment, the alkyl is a C1-4 alkyl. A non-limiting exemplary (hydroxyalkylamino)alkyl group is β€”CH2N(CH3)CH2CH2CH2OH.

For the purpose of the present disclosure, the term β€œcycloalkylamino” as used by itself or as part of another group refers to β€”NR25aR25b, wherein R25a is optionally substituted cycloalkyl and R25b is hydrogen or C1-4 alkyl.

For the purpose of the present disclosure, the term β€œheterocycloamino” as used by itself or as part of another group refers to β€”NR25cR25d, wherein R25c is optionally substituted heterocycle and R25d is hydrogen or C1-4 alkyl. Non-limiting exemplary heterocycloamino groups include:

For the purpose of the present disclosure, the term β€œ(heterocycloamino)alkyl” as used by itself or as part of another group refers to an alkyl group substituted with an heterocycloamino group. In one embodiment, the alkyl is a C1-4 alkyl.

For the purpose of the present disclosure, the term β€œaralkylamino” as used by itself or as part of another group refers to β€”NR26aR26b, wherein R26a is aralkyl and R26b is hydrogen or C1-4 alkyl. Non-limiting exemplary aralkylamino groups include β€”N(H)CH2Ph and β€”N(CH3)CH2Ph.

For the purpose of the present disclosure, the term β€œ(amino)alkyl” as used by itself or as part of another group refers to an alkyl group substituted with an amino group. In one embodiment, the alkyl is a C1-4 alkyl. Non-limiting exemplary (amino)alkyl groups include β€”CH2NH2, β€”C(NH2)(H)CH3, β€”CH2CH2NH2, β€”CH2C(NH2)(H)CH3, β€”CH2CH2CH2NH2, β€”CH2CH2CH2CH2NH2, and β€”CH2C(CH3)2CH2NH2.

For the purpose of the present disclosure, the term β€œ(alkylamino)alkyl” as used by itself or as part of another group refers to an alkyl group substituted with an alkylamino group. In one embodiment, the alkyl is a C1-4 alkyl. A non-limiting exemplary (alkylamino)alkyl group is β€”CH2CH2N(H)CH3.

For the purpose of the present disclosure., the term β€œ(dialkylamino)alkyl” as used by itself or as part of another group refers to an alkyl group substituted by a dialkylamino group. In one embodiment, the alkyl is a C1-4 alkyl. Non-limiting exemplary (dialkylamino)alkyl groups are β€”CH2CH2N(CH3)2.

For the purpose of the present disclosure, the term β€œ(cycloalkylamino)alkyl” as used by itself or as part of another group refers to an alkyl group substituted by a cycloalkylamino group. In one embodiment, the alkyl is a C1-4 alkyl. Non-limiting exemplary (cycloalkylamino)alkyl groups include β€”CH2N(H)cyclopropyl, β€”CH2N(H)cyclobutyl, and β€”CH2N(H)cyclohexyl.

For the purpose of the present disclosure, the term β€œ(aralkylamino)alkyl” as used by itself or as part of another group refers to an alkyl group substituted with an aralkylamino group. In one embodiment, the alkyl is a C1-4 alkyl. A non-limiting exemplary (aralkylamino)alkyl group is β€”CH2CH2CH2N(H)CH2Ph.

For the purpose of the present disclosure, the term β€œ(hydroxyalkylamino)alkyl” as used by itself or as part of another group refers to an alkyl group substituted an hydroxyalkylamino group. A non-limiting exemplary (hydroxyalkylamino)alkyl group is β€”CH2CH2NHCH2CH2OH.

For the purpose of the present disclosure,the term β€œ(cyano)alkyl” as used by itself or as part of another group refers to an alkyl group substituted with one or more cyano, e.g., β€”CN, groups. In one embodiment, the alkyl is a C1-4 alkyl. Non-limiting exemplary (cyano)alkyl groups include β€”CH2CH2CN, β€”CH2CH2CH2CN, and β€”CH2CH2CH2CH2CN.

For the purpose of the present disclosure, the term β€œ(amino)(hydroxy)alkyl” as used by itself or as part of another group refers to an alkyl group substituted with one amino, alkylamino, dialkylamino, or heterocyclo group and one hydroxy group. In one embodiment, the alkyl is a C1-5 alkyl. In another embodiment, the alkyl is a C1-4 alkyl. Non-limiting exemplary (amino)(hydroxy)alkyl groups include:

For the purpose of the present disclosure, the term β€œ(amino)(carboxamido)alkyl” as used by itself or as part of another group refers to an alkyl group substituted with one amino, alkylamino, or dialkylamino, and one carboxamido group. In one embodiment, the alkyl is a C1-6 alkyl. Non-limiting exemplary (amino)(carboxamido)alkyl groups include:

For the purpose of the present disclosure, the term β€œ(amino)(aryl)alkyl” as used by itself or as part of another group refers to an alkyl group substituted with one amino, alkylamino, or dialkylamino group and one optionally substituted aryl group. In one embodiment, the, alkyl is a C1-6 alkyl. In one embodiment, the optionally substituted aryl group is an optionally substituted phenyl. Non-limiting exemplary (amino)(aryl)alkyl groups include:

For the purpose of the present disclosure, the term β€œ(amino)(heteroaryl)alkyl” as used by itself or as part of another group refers to an alkyl group substituted with one amino, alkylamino, or dialkylamino group and one optionally substituted heteroaryl group. In one embodiment, the alkyl is a C1-6 alkyl. In one embodiment, the alkyl is a C1-4 alkyl. In one embodiment, the optionally substituted heteroaryl group is an optionally substituted pyridyl. Non-limiting exemplary (amino)(heteroaryl)alkyl groups include:

For the purpose of the present disclosure, the term β€œ(cycloalkyl)alkyl” as used by itself or as part of another group refers to an alkyl group substituted with one optionally substituted cycloalkyl group. In one embodiment, the alkyl is a C1-4 alkyl. In one embodiment, the cycloalkyl is a C3-6 cycloalkyl. In one embodiment, the optionally substituted cycloalkyl group is substituted with an amino or (amino)alkyl group. Non-limiting exemplary (cycloalkyl)alkyl groups include:

For the purpose of the present disclosure, the term β€œ(hydroxy)(aryl)alkyl” as used by itself or as part of another group refers to an alkyl group substituted with one hydroxy group and one optionally substituted aryl group. In one embodiment, the alkyl is a C-1-6 alkyl. In one embodiment, the optionally substituted aryl group is an optionally substituted phenyl. Non-limiting exemplary (hydroxy)(aryl)alkyl groups include:

For the purpose of the present disclosure, the term β€œcarboxamido” as used by itself or as part of another group refers to a radical of formula β€”C(═O)NR26aR26b, wherein R26a and R26b are each independently hydrogen, optionally substituted alkyl, optionally substituted aryl, aralkyl, (heteroaryl)alkyl, or optionally substituted heteroaryl, or R26a and R26b taken together with the nitrogen to which they are attached from a 3- to 8-membered heterocyclo group. In one embodiment, R26a and R26b are each independently hydrogen or optionally substituted alkyl. Non-limiting exemplary carboxamido groups include β€”CONH2, β€”CON(H)CH3, β€”CON(CH3)2, and β€”CON(H)Ph.

For the purpose of the present disclosure, the term β€œ(carboxamido)alkyl” as used by itself or as part of another group refers to an alkyl group substituted with a carboxamido group. Non-limiting exemplary (carboxamido)alkyl groups include β€”CH2CONH2, β€”C(H)CH3β€”CONH2, and β€”CH2CON(H)CH3.

For the purpose of the present disclosure, the term β€œsulfonamido” as used by itself or as part of another group refers to a radical of the formula β€”SO2NR27aR27b, wherein R27a and R27b are each independently hydrogen, optionally substituted alkyl, or optionally substituted aryl, or R27a and R27b taken together with the nitrogen to which they are attached from a 3- to 8-membered heterocyclo group. Non-limiting exemplary sulfonamido groups include β€”SO2NH2, β€”SO2N(H)CH3, and β€”SO2N(H)Ph.

For the purpose of the present disclosure, the term β€œalkylcarbonyl” as used by itself or as part of another group refers to a carbonyl group, i.e., β€”C(═O)β€”, substituted by an alkyl group. A non-limiting exemplary alkylcarbonyl group is β€”COCH3.

For the purpose of the present disclosure, the term β€œarylcarbonyl” as used by itself or as part of another group refers to a carbonyl group, i.e., β€”C(═O)β€”, substituted by an optionally substituted aryl group. A non-limiting exemplary arylcarbonyl group is β€”COPh.

For the purpose of the present disclosure, the term β€œalkylsulfonyl” as used by itself or as part of another group refers to a sulfonyl group, i.e., β€”SO2β€”, substituted by any of the above-mentioned optionally substituted alkyl groups. A non-limiting exemplary alkylsulfonyl group is β€”SO2CH3.

For the purpose of the present disclosure, the term β€œarylsulfonyl” as used by itself or as part of another group refers to a sulfonyl group, i.e., β€”SO2β€”, substituted by any of the above-mentioned optionally substituted aryl groups. A non-limiting exemplary arylsulfonyl group is β€”SO2Ph.

For the purpose of the present disclosure, the term β€œmercaptoalkyl” as used by itself or as part of another group refers to any of the above-mentioned alkyl groups substituted by a β€”SH group.

For the purpose of the present disclosure, the term β€œcarboxy” as used by itself or as part of another group refers to a radical of the formula β€”COOH.

For the purpose of the present disclosure, the term. β€œcarboxyalkyl” as used by itself or as part of another group refers to any of the above-mentioned alkyl groups substituted with a β€”COOH. A non-limiting exemplary carboxyalkyl group is β€”CH2CO2H.

For the purpose of the present disclosure, the term β€œalkoxycarbonyl” as used by itself or as part of another group refers to a carbonyl group, i.e., β€”C(═O)β€”, substituted by an alkoxy group. Non-limiting exemplary alkoxycarbonyl groups are β€”CO2Me and β€”CO2Et.

For the purpose of the present disclosure, the term β€œaralkyl” or β€œarylalkyl” as used by itself or as part of another group refers to an alkyl group substituted with one, two, or three optionally substituted aryl groups. In one embodiment, the aralkyl group is a C1-4 alkyl substituted with one optionally substituted aryl group. In another embodiment, the aralkyl group is a C1 or C2 alkyl substituted with one optionally substituted phenyl group. In another embodiment, the aralkyl group is a C1 alkyl substituted with one optionally substituted phenyl group, i.e., a benzyl group wherein the phenyl is optionally substituted. Non-limiting exemplary aralkyl groups include benzyl, phenethyl, β€”CHPh2, β€”CH2(4-OH-Ph), and β€”CH(4-F-Ph)2.

For the purpose of the present disclosure, the term β€œureido” as used by itself or as part of another group refers to a radical of the formula β€”NR30aβ€”C(═O)β€”NR30bR30c, wherein R22a is hydrogen, alkyl, or optionally substituted aryl, and R30b and R30c are each independently hydrogen, alkyl, or optionally substituted aryl, or R30b and R30c taken together with the nitrogen to which they are attached form a 4- to 8-membered heterocyclo group. Non-limiting exemplary ureido groups include β€”NHβ€”C(Cβ€”O)β€”NH2 and β€”NHβ€”C(C═O)β€”NHCH3.

For the purpose of the present disclosure, the term β€œguanidino” as used by itself or as part of another group refers to a radical of the formula β€”NR28aβ€”C(═NR29)β€”NR28bR28c, wherein R28a, R28b, and R28c are each independently hydrogen, alkyl, or optionally substituted aryl, and R29 is hydrogen, alkyl, cyano, alkylsulfonyl, alkylcarbonyl, carboxamido, or sulfonamido. Non-limiting exemplary guanidino groups include β€”NHβ€”C(C═NH)β€”NH2, β€”NHβ€”C(C═NCN)β€”NH2, and β€”NHβ€”C(C═NH)β€”NHCH3.

For the purpose of the present disclosure, the term β€œ(heterocyclo)alkyl” as used by itself or as part of another group refers to an alkyl group substituted with one, two, or three optionally substituted heterocyclo groups. In one embodiment, the (heterocyclo)alkyl is a C1-4 alkyl substituted with one optionally substituted heterocyclo group. The heterocyclo can be linked to the alkyl group through a carbon or nitrogen atom. Non-limiting exemplary (heterocyclo)alkyl groups include:

For the purpose of the present disclosure, the term β€œ(heteroaryl)alkyl” or β€œheteroaralkyl” as used by itself or as part of another group refers to an alkyl group substituted with one, two, or three optionally substituted heteroaryl groups. In one embodiment, the (hetcroaryl)alkyl group is a C1-4 alkyl substituted with one optionally substituted heteroaryl group. Non-limiting exemplary (heteroaryl)alkyl groups include:

For the purpose of the present disclosure, the term β€œalkylcarbonylamino” as used by itself or as part of another group refers to an alkylcarbonyl group attached to an amino. A non-limiting exemplary alkylcarbonylamino group is β€”NHCOCH3.

The present disclosure encompasses any of the Compounds of the Disclosure being isotopically-labelled (i.e., radiolabeled) by having one or more atoms replaced by an atom having a different atomic mass or mass number. Examples of isotopes that can be incorporated into the disclosed compounds include isotopes of hydrogen, carbon, nitrogen, oxygen, phosphorous, fluorine and chlorine, such as 2H (or deuterium (D)), 3H, 11C, 13C, 14C, 15N, 18O, 17O, 31P, 32P, 35S, 18F, and 36Cl, respectively, e.g., 3H, 11C, and 14C. In one embodiment, provided is a composition wherein substantially all of the atoms at a position within the Compound of the Disclosure are replaced by an atom having a different atomic mass or mass number. In another embodiment, provided is a composition wherein a portion of the atoms at a position within the Compound of the disclosure are replaced, i.e., the Compound of the Disclosure is enriched at a position with an atom having a different atomic mass or mass number.” Isotopically-labelled Compounds of the Disclosure can he prepared by methods known in the art.

Compounds of the Disclosure may contain one or more asymmetric centers and may thus give rise to enantiomers, diastereomers, and other stereoisomeric forms. The present disclosure is meant to encompass the use of all such possible forms, as well as their racernic and resolved refills and mixtures thereof. The individual enantiomers can be separated according to methods known in the art in view of the present disclosure. When the compounds described herein contain olefinic double bonds or other centers of geometric asymmetry, and unless specified otherwise, it is intended that they include both E and Z geometric isomers. All tautomers are intended to be encompassed by the present disclosure as well.

As used herein, the term β€œstereoisomers” is a general term for all isomers of individual molecules that differ only in the orientation of their atoms in space. It includes enantiomers and isomers of compounds with more than one chiral center that are not minor images of one another (diastereomers).

The term β€œchiral center” or β€œasymmetric carbon atom” refers to a carbon atom to which four different groups are attached.

The terms β€œenantiomer” and β€œenantiomeric” refer to a molecule that cannot be superimposed on its mirror image and hence is optically active wherein the enantiomer rotates the plane of polarized light in one direction and its mirror image compound rotates the plane of polarized light in the opposite direction.

The term β€œracemic” refers to a mixture of equal parts of enantiomers and which mixture is optically inactive.

The term β€œabsolute configuration” refers to the spatial arrangement of the atoms of a chiral molecular entity (or group) and its stereochemical description, e.g., R or S.

The stereochemical terms and conventions used in the specification are meant to be consistent with those described in Pure & Appl. Chem 68:2193 (1996), unless otherwise indicated.

The term β€œenantiomeric excess” or β€œee” refers to a measure for how much of one enantiomer is present compared to the other. For a mixture of R and S enantiomers, the percent enantiomeric excess is defined as |Rβˆ’S|*100, where R and S are the respective mole or weight fractions of enantiomers in a mixture such that R+Sβˆ’1. With knowledge of the optical rotation of a chiral substance, the percent enantiomeric excess is defined as ([Ξ±]obs/[Ξ±]max)*100, where [Ξ±]obs is the optical rotation of the mixture of enantiomers and [Ξ±]max is the optical rotation of the pure enantiomer. Determination of enantiomeric excess is possible using a variety of analytical techniques, including NMR spectroscopy, chiral column chromatography or optical polarimetry.

The terms β€œenantiomerically pure” or β€œenantiopure” refer to a sample of a chiral substance all of whose molecules (within the limits of detection) have the same chirality sense.

The terms β€œenantiomerically enriched” or β€œenantioenriched” refer to a sample of a chiral substance whose enantiomeric ratio is greater than 50:50. Enantiomerically enriched compounds may be enantiomerically pure.

The terms β€œa” and β€œan” refer to one or more.

The term β€œabout,” as used herein, includes the recited number Β±10%. Thus, β€œabout 10” means 9 to 11.

The present disclosure encompasses the preparation and use of salts of the Compounds of the Disclosure, including noir-toxic pharmaceutically acceptable salts. Examples of pharmaceutically acceptable addition salts include inorganic and organic acid addition salts and basic salts. The pharmaceutically acceptable salts include, but are not limited to, metal salts such as sodium salt, potassium salt, cesium salt and the like; alkaline earth metals such as calcium salt, magnesium salt and the like; organic amine salts such as triethylamine salt, pyridine salt, picoline salt, ethanolamine salt, triethanolamine salt, dicyclohexylamine salt, N,Nβ€²-dibetrzylethylenediamine salt and the like; inorganic acid salts such as hydrochloride, hydrobromide, phosphate, sulphate and the like; organic acid salts such as citrate, lactate, tartrate, maleate, fumarate, mandelate, acetate, dichloroacetate, trifluoroacetate, oxalate, formate and the like; sulfonates such as methanesulfonate, benzenesulfonate, p-toluenesulfonate and the like; and amino acid salts such as arginate, asparginate, glutamate and the like. The term β€œpharmaceutically acceptable salt” as used herein, refers to any salt, e.g., obtained by reaction with an acid or a base, of a Compound of the Disclosure that is physiologically tolerated in the target patient (e.g., a mammal, e.g., a human).

Acid addition salts can be formed by nixing a solution of the particular Compound of the Disclosure with a solution of a pharmaceutically acceptable non-toxic acid such as hydrochloric acid, fumaric acid, maleic acid, succinic acid, acetic acid, citric acid, tartaric acid, carbonic acid, phosphoric acid, oxalic acid, dichloroacetic acid, or the like. Basic salts can be formed by mixing a solution of the compound of the present disclosure with a solution of a pharmaceutically acceptable non-toxic base such as sodium hydroxide, potassium hydroxide, choline hydroxide, sodium carbonate and the like.

The present disclosure encompasses the preparation and use of solvates of Compounds of the Disclosure. Solvates typically do not significantly alter the physiological activity or toxicity of the compounds, and as such may function as pharmacological equivalents. The term β€œsolvate” as used herein is a combination, physical association and/or solution of a compound of the present disclosure with a solvent molecule such as, e.g. a disolvate, monosolvate or hemisolvate, where the ratio of solvent molecule to compound of the present disclosure is about 2:1, about 1:1 or about 1:2, respectively. This physical association involves varying degrees of ionic and covalent bonding, including hydrogen bonding. In certain instances, the solvate can be isolated, such as when one or more solvent molecules are incorporated into the crystal lattice of a crystalline solid. Thus. β€œsolvate” encompasses both solution-phase and isolatable solvates. Compounds of the Disclosure can be present as solvated forms with a pharmaceutically acceptable solvent, such as water, methanol, ethanol, and the like, and it is intended that the disclosure includes both solvated and unsolvated forms of Compounds of the Disclosure. One type of solvate is a hydrate. A β€œhydrate” relates to a particular subgroup of solvates where the solvent molecule is water. Solvates typically can function as pharmacological equivalents. Preparation of solvates is known in the art. See, for example, M. Caira et al, J. Pharmaceut. Sci., 93(3):601-611 (2004), which describes the preparation of solvates of fluconazole with ethyl acetate and with water. Similar preparation of solvates, hemisolvates, hydrates, and the like are described by E. C. van Tonder et al., AAPS Pharm. Sci. Tech., 5(1):Article 12 (2004), and A. L. Bingham et al., Chem. Commun. 603-604 (2001). A typical, non-limiting, process of preparing a solvate would involve dissolving a Compound of the Disclosure in a desired solvent (organic, water, or a mixture thereof) at temperatures above 20Β° C. to about 25Β° C., then cooling the solution at a rate sufficient to form crystals, and isolating the crystals by known methods, e.g., filtration. Analytical techniques such as infrared spectroscopy can be used to confirm the presence of the solvent in a crystal of the solvate.

Since Compounds of the Disclosure are inhibitors of SMYD proteins, such as SMYD3 and SMYD2, a number of diseases, conditions, or disorders mediated by SMYD proteins, such as SMYD3 and SMYD2, can be treated by employlng these compounds. The present disclosure is thus directed generally to a method for treating a disease, condition, or disorder responsive to the inhibition of SMYD proteins, such as SMYD3 and SMYD2, in an animal suffering from, or at risk of suffering from, the disorder, the method comprising administering to the animal au effective amount of one or more Compounds of the Disclosure.

The present disclosure is further directed to a method of inhibiting SMYD proteins in au animal in need thereof, the method comprising administering to the animal a therapeutically effective amount of at least one Compound of the Disclosure.

The present disclosure is further directed to a method of inhibiting SMYD3 in an animal in need thereof, the method comprising administering to the animal a therapeutically effective amount of at least one Compound of the Disclosure.

The present disclosure is further directed to a method of inhibiting SMYD2 in an animal in need thereof, the method comprising administering to the animal a therapeutically effective amount of at least one Compound of the Disclosure.

As used herein, the terms β€œtreat,” β€œtreating,” β€œtreatment” and the like refer to eliminating, reducing, or ameliorating a disease or condition, and/or symptoms associated therewith. Although not precluded, treating a disease or condition does not require that the disease, condition, or symptoms associated therewith be completely eliminated. As used herein, the terms β€œtreat,” β€œtreating,” β€œtreatment,” and the like may include β€œprophylactic treatment,” which refers to reducing the probability of redeveloping a disease or condition, or of a recurrence of a previously-controlled disease or condition, in a subject who does not have, but is at risk of or is susceptible to, redeveloping a disease or condition or a recurrence of the disease or condition. The term β€œtreat” and synonyms contemplate administering a therapeutically effective amount of a Compound of the Disclosure to an individual in need of such treatment.

Within the meaning of the disclosure, β€œtreatment” also includes relapse prophylaxis or phase prophylaxis, as well as the treatment of acute or chronic signs, symptoms and/or malfunctions. The treatment can be orientated symptomatically, for example, to suppress symptoms. h cart be effected over a short period, be oriented over a medium term, or can be a long-term treatment, for example within the context of a maintenance therapy.

The term β€œtherapeutically effective amount” or β€œeffective dose” as used herein refers to an amount of the active ingredient(s) that is(are) sufficient, when administered. by a method of the disclosure, to efficaciously deliver the active ingredient(s) for the treatment of condition or disease of interest to an individual in need thereof. In the case of a cancer or other proliferation disorder, the therapeutically effective amount of the agent may reduce (i.e., retard to some extert and preferably stop) unwanted cellular proliferation; reduce the number of cancer cells; reduce the tumor size; inhibit (i.e., retard. to some extert and preferably stop) cancer cell infiltration into peripheral organs; inhibit (i.e., retard to some extert and preferably stop) tumor metastasis; inhibit, to some extert, tumor growth; modulate protein methylation. In the target cells; and/or relieve, to some extert, one or more of the symptoms associated with the cancer. To the extert the administered compound or composition prevents growth and/or kills existing cancer cells, it may be cylostatic and/or cylotoxic.

The term β€œcontainer” means any receptacle and closure therefore suitable for storing, shipping, dispensing, and/or handling a pharmaceutical product.

The term β€œinsert” means information accompanying a pharmaceutical product that provides a description of how to administer the product, along with the safety and efficacy data required to allow the physician, pharmacist, and patient to make an informed decision regarding use of the product. The package insert generally is regarded as the β€œlabel” for a pharmaceutical product.

The team β€œdisease” or β€œcondition” or β€œdisorder” denotes disturbances and/or anomalies that as a rule are regarded as being pathological conditions or functions, and that can manifest themselves in the form of particular signs, symptoms, and/or malfunctions. As demonstrated below, Compounds of the Disclosure inhibit SMYD proteins, such as SMYD3 and SMYD2 and can be used in treating diseases and conditions such as proliferative diseases, wherein inhibition of SMYD proteins, such as SMYD3 and SMYD2 provides a benefit.

In some embodiments, the Compounds of the Disclosure can be used to treat a β€œSMYD protein mediated disorder” (e.g., a SMYD3-mediated disorder or a SMYD2-mediated disorder). A SMYD protein mediated disorder is any pathological condition in which a SMYD protein is know to play a role. In some embodiments, a SMYD-mediated disorder is a proliferative disease.

In some embodiments inhibiting SMYD proteins, such as SMYD3 and SMYD2, is the inhibition of the activity of one or more activities of SMYD proteins such as SMYD3 and SMYD2. In some embodiments, the activity of the SMYD proteins such as SMYD3 and SMYD2 is the ability of the SMYD protein such as SMYD3 or SMYD2 to transfer a methyl group to a target protein (e.g., histone). It should be appreciated that the activity of the one or more SMYD proteins such as SNEYD3 and SMYD2 may be inhibited in vitro or in vivo. Examplimy levels of inhibition of the activity one or more SMYD proteins such as SMYD3 and SMYD2 include at least 10% inhibition, at least 20% inhibition, at least 30% inhibition, at least 40% inhibition, at least 50% inhibition, at least 60% inhibition, at least 70% inhibition, at least 80% inhibition, at least 90% inhibition, and up to 100% inhibition.

The SMYD (SET and MYND domain) family of lysine methyltransferases (KMTs) plays pivotal roles in various cellular processes, including gene expression regulation and DNA damage response. The family of human SMYD proteins consists of SMYD1,SMYD2,SMYD3,SMYD4 and SMYD5. SMYD1,SMYD2, and SMYD3 share a high degree of sequence homology and, with the exception of SMYD5, human SMYD proteins harbor at least one C-terminal tetratrico peptide repeat (TPR) domain. (See e.g., Abu-Farha et al, J. Mol Cell Biol (2011) 3 (5) 301-308). The SMYD proteins have been found to be linked to various cancers (See e.g., Hamamoto et al. NNat Cell. Biol. 2004, 6: 731-740), Hu et al. Canncer Research 2009, 4067-4072, and Komatsu et al.. Carcinogenesis 2009, 301139-1146.)

SMYD3 is a protein imethyltransferase found to be expressed at high levels in a number of different cancers (Hamamoto, R et al Nat. Cell Biol., 6(8):731-40 (2004)). SMYD3 likely plays a role in the regulation of gene transcription and signal transduction pathways critical for survival of breast, liver, prostate and lung cancer cell lines (Hamamoto, R., et al., Nat. Cell Biol., 6(8):731-40 (2004); Hamamoto, R., et al., Cancer Sci., 97(2):113-8 (2006); Van Aller, G. S., et al., Epigenetics, 7(4):340-3 (2012); Liu, C., et al., J. Natl. Cancer Inst., 105(22):1β€²219-28 (2013); Mazur, P. K., et al., Nature, 510(7504):283-7 (2014)).

Genetic knockdown of SMYD3 leads to a decrease in prolikration of a variety of cancer cell lines (Hamamoto, R., et al, Nat. Cell Biol., 6(8):731-40 (2004); Hamamoto, R., et al., Cancer Sci., 97(2):113-8 (2006); Van Aller, G. S., et al., Epigenetics, 7(4)340-3 (2012); Liu, C., et al., J. Natl. Cancer Inst., 105(22):1719-28 (2013); Mazur, P. K. et al., Nature, 510(7504);283-7 (2014)). Several studies employlng RNAi-based technologies have shown that ablation of SMYD3 in hepatocellular carcinoma cell lines greatly reduces cell viability and that its pro-survival role is dependent on its catalylic activity (Hamamoto, R., et al., Nat. Cell Biol., 6(8);731-40 (2004); Van Aller, G. S., et al., Epigenetics, 7(4):340-3 (2012)). Moreover, SMYD3 has also been shown to be a critical mediator of transformation resulting from gain of function mutations in the oncogene, KRAS for both pancreatic and lung adenocarcinoma in mouse models. The dependence of KRAS on SMYD3 was also shown to be dependent on its catalylic activity (Mazur, P. K., et al., Nature, 510(7504):283-7 (2014)). SMYD3 function has also been implicated in colerectal cancers and RNAi mediated knockdown of SMYD3 has been shown to impair colerectal cell proliferation. (Peserico et al., Cell Physiol. 2015 Feb 28. doi: 10.10021jcp.24975. [Epub ahead of print]).

Furthermore, SMYD3 function has also been shown to play a role in immunology and development. For instance, de Almeida reported that SMYD3 plays a role in generation of inducible regulatory T cells (iTreg) cells. In a mouse model of respiratory syncylial virus (RSV) infection, a model in which iTreg cells have a critical role in regulating lung pathogenesis, SMYD3βˆ’/βˆ’ mice demonstrated exacerbation of RSV-induced disease related to enhanced proinflammatory responses and worsened pathogenesis within the lung (de Almeida et al. Mucosal Immunol. 2015 Feb 11, doi: 10.1038/mi.2015.4. [Epub ahead of print]). In addition, as to development, Proserpio et al. have shown the importance of SMYD3 in the regulation of skeletal muscle atrophy (Proserpio et al. Genes Dev. 2013 Jun 1;27(11): 1299-312), while Fujii et al. have elucidated the role of SMYD3 in cardiac and skeletal muscle development (Fujii et al. PLoS One. 2011;6(8):e23491).

SMYD2 (SET and. MYND domain-containing protein 2) was first characterized as protein that is a member of a sub-family of SET domain containing proteins which catalyze the site-specific transfer of methyl groups onto substrate proteins. SMYD2 was initially shown to have methyltransferase activity towards lysine 36 on histone H3 (H3K36) but has subsequently been shown to have both histone and non-histone methyltrasferase activity.

SMYD2 has been implicated in the pathogenesis of multiple cancers. It has been shown to be over-expressed, compared to matched normal samples, in tumors of the breast, cervix, colon, kidney, liver, head and neck, skin, pancreas, ovary, esophagus and prostate, as well as hematologic malignancies such as AML, B- and T-ALL, CLL and MCL, suggesting a role for SMYD2 in the biology of these cancers. More specifically, studies using genetic knock-down of SMYD2 have demonstrated anti-proliferative effects in esophageal squamous cell carcinoma (ESCC), bladder carcinoma and cervical carcinoma cell lines. (See e.g., Komatsu et al., Carcinogenesis 2009, 30, 1139, and Cho et al., Neoplasia. 2012 Jan;14(6):476-86). Moreover, high expression of SMYD2 has been shown to be a poor prognostic factor in both ESCC and pediatric ALL. (See e.g., Komatsu et al. Br J Cancer. 2015 Jan 20; 112(2):357-64, and Sakamoto et al., Leuk Res. 2014 Apr;38(4):496-502). Recently, Nguyen et al., have shown that a small molecule inhibitor of SMYD2 (LLY-507) inhibited the proliferation of several esophageal, liver and breast cancer cell lines in a dose-dependent manner. (Nguyen et al., i J Biol Chem. 2015 Mar 30. pii: jbc.M114.626861. [Epub ahead of print]).

SMYD2 has also been implicated in immunology. For instance, Xu et al. have shown that SMYD2 is a negative regulator of macrophage activation by suppressing Interleukin-6 and TNF-alpha production. (Xu et al., J Biol Chem. 2015 Feb 27;290(9):5414-23).

In one aspect, the present disclosure provides a method of treating cancer in a patient comprising administering a therapeutically effective amount of a Compound of the Disclosure. While not being limited to a specific mechanism, in some embodiemtns, Compounds of the Disclorure can treat cancer by inhibiting SMYD proteins, such as SMYD3 and SMYD2. Examples of treatable cancers include, but are not limited to, adrenal cancer, acinic cell carcinoma, acoustic neuroma, acral lentigious melanoma, acrospiroma, acute eosinophilic leukemia, acute erylhroid leukemia, acute lymphoblastic leukemia, acute megakaryoblastic leukemia, acute monocylic leukemia, acute promyelocylic leukemia, adenocarcinoma, adenoid cystic carcinoma, adenoma, adenomatoid odontogenic tumor, adenosquamous carcinoma, adipose tissue neoplasm, adrenocortical carcinoma, adult T-cell leukemia/lymphoma, aggressive NK-cell leukemia, AIDS-related lymphoma, alveolar rhabdornyosarcoma, alveolar soft part sarcoma, ameloblastic fibroma, anaplastic large cell lymphoma, anaplastic thyroid cancer, angioimmunoblastic T-cell lymphoma, angiomyolipoma, angiosarcoma, astrocyloma, atypical teratoid rhabdoid tumor, B-cell chronic lymphocylic leukemia, B-cell prolymphocylic leukemia, B-cell lymphoma, basal cell carcinoma, biliary tract cancer, bladder cancer, blastoma, bone cancer, Brenner tumor, Brown tumor, Burkitt's lymphoma, breast cancer, brain cancer, carcinoma, carcinoma in situ, carcinosarcoma, cartilage tumor, cornentoma, myeloid, sarcoma, chondroma, chordoma, choriocarcinoma, choroid plexus papilloma, clear-cell sarcoma of the kidney, craniopharyngioma, cutaneous T-cell lymphoma, cervical cancer, colorectal cancer, Degos disease, desmoplastic small round cell tumor, diffuse large B-cell lymphoma, dysembryoplastic neuroepithelial tumor, dysgerminoma, embryonal carcinoma, endocrine gland neoplasm, endodermal sinus tumor, enteropathy-associated T-cell lymphoma, esophageal cancer, fetus in fetu, fibroma, fibrosarcoma, follicular lymphoma, follicular thyroid cancer, ganglioneuroma, gastrointestinal cancer, germ cell tumor, gestational choriocarcinoma, giant cell fibroblastoma, giant cell tumor of the bone, glial tumor, glioblastoma multiforme, glioma, gliomatosis cerebri, glucagonoma, gonadoblastoma, granulosa cell tumor, gynandroblastoma, gallbladder cancer, gastric cancer, hairy cell leukemia, hemangioblastoma, head and neck cancer, hemangiopericyloma, hematological malignancy, hepatoblastoma, hepatosplenic T-cell lymphoma., Hodgkin's lymphoma., non-Hodgkin's lymphoma, invasive lobular carcinoma, intestinal cancer, kidney cancer, laryngeal cancer, lentigo maligna, lethal midline carcinoma, leukemia, leydig cell tumor, liposarcoma, lung cancer, lymphangioma, lymphangiosarcoma, lymphoepithelionta. lymphoma, acute lymphocylic leukemia, acute myelogeous leukemia, chronic lymphocylic leukemia, liver cancer, small cell lung cancer, non-small cell lung cancer, MALT lymphoma, malignant fibrous histiocyloma, malignant peripheral nerve sheath tumor, malignant triton tumor, mantle cell lymphoma, marginal zone B-cell lymphoma, mast cell leukemia, mediastinal germ cell tumor, medullar/ carcinoma of the breast, medullary thyroid cancer, medulloblastoma, melanoma, meningioma, merkel cell cancer, mesothelioma, metastatic urothelial carcinoma, mixed Mullerian tumor, mucinous tumor, multiple myeloma, muscle tissue neoplasm, mycosis fungoides, myxoid liposarcoma, myxoma, myxosarcoma, nasopharyngeal carcinoma, neurinoma, neuroblastoma, neurofibroma, neuroma, nodular melanoma, ocular cancer, oligoastrocyloma, oligodendroglioma, oncocyloma, optic nerve sheath meningioma, optic nerve tumor, oral cancer, osteosarcoma, ovarian cancer, Pancoast tumor, papillary thyroid cancer, paraganglioma, pinealoblastoma, pineocyloma, pituicyloma, pituitary adenoma, pituitary tumor, plasmacylorna, polyembryoma, precursor T-lymphoblastic lymphoma, primary central nervous system lymphoma, primary effusion lymphoma, preimary peritoneal cancer, prostate cancer, pancreatic cancer, pharyngeal cancer, pseudomyxoma periotonei, renal cell carcinoma, renal medullary carcinoma, retinoblastoma, rhabdomyoma, rhabdomyosarcoma, Richter's transformation, rectal cancer, sarcoma, Schwarmomatosis, Sertoli cell tumor, sex cord-gonadal stromal tumor, signet ring cell carcinoma, skin cancer, small blue round cell tumors, small cell carcinoma, soft tissue sarcoma, somatostatinoma, soot wart, spinal tumor, splenic marginal zone lymphoma, squamous cell carcinoma, synovialsarcoma, Sezary's disease, small intestine cancer, squamous carcinoma, stomach cancer, T-cell lymphoma, testicular cancer, thecoma, thyroid cancer, transitional cell carcinoma, throat cancer, urachal cancer, urogenital cancer, urothelial carcinoma, uveal melanoma, uterine cancer, verrucous carcinoma, visual pathway glioma, vulvar cancer, vaginal cancer, Waldenstrom's maeroglobulinemia, Warthin's tumor, and Wilms' tumor.

In another embodiment, the cancer is breast, cervix colon, kidney, liver, head and neck, skin, pancreas, ovary, esophagus, or prostate cancer.

In another embodiment, the cancer is a hematologic malignancy such as acute myeloid leukemia (AML), B- and T-acute lymphoblastic leukemia (ALL), chronic lymphocylic leukemia (CLL), or mantle cell lymphoma (MCL).

In another embodiment the cancer is esophageal squamous cell carcinoma (ESCC), bladder carcinoma, or cervical carcinoma.

In another embodiment, the cancer is a leukemia, for example a leukemia selected from acute monocylic leukemia, acute myelogenous leukemia, chronic myelogenous leukemia, chronic lymphocylic leukemia and mixed lineage leukemia (MLL). In another embodiment the cancer is NUT-midline carcinoma. In another embodiment the cancer is multiple rnyeloma. In another embodiment the cancer is a lung cancer such as small cell lung cancer (SCLC). In another embodiment the cancer is a neuroblastoma. In another embodiment the cancer is Burkitt's lymphoma. In another embodiment the cancer is cervical cancer. hi another embodiment the cancer is esophageal cancer. In another embodiment the cancer is ovarian cancer. In another emboditnent the cancer is colorectal cancer. In another embodiment, the cancer is prostate cancer. In another embodiment, the cancer is breast cancer.

In another embodiment, the present disclosure provides a therapeutic method of modulating protein methylation, gene expression, cell proliferation, cell differentiation and/or apoptosis in vivo in the cancers mentioned above by administering a therapeutically effective amount of a Compound of the Disclosure to a subject in need of such therapy.

Compounds of the Disclosure can be administered to a mammal in the form of a raw chemical without any other components present. Compounds of the Disclosure can also be administered to a mammal as part of a pharmaceutical composition containing the compound combined with a suitable pharmaceutically acceptable carrier. Such a carrier can be selected floral pharmaceutically acceptable excipients and auxiliaries. The term β€œpharmaceutically acceptable carrier” or β€œphatinaceutically acceptable vehicle” encompasses any of the standard pharmaceutical carriers, solvents, surfactants, or vehicles. Suitable pharmaceutically acceptable vehicles include aqueous vehicles and nonaqueous vehicles. Standard pharmaceutical carriers and their formulations are described in Remington's Pharmaceutical Sciences, Mack Publishing Co., Easton, Pa., 19th ed. 1995.

Pharmaceutical compositions within the scope of the present disclosure include all compositions where a Compound of the Disclosure is combined with one or more pharmaceutically acceptable carriers. In one embodiment, the Compound of the Disclosure is present in the composition in an amount that is effective to achieve its intended therapeutic purpose. While individual needs may vary, a determination of optimal ranges of effective amounts of each compound is within the skill of the art. Typically, a Compound of the Disclosure can be administered to a mammal, e.g., a human, orally at a dose of from about 0.0025 to about 1500 mg per kg body weight of the mammal, or an equivalent amount of a pharmaceutically acceptable salt or solvate thereof, per day to treat the particular disorder. A useful oral dose of a Compound of the Disclosure administered to a mammal is from about 0.0025 to about 50 mg per kg body weight of the mammal, or an equivalent amount of the pharmaceutically acceptable salt or solvate thereof. For intramuscular injection, the dose is typically about one-half of the oral dose.

A unit oral dose may comprise from about 0.01 mg to about 1 g of the Compound, of the Disclosure, e.g., about 0.01 mg to about 500 mg, about 0,01 mg to about 250 mg, about 0.01 mg to about 100 mg, 0.01 mg to about 50 mg, e.g., about 0.1 mg to about 10 mg, of the compound. The unit dose can be administered one or more times daily, e.g., as one or more tablets or capsules, each containing from about 0.01 mg to about 1 g of the compound, or an equivalent amount of a pharmaceutically acceptable salt or solvate thereof.

A pharmaceutical composition of the present disclosure can be administered to any patient that may experience the beneficial effects of a Compound of the Disclosure. Foremost among such patients are mammals, e.g., humans and companion animals, although the disclosure is not intended to be so limited. In one embodiment, the patient is a human.

A pharmaceutical composition of the present disclosure can be administered by any means that achieves its intended purpose. For example, administration can be by the oral, parenteral, subcutaneous, intravenous, intramuscular, intraperitoneal, transdermal, intranasal, transmucosal, rectal, intravaginal or buccal route, or by inhalation. The dosage administered and route of administration will vary, depending upon the circumstances of the particular subject, and taking into account such factors as age, gender, health, and weight of the recipient, condition or disorder to be treated, kind of concurrent treatment, if any, frequency of treatment, and tile nature of the effect desired.

In one embodiment, a pharmaceutical composition of the present disclosure can be administered orally. In another embodiment, a pharmaceutical composition of the present disclosure cart be administered orally and is formulated into tablets, dragees, capsules, or art oral liquid preparation. In one embodiment, the oral formulation comprises extruded multiparticulates comprising the Compound of the Disclosure.

Alternatively, a pharmaceutical composition of the present disclosure can be administered rectally, and is formulated in suppositories.

Alternatively, a pharmaceutical composition of the present disclosure can be administered by injection.

Alternatively, a pharmaceutical composition of the present disclosure can be administered transdermally.

Alternatively, a pharmaceutical composition of the present disclosure can be administered by inhalation or by intranasal or transmucosal administration.

Alternatively, a pharmaceutical composition of the present disclosure can be administered by the intravaginal route.

A pharmaceutical composition of the present disclosure can contain from about 0.01 to 99 percent by weight, e.g., from about 0.25 to 75 percent by weight, of a Compound of the Disclosure, e.g., about 1%, about 5%, about 10%, about 15%, about 20%, about 25%, about 30%, about 35%, about 40%, about 45%, about 50%, about 55%, about 60%, about 65%, about 70%, or about 75% by weight of a Compound of the Disclosure.

A pharmaceutical composition of the present disclosure is manufactured in a manner which itself will be known. In view of the instant disclosure, for example, by means of conventional mixing, granulating, dragee-making, dissolving, extrusion, or lyophilizing processes. Thus, pharmaceutical compositions for oral use can be obtained by combining the active compound with solid excipients, optionally grinding the resulting mixture and processing the mixture of granules, after adding suitable auxiliaries, if desired or necessary, to obtain tablets or dragee cores.

Suitable excipients include fillers such as saccharides (for example, lactose, sucrose, mannitol or sorbitol), cellulose preparations, calcium phosphates (for example, tricalcium phosphate or calcium hydrogen phosphate), as well as binders such as starch paste (using, for example, maize starch, wheat starch, rice starch, or potato starch), gelatin, tragacanth, methyl cellulose, hydroxypropylmethylcellulose, sodium carboxymethylcellulose, and/or polyvinyl pyrrolidone. If desired, one or more disintegrating agents can be added, such as the above-mentioned starches and also carboxymethyl-starch, cross-linked polyvinyl pyrrolidone, agar, or alginic acid or a salt thereof, such a.s sodium alginate.

Auxiliaries are typically flow-regulating agents and lubricants such. as, for example, silica, talc, stearic acid or salts thereof (e.g, magnesium stearate or calcium stearate), and polyethylene glycol. Drager cores are provided with suitable coatings that are resistant to gastric juices. For this purpose, concentrated saccharide solutions can be used, which may optionally contain gum arabic, talc, polyvinyl pyrrolidone, polyethylene glycol and/or titanium dioxide, lacquer solutions and suitable organic solvents or solvent mixtures. In order to produce coatings resistant to gastric juices, solutions of suitable cellulose preparations such as acetylcellulose phthalate or hydroxypropylmethyl-cellulose phthalate can be used. Dye stuffs or pigments can he added to the tablets or dragee coatings, for example, for identification or in order to characterize combinations of active compound doses.

Examples of other pharmaceutical preparations that can be used orally include push-fit capsules made of gelatin, or soft. sealed capsules made of gelatin and a plasticizer such as glycerol or sorbitol. The push-fit capsules can contain a compound in the form of granules, which can he mixed with fillers such as lactose, binders such as starches, and/or lubricants such as talc or magnesium stearate and, optionally, stabilizers, or in the form of extruded rnultiparticulates. In soft capsules, the active compounds are preferably dissolved, or suspended in suitable liquids, such as fatty oils or liquid paraffin. In addition, stabilizers can be added.

Possible pharmaceutical preparations for rectal administration include, for example, suppositories, which consist of a combination of one or more active compounds with a suppository base. Suitable suppository bases include natural and synthetic triglycerides, and paraffin hydrocarbons, among others. It is also possible to use gelatin rectal capsules consisting of a combination of active compound with a base material such as, for example, a liquid triglyceride, polyethylene glycol, or paraffin hydrocarbon.

Suitable formulations for parenteral administration include aqueous solutions of the active compound in a water-soluble foi in such as, for example, a water-soluble salt, alkaline solution, or acidic solution. Alternatively, a suspension of the active compound can be prepared as an oily suspension. Suitable lipophilic solvents or vehicles for such as suspension may include fatty oils (for example, sesame oil), synthetic fatty acid esters (for example, ethyl oleate), triglycerides, or a polyethylene glycol such as polyethylene glycol-400 (PEG-400). An aqueous suspension may contain one or more substances to increase the viscosity of the suspension, including for example, sodium carboxymethyl cellulose, sorbitol, and/or dextran. The suspension may optionally contain stabilizers,

In another embodiment, the present disclosure provides kits which comprise a Compound, of the Disclosure (or a composition comprising a Compound, of the Disclosure) packaged in a maimer that facilitates their use to practice methods of the present disclosure. In one embodiment, the kit includes a Compound of the Disclosure (or a composition comprising a Compound of the Disclosure) packaged in a container, such as a sealed bottle or vessel, with a label affixed to the container or included in the kit that describes use of the compound or composition to practice the method of the disclosure. In one embodiment, the compound or composition is packaged in a unit dosage form. The kit further can include a device suitable for administering the composition according to the intended route of administration.

General Synthesis of Compounds

Compounds of the Disclosure are prepared using methods known to those skilled in the art in view of this disclosure, or by the illustrative methods shown in the General Schemes below. In the General Schemes, A, Y, R12a, R12b, R13a, R13b, and Z of Formulae A-D are as defined in connection with Formula VI, unless otherwise indicated. In any of the General Schemes, suitable protecting can be employed in the synthesis, for example, when Z is (amino)alkyl or any other group that may group that may require protection. (See, Wuts, P. G. M.; Greene, T. W., β€œGreene's Protective Groups in Organic Synthesis”, 4th Ed., J. Wiley & Sons, NY, 2007).

Compound A is converted to compound B (i.e, a compound having Formula VI, wherein X is β€”S(═O)2+) by coupling with a suitable sulfonyl chloride (Zβ€”SO2Cl) in the presence of a suitable base such as TEA or DIPEA in a suitable solvent such as dichloromethane, acetonitrile, or DMF.

Compound A is converted to compound C (i.e, a compound having Formula VI, wherein X is β€”C(═O)β€”) by coupling with a suitable acide chloride (Zβ€”COCl) in the presence of a suitable base such as TEA or DIPEA in a suitable solvent such as dichloromethane, acetonitrile, or DMF, or by coupling with a suitable carboxylic acid. (Zβ€”CO2H) in the presence of a suitable coupling reagent such as HATU and a suitable base such as TEA or DIPEA in a suitable solvent such as dichloromethane, acetonitrile, or DMF.

Compound A is converted to compound D (i.e, a compound having Formula VI, wherein X is β€”C(═O)C(R4)(H)β€”) by coupling with a suitable carboxylic acid (Zβ€”C(H)R4CO2H) in the presence of a suitable coupling reagent such as HATU and a suitable base such as TEA or DIPEA in a suitable solvent such as dichloromethane, acetonitrile, or DMF.

EXAMPLES

General Synthetic Methods

General methods and experimental procedures for preparing and characterizing; Compounds of the Disclosure are set forth in the general schemes above and the examples below. Wherever needed, reactions were heated using conventional hotplate apparatus or heating mantle or microwave irradiation equipment. Reactions were conducted with or without stirring, under atmospheric or elevated pressure in either open or closed vessels. Reaction progress was monitored using conventional techniques such. as TLC, HPLC, FPLC, or LCMS using instrumentation and methods described below. Reactions were quenched and crude compounds isolated using conventional methods as described in the specific examples provided. Solvent removal was carried out with or without heating, under atmospheric or reduced pressure, using either a rotary or centrifugal evaporator.

Compound purification was carried out as needed using a variety of traditional methods including, but not limited to, preparative chromatography under acidic, neutral, or basic conditions using either normal phase or reverse phase HPLC or flash columns or Prep-TLC plates. Compound purity and mass confirmations were conducted using standard HPLC and/or UPLC and/or MS spectrometers and/or LCMS and/or GC equipment (i.e., including, but not limited to the following instrumentation: Waters Alliance 2695 with 2996 PDA detector connected with ZQ detector and ESI source; Shimadzu LDMS-2020; Waters Acquity H Class with PDA detector connected with SQ detector and ESI source; Agilent 1100Series with PDA detector; Waters Alliance 2695 with 2998 PDA detector; AB SCIEX API 2000 with ESI source; Agilent 7890 GC). Exemplified compounds were dissolved in either MeOH or McCN to a concentration of approximately 1 mg/mL and analyzed by injection of 0.5-10 ΞΌL into an appropriate LCMS system using the methods provided in the following table. In each case the flow rate is 1 ml/min.

MS Heat MS Detector
Mobile Mobile Block Temp Voltage
Method Column Phase A Phase B Gradient Profile (Β° C.) (kV)
A Shim-pack Water/0.05% ACN/0.05% 5% to 100% B in 250 1.5
XR-ODS TFA TFA 2.0 minutes, 100%
2.2 ΞΌm B for 1.1 minutes,
3.0 Γ— 50 mm 100% to 5% B in
0.2 minutes, then
stop
B Gemini- Water/0.04% ACN 5% to 100% B in 200 0.75
NX 3 ΞΌm Ammonia 2.0 minutes, 100%
C18 B for 1.1 minutes,
110A 100% to 5% B in
0.1 minutes, then
stop
C Shim-pack Water/0.05% ACN/0.05% 5% to 100% B in 250 0.85
XR-ODS TFA TFA 2.0 minutes, 100%
1.6 ΞΌm B for 1.1 minutes,
2.0 Γ— 50 mm 100% to 5% B in
0.1 minutes, then
stop
D Shim-pack Water/0.05% ACN/0.05% 5% to 100% B in 250 0.95
XR-ODS TFA TFA 2.0 minutes, 100%
2.2 ΞΌm B for 1.1 minutes,
3.0 Γ— 50 mm 100% to 5% B in
0.1 minutes, then
stop

Compound structure confirmations were carried out using standard 300 or 400 MHz NMR spectrometers with nOc's conducted whenever necessary.

The following abbreviations are used herein:

Abbreviation Meaning
ACN acetonitrile
atm. atmosphere
DCM dichloromethane
DHP dihydropyran
DIBAL diisobutyl aluminum hydride
DIEA diisopropyl ethylamine
DMF dimethyl formamide
DMF-DMA dimethyl formamide dimethyl
acetal
DMSO dimethyl sulfoxide
Dppf 1,1β€²-
bis(diphenylphosphino)ferrocene
EA ethyl acetate
ESI electrospray ionization
EtOH Ethanol
FA formic acid
GC gas chromatography
H hour
Hex hexanes
HMDS hexamethyl disilazide
HPLC high performance liquid
chromatography
IPA Isopropanol
LCMS liquid chromatography/mass
spectrometry
MeOH Methanol
Min Minutes
NBS N-bromo succinimide
NCS N-chloro succinimide
NIS N-iodo succinimide
NMR nuclear magnetic resonance
nOe nuclear Overhauser effect
Prep. Preparative
PTSA para-toluene sulfonic acid
Rf retardation factor
rt room temperature
RT retention time
sat. Saturated
SGC silica gel chromatography
TBAF tetrabutyl ammonium fluoride
TEA Triethylamine
TFA trifluoroacetic acid
THF Tetrahydrofuran
TLC thin layer chromatography
UPLC ultra performance liquid
chromatography

Example 1

Synthesis of tert-butyl ((2S)-1-(4-(1-aminoethyl)piperidin-1-yl)-1-oxopropan-2-yl)carbamate

Step 1:Synthesis of tert-butyl 4-(methoxy(methyl)carbamoyl)piperidine-1-carboxylate

To a solution of 1-(tert-butoxycarbonyl)piperidine-4-carboxylic acid (20.0 g, 87.23 mmol) in DCM (200 mL) was added HATU (36.46 g, 95.95 mmol), TEA (17.62 g, 174.46 mmol) and N,O-dimethylhydroxylamine (8.93 g, 91.59 mmol). The mixture was stirred at 25Β° C. for 16 h. The mixture was washed with H2O and the DCM layer was evaporated and the residue purified by silica column (PE/EA-1:1) to give the tert-butyl 4-(methoxy(methyl)carbamoyl)piperidine-1-catboxylate (21.0 g, yield: 88.5%). 1H NMR (400 MHz, CDCl3): Ξ΄=4.27-4.01 (m, 2H), 3.71 (s, 3H), 3.19 (s, 3H), 2.85-2.70 (m, 3H), 1.75-1.62 (m, 4H), 1.46 (s, 9H).

Step 2:Synthesis of tert-butyl 4-acetylpiperidine-1-carboxylate

To a solution of tert-butyl 4-(methoxy(methyl)carbamoyl)piperidine-1-carboxylate (10.0 g, 36,76 mmol) in THF (150 mL) was added MeMgBr (24.5 mL, 73.52 mmol) at βˆ’78Β° C. The mixture was stirred at 25Β° C. for 16 h. TLC showed the reaction worked well. The mixture was quenched with aq. NH4Cl and H2O (100 mL) was added. The mixture was extracted with DCM (100 mLΓ—3). The DCM layer was dried and evaporated to give the tert-butyl 4-acetylpiperidine-1-carboxylate (7.9 g, yield: 94.7%). 1H NMR (400 MHz, CDCl3): Ξ΄=4.10 (br. s., 2H), 2.88-2.70 (m, 2H), 2.46 (tt, J=3.6, 11.5 Hz, 1H), 2.17 (s, 3H), 1.84 (d, J=11.5 Hz, 2H), 1.58-1.48 (m, 2H), 1.48-1.41 (m, 9H).

Step 3:Synthesis of tert-butyl 4-(1-aminoethyl)piperidine-1-carboxylate

To a solution of tert-butyl 4-acetylpiperidine-1-carboxylate (7.9 g, 34.8 mmol) in McOH (100 mL) was added NH4OAc (10.72 g, 139.2 mmol) and AcOH (1 mL). The mixture was stirred at 25Β° C. for 2 h, then was added NaBH3CN (2.63 g, 41.76 mmol). The mixture was stirred at 25Β° C. for 16 h. The mixture was evaporated and 2N NaOH (50 mL) was added to the residue. The solution was extracted with DCM (100 mLΓ—3). The DCM layer was washed with H2O and brine dried and evaporated to give the tert-butyl 4-(1-aminoethyl)piperidine-1-carboxylate (7.93 g, yield: 100%). 1H NMR (400 MHz, CDCl3): Ξ΄=4.15 (br. s., 2H), 2.77-2.57 (m, 3H), 1.76-1.59 (m, 2H), 1.46 (s, 9H), 1.33-10 (m, 5H), 1.06 (d, J=6.5 Hz, 3H).

Step 4:Synthesis of tert-butyl 4-(1-(((benzyloxy)carbonyl)amino) ethyl)piperidine-1-carboxylate

To a solution of tert-butyl 4-(1-aminoethyl)piperidine-1-carboxylate (7.93 g, 34.8 mmol) in THF (80 mL) was added K2CO3 (9.6 g, 69.6 mmol) and Cbz-Cl (7.1 g, 41.76 mmol). The mixture was stirred at 25Β° C. for 16 h. The mixture diluted with H2O and extracted with EA (50 mLΓ—3) and the EA layer evaporated to give tert-butyl 4-(1-(((benzyloxy)carbonyl)amino)ethyl)piperidine-1-carboxylate (10.1 g, yield: 80.2%). 1H NMR (400 MHz, DMSO-d6): Ξ΄=7.42-7.23 (m, 5H), 7.16 (d, J=8.8 Hz, 1H), 5.00 (s, 2H), 3.94 (d, J=11.8 Hz, 2H), 3.45-3.34 (m, 1H), 2.71-2.55 (m, 2H), 1.67-1.42 (m, 3H), 1.38 (s, 9H), 1.13-0.89 (m, 5H).

Step 5:Synthesis of benzyl (1-(piperidin-4-yl)ethyl)carbamate

To a solution of tert-butyl 4-(1-(((benzyloxy)carbonyl)amino)ethyl)piperidine-1-carboxylate (10.1 g, 27.87 mmol) in EA (50 mL) was added HCl/EA (50 mL). The mixture was stirred at 25Β° C. for 16 h. Solvents were then evaporated to give the benzyl (1-(piperidin-4-yl)ethyl)carbamate as a white solid. (8.3 g, yield: 100%). 1H NMR (400 MHz, DMSO-d6): Ξ΄=8.88 (br. s., 1H), 8.50 (d, J=9.5 Hz, 1H), 7.42-7.30 (m, 5H), 7.26 (d, J=8.8 Hz, 1H), 5.04-4.98 (nn 2H), 3.46-3.41 (m, 1H), 3.24 (d, J=11.8 Hz, 2H), 2.84-2.71 (m, 2H), 1.74 (d, J=13.6 Hz, 2H), 1.53 (d, J=3.8 Hz, 1H), 1.40-1.28 (m, 2H), 1.05-0.99 (m, 3H).

Step 6:Synthesis of tert-butyl N-[(1S)-2-[4-[1-(benzyloxycarbonylamino)ethyl]-1-piperidyl]-1-methyl-2-oxo-ethyl]carbamate

To a solution of benzyl (1-(piperidin-4-yl)ethyl)carbamate (7.0 g, 23.43 mmol) in DCM (100 mL) was added HATU (8.9 g, 23.43 mmol), TEA (4.73 g, 46.86 mmol) and (S)-2-((tert-butoxycarbonyl)amino)propanoic acid (4.43 g, 23.43 mmol). The mixture was stirred at 25Β° C. for 5 h. The mixture was washed with H2O and the DCM layer evaporated. The residue was purified by silica column (PE/EA-1:1) to give the tert-butyl N-[(1S)-2-[4-[1-(benzyloxycarbonylamino)ethyl]-1-piperidyl]-1-methyl-2-oxo-ethyl]carbamate (8.9 g, yield: 87.7%). 1H NMR (400 MHz, CDCl3): Ξ΄=7.37 (s, 5H), 5.58 (br. s., 1H), 5.15-5.03 (m, 2H), 4.60 (dd, J=7.4, 14.7 Hz, 3H), 3.96-3.86 (m, 1H), 3.68 (br. s., 1H), 2.99 (br. s., 1H), 2.54 (d, J=11.0 Hz, 1H), 1.91-1.63 (m, 3H), 1.44 (br. s., 9H), 1.28 (d, J=6.8 Hz, 4H), 1.21-1.07 (m, 4H).

Step 7:Synthesis of tert-butyl ((2S)-1-(4-(1-aminoethyl)piperidin-1-yl)-1-oxopropan-2-yl)carbamate

To a solution of tert-butyl N-[(1S)-2-[4-[1-(benzyloxycarbonylamino)ethyl]-1-piperidyl]-1-1-methyl-2-oxo-ethyl]carbamate (8.9 g, 20.55 mmol) in McOH (100 mL) was added Pd/C (900 mg). The mixture was stirred at 25Β° C. for 16 hours under H2 (50 psi). The reaction mixture was filtered and the filtrate was evaporated to give the tert-butyl ((2S)-1-(4-(1-aminoethyl)piperidin-1-yl)-1-oxopropan-2-yl)carbamatc. (5.6 g, yield 91.2%). 1H NMR (400 MHz, MeOD-d4): Ξ΄=5.61 (t, J=7.2 Hz, 1H), 4.71-4.56 (m, 2H), 3.91 (br. s., 1H), 3.06-2.96 (m, 1H), 2.77-2.71 (m, 1H), 2.59-2.50 (m, 1H), 1.85-1.68 (m, 2H), 1.44 (d, J=3.0 Hz, 9H), 1.35-1.22 (m, 4H), 1.19-1.04 (m, 4H); LCMS (m/z): 300.2 [M+H]+.

Example 2

Synthesis of tert-butyl (3-(((1r,4r)-4-aminocyclohexyl)amino)-3-oxopropyl)carbamate

Step 1:Synthesis of tert-butyl N-[3-[[4-(benzyloxycarbonylamino)cyclohexyl]amino]-3-oxo-propyl]carbamate

To a solution of 3-((tert-butoxycarbonyl)amino)propanoic acid (8.38 g, 44.30 mmol, 1.10 Eq) and TEA (8.2 g, 80 mmol, 2.0 Eq) in DCM (500 mL) was added HATU (15.31 g, 40.27 mmol, 1.00 Eq) in one portion at 20Β° C. The mixture was stirred at 20Β° C. for 30 minutes. Then benzyl N-(4-aminocyclohexyl)carbamate (10.00 g, 40.27 mmol, 1.00 Eq) was added in one portion at 20Β° C. The mixture was stirred at 20Β° C. for 12 hr at which point LCMS analysis showed the reaction was complete. The mixture was washed with water (400 mLΓ—3) and extracted with DCM (600 mLΓ—3). The combined organic layer was concentrated in vacuum. The residue was purified by recrystallization (from minimum MeOH) to afford tert-butyl N-[3-[[4-(benzyloxycarbonylamino) cyclohexyl]amino]-3-oxo-propyl] carbamate (14.60 g, 34.80 mmol, 86.42% yield) as white solid. 1H NMR (400 MHz, DMSO-d6) Ξ΄ 7.74 (d, J=7.78 Hz, 1H), 7.31-7.40 (m, 5H), 7.20 (d, J=7.78 Hz, 1H), 6.73 (t, J=5.40 Hz, 1H), 5.00 (s, 2H), 3.44 (d, J=6.78 Hz, 1H), 3.23 (dd, J=7.40, 3.14 Hz, 1H), 3.10 (q, J=6.61 Hz, 2H), 2.18 (t, J=7.40 Hz, 2H), 1.78 (br. s., 4H), 1.37 (s, 9H), 1.16-1.27 (m, 4H); LCMS (m/z): 320.2 [M+Hβˆ’100]+.

Step 2:Synthesis of tert-butyl (3-(((1r,4r)-4-aminocyclohexyl)amino)-3-oxopropyl) carbamate

To a solution of tert-butyl N-[3-[[4-(benzyloxycarbonylamino) cyclohexyl]amino]-3-oxo-propyl]carbamate (14.60 g, 34.80 mmol, 1.00 Eq) in MeOH (500 mL) was added Pd/C (5 g) under N2. The suspension was degassed under vacuum and purged with H2 several times. The mixture was stirred under H2 (50 psi) at 50Β° C. for 12 hours. LCMS showed the starting material was consumed completely. The reaction mixture was filtered and concentrated to give tert-butyl N-[3-[(4-aminocyclohexyl) amino]-3-oxo-propyl]carbatnate (9.80 g, 34.34 mmol, 98.67% yield) as yellow solid. 1H NMR (400 MHz, DMSO-d6) Ξ΄ 7.74 (d, J=7.53 Hz, 1H), 6.63-6.84 (m, 1H), 3.43 (br. s., 1H), 3.09 (q, J=6.78 Hz, 2H), 2.60 (br. s., 1H), 2.18 (t, J=7.28 Hz, 2H), 1.70-1.82 (m, 4H), 1.37 (s, 9H), 1.08-1.20 (m, 4H); LCMS (m/z): 230.2 [M+Hβˆ’56]+.

Example 3

Synthesis of N-(1-(1-((S)-2-aminopropanoyl)piperidin-4-yl)ethyl)-6-chloro-2-oxoindoline-5-carboxamide (Cpd. No. 490)

Step 1:Synthesis of ((2S)-1-(4-(1-(6-chloro-2-oxoindoline-5-carboxamido) ethyl)piperidin-1-yl)-1-oxopropan-2-yl)carbamate

To a mixture of 6-chloro-2-oxoindoline-5-carboxylic acid (100.00 mg, 472.59 umol, 1.00 Eq), HATU (179.69 mg, 472.59 umol, 1.00 Eq) and TEA (47.82 mg, 472.59 umol, 1.00 Eq) in DCM (10 mL) was added tert-butyl ((2S)-1-(4-(1-aminoethyl)piperidin-1-yl)-1-oxopropan-2-yl)carbamate (141.50 mg, 472.59 umol, 1.00 Eq). The mixture was stirred at 20Β° C. for 3 hours. LCMS showed the reaction was complete. Water (5 mL) was added to the reaction and the aqueous phase was extracted with DCM (10 mLΓ—3). The combined organic phase was dried over anhydrous Na2SO4, filtered and concentrated in vacuum to afford tert-butyl ((2S)-1-(4-(1-(6-chloro-2-oxoindoline-5-carboxamido)ethyppiperidin-1-yl)-1-oxopropart-2-yl)carbaamate (100.00 mg, crude). LCMS (m/z):493.2 [M+H]+.

Step 2:Synthesis of N-(1-(1-((S)-2-aminopropanoyl)piperidin-4-yl)ethyl)-6-chloro-2-oxoindoline-5-carboxamide

To a solution of tert-butyl ((2S)-1-(4-(1-(6-chloro-2-oxoindoline-5-carboxamido)ethyl)peperidin-1-yl)-1-oxopropan-2-yl)carbamate (100.00 mg, 202.84 umol, 1.00 Eq) in DCM (10 mL) was added dropwise TEA (3 mL) at 0Β° C. The resulting solution was then stirred for 3 hours at 25Β° C. TLC showed the reaction was complete. The mixture was evaporated and purified by prep-HPLC to afford N-(1-(1-((S)-2-aminopropanoyl)piperidin-4-yl)ethyl)-6-chloro-2-oxoindoline-5-carboxamide (38.50 mg, yield: 48.31%). 1H NMR (400 MHz, MeOD-d4):=7.29 (s, 1H), 695 (s, 1H), 4.56 (d, J=12.5 Hz, 1H), 4.45-4.38 (m, 1H), 3.91 (d, J=12.3 Hz, 2H), 3.54 (s, 2H), 3.15 (br. s., 2H), 2.72-2.63 (m, 1H), 2.01-1.85 (m, 2H), 1.75 (br. s., 1H), 1.46 (dd, J=6.9, 11.7 Hz, 3H), 1.29-1.18 (m, 4H). LCMS (m/z): 393.2 [M+H]+.

Example 4

Synthesis of N-(1-(1-((S)-2-aminopropanoyl)piperidin-4-yl)ethyl)-2-oxoindoline-5-carboxamide hydrochloride (Cpd. No. 86)

Step 1:Synthesis of tert-butyl ((2S)-1-oxo-1-(4-(1-(2-oxoindoline-5-carboxamido)ethyl)piperidin-1-yl)propan-2-yl) carbamate

To a stirred solution of 2-oxoindoline-5-carboxylic acid (0.177 g, 1.00 mmol) in DMF (2 mL), were added EDCl.HCl (0.24 g, 1.25 mmol), HOBt (0.168 g, 1.25 mmol) and triethylamine (0.35 mL, 2.5 mmol). The solution was stirred for 10 min at 0Β° C. tert-Butyl ((2S)-1-(4-(1-aminoethyl)piperidin-1-yl)-1-oxopropan-2-yl)carbamate (0.25 g, 0.83 mmol) was added and the reaction stirred at rt for 6 h. The progress of the reaction was monitored by TLC. After complete consumption of starting material, the reaction was quenched with water and extracted with ethyl acetate. The organic layer was separated, washed with brine, dried over anhydrous Na2SO4 and concentrated under reduced pressure to obtain a crude residue which was purified by column chromatography to afford tert-butyl ((2S)-1-oxo-1-(4-(1-(2-oxoindoline-5-carboxamido)ethyl)piperidin-1-yl)propan-2-yl)carbamate (0.11 g,28%). LCMS: 359.25 (M-Boc)+.

Step 2:Synthesis of N-(1-(1-((S)-2-aminopropanoyl)piperidin-4-yl)ethyl)-2-oxoindoline-5-carboxamide hydrochloride

To a stirred solution of tert-butyl ((2S)-1-oxo-1-(4-(1-(2-oxoindoline-5-carboxamido)ethyl)piperidin-1-yl)propan-2-yl)carbamate (0.1 g, 0.47 mmol) in dioxane (2 mL) was added 4 M dioxane:HCl solution (4 mL) at 0Β° C. and the reaction mixture stirred at rt for 5 h. The progress of the reaction was monitored by TLC. After complete consumption of tert-butyl ((2S)-1-oxo-1-(4-(1-(2-oxoindoline-5-carboxamido)ethyl) piperidin-1-yl)propan-2-yl)carbamate, the solvent was removed under reduced pressure to obtain a crude residue which was purified by repeated washing with ether and pentane to obtain N-(1-(1-((S)-2-aminopropanoyl)piperidin-4-yl)ethyl)-2-oxoindoline-5-carboxamide hydrochloride (0.08 g, 93%). 1H NMR (400 MHz, DMSO-d6): Ξ΄ 10.63 (s, 1H), 8.06 (q, J=11.0, 8.4 Hz, 4H), 7.77-7.70 (m, 2H), 6.85 (d, J=8.5 Hz, 1H), 4.38-4.35 (m, 2H), 3.85 (d, J=13.9 Hz, 2H), 3.53 (s, 2H),3.09-2.90 (m, 1H), 2.57 (dd, J=25.3, 12.8 Hz, 1H), 1.75 (dd, J=26.2, 12.6 Hz, 3H), 1.3-1.28 (m, 3H), 1.12 (d, J=6.8 Hz, 4H), 1.02 (d, J=12.5 Hz, 1H); LCMS: 359.23 (M+1)+.

Example 5

Synthesis of N-(1-(1-((S)-2-aminopropanoyl)piperidin-4-yl)ethyl)-2-oxo-2,3-dihydrobenzo[d]oxazole-6-carboxamide hydrochloride (Cpd. No. 94)

Step 1:Synthesis of tert-butyl ((2S)-1-oxo-1-(4-(1-(2-oxo-2,3-dihydrobenzo[d]oxazole-6-carboxamido)ethyl)piperidin-1-yl)propan-2-yl)carbamate

To a stirred solution of 2-oxo-2,3-dihydrobenzo[d]oxazole-6-carboxylic acid (0.2 g, 0.66 mmol) in DMF (1.5 rnL) was added EDCl.HCl (0.191 g, 1.00 mmol), HOBt (0.091 g, 0.66 mmol) and diispropylethylamine (0.34 mL, 2.00 mmol). The solution was stirred for 10 min at 0Β° C. After that, tert-butyl ((2S)-1-(4-(1-aminoeihyl)piperidin-1-yl)-1-oxopropan-2-yl)carbamate (0.142 g, 0.80 mmol) was added and the reaction stirred at rt for 12 h. The progress of the reaction was monitored by TLC. After complete consumption of starting material, the reaction was quenched with water and extracted with ethyl acetate. The organic layer was separated, washed with brine, dried over anhydrous Na2SO4 and concentrated under reduced pressure to obtain a crude residue which was purified by column chromatography to afford tert-butyl ((2S)-1-oxo-1-(4-(1-(2-oxo-2,3-dihydrobenzo[d]oxazole-6-carboxamido)ethyl)piperidin-1-yl)propan-2-yl)carbamate (0.104 g, 33%). LCMS: 361.05 (Mβˆ’Boc)+.

Step 2:Synthesis of N-(1-(1-((S)-2-aminopropanoyl)piperidin-4-yl)ethyl)-2-oxo-2,3-dihydrobenzo[d]oxazole-6-carboxamide hydrochloride

To a stirred solution of ((2S)-1-oxo-1-(4-(1-(2-oxo-2,3-dihydrobenzo[d]oxazole-6-carboxamido)ethyl)piperidin-1-yl)propan-2-yl)carbamate (0.03 g, 0.08 mmol) in dioxane (1 ml.) at 0Β° C. was added 4M dioxane:HCl solution (1 mL). The reaction mixture was stirred at rt for 3 h. The progress of the reaction was monitored by TLC. After complete consumption of starting material, the solvent was removed under reduced pressure to obtain a crude residue which was purified by repeated washing with ether and hexane to obtain N-(1-(1-((S)-2-aminopropanoyl)piperidin-4-yl)ethyl)-2-oxo-2,3-dihydrobenzo[d]oxazote-6-carboxamide hydrochloride (0.008 g, 36%). 1H NMR (400 MHz, DMSO-d6): Ξ΄ 10.66 (s, 1H), 8.72 (d, J=12.3 Hz, 1H), 8.42 (q, J=8.1, 7.1 Hz, 2H), 7.74 (d, J=8.0 Hz, 2H), 6.86 (d, J=8.1 Hz, 1H), 3.54 (s, 2H), 3.25 (d, J=12.4 Hz, 2H), 3.16 (t, J=6.1 Hz, 2H), 2.82 (q, J=11.8 Hz, 2H), 2.62 (s, 1H), 1.79 (d, J=13.4 Hz, 2H), 1.35-1.32 (m, 2H); LCMS: 274.15 (M+H)+.

Example 6

Synthesis of N-(1-(1-((S)-2-aminopropanoyl)piperidin-4-yl)ethyl)-2-oxo-2,3-dihydro-1H-benzo[d]imidazole-5-carboxamide (Cpd. No. 93)

Step 1:Synthesis of N-(1-(1-((S)-2-aminopropanoyl)piperidin-4-yl)ethyl)-2-oxo-2,3-dihydro-1H-benzo[d]imidazole-5-carboxamide hydrochloride

To a stirred solution of 2-oxo-2,3-dihydro-1H-benzo[d]imidazole-5-carboxylic acid (0.2 g, 0.66 mmol) in DMF (1.5 mL) was added EDCl.HCl (0.191 g, 1.00 mmol), HOBt (0.091g, 0,66 mmol) and diispropylethylamine (0.34 mL, 2.00 mmol). The solution was stirred for 10 min at 0Β° C. After that tert-butyl ((2S)-1-(4-(1-1 mmol) was added and the reaction stirred at rt for 12 h. The progress of the reaction was monitored by TLC. After complete consumption of starting material, the reaction was quenched with water and extracted with ethyl acetate. The organic layer was washed with brine, dried over anhydrous Na2SO4 and concentrated under reduced pressure to obtain a crude residue which was purified by column chromatography to afford tert-butyl ((2S)-1-oxo-1-(4-(1-(2-oxo-2,3-dihydro-1H-benzo[d]imidazole-5-carboxamido)ethyl)piperidin-1-yl)propan-2-yl)carbamate (0.140 g, 45%). LCMS: 360.2 (Mβˆ’Boc)+.

Step 2:Synthesis of N-(1-(1-((S)-2-aminopropanoyl)piperidin-4-yl)ethyl)-2-oxo-2,3-dihydro-1H-benzo[d]imidazole-5-carboxamide hydrochloride

To a stirred solution of tert-butyl ((2S)-1-oxo-1-(4-(1-(2-oxo-2,3-dihydro-1H-benzo[d]imidazole-5-carboxamido)ethyl)piperidin-1-yl)propan-2-yl)carbamate (0.1 g, 0.21 mmol) in dioxane (2 mL) at 0Β° C. was added 4M dioxane:HCl solution (1 mL). The reaction mixture was stirred at rt for 3 h. The progress of the reaction was monitored by TLC. After complete consumption of the starting material, the solvent was removed under reduced pressure to obtain a crude residue which was purified by repeated washing with ether and hexane to obtain N-(1-(1-((S)-2-aminopropanoyl)piperidin-4-yl)ethyl)-2-oxo-2,3-dihydro-1H-benzo[d]imidazole-5-carboxamide hydrochloride (0.060 g, 69%). 1H NMR (400 MHz, DMSO-d6): Ξ΄ 10.85 (d, J=16.4 Hz, 2H), 8.10 (p, J=8.9, 7.6 Hz, 4H), 7.55-7.52 (m, 1H), 7.44 (q, J=2.0 Hz, 1H), 6.95 (d, J=8.1 Hz, 1H), 4.44-4.24 (m, 2H), 3.88-3.86 (m, 2H), 3.09-2.91 (m, 1H), 2.6-2.57 (m, 1H), 1.83-1.64 (m, 3H), 1.33-0.99 (m, 8H); LCMS: 360.25 (M+1)+.

Example 7

N-(1-(4-aminobutanoyl)piperidin-4-yl)-1H-1,2,4-triazole-5-carboxamide (Cpd. No. 560)

Step 1:Synthesis of tert-butyl 4-(1H-1,2,4-triazole-5-carbonylamino)piperidine-1-carboxylate

To a solution of 1H-1,2,4-triazole-5-carboxylic acid (2.00 g, 17.69 mmol, 1.00 Eq) in DMF (100 mL) was added TEA (2.68 g, 26.53 mmol, 1.50 Eq), BOP-Cl (4.95 g, 19.46 mmol, 1.10 Eq), and test-butyl 4-aminopiperidinc-1-carboxylate (3.90 g, 19.46 mmol, 1.10 Eq). The reaction mixture was stirred at 20Β° C. for 12 hr. The reaction mixture was concentrated and dissolved in MeOH, filtered, the organic layer was concentrated and purified by silica gel column chromatography to give tert-butyl 4-(1H-1,2,4-triazole-5-carbonylamino)piperidine-1-carboxylate (3.13 g, 10.60 mmol, 59.9% yield) as a yellow solid. LCMS (m/z): 240.1 [M+Hβˆ’56]+.

Step 2:Synthesis of N-(4-piperidyl)-1H-1,2,4-triazole-5-carboxamide

To a solution of tert-butyl 4-(1H-1,2,4-triazole-5-carbonylamino)piperidine-1-carboxylate (3.13 g, 10.60 mmol, 1.00 Eq) in DCM (50 mL) was added TFA (10 mL). The reaction mixture was stirred at 20Β° C. for 5 hr. The reaction mixture was concentrated and lyophilized to afford N-(4-piperidyl)-1H-1,2,4-triazole-5-carboxamide (6.00 g, 19.40 mmol, 91.51% yield) as a light yellow solid. LCMS (m/z). 196.2 [M+H]+.

Step 3:Synthesis of tert-butyl (4-(4-(1H-1,2,4-triazole-5-carboxamido)piperidin-1-yl)-4-oxobutyl)carbamate

To a mixture of 4-((tert-butoxycarbonyl)amino)butanoic acid (203.00 mg, 998.87 umol, 1.00 q) and HATU (379.80 mg, 998.87 umol, 1.00 Eq) in DCM (10 mL) was added Et3N (202.15 mg, 2.00 mmol, 2.00 Eq) in one portion at 20Β° C. The mixture was stirred at 20Β° C. for 30 min. Then N-(piperidin-4-yl)-1H-1,2,4-triazole-5-carboxamide (195.00 mg, 998.87 umol, 1.00 Eq) was added in one portion at 20Β° C. The mixture was stirred at 20Β° C. for 12 h. LCMS showed the reaction was complete. The reaction mixture was washed with water (40 mLΓ—3)andextracted with DCM (50 mLΓ—3). The combined organic layer was concentrated under vacuum. The residue was purified by prep-HPLC to afford tert-butyl (4-(4-(1H-1,2,4-triazole-5-carboxamido)piperidin-1-yl)-4-o xobutyl)carbamate (200.00 mg, 525.71 umol, 52.63% yield) as white solid. 1H NMR (400 MHz, MeOD-d4) Ξ΄ 8.45 (s, 1H) 4.54 (d, J=13.30 Hz, 1H) 4.13-4.21 (m, 1H) 4.01 (d, J=13.80 Hz, 1H) 3.23-3.30 (m, 1H) 3.11 (t, J=6.78 Hz, 2H) 2.85 (t, J=11.67 Hz, 1H) 2.46 (t, J=7.53 Hz, 2H) 1.97-2.07 (m, 2H) 1.78 (quin, J=7.15 Hz, 2H) 1.53-1.65 (m, 2H) 1.38-1.53 (m, 9H); LCMS (m/z): 381.2 [M+H]+.

Step 4:Synthesis of N-(1-(4-aminobutanoyl)piperidin-4-yl)-1H-1,2,4-triazole-5-carboxamide

To a mixture of tert-butyl (4-(4-(1H-1,2,4-triazole-5-carboxamido)piperidin-1-yl)-4-oxobutyl)carbamate (200.00 mg, 525.71 umol, 1.00 Eq) in DCM (20 mL) was added TEA (5 mL) dropwise at 0Β° C. The mixture was stirred at 0Β° C. for 30 min. The reaction then warmed slowly to 20Β° C. and stirred at this temperature for another 12 h . LCMS showed the reaction complete. The mixture was concentrated under reduced pressure at 60Β° C. The residue was purified by prep-HPLC to afford N-(1 (4-aminobutanoyl)piperidin-4-yl)-1H-1,2,4-triazole-5-carboxamide (104.20 mg, 50.26% yield) as colorless oil (TEA salt). 1H NMR (400 MHz, MeOD-d4) Ξ΄ 8.49 (s, 1H) 4.54 (d, J=13.55 Hz, 1H) 4.12-4.21 (m, 1H) 1.00 (d, J=13.80 Hz, 1H) 3.25 (t, J=11.80 Hz, 1H) 3.02 (t, J=7.28 Hz, 2H) 2.86 (t, J=11.67 Hz, 1H) 2,60 (t, J=6.90 Hz, 2H) 1.92-2.08 (m, 4H) 1.46-1.73 (m, 2H); LCMS (m/z): 281.1 [M+H]+.

Example 8

Synthesis of N-((1r,4r)-4-aminocyclohexyl)-1-benzyl-3-methyl-1H-pyrazole-5-carboxamide hydrochloride (Cpd. No. 29)

Step 1:Synthesis of tert-butyl ((1r,4r)-4-(1-benzyl-3-methyl-1H-pyrazole-5-carboxamido)cyclohcxyl)carbamatc

To a stirred solution of 1-benzyl-3-methyl-1H-pyrazole-5-carboxylic acid (0.150 g, 0.69 mmol) in DMF (5 mL) was added HATU (0.393 g, 1.0 mmol) and diisopropylethylamine (0.24 mL, 1.4 mmol). The solution was stirred for 10 min at 0Β° C. tert-Butyl ((1r,4r)-4-aminocyclohexyl)carbamate (0.147 g, 0.69 mmol) was added and the reaction stirred at rt for 2 h. The progress of the reaction was monitored by TLC. After complete consumption of starting material, the reaction was quenched with water and extracted with ethyl acetate. The organic layer was separated, washed with brine, dried over anhydrous Na2SO4 and concentrated under reduced pressure to obtain a crude residue which was purified by column chromatography to afford tert-butyl ((1r,4r)-4-(1-benzyl-3-methyl-1H-pyrazole-5-carboxamido)cyclohexyl)carbamate (0.08 g, 25%). LCMS: 313.1 (Mβˆ’100)+.

Step 2:Synthesis of N-((1r,4r)-4-aminocyclohexyl)-1-benzyl-3-methyl-1H-pyrazole-5-carboxamide hydrochloride

To a stirred solution of tert-butyl ((1r,4r)-4-(1-benzyl-3-methyl-1H-pyrazole-5-carboxamido)cyclohexyl)carbamate (0.05 g, 0.121 mmol) in dioxane (1 mL) at 0Β° C. was added 4 M dioxa.ne:HCl (1.5 mL). The reaction mixture was stirred at rt for 1 h. The progress of the reaction was monitored by TLC. After complete consumption of the starting material, the solvent was removed under reduced pressure to obtain a crude residue. The material was purified by repeated washing with ether and pentane to obtain N-((1r,4r)-4-aminocyclohexyl)-1-benzyl-3-methyl-1H-pyrazole-5-carboxamide hydrochloride (0.03 g, 51%). 1H NMR (400 MHz, DMSO-d6): Ξ΄ 8.26 (d, J=7.8 Hz, 1H), 7.94 (d, J=5.3 Hz, 3H), 7.33-7.10 (m, 5H), 6.66 (s, 1H), 5.60 (s, 2H), 2.96 (d, J=10.9 Hz, 1H), 2.16 (s, 3H), 1.96 (d, J=10.4 Hz, 2H), 1.83 (d, J=11.1 Hz, 2H), 1.47-1.26 (m, 4H); LCMS: 313.2 (M+H)+.

Example 9

Synthesis of N-((1r,4r)-4-aminocyclohexyl)-1-cycloprpyl-1H-1,2,3-triazole-4-carboxamide hydrochloride

Step 1:Synthesis of tert-butyl ((1r,40r)-4-(1-cyclopropyl-1H-1,2,3-triazolel-4-carboxamido)cyclohexyl)carbamate

To a stirred solution of tert-butyl ((1r,4r)-4-aminocyclohexyl)carbamate (0.090 g, 0.420 mmol) in DMF (2 mL) wasadded EDCI (0.096 g, 0.504 mmol), HOBT (0.068 g, 0.504 mmol) and DIPEA (0.3 mL) and the solution stirred for 10 nun at 0Β° C. 1-cyclopropyl-1H-1,2,3-triazole-4-carboxylic acid (0.064 g, 0.420 mmol) was then added and the reaction mixture stirred at rt for 2hr. The progress of the reaction was monitored by TLC. After complete consumption of starting material, the reaction was quenched with water and extracted with ethyl acetate. Theorganic layer was separated, washed with brine, dried using Na2SO4 and concentrated under reduced pressure to obtain a residue which was purified by column chromatography to afford tert-butyl ((1r,4r)-4-(1-cyclopropyl-1H-1,2,3-triazole-4-carboxamido)cyclohexyl)carbamate (0.035 g, 24%). LCMS: 250.1 (Mβˆ’100)+ observed.

Step 2:Synthesis of N-((1r,4r)-4-aminocyclohexyl)-1-cyclopropyl-1H-1,2,3-triazole-4-carboxamide hydrochloride

To a stirred solution of tert-butyl ((1r,4r)-4-(1-cyclopropyl-1H-1,2,3-triazole-4-carboxamido)cyclohexyl)carbamate (0.035 g, 0.10 mmol) in methanol (3 mL) was added 4M methanol:HCl (3 mL) at 0Β° C. and the reaction stirred at rt for 16 hr. The progress of the reaction was monitored by TLC. After complete consumption of starting material, the solvent was removed under reduced pressure and the residue was purified by washings with diethyl ether and DCM to obtain N-(((1r,4r)-4-aminocyclohexyl)-1-cyclopropyl-1H-1,2,3-triazole-4-carboxamide hydrochloride (0.013 g, 49%). 1H NMR (400 MHz, DMSO-d6) Ξ΄ 8.58 (s, 1H), 8.31 (d, J=8.3 Hz, 1H), 7.97 (s, 2H), 4.1-4.05 (m, J=7.5, 3.9 Hz, 1H), 3.75-3.66 (m, 1H), 3.01-2.88 (m, 1H), 1.97 (d, J=10.5 Hz, 2H), 1.83 (d, J=9.5 Hz, 2H), 1.55-1.34 (m, 4H), 1.25-1.07 (m, 4H); LCMS: 250.05 (M+H)+.

Example 10

Synthesis of 2-oxo-N-(piperidin-4-ylmethyl)indoline-5-carboxamide hydrochloride (Cpd. No. 100)

Step 1:Synthesis of tert-butyl 4-((2-oxoindoline-5-carboxamido)methyl) piperidine-1-carboxylate

To a stirred solution of 2-oxoindoline 5 carboxylic acid (0.7 g, 3.95 mmol) in DMF (5 mL) was added EDCl.HCl (1.13 g, 5.92 mmol), HOBt (0.8 g, 5.92 mmol) and triethylamine (1.7 mL, 11.8 mmol). The solution was stirred for 10 min at 0Β° C. After that tert-butyl 4-(aminomethyl)piperidine-1-carboxylate (0.93 g, 4.34 mmol) was added and the reaction stirred at rt for 16 h. The progress of the reaction was monitored by TLC. After complete consumption of starting material, the reaction was quenched with water and extracted with ethyl acetate. The organic layer was washed with brine, dried over anhydrous Na2SO4 and concentrated under reduced pressure to obtain a crude residue which was purified by preparative HPLC to afford tert-butyl 4-((2-oxoindoline-5-carboxamido)methyl)piperidine-1-carboxylate (0.130 g, 8%) LCMS: 274.1 (Mβˆ’Boc)+.

Step 2:Synthesis of 2-oxo-N-(peperidin-4-ylmethyl)indoline-5carboxamide hydrochloride

To a stirred solution or tert-butyl 4-((2-oxoindoline-5-carboxamido)methyl)piperidine-1-carboxylate (0.03 g, 0.08 mmol) in dioxane (1 mL) at 0Β° C. was added 4M dioxane:HCl solution (1 mL). The reaction mixture was stirred at rt for 3 h. The progress of the reaction was monitored by TLC. After complete consumption of starting material, the solvent was removed under reduced pressure to obtain a crude residue which was purified by repeated washing with ether and hexane to obtain 2-oxo-N-(piperidin-4-ylmethyl)indoline-5-carboxamide hydrochloride (0.008 g, 36%). 1H NMR (400 MHz, DMSO-d6): Ξ΄ 10.66 (s, 1H), 8.72 (d, J=12.3 Hz, 1H), 8.42 (q, J=8.1, 7.1 Hz, 2H), 7.74 (d, J=8.0 Hz, 2), 6.86 (d, J=8.1 Hz, 1H), 3.54 (s, 2H), 3.25 (d, J=12.4 Hz, 2H), 3.16 (t, J=6.1 Hz, 2H), 2.82 (q, J=11.8 Hz, 2H), 2.62 (s, 1H), 1.79 (d, J=13.4 Hz, 2H), 1.35-1.32 (m, 2H); LCMS: 274.15 (M+H)+.

Example 11

Synthesis of 2-oxo-N-((1R,3r,5SR)-8-(piperidin-4-ylmethylsulfonyl)-8-aza-bicyclo[3.2.1]octan-3-yl)-2,3-dihydrobenzo[d]oxazole-6-carboxamide hydrochloride (Cpd. No. 601)

Step 1:Synthesis of benzyl 4-(((1R,3r,5S)-3-((2,2,2-trichloroethoxy) carbonylamino)-8-aza-bicyclo[3.2.1]octan-8-ylsulfonyl)methyl)piperidine-1-carboxylate

Into a 100-mL round-bottom flask was placed 2,2,2-frichloroethyl N-[(1R,3S,5S)-8-azabicyclo[3.2.1]octan-3yl]-carbamate (780 mg, 2.59 mmol, 1.00 equiv), dichloromethane (10 mL), TEA (0.93 g) added dropwise at 0Β° C. Then benzyl 4-[(chlorosulfonyl)methyl]piperidine-1-carboxylate (1 g, 3.01 mmol, 1.17 equiv) was added in several portions. The resulting solution was stirred overnight at room temperature. The resulting mixture was concentrated under vacuum. The residue was chromatographed on a silica gel column with dichloromethane/methanol (20:1-10:1). This resulted in 1.3 g (84%) of benzyl 4-[[(1R,3r,5S)-3-[[(2,2,2-trichloroethoxy)carbonyl]amino]-8-azabicyclo[3.2.1]octane-8-sulfonyl]methyl]piperidine-1-carboxylate as a white solid. 1H NMR (400 MHz, CDCl3) Ξ΄: 7.41-7.32 (m, 5H), 5.32-5.10 (m, 2H), 4.48 (s, 2H), 4.27-4.12 (m, 4H), 4.00-3.96 (m, 1H), 2.93-2.80 (m, 4H), 2.30-2.07 (m, 5H), 1.98-1.91 (m, 6H), 1.30-1.26 (m, 3H) ppm. LCMS (method A, ESI): RT=1.32 mm, m/z=620.2 [M+Na]+.

Step 2:Synthesis of benzyl 4-(((1R,3r,5S)-3-amino-8-aza-bicyclo[3.2.1]octan-8-ylsulfonyl)methyl)piperidine-1-carboxylate

Into a 100-mL round-bottom flask was placed benzyl 4-[[(1R,3r,5S)-3-[[(2,2,2-trichloroethoxy)carbonyl]amino]-8-azabicyclo[3.2.1]octane-8-sulfonyl]methyl]piperidine-1-carboxylate (1 g, 1.68 mmol, 1.00 equiv), acetic acid (15 mL), water (1 mL), and zinc (1.63 g, 24.92 mmol, 14.88 equiv). The resulting mixture was stirred for 2 h at room temperature and then diluted with 30 mL of H2O. The solids were filtered out. The pH value of the filtrate was adjusted to 9 with NaOH (40%, aq.), The resulting solution was extracted with 3Γ—30 mL. of dichloromethane and the organic layers combined, dried over anhydrous sodium sulfate and concentrated under vacuum. This resulted in 0.7 g (99%) of benzyl 4-[[(1R,3r,5S)-3-amino-8-azabicyclo[3.2.1]octane-8-sulfonyl]methyl]piperidine-1-carboxylate as a white solid. LCMS (method D, ESI): RT=0.85 min, m/z=422.3 .[Mβˆ’H]+.

Step 3:Synthesis of benzyl 4-(((1R,3r,5S)-3-(2-oxo-2,3-dihydrobenzo[d]oxazole-6-carboxamido)-8-aza-bicyclo[3.2.1]octan-8-ylsulfonyl)methyl)piperidine-1-carvoxylate

Into a 25-mL round-bottom flask was placed 2-oxo-2,3-dihydro-1,3-benzoxazole-6-carboxylic acid (100 mg, 0.56 mmol, 2.35 equiv), N,N-dimethylformamide (10 mL), HOBT (135 mg, 2.00 equiv) and EDCI (191 mg, 2.00 equiv). Then benzyl 4-[[(1R ,3r,5S)-3-amino-8-azabicyclo[3.2.1]octane-8-sulfonyl]methyl]piperidine-1-carboxylate (100 mg, 0.24 mmol, 1.00 equiv) was added in several portions. After complete adddition, TEA (250 mg, 5.00 equiv) was added dropwise. The resulting solution was stirred for 1 h at room temperature. The mixture was concentrated under vacuumand the residue diluted with 10 mL of H2O. This mixture was extracted with 3Γ—10 mL of ethyl acetate and the organic layers combined. The combined extracts were washed with 2Γ—30 mL of brine, dried, and concentrated. The residue was chromatographed on a silica gel column with dichloromethane/methanol (10/1). This resulted in 100 mg (72%) of benzyl 4-[[(1R,3r,5S)-3-(2-oxo-2,3-dihydro-1,3-benzoxazole-6-amido)-8-azabicyclo[3.2.1]octane-8-sulfonyl]methyl]piperidine-1-carboxylate as yellow oil. LCMS (method D, ESI): RT=1.38 min, m/z=583.0 [M+H]+.

Step 4:Synthesis of 2-oxo-N-((1R,3r,5S)-8-(piperidin-4-ylmethylsulfonyl)-8-aza-bicyclo[3.2.1]octan-3-yl)-2,3-dihydrobenzo[d]oxazole-6-carboxamide

Into a 25-mL round-bottom flask was placed benzyl 4-[[(1R,3r,5S)-3-(2-oxo-2,3-dihydro-1,3-benzoxazole-6-amido)-8-azabicyclo[3.2. 1 ]octane-8-sulfonyl]methyl]piperidine-1-carboxylate (100 mg, 0.17 mmol, 1.00 equiv) and hydrochloric acid (12N, 10 mL). The resulting solution was stirred for 4 h at room temperature and then concentrated under vacuum. The residue was applied onto Pre-HPLC with the following conditions: Column: X Bridge C18, 19*150 mm, 5 um; Mobile Phase A: Water/0.05% TFA, Mobile Phase B: ACN; Flow rate: 20 mL/min; Gradient: 30% B to 70% B in 10 min; 254 nm. The product was dissolved again into hydrochloric acid (5 mL, 12 N) and concentrated under vacuum. This resulted in 7.3 mg (9%) of 2-oxo-N-[(1R,3r,5S)-8-[(piperidin-4-ylmethane)sulfonyl]-8-azabicyclo[3.2.1]octan-3-yl]-2,3-dihydro-1,3-benzoxazole-6-carboxamide as a white solid. 1H NMR (300 MHz, D2O) Ξ΄: 7.52-749 (m, 2H), 7.18-7.16 (m, 1H), 4.21 (s, 2H), 4.08-4.03 (m, 1H), 3.38-3.34 (m, 2H), 3.20-3.18 (m, 2H), 3.02-2.93 (m, 2H), 2.24-1.94 (m, 11H), 1.54-1.51 (m, 2H) ppm. LCMS (method D, ESI): RT=1.65 min, m/z=449.2 [Mβˆ’HCl+H]+.

Example 12

Synthesis of (2R)-2-methyl-3-oxo-N-[(1R,3r,5S)-8-[(piperidin-4-ylmethane)sulfonyl]-8-azabicyclo[3.2.1]octan-3-yl]-3,4-dihydro-2H-1,4-benzoxazine-6-carboxamide hydrochloride (Cpd. No. 625)

Step 1:Synthesis of methyl 3-(2-bromopropanamido)-4-hydroxybenzoate

Into a 100-mL round-bottom flask was placed ethyl acetate (10 mL), water (10 mL), methyl 3-amino-4-hydroxybenzoate (1 g, 5.98 mmol, 1.00 equiv), and sodium bicarbonate (553 mg, 1.10 equiv). This was followed by the addition 2-bromopropanoyl bromide (1.3 g, 6.02 mmol, 1.00 equiv) which was added dropwise with stirring, at 0Β° C., The resulting solution was stirred for 30 min at room temperature. The mixture was then washed with 2Γ—30 mL of H2O and 1Γ—30 mL of brine. The mixture was dried over anhydrous sodium sulfate, filtered and concentrated under vacuum. This resulted in 1.5 g (83%) of methyl 3-(2-bromopropanamido)-4-hydroxybenzoate as a brown solid. 1H NMR (300 MHz, CDCl3) Ξ΄: 8.89 (s, 1H), 8.43 (s, 1H), 7.89-7.82 (m, 2H), 7.04 (d, J=8.4 Hz, 1H), 4.65 (q, J=14.1 Hz, 1H), 3.07 (s, 3H), 2.01 (d, J=7.2 Hz, 3H) ppm. LCMS (method D, ESI): RT=1.30 min, m/z=302.0 [M+H]+.

Step 2:Synthesis of methyl 2-methyl-3-oxo-3,4-dihydro-2H-benzo[b][1,4]oxazine-6-carboxylate

Into a 100-mL round-bottom flask was placed N,N-dimethylformamide (10 mL), methyl 3-(2-bromopropanamido)-4-hydroxybenzoate (1.5 g, 4.96 mmol, 1.00 equiv), and potassium carbonate (880 mg, 1.30 equiv). The resulting mixture was stirred for 15 h at room temperature. The mixture was then diluted with 30 mL of H2O. The solids were collected by filtration. This resulted in 1 g (91%) of methyl 2-methyl-3-oxo-3,4-dihydro-2H-benzo[b][1,4]oxazine-6-carboxylate as a brown solid. 1H NMR (400 MHz, CDCl3) Ξ΄: 8.29 (s, 1H), 7.72 (q, J=8.4 Hz, 1H), 7.56 (d, J=2 Hz, 1H), 7.03 (d, J=8.4 Hz, 1H), 4.77 (q, J=14 Hz, 1H), 3.93 (s, 3H), 1.64 (d, J=7.2 Hz, 3H)ppm. LCMS (method C, ESI): RT=0.96 min, m/z=222.0 [M+H]+.

Step 3:Synthesis of 2-methyl-3-oxo-3,4-dihydro-2H-benzo[b]1,4]oxazine-6-carboxylic acid

Into a 100-mL round-bottom flask was placed teirahydrofuran (15 mL), methanol (15 mL), water (10 mL), and methyl 2-methyl-3-oxo-3,4-dihydro-2H-1,4-benzo[b][1,4]oxazine-6-carboxylate (1 g, 4.52 mmol, 1.00 equiv). This was followed by the addition of a solution of sodium hydroxide (362 mg, 2.00 equiv) in 5 ml H2O which was added dropwise with stirring at 0Β° C. The resulting solution was stirred for 10 min at 0Β° C. in an ice/salt bath. The resulting solution was allowed to react, with stirring, for an additional 15 h at room temperature. The reaction mixture was concentrated under vacuum. The residue was diluted with 30 mL of H2O and the pH adjusted to 3-4 with hydrochloric acid (1 N). The solids were collected by filtration. This resulted in 900 mg (96%) of 2-methyl-3-oxo-3,4-dihydro-2H-benzo[b][1,4]oxazine-6-carboxylic acid as a white solid. 1H NMR (400 MHz, CD3OD) Ξ΄: 7.68 (q, J=8.4 Hz, 1H), 7.59 (d, J=2 Hz, 1H), 4.47 (s, 1H), 7.03 (d, J=8.4 Hz, 1H), 4.75 (q, J=13.6 Hz, 1H), 1.55 (d, J=6.8 Hz, 3H) ppm. LENTS (method A, ESI): RT=1.08 min, m/z=208.0 [MH+H]+.

Step 4:Synthesis of tert-butyl (1R,3r,5S)-3-(2-methyl-3-oxo-3,4-dihydro-2H-benzo[b][1,4]oxazine-6-carboxamido)-8-azabicyclo[3.2.1]octane-8-carboxylate

Into a 100-mL round-bottom flask was placed N,N-dimethylformamide (50 mL), 2-methyl-3-oxo-3,4-dihydro-2H-benzo[b][1,4]oxazine-6-carboxylic acid (500 mg, 2.41 mmol, 1.00 equiv), EDCI (923 mg, 2.00 equiv), HOBT (652 mg, 2.00 equiv), and tert-butyl (1R,3r,5S)-3-amino-8-azabicyclo[3.2.1]octarte-8-carboxylate (710 mg, 3.14 mmol, 1.30 equiv). This was followed by the addition of TEA (1232 mg, 5.0 equiv) which was added dropwise with stirring at 0Β° C. The resulting solution was stirred for 14 h at room temperature. The reaction mixture was then diluted with 50 mL of EA. The resulting mixture was washed with 3Γ—30 mL of H2O and 1Γ—30 mL of brine. The mixture was dried over anhydrous sodium sulfate, filtered and concentrated. The residue was chromatographed on a silica gel column with ethyl acetate/petroleum ether (4:1). This resulted in 800 mg (80%) of tert-butyl (1R,3r,5S)-3-(2-methyl-3-oxo-3,4-dihydro-2H-benzo[b][1,4]oxazine-6-carboxamido)-8-azabicyclo[3.2.1]octane-8-carboxylate as a white solid. 1H NMR (400 MHz, CDCl3) Ξ΄: 8.66 (s, 1H), 7 52 (d, J=1.6 Hz, 1H), 7.22 (q, J=8.41 Hz, 1H), 7.02 (d, J=8.4 Hz, 1H), 6.51 (d, J=6.8 Hz, 1H), 4.72 (q, J=13.6 Hz, 1H), 4.39-4.20 (m, 3H), 2.45-2.25 (m, 2H), 2.20-2.10 (m, 2H), 1.95-1.75 (m, 4H), 1.60 (d, J=7.2 Hz, 3H),1.50 (s, 9H) ppm. LCMS (method C, ESI): RT=1.08 min, m/z=416.0 [M+H]+.

Step 5:Synthesis of N-[(1R,3r,5S)-8-azabicycto[3.2.1]octan-3-yl]-2-methyl-3-oxo-3,4-dihydro-2H-benzo[b][1,4]oxazine-6-carboxamide

Into a 100-mL round-bottom flask was placed dichloromethane (20 mL) and tert-butyl (1R,3r,5S)-3-(2-methyl-3-oxo-3,4-dihydro-2H-benzo[b][1,4]oxazine-6-carboxamido)-8-azabicyclo[3.2.1]octane-8-carboxylate (800 mg, 1.93 mmol, 1.00 equiv). To the above, hydrogen chloride (gas) was introduced. The resulting solution was stirred for 4 h at room temperature and then was concentrated under vacuum. The residue was diluted with 40 mL of H2O. The pH was adjusted to 8 with saturated aqueous sodium carbonate and theresulting mixture extracted with 3Γ—40 mL of DCM. The organic layers were combined and washed with 2Γ—10 mL of brine. The extract was concentrated under vacuum. This resulted in 500 mg (82%) of N-[(1R,3r,5S)-8-azabicyclo[3.2.1]octan-3-yl]-2-methyl-3-oxo-3,4-dihydro-2H-benzo[b][1,4]oxazine-6-carboxamide as a light yellow solid. 1H NMR (400 MHz, CDCl3) Ξ΄: 7.42 (q, J=8.4 Hz, 1H), 7.37 (d, J=2 Hz, 1H), 7.04 (d, J=8.4 Hz, 1H), 4.72 (q, J=13.6 Hz, 1H), 4.12 (t, J=6.4 Hz, 1H), 114), 3.69 (s, 2H), 2.22-2.15 (m, 4H), 2.10-1.95 (m, 4H), 1.51 (d, J=6.8 Hz, 3H) ppm. LCMS (method A, ESI): RT=0.93 min, m/z=364.0 [M+H]+.

Step 6:Synthesis of benzyl 4-[[(1R,3r,5S)-3-(2-methyl-3-oxo-3,4-dihydro-2H-benzo[b][1,4]oxazine-6-carboxamido) 8 azabicyclo[3.2.1]octane-8-sulfonyl]methyl]piperidine-1-carboxylate

Into a 100-mL 3-necked round-bottom flask was placed N,N-dimethylformamide (10 mL), N-[(1R,3r,5S)-8-azabicyclo[3.2.1]-octan-3-yl]-2-methyl-3-oxo-3,4-dihydro-2H-benzo[b][1,4]oxazine-6-carboxamide (250 mg, 0.79 mmol, 1.00 equiv), and TEA (231 mg, 3.00 equiv). This was followed by the addition of a solution of benzyl 4-[(chlorosulfonyl)methyl]piperidine-1-carboxylate (657 mg, 1.98 mmol, 2.50 equiv) in 2 ml N,N-dimethylformamide which was added dropwise with stirring at βˆ’20Β° C. The resulting solution was stirred for 30 min at βˆ’20Β° C. The mixture was allowed to react, with stirring, for an additional 15 h at room temperature. The mixture was diluted with 50 mL of EA and washed with 2Γ—20 mL of water and 2Γ—20 mL of brine. The organic phase was dried over anhydrous sodium sulfate and filtered. The residue was ehromatographed on a silica gel column with dichloromethane/methanol (20:1). This resulted in 60 mg (12%) of benzyl 4-[[(1R,3r,5S)-3-(2-methyl-3-oxo-3,4-dihydro-2H-benzo[b][1,4]oxazine-6-carboxamido)-8-azabicyclo[3.2.1]octane-8-sulfonyl]methyl]piperidine-1-carboxylate as a white solid. LCMS (method B, ESI): RT=1.43 min, m/z=611.0 [M+H]+.

Step 7:Synthesis of benzyl 4-[[(1R,3r,5S)-3-[(2R)-2-methyl-3-oxo-3,4-clihydro-2 H-benzo[b][1,4]oxazine-6-amido]-8-azabicyclo[3.2.1]octane-8-sulfonyl]methyl]piperidine-1-carboxylate

Benzyl 4-[[(1R,3r,5S)-3-(2-methyl-3-oxo-3,4-dihydro-2H-benzo[b][1,4]oxazine-6-carboxamido)-8-azabicyclo[3.2.1]octane-8-sulfonyl]methyl]piperidine-1-carboxylate (60 mg) was purified by Chiral-Prep-HPLC with the following conditions (Chiral_HPLC): Column, CHIRALPAK IA; mobile phase, MTBE: EtOH=50:50; Detector, 254 nm. This resulted in 28 mg (47%) of benzyl 4-[[(1R,3r,5S)-3-[(2R)-2-methyl-3-oxo-3,4-dihydro-2H-benzo[b][1,4]oxazine-6-carboxamido]-8-azabicyclo[3.2.1]octane-8-sulfonyl]methyl]piperidine-1-carboxylate as a white solid. ee value: 100%

Step 8:Synthesis of (2R)-2-methyl-3-oxo-N-[(1R,3r,5S)-8-[(piperidin-4-ylmethane)sulfonyl]-8-azabicyclo[3.2.1]octan-3-yl]-3,4-dihydro-2H-benzo[b][1,4]oxazine-6-carboxamide hydrochloride

Into a 50-mL round-bottom flask was placed benzyl 4-[[(1R,3r,5S)-3-[(2R)-2-methyl-3-oxo-3,4-dihydro-2H-benzo[b][1,4]oxazine-6-carboxamido]-8-azabicyclo[3.2.1]octane-8-sulfonyl]methyl]piperidine-1-carboxylate (28 mg, 0.05 mmol, 1.00 equiv) and hydrochloric acid (12N, 10 mL). The resulting solution was stirred for 4 h at room temperature. The resulting mixture was washed with 2Γ—10 mL of DCM and the aqueous layer concentrated under vacuum. The crude product was purified by Prep-HPLC with the following conditions (Prep_HPLC_MC5): Column, X Select C18, 119*250 mm, 5 um; mobile phase, Water/0.05% TEA, Mobile Phase B: ACN; Flow rate: 30 mL/min; Gradient: 23% B to 42% B in 11.5 min; Detector, 254 nm. The resulting fractions were concentrated under vacuum. The solids were dissolved in 2 ml hydrochloric acid (12 N) and again concentratcd under vacuum. This resulted in 4.9 mg (21%) of (2R)-2-methyl-3-oxo-N-[(1R,3r,5S)-8-[(piperidin-4-ylmethane)sulfonyl]-8-azabicyclo[3.2.1]octan-3-yl]-3,4-dihydro-2H-benzo[b][1,4]oxazine-6-carboxamide hydrochloride as a white solid. 1H NMR (400 MHz, D2O) Ξ΄: 7.32 (d, J=8 Hz, 1H), 7.21 (s, 1H), 7.01 (d, J=8.4 Hz, 1H), 4.79-4.72 (m, 1H), 4.21 (s, 2H), 4.04 (s, 1H), 3.37 (d, J=12.8 Hz, 2H), 3.20 (d, J=6.4 Hz, 2H), 2.95 (t, J=10.4 Hz, 2H), 2.25-2.15 (m, 3H), 2.14-2.00 (m, 6H), 1.95 (d, J=14.8 Hz, 2H), 1.65-1.40 (m,5H) ppm. LCMS (method A, ESI): RT=1.49 min, m/z=477.3[Mβˆ’HCl+H]βˆ’.

Example 13

Synthesis of N-[(1R,3r,5S)-8-[4-benzylamino)piperidine-1-sulfonyl]-8-azabicyclo[3.2.1]octan-3-yl]-2-oxo-2,3-dihydro-1H-indole-5-carboxamide (Cpd. No. 587)

Step 1:Synthesis of tert-butyl (1R,3r,5S)-3-[[(2,2,2-trichloroethoxy)carbonyl]amino]-8-azabicyclo[3.2.1]octane-8-carboxylate

Into a 250-mL 3-necked round-bottom flask was placed tert-butyl (1R,3r,5S)-3-amino-8-azabicyclo[3.2.1]octane-8-carboxylate (5 g, 22.09 mmol, 1.00 equiv), water (100 mL), and NaHCO3 (4.83 g, 149.50 mmol, 2.60 equiv). The solution was cooled to 0Β° C. and 2,2,2-trichloroethyl chloroformate (5.63 g, 26.57 mmol, 1.20 equiv) added dropwise over 10 mins. The resulting solution was stirred at room temperature overnight. The reaction mixture was extracted with 3Γ—100 mL of dichloromethane and the organic layers combined. The combined extracts were washed with 3Γ—100 mL of brine, dried over anhydrous sodium sulfate, filtered and concentrated under vacuum. The resulting residue was washed with 3Γ—100 mL of hexane. This resulted in 8.32 g (94%) of tert-butyl (1R,3r,5S)-3-[[(2,2,2-trichloroethoxy)carbonyl]amino]-8-azabicyclo[3.2.1.]octane-8-carboxylate as a white solid. 1H NMR (300 MHz, CDCl3) Ξ΄: 5.30 (brs, 1H), 4.73 (s, 2H), 4.23 (brs, 2H), 4.00-3.89 (m, 1H), 2.30-2.17 (m, 2H), 2.12-2.03 (m, 2H), 1.90-1.80 (m, 2H), 1.78-1.69 (m, 2H), 1.46 (s, 9H) ppm. LCMS (method C, ESI): RT=1.27 min, m/z=386.0 [M+Hβˆ’15]+.

Step 2:Synthesis of 2,2,2-trichloroethyl N-[(1R,3r,5S)-8-azabicyclo[3.2.1]octan-3-yl]carbamate

Into a 250-mL round-bottom flask was placed tert-butyl (1R,3r,5S)-3-[[(2,2,2-trichloroethoxy)carbonyl]amino]-8-azabicyclo[3.2.1]octane-8-carboxylate (4 g, 9.96 mmol. 1.00 equiv) and dichloromethane (40 mL). To this hydrogen chloride (gas) was introduced. The resulting solution was stirred for 1 h at room temperature. The mixture was then concentrated under vacuum. This resulted in 3.3 g (98%) of 2,2,2-trichloroethyl N-[(1R,3r,5S)-8-azabicyclo[3.2.1]octan-3-yl]carbamate hydrochloride as a white solid. 1H NMR (300 MHz, D2O) Ξ΄: 4.72 (s, 2H), 4.09 (brs, 2H), 3.83-3.75 (m, 1H), 2.28-1.95 (m, 8H) ppm.

Step 3:Synthesis of 2,2,2-trichloroethyl N-[(1R,3r,5S)-8-(4-[[(tert-butoxy)carbonyl]amino]piperidine-1-sulfonyl)-8-azabicyclo[3.2.1]octan-3-yl]carbamate

Into a 25-mL round-bottom flask was placed 2,2,2-trichloroethy N-[(1R,3r,5S)-8-azabicyclo[3.2.1]octan-3-yl]carbamate hydrochloride (1.0 g, 2.96 mmol, 1.00 equiv) and dichloromethane (15 mL). This was followed by the addition of TEA (1.5 g, 14.82 mmol, 5.01 equiv) dropwise with stirring at 0Β° C. To this was then added tert-butyl N-[1-(chlorosulfonyl)piperidin-4-yl]carbamate (1.8 g, 6.02 mmol, 2.04 equiv) in several batches at 0Β° C. The resulting solution was stirred for 14 h at 20Β° C. The reaction mixture was diluted with 35 mL of dichloromethane and washed with 3Γ—10 mL of brine. The organic layer was dried over anhydrous sodium sulfate and concentrated under vacuum. The residue was chromatographed on a silica gel column with ethyl acetate/petroleum ether (1:2). This resulted in 1.5 g (90%) of 2,2,2-trichloroethyl N-[(1R,3r,5S)-8-(4-[[(tert-butoxy)carbonyl]amino]piperidine-1-sulfonyl)-8-azabicyclo[3.2.1]octan-3-yl]carbamate as a white solid. 1H NMR (400 MHz, CDCl3) Ξ΄: 5.22 (brs, 1H), 4.75 (s, 2H), 4.46 (brs, 1H), 4.13 (brs, 2H), 4.01-3.95 (m, 1H), 3.70 (d, J=12.0 Hz, 2H), 3.58 (brs, 1H), 2.84 (t, J=11.2 Hz, 2H), 2.33-2.14 (m, 4H), 2.10-1.98 (m, 2H), 1.96-1.84 (m, 3H), 1.65-1.50 (m, 3H), 1.47 (s, 9H) ppm. LCMS (method D, ESI): RT=1.58 min, m/z=507.0 [M+Hβˆ’56]51.

Step 4:Synthesis of tert-butyl N-[1-[(1R,3r,5S) 3 amino-8-azabicyclo[3.2.1]octane-8-sulfonyl]piperidin-4-yl]carbamate

Into a 100-mL round-bottom flask was placed 2,2,2-trichloroethyl N-[(1R,3r,5S)-8-(4-[[(tert-butoxy)carbonyl]amino]piperidine-1-sulfonyl)-8-azabicyclo[3.2.1]octan-3-yl]carbamate (1.0 g, 1.77 mmol, 1.00 equiv), AcOH (15 mL), zinc (1.73 g, 26.45 mmol, 14.92 equiv) and water (1 mL). The resulting mixture was stirred for 1 h at 25Β° C. The mixture was then diluted with 30 mL of H2O and the solids were filtered out. The pH was adjusted to 9 with sodium carbonate (aq. sat.). The resulting solution was extracted with 5Γ—30 mL of dichloromethane and the organic layers combined. After concentration this resulted in 500 mg (73%) of tert-butyl N-[1-[(1R,3r,5S)-3-amino-8-azabicyclo[3.2.1]octane-8-sulfonyl]piperidin-4-yl]carbamate as a white solid. LCMS (method A, ESI): RT=1.08 min, m/z=333.0 [M+Hβˆ’56]+.

Step 5:Synthesis of tert-butyl N-[1-[(1R,3r,5S)-3-(2-oxo-2,3-dihydro-1H-indole-5-carboxamido)-8-azabicyclo[3.2.1]octane-8-sulfonyl]piperidin-4-yl]carbamate

Into a 25-mL round-bottom flask was placed tert-butyl N-[1-[(1R,3r,5S)-3-amino-8-azabicyclo[3.2.1]octane-8-sulfonyl]piperidin-4-yl]carbamate (200 mg, 0.51 mmol, 1.00 equiv), dichloromethane (5 mL), 2-oxo-2,3-dihydro-1H-indole-5-carboxylic acid (109 mg, 0.62 mmol, 1.20 equiv), EDCI (118 mg, 0.62 mmol, 1.20 equiv), and HOBT (104 mg, 0.77 mmol, 1.50 equiv). This was followed by the addition of TEA (260 mg, 2.57 mmol, 4.99 equiv) dropwise with stirring at 0Β° C. The resulting solution was stirred for 14 h at 20Β° C. The reaction mixture was then diluted with 10 mL of dichloromethane and was washed with 2Γ—5 mL of brine. The organic layer was dried over anhydrous sodium sulfate and concentrated under vacuum. The residue was chromatographed on a silica gel column with ethyl acetate/petroleum ether (1:1). This resulted in 243 mg (86%) of tert-butyl N-[1-[(1R,3r,5S)-3-(2-oxo-2,3-dihydro-1H-indole-5-carboxamido)-8-azabicyclo[3.2.1]octane-8-sulfonyl]piperidin-4-yl]carbamate as a off-white solid. LCMS (method A, ESI): RT=1.27 min, m/z=448.0 [M+Hβˆ’100]+.

Step 6:Synthesis of N-[(1R,3r,5S)-8-(4-aminopiperidine-1-sulfonyl)-8-azabicyclo[3.2.1]octan-3-yl]-2-oxo-2,3-dihydro-1H-indole-5-carboxamide

Into a 25-mL round-bottom flask was placed tert-butyl N-[1-[(1R,3r,5S)-3-(2-oxo-2,3-dihydro-1H-indole-5-carboxamido)-8-azabicyclo[3.2.1]octane-8-sulfonyl]piperidin-4-yl]carbamate (241 mg, 0.44 mmol. 1.00 equiv) and dichloromethane (5 mL). To this hydrogen chloride (gas) was introduced. The resulting solution was stirred for 2 h at 15Β° C. The mixture was then concentrated under vacuum. This resulted in 200 mg (94%) of N-[(1R,3r,5S)-8-(4-aminopiperidine-1-sulfonyl)-8-azabicyclo[3.2.1]octan-3-yl]-2-oxo-2,3-dihydro-1H-indole-5-carboxamide hydrochloride as a yellow solid. 1H NMR (400 MHz, CD3OD) : 7.70 (d, J=8.0 Hz, 2H), 6.97 (d, J=8.0 Hz, 1H), 4.14 (s, 3H), 3.86 (d, J=13.2 Hz, 2H), 3.61 (s, 2H), 3.31-3.25 (m, 1H), 2.91 (t, J=12.4 Hz, 2H), 2.37-2.25 (m, 2H), 2.21-1.98 (m, 8H), 1.76-1.63 (m, 2H) ppm. LCMS (method A, ESI): RT=1.07 min, m/z=448.3 [M+H]+.

Step 7:Synthesis of N-[(1R,3r,5S)-8-[4-(benzylamino)piperidine-1-sulfonyl]-8-azabicyclo[3.2.1]octan-3-yl]-2-oxo-2,3-dihydro-1H-indole-5-carboxamide

Into a 25-mL round-bottom flask was placed N-[(1R,3r,5S)-8-(4-aminopiperidine-1-sulfonyl)-8-azabicyclo[3.2.1]octan-3-yl]-2-oxo-2,3-dihydro-1H-indole-5-carboxamide hydrochloride (60 mg, 0.12 mmol, 1.00 equiv), methanol (5 mL), and benzaldehyde (13 mg, 0.12 mmol, 0.99 equiv). The mixture was stirred for 0.5 h at 20Β° C. To this NaBH3CN (7.8 mg, 0.12 mmol, 1.00 equiv) was added in batches. The resulting solution was stirred for 2 h at 70Β° C. The reaction mixture was concentrated under vacuum. The residue was diluted with 5 mL of H2O and extracted with 2Γ—5 mL of dichloromethane. The organic layers combined and concentrated. The crude product was purified by Prep-HPLC with the following conditions: Column, X Bridge C18, 19*150 mm, 5 um; Mobile Phase A: Water/0.05% TEA, Mobile Phase B: ACN; Flow rate: 20 mL/min; Gradient: 30% B to 70% B in 10 min; Detector, 254 nm. This resulted in 14.8 mg (18%) of N-[(1R,3r,5S)-8-[4-(benzylamino)piperidine-1-sulfonyl]-8-azabicyclo[3.2.1 ]octan-3-yl]-2-oxo-2,3-dihydro-1H-indole-5-carboxamide trifluoroacetic acid as a white solid. 1H NMR (300 MHz, CD3OD) : 7.70 (d, J=7.8 Hz, 2H), 7.69-7.48 (m, 5H), 6.97 (d, J=8.4 Hz, 1H), 4.28 (s, 2H), 4.14 (s, 3H), 3.92 (d, J=12.6 Hz, 2H), 3.60 (s, 2H), 3.54-3.35 (m, 1H), 2.90 (t, J=13.2 Hz, 2H), 2.35-2.22 (m, 4H), 2.21-2.10 (m, 4H), 2.09-1.98 (m, 2H), 1.85-1.68 (m, 2H) ppm. LCMS (method A, ESI): RT=2.26 min, m/z=538.4 [M+H]+.

Example 14

Synthesis of N-[(1R,3r,5S)-8-[4-(benzylamino)piperidine-1-sulfonyl]-8-azabicyclo[3.2.1]octan-3-yl]-6-chloro-2-oxo-2,3-dihydro-1H-indole-5-carboxamide trifluoroacetate (Cpd. No. 592)

Step 1:Synthesis of tert-butyl N-[1-[(1R,3r,5S)-3-(6-chloro-2-oxo-2,3-dihydro-1H-indole-5-carboxamido)-8-azabicyclo[3.2.1]octane-8-sulfonyl]piperidin-4-yl]carbamate

Into a 25-mL round-bottom flask was placed 6-chloro-2-oxo-2,3-dihydro-1H-indole-5-carboxylic acid (170 mg, 0.80 mmol, 1.00 equiv), dichloromethane (10 mL), HOBT (216 mg, 1.60 mmol, 2.00 equiv), EDCI (306 mg, 1.60 mmol, 2.00 equiv), and tert-butyl N-1-[(1R,3r,5S)-3-amino-8-azabicyclo[3.2.1]octane-8-suffonyl]piperidin-4-ylcarbamate (375 mg, 0.97 mmol, 120 equiv). This was followed by the addition of TEA (400 mg, 3.95 mmol, 5.00 equiv) dropwise with stirring at 0Β° C. The resulting solution was stirred for 2 h at room temperature. The reaction mixture was diluted with 10 mL of dichloromethane and washed with 2Γ—5 of brine. The organic layer was dried over anhydrous sodium sulfate and concentrated under vacuum. The residue was chromatographed on a silica gel column with ethyl acetate/petroleum ether (3:1). This resulted in 300 mg (64%) of tert-butyl N-[1-[(1R,3r,5S)-3-(6-chloro-2-oxo-2,3-dihydro-1H-indole-5-carboxamido)-8-azabicyclo[3.2.1]octane -8-sulfonyl]piperidin-4-yl]carbamate as a red solid. LCMS (method C, ESI): RT=0.88 min, m/z=582.0 [M+H]+.

Step 2:Synthesis of N-[(1R,3r,5S)-8-(4-aminopiperidine-1-sulfonyl)-8-azabicyclo[3.2.1]octan-3-yl]-6-chloro-2-oxo-2,3-dihydro-1H-indole-5-carboxamide hydrochloride

Into a 25-mL round-bottom flask was placed tert-butyl N-[1-[(1R,3r,5S)-3-(6-chloro-2-oxo-2,3-dihydro-1H-indole-5-carboxainido)-8-azabicyclo[3.2.1]octane-8-sulfonyl]piperidin-4-yl]carbamate (300 mg, 0.52 mmol, 1.00 equiv) and hydrogen chloride/dioxane (10 mL, saturated, this solution was made by introducing hydrogen chloride gas into 1,4-dioxane under 0Β° C. for 6 hours). The resulting solution was stirred for 4 h at room temperature. The mixture was then concentrated under vacuum. This resulted in 170 mg (64%) of N-[(1R,3r,5S)-8-(4-aminopiperidine-1-sulfonyl)-8-azabieyclo[3.2.1]octan-3-yl]-6-chloro-2-oxo-2,3-dihydro-1H-indole-5-carboxamide hydrochloride as a red solid. LCMS (method A, ESI): RT=0.96 min, m/z=482.0 [M+H]+.

Step 3:Synthesis of N-[(1R,3r,5S)-8-[4-(benzylamino)piperidine-1-sulfonyl]-8-azabicyclo[3.2.1]octan-3-yl]-6-chloro-2-oxo-2,3-dihydro-1H-indole-5-carboxamide; trifluoroacetic acid

Into a 25-mL round-bottom flask was placed N-[(1R,3r,5S)-8-(4-aminopiperidine-1-sulfonyl)-8-azabicyclo[3.2.1]octan-3-yl]-6-chloro-2-oxo-2,3-dihydro-1H-indole-5-carboxamide hydrochloride (50 mg, 0.10 mmol, 1.00 equiv), methanol (5 mL), and benzaldehyde (12.3 mg, 0.12 mmol, 1.20 equiv). The mixture was stirred for 0.5 h at 20Β° C. To the above NaBH3CN (7.3 mg, 0.12 mmol, 1.20 equiv) was added in batches. The resulting solution was stirred for 1 h at 70Β° C. The reaction mixture was then concentrated under vacuum and the crude product purified by Prop-HPLC with the following conditions: Column: X Select C18, 19*250 mm, 5 um; Mobile Phase A: Water/0.05% TFA, Mobile Phase B: ACN; Flow rate: 30 mL/min; Gradient 5% B to 36% B in 12.5 min; Detector: 254 nm. This resulted in 28 mg (42%) of N-[(1R,3r,5S)-8-[4-(benzylamino)piperidine-1-sulfonyl]-8-azabicyclo[3.2.1]octan-3-yl]-6-chloro-2-oxo-2,3-dihydro-1H-indole-5-carboxamide trifluoroacetateas a white solid. 1H NMR (400 MHz, CD3OD): 7.53-7.49 (m, 5H), 7.33 (s, 1H), 6.97 (s, 1H), 4.29 (s, 2H), 4.16 (s, 3H), 3.91 (d, J=2.8 Hz, 2H), 3.57 (s, 2H), 3.41-3.37 (m, 1H), 2.89 (t, J=10.8 Hz, 2H), 2.37-2.21 (m, 4H), 2.20-2.08 (m, 4H), 2.05-1.96 (m, 2H), 1.80-1.70 (m, 2H) ppm. LCMS (method A, ESI): RT=1.31 min, m/z=572.2 [M+H]+.

Example 15

Synthesis of 6-chloro-2-oxo-N-((1S,3r,5R)-8-((1-(4,4,4-trifluorobutyl)piperidin-4-yl)methylsulfonyl)-8-azabicyclo[3.2.1]octan-3-yl)indoline-5-carboxamide (Cpd. No. 595)

Step 1:Synthesis of tert-butyl (1R,3S,5S)-3-[[(2,2,2-trichloroethoxy)carbonyl]amino]-8-azabicyclo[3.2.1]octane-8-carboxylate

Into a 250-mL round-bottom flask, was placed water (120 mL). This was followed by the addition of tert-butyl (1R,5S)-3-amino-8-azabicyclo[3.2.1]octarte-8-carboxylate (2 g, 8.84 mmol, 1.00 equiv), sodium bicarbonate (1.92 g, 22.85 mmol, 2.59 equiv). To the mixture was added 2,2,2-trichloroethyl chlorformate (2.28 g, 10.76 mmol, 1.22 equiv) dropwise with stirring at 0Β° C. The resulting solution was stirred for 18 h at 20Β° C. The resulting solution was extracted with 3Γ—150 mL of ethyl acetate and the organic layers combined and dried over anhydrous sodium sulfate and concentrated under vacuum. This resulted in 4.16 g (crude) of tert-butyl (1R,5S)-3-[[(2,2,2-trichloroethoxy)carbonyl]amino]-8-azabicyclo[3.2.1]octane-8-carboxylate as a white solid. 1H NMR(300 MHz, CDCl3): Ξ΄ 4.75(s, 2H), 4.25 (s, 2H), 4.00-3.90(m, 1H), 2.29-2.00(m, 4H), 2.89-2.71 (m, 4H), 1.4.5 (s, 9H)ppm.

Step 2:Synthesis of 2,2,2-trichloroethyl (1S,3r,5R.)-8-aza-bicyclo[3.2.1]octan-3-ylcarbamate

Into a 100-mL round-bottom flask, was placed dichloromethane (20 mL), tert-butyl (1R,3S,5S)-3-[[(2,2,2-trichloroethoxy)carbonyl]amino]-8-azabicyclo[3.2.1]octane-8-carboxylate (2 g, 4.98 mmol, 1.00 equiv). Then hydrogen chloride gas was introduced into mixture. The resulting solution was stirred for 12 h at 80Β° C. The resulting mixture was concentrated under vacuum. This resulted in 1.7 g (crude) of 2,2,2-trichloroethyl N-[(1R,3S,5S)-8-azabicyclo[3.2.1]octan-3-yl]carbamate as a yellow solid. LCMS (method D, ESI): RT=0.86 min, m/z=303.2[M+H]+.

Step 3:Synthesis of benzyl 4(((1S,3r,5R)-3-((2,2,2-trichloroethoxy)carbonylamino)-8-aza-bicyclo[3.2.1]octan-8-ylsulfonyl)methyl)piperidine-1-carboxylate

Into a 100-mL round-bottom flask, was placed dichloromethane (30 mL), 2,2,2-trichloroethyl N-[(1R,3S,5S)-8-azabicyclo[3.2.1]octan-3-yl]carbamate (2.4 g, 7.96 mmol, 1.00 equiv), TEA (3.2 g, 31.62 mmol, 3.97 equiv). Then benzyl 4-[(chlorosulfonyl)methyl]piperidine-1-carboxylate (4 g, 12.05 mmol, 1.51 equiv) was added by dropwise at 0Β° C. The resulting solution was stirred for 12 h at 10Β° C. The resulting mixture was washed with 3Γ—30 mL of water and 1Γ—30 mL of brine. The mixture was dried over anhydrous sodium sulfate and concentrated under vacuum. The residue was applied onto a silica gel column with dichloromethane/methanol (20:1). This resulted in 2.8 g (59%) of benzyl 4-[[(1R,3S,5S)-3-[[(2,2,2-trichloroethoxy)carbonyl]amino]-8-azabicyclo[3.2.1]octane-8-sulfonyl]methyl]piperidine-1-carboxylate as a yellow solid. 1H NMR(300 MHz, CDCl3): Ξ΄ 7.41-7.30 (m, 5H), 5.15 (s, 2H), 4.75 (s, 2H), 4.30-4.15(m, 4H), 4.05-3.90 (m, 1H), 2.95-2.76 (m, 4H), 2.35-2.10 (m, 4H), 2.10-1.90 (m, 5H), 1.57(s, 1H), 1.40-1.20(m, 3H) ppm. LCMS (method D, ESI): RT=1.15 min, m/z=596.1 [M+H]+.

Step 4 2,2,2-trichloroethyl (1S,3r,5R)-8-(piperidin-4-ylmethylsulfonyl)-8-azabicyclo[3.2.1]octan-3-ylcarbamate hydrochloride salts

Into a 250-mL round-bottom flask, was placed benzyl 4-[[(1R,5S)-3-[[(2,2,2-trichloroethoxy)carbonyl]amino]-8-azabicyclo[3.2.1]octane-8-sulfonyl]methyl]piperidine-1-carboxylate (1.5 g, 2.51 mmol, 1.00 equiv). This was followed by the addition of hydrochloric acid (12 N, 140 mL) at 10Β° C. The resulting solution was stirred for 12 h at 50Β° C. The resulting mixture was concentrated under vacuum. This resulted in 1.1 g (88%) of 2,2,2-trichloroethyl N-[(1R,5S)-8-[(piperidin-4-ylmethane)sulfonyl]-8-azabicyclo[3.2.1]octan-3-yl]carbamate hydrochloride as a yellow solid. LCMS (method D, ESI): RT=0.67 min, m/z=464.0 [M+H]+.

Step 5:Synthesis of 2,2,2-trichloroethyl (1S,3r,5R)-8-((1-(4,4,4-trifluorobutyl)piperidin-4-yl)methylsulfonyl)-8-aza-bicyclo[3.2.1]octan-3-ylcarbamate

Into a 100-mL round-bottom flask, was placed dichloromethane (40 mL). This was followed by the addition of methanol (20 mL), 2,2,2-trichloroethyl N-[(1R,5S)-8-[(piperidin-4-ylmethane)sulfonyl]-8-azabicyclo[3.2.1]octan-3-yl]carbamate hydrochloride (300 mg, 0.60 mmol, 1.00 equiv), 4,4,4-trifluorobutanal (227 mg, 1.80 mmol, 3.00 equiv). Then NaBH3CN (303 mg, 4.81 mmol, 8.00 equiv) was added into by batchwise. To the mixture was added acetic acid (1 mL). The resulting solution was stirred for 6 h at 10Β° C. The resulting mixture was concentrated under vacuum. The resulting solution was extracted with 3Γ—100 mL of dichloromethane and the organic layers combined. The resulting mixture was washed with 1Γ—50 mL of brine. The mixture was dried over anhydrous sodium sulfate and concentrated under vacuum. The residue was purified by flash chromatography with eluent (PE/EtOAc=2/1 to 100% EtOAc). This resulted in 295 mg (86%) of 2,2,2-trichloroethylN-[(1R,5S)-8-([[1-(4,4,4-trifluorobutyl)piperidin-4-yl]methane]sulfonyl)-8-azabicyclo[3.2.1] octan-3-yl]carbamate as yellow oil. 1H NMR(300 MHz, CDCl3): Ξ΄ 4.75 (s, 2H), 4.30 (s, 2H), 4.02-3.95 (m, 1H), 3.10-3.02 (m, 2H), 3.00-2.95 (m, 2H), 2.58-2.50 (m, 2H), 2.32-1.78 (m, 17H), 1.60-1.48 (m, 2H) ppm. LCMS (method D, ESI): RT=0.97 min, m/z=572.0 [M+H]+.

Step 6:Synthesis of (1S,3r,5R)-8-((1-(4,4,4-trifluorobutyl)piperidin-4-yl)methylsulfonyl)-8-aza -bicyclo[3.2.1]octan-3-amine

Into a 100-mL round-bottom flask, was placed 2,2,2-trichloroethyl N-[(1R,3S,5S)-8-([[1-(4,4,4-trifluorobutyl)piperidin-4-yl]methane]sulfonyl)-8-azabicyclo[3.2.1]octan-3-yl]carbamate (50 mg, 0.09 mmol, 1.00 equiv). This was followed by the addition of acetic acid (15 mL), water (1 mL) and Zn (90 mg). The resulting solution was stirred for 12 h at 10Β° C. The solids were filtered out. The pH value of the solution was adjusted to 8 with sodium carbonate (sat. aq.). The resulting solution was extracted with 3Γ—50 mL of ethyl acetate and the organic layers combined and concentrated under vacuum. This resulted in 25 mg (72%) of (1R,3S,5S)-8-([[1-(4,4,4-trifluorobutyl)piperidin-4-yl]methane]sulfonyl)-8-azabicyclo[3.2.1]octan-3-amine as a yellow solid. LCMS (method B, ESI): RT 1.24 min, m/z=398.0 [M+H]+.

Step 7:Synthesis of 6-chloro-2-oxo-N-((1S,3r,5 R)-8-((1-(4,4,4-trifluorobutyl)piperidin-4-yl)methylsulfonyl)-8-aza-bicyclo[3.2.1]octan-3-yl)indoline-5-carboxamide

Into a 100mL round-bottom flask, was placed N,N-dimethylformamide (10 mL), (1R,3S,5S)-8-([[1-(4,4,4-trifluorobutyl)piperidin-4-yl]methane]sulfonyl)-8-azabicyclo[3.2.1]octan-3-amine (50 mg, 0.13 mmol, 1.00 equiv), 6-chloro-2-oxo-2,3-dihydro-1H-indole-5-carboxylic acid (46 mg, 0.22 mmol, 1.73 equiv), 1H-1,2,3-benzotriazol-1-ol (35 mg, 0.26 mmol, 2.06 equiv), EDCI (50 mg, 0.26 mmol, 2.07 equiv), TEA (0.3 mL). The resulting solution was stirred for 12 h at 10Β° C. The solids were filtered out. The resulting mixture was diluted with 10 mL of water. The resulting solution was extracted with of 2Γ—10 mL dichloromethane and the organic layers combined. The organic phase was dried over anhydrous sodium sulfite and concentrated under vacuum. The crude reside was purified by Prep-HPLC with the following conditions (2#-Waters 2767-2(HPLC-08)): Column, Xbridge Prep Phenyl, 5 um, 19Γ—150 mm; mobile phase, Water with 50 mmol ammonium bicarbonate and acetonitrile (10.0% acetonitrile up to 33.0% in 2 min, up to 53.0% in 8 min, up to 100.0% in 1 min, down to 10.0% in 1 min); Detector, UV 254 nm. This resulted in 5.7 mg (8%) of 6-chloro-2-oxo-N-[(1R,3S,5S)-8-([[1-(1,4,4-trifluorobutyl)piperidin-4-yl]methane]sulfonyl)-8-azabicyclo[3.2.1]octan-3-yl]-2,3-dihydro-1H-indole-5-carboxamide as a light pink solid. 1HNMR (300 MHz, CD3OD): Ξ΄ 7.32 (s, 1H), 6.95 (s, 1H), 4.30-4.10 (m, 3H), 3.35 (s, 2H), 3.10-2.90 (m, 4H), 2.50-2.40 (m, 2H), 2.40-1.90 (m, 15H), 1.85-1.70 (m, 2H), 1.51-1.35 (m, 2H) ppm. LCMS (method B, ESI): RT=1.67 min, m/z=591.1 [M+H]+.

Example 16

Synthesis of N-((1R,3r,5S)-8-(4-aminocyclohexylsulfonyl)-8-aza-bicyclo[3.2.1]octan-3-yl-2,2-difluorobenzo[d][1,3]dioxole-5-carboxamide trifluoroacetate (Cpd. No. 622)

Step 1:Synthesis of tert-butyl (1R,3r,5S)-3-(2,2-difluoro-2H-1,3-benzo[d][1,3]idioxole-5-carboxamido)-8-azabicyclo[3.2.1]octano-8-carboxylate

Into a 100-mL round-bottom flask was placed dichloromethane (50 mL), 2,2-difluoro-2H-1,3-benzo[d][1,3]dioxole-5-carboxylic acid (1.5 g, 7.42 mmol, 1.00 equiv), tert-butyl (1R,5S,7S)-7-amino-3-azabicyclo[3.3.2]decane-3-carboxylate (2.0 g, 7.86 mmol, 1.06 equiv), HATU (5.65 g), and TEA (2.25 g, 22.24 mmol, 3.00 equiv). The resulting solution was stirred for 12 h at 25Β° C. The resulting mixture was washed with 3Γ—50 mL of H2O. The organic layer was dried over anhydrous sodium sulfite, and concentrated. The residue was chromatographed on a silica reel column with PE: EA (1:1). This resulted in 3.0 g (92%) of tert-butyl(1R,5r,7S)-7-(2,2-difluoro-2H-1,3-benzo[d][1,3]dioxote-5-carboxamido)-3-azabicyclo[3.3.2]decane-3-carboxylate as a white solid. 1HNMR (300 MHz, DMSO): Ξ΄ 8.20-8.15 (m, 1H), 7.77 (s, 1H), 7.68 (d, J=8.7 Hz, 1H), 7.52 (d, J=8.4 Hz, 1H), 4.08-3.90 (m, 1H), 3.50-3.10 (m, 2H), 2.15-1.80 (m, 8H), 1.50-1.30 (m, 9H) ppm. LCMS (method C, ESI): RT=1.25 min, m/z=411.2 [M+H]+.

Step 2:Synthesis of N-((1R,3r,5S)-8-aza-bicyclo[3.2.1]octan-3-yl)-2,2-difluorobenzo[d][1,3]dioxole-5-carboxamide

Into a 100-mL round-bottom flask was placed a solution of tert-butyl (1R,3r,5S)-3-(2,2-difluoro-2H-1,3-benzo[d][1,3]dioxole-5-carboxamido)-8-azabicyclo[3.2.1]octane-8-carboxylate (1.5 g, 3.65 mmol, 1.00 equiv) in methanol (30 mL). Hydrogen chloride gas was introduced into the solution at 0Β° C. for 1 h. The resulting solution was stirred for another 1 h at 20Β° C. The mixture was then concentrated under vacuum. This resulted in 1.3 g (crude) of N-[(1R,3r,5S)-8-azabicyclo[3.2.1]octan-3-yl]-2,2-difluoro-2H-1,3-benzo[d][1,3]dioxole-5-carboxamide as a white solid. LCMS (method A, ESI): RT=0.80 min, m/z=311.2 [M+H]+.

Step 3:Synthesis of 2,2-difluoro-N-((1R,3r,5S)-8-(4-oxocyclohexylsulfonyl)-8-aza-bicyclo[3.2.1]octan-3-yl)benzo[d][1,3]dioxole-5-carboxamide

Into a 250-mL 3-necked round-bottom flask purged and maintained with an inert atmosphere of nitrogen was placed a solution of N-[(1R,3r,5S)-8-azabicyclo[3.2.1]octan-3-yl]-2,2-difluoro-2H-1,3-benzo[d][1,3]dioxoe-5-carboxamide (900 mg, 2.90 mmol, 1.00 equiv) in THF (150 mL). This was followed by the addition of LiHMDS (1M in THF, 10 mL) dropwise with stirring at βˆ’60Β° C. To this was added 4-oxocyclohexane-1-sulfonyl chloride (700 mg, 3.56 mmol, 1.23 equiv) in portions at βˆ’60Β° C. The resulting solution was allowed to warm to room temperature and stirred for another 12 hours at 25Β° C. The resulting mixture was concentrated under vacuum. The residue was extracted with 3Γ—60 mL, of dichloromethane and the organic layers combined, dried over anhydrous sodium sulfate and concentrated. The residue was chromatographed on a C18 gel column with H2O/CH3CN=3:5. This resulted in 260 mg (19%) of 2,2-difluoro-N-[(1R,3rS,5S)-8-[(4-oxocyclohexane)sulfonyl]-8-azabicyclo[3.2.1]octan-3-yl]-2H -1,3-benzo[d][1,3]dioxole-5-carboxamide as a white solid. LCMS (method B, ESI): RT=1.08 min, m/z=471.0 [M+H]+.

Step 4:Synthesis of N-((1R,3r,5S)-8-(4-aminocyclohexylsulfonyl)-8-aza-bicyclo[3.2.1]octan-3-yl)-2,2-difluorobenzo[d][1,3]dioxole-5-carboxamide trifluoroacetate

Into a 250-mL round-bottom flask was placed methanol (130 mL), 2,2-difluoro-N-[(1R,3r,5S)-8-[(4-oxocyclohexane)sulfonyl]-8-azabicyclo[3.2.1]octan-3-yl]-2H-1,3-benzo[d][1,3]dioxole-5-carboxamide (200 mg, 0.43 mmol, 1.00 equiv), HCOONH4 (1080 mg, 17.13 mmol, 40.29 equiv), and acetic acid (24 mg, 0.40 mmol, 0.94 equiv). Then NaBH3CN (50 mg, 0.79 mmol, 1.87 equiv) was added batchwise. The resulting solution was stirred for 2 h at 20Β° C. The mixture was then concentrated under vacuum. The residue was slurried with 150 mL of EtOAc and then filtrated. The filtrate was concentrated under vacuum. The crude product was purified by Prep-HPLC with the following conditions: Column, X Bridge C18, 19*150 mm, 5 um; mobile phase, Mobile Phase A: Water/0.05% TFA, Mobile Phase B: ACN; Flow rate: 20 mL/min; Detector, 254 nm. This resulted in 15.2 mg (6%) of N-[(1R,3r,5S)-8-[(4-aminocyclohexane)sulfonyl]-8-azabicyclo[3.2.1]octan-3-yl]-2,2-difluoro-2H-1,3-benzo[d][1,3]dioxole-5-carboxamide trifluoroacetic acid as a white solid. 1H NMR(300 MHz, D2O): Ξ΄ 7.46-7.44 (m, 2H), 7.19 (d, J=6 Hz, 1H), 4.18 (s, 2H), 4.05 (t, J=6.0 Hz, 1H), 3.48-3.10 (m, 2H), 2.30-1.80 (m, 13H), 1.65-1.38 (m, 3H) ppm. LCMS (method D, ESI): RT=1.55 min, m/z=472.0 [M+H]+.

Example 17

Synthesis of N-[(1R,3r,5S)-8-(4-aminopiperidine-1-sulfonyl)-8-azabicyclo[3.2.1]octan-3-yl]-5-ethyl-1,2-thiazole-3-carboxamide hydrochloride (Cpd. No. 610)

Step 1: Synthesis of tert-butyl N-[1-[(1R,3r,5S)-3-(5-ethyl-1,2-thiazole-3-carboxamido)-8-azabicyclo[3.2.1]octane-8-sulfonyl]piperidin-4-yl]carbamate

Into a 50-mL round-bottom flask purged and maintained with an inert atmosphere of nitrogen was placed dichloromethane (10 mL), 5-ethyl-1,2-thiazole-3-carboxylic acid (44 mg, 0.28 mmol, 1.00 equiv), tert-butyl N-[1-[(1R,3r,5S)-3-amino-8-azabicyclo[3.2.1]octane-8-sulfonyl]piperidin-4-yl]carbamate (100 mg, 0.34 mmol, 1.21 equiv), HOBT (52 mg, 0.38 mmol, 1.36 equiv)), and EDCI (150 mg, 0.79 mmol, 2.80 equiv). This was followed by the addition of a solution of triethylamine (80 mg, 0.79 mmol, 2.80 equiv) in dichloromethane (1 ml) which was added dropwise with stirring at 0Β° C. The resulting solution was stirred for 15 hours at 20Β° C. The reaction was quenched by the addition of 50 mL of water and extracted with 2Γ—100 mL of dichloromethane. The organic layers were combined and washed with 1Γ—50 mL of brine. The organic layer was dried over anhydrous sodium sulfate and concentrated under vacuum. The residue was chromatographed on a silica gel column with ethyl acetate/petroleum ether (1:2). This resulted in 120 mg (81%) of tert-butyl N-[1-[(1R,3r,5S)-3-(5-ethyl-1,2-thiazole-3-carboxamido)-8-azabicyclo[3.2.1]octane-8-sulfonyl]piperidin-4-yl]carbamate as a solid. LCMS (method A, ESI): RT=1.61 min, m/z=528.0[M+H]+.

Step 2:Synthesis of N-[(1R,3r,5S)-8-(4-aminopiperidine-1-sulfonyl)-8-azabicyclo[3.2.1]octan-3-yl]-5-ethyl-1,2-thiazole-3-carboxamide hydrochloride

Into a 50-mL round-bottom flask was placed tert-butyl N-[1-[(1R,3r,5S)-3-(5-ethyl-1,2-thiazole-3-carboxamido)-8-azabicyclo[3.2.1]octane-8-sulfonyl]piperidin-4-yl]carbamate (120 mg, 0.23 mmol, 1.00 equiv) and hydrogen chloride/dioxane (10 mL, saturated, this solution was made by introducing hydrogen chloride gas into 1,4-dioxane under 0Β° C. for 6 hours). The resulting solution was stirred for 3 hours at 20Β° C. The mixture was then concentrated under vacuum. This resulted in 57.8 mg (55%) of N-[(1R,3r,5S)-8-(4-aminopiperidine-1-sulfonyl)-8-azabicyclo[3.2.1]octan-3-yl]-5-ethyl-1,2-thiazole-3-carboxamide hydrochloride as a solid.1H NMR (300 MHz, D2O) Ξ΄: 7.45 (s, 1H), 4.15-4.02 (m, 3H), 3.80-3.78 (m, 2H), 3.38-3.22 (m, 1H), 2.98-2.82 (m, 4H), 2.30-2.18 (m, 2H), 2.11-1.87 (m, 8H), 1.71-1.52 (m, 2H), 1.30-1.20 (m,3H) ppm. LCMS (method A, ESI): RT=1.81 min, m/z=428.2 [Mβˆ’HCl+H]+.

Example 18

Synthesis of N-((1R,3r,5S)-8-(4-aminopiperidin-1-ylsulfonyl)-8-aza-bicyclo[3.2.1]octan-3-yl)-3-oxo-3,4-dihydro-2H-benzo[b][1,4]oxazine-6-carboxamide hydrochloride (Cpd, No. 609)

Step 1:Synthesis of 3-oxo-3,4-dihydro-2H-1,4-benzo[b][1,4]oxazine-6-carboxylic acid

Into a 100-mL round-bottom flask was placed methyl 3-oxo-3,4-dihydro-2H-1,4-benzo[b][1,4]oxazine-6-carboxylate (1 g, 4.83 mmol, 1.00 equiv), methanol (15 mL), tetrahydrofuran (15 mL), and water (15 mL). This was followed by the addition of a solution of sodium hydroxide (386 mg, 9.65 mmol, 2.00 equiv) in 5 ml H2O which was added dropwise with stirring at 0Β° C. The solution was stirred for 20 min at 0Β° C. In an ice/salt bath. The resulting solution was allowed to react, with stirring, for an additional 18 h at room temperature. The reaction mixture was then concentrated under vacuum. The residue was diluted with 50 mL of H2O and The pH adjusted to 3-4 with hydrochloric acid (1 N). The resulting mixture was extracted with 3Γ—50 mL of ethyl acetate. The organic layers were combined and washed with 2Γ—30 mL of water and 1Γ—30 mL of brine. The organic layer was dried over anhydrous sodium sulfate, filtered, and, the filtrate concentrated under vacuum. This resulted in 850 mg (91%) of 3-oxo-3,4-dihydro-2H-1,4-benzo[b][1,4]oxazine-6-carboxylic acid as a brown solid. 1H NMR (300 MHz, CD3OD) Ξ΄: 7.68 (q, J=8.4 Hz, 1H), 7.61 (d, J=1.8 Hz, 1H), 7.02 (d, J=8.4 Hz, 1H), 4.68 (s, 2H) ppm. LCMS (method A, ESI): RT=1.01 min, m/z=194.0 [M+H]+.

Step 2:Synthesis of 2,2,2-trichloroethyl N-[(1R,3r,5S)-8-(4-[[(tert-butoxy)carbonyl]amino]piperidine-1-sulfonyl)-8-azabicyclo[3.2.1]octan-3-yl]carbamate

Into a 100-mL round-bottom flask was placed dichloromethane (30 mL), 2,2,2-trichloroethyl N-[(1R,3r,5S)-8-azabicyclo[3.2.1]octan-3-yl]carbamate hydrochloride (900 mg, 2.66 mmol, 1.00 equiv), and TEA (1.37 g, 13.54 mmol, 5.00 equiv). This was followed by the addition of a solution of tert-butyl N-[1-(chlorosulfonyl)piperidin-4-yl]carbamate (1.6 g, 5.35 mmol, 2.00 equiv) in 2 ml dichloromethane which was added dropwise with stirring at 0Β° C. The resulting solution was stirred for 14 h at 10Β° C. The mixture was then washed with 3Γ—30 mL of brine. The organic layer was dried over anhydrous sodium sulfate, filtered, and the filtrate concentrated under vacuum. The residue was chromatographed on a silica gel column with ethyl acetate/petroleum ether (1:I). This resulted in 1.1 g (73%) of 2,2,2-trichloroethyl N-[(1R,3r,5S)-8-(4-[[(tert-butoxy)carbonyl]amino]piperidine-1-sulfonyl)-8-azabicyclo[3.2.1]octan-3-yl]carbamate as a white solid. 1H NMR (400 MHz, CDCl3) Ξ΄: 5.22 (s, 1H), 4.75 (s, 2H), 4.47 (s, 1H), 4.14 (s, 2H), 3.98 (d, J=6 Hz, 1H), 3.70 (d, J=12 Hz, 2H), 3.58 (s, 1H), 2.84 (t, J=11.2 Hz, 2H), 2.27-2.25 (m, 4H), 2.03 (d, J=10.8 Hz, 2H), 1.95-1.87 (m, 4H), 1.58 (s, 2H), 1.55-1.40 (m, 9H) ppm. LCMS (method C, ESI): RT=1.24 min, m/z=563.0 [M+H]+.

Step 3:Synthesis of tert-butyl N-[1-[(1R,3r,5S)-3-amino-8-azabicyclo[3.2.1]octane-8-sulfonyl]piperidin-4-yl]carbamate

Into a 100-mL round-bottom flask was placed 2,2,2-trichloroethyl N-[(1R,3r,5S)-8-(4-[[(tert-butoxy)carbonyl]amino]piperidine-1-sulfonyl)-8-azabicyclo[3.2.1 ]octan-3-yl]carbamate (1.1 g, 1.95 mmol, 1.00 equiv), Zn (1.9 g, 15.00 equiv), AcOH (15 mL), and water (1 mL). The resulting mixture was stirred for 3 h 10Β° C. The solids were filtered out. The pH was adjusted to 8 with sodium carbonate (aq. sat.). The resulting solution was extracted with 4Γ—50 mL of ethyl acetate. The organic layers were combined, dried over anhydrous sodium sulfate, filtered, and concentrated under vacuum. This resulted in 750 mg (crude) of tert-butyl N-[1-[(1R,3r,5S)-3-amino-8-azabicyclo[3.2.1]octane-8-sulfonyl]piperidin-4-yl]carbamate as a light yellow crude solid. LCMS (method C, ESI): RT=0.61 min, m/z=389.0 [M+H]+.

Step 4:Synthesis of tert-butyl (1-(((1R,3r,5S)-3-(3-oxo-3,4-dihydro-2H-benzo[b][1,4]oxazine-6-carboxamido)-8-azabicyclo[3.2.1]octan-8-yl)sulfonyl)piperidin-4-yl)carbamate

Into a 100-mL round-bottom flask was placed N,N-dimethylformamide (10 mL), 3-oxo-3,4-dihydro-2H-1,4-benzo[b][1,4]oxazine-6-carboxylic acid (55 mm, 0.28 mmol, 1.10 equiv), EDCI (98 mg, 0.51 mmol, 2.00 equiv), HOBT (70 mg, 0.52 mmol, 2.00 equiv), and tert-butyl N-1-[(1R,3r,5S)-3-amino-8-azabicyclo[3.2.1]octane-8-sulfonyl]piperidin-4-ylcarbamate (100 mg, 0.26 mmol, 1.00 equiv). This was followed by the addition of TEA (131 mg, 1.29 mmol, 5.00 equiv) which was added dropwise with stirring at 0Β° C. The resulting solution was stirred for 15 h at 10Β° C. The reaction mixture was diluted with 10 mL of H2O and extracted with 3Γ—10 mL of ethyl acetate. The organic layers were combined, dried over anhydrous sodium sulfate, filtered, and concentrated under vacuum. The residue was chromatographed on a silica gel column with dichloramethanelmethanol (10:1). This resulted in 100 mg (69%) of tert-butyl N-[1-[(1R,3r,5S)-3-(3-oxo-3,4-dihydro-2H-1,4-benzo[b][1,4]oxazine-6-carboxamido)-8-azabicyclo[3.2.1]octane-8-sulfonyl]piperidin-4-yl]carbamate as a white solid. LCMS (method A, ESI): RT=1.32 min, m/z=586.0 [M+Na]+.

Step 5:Synthesis of N-((1R,3r,5S)-8-(4-aminopiperidin-1-ylsulfonyl)-8-aza-bicyclo[3.2.1]octan-3-yl)-3-oxo-3,4-dihydro-2H-benzo[b][1,4]oxazine-6-carboxamide hydrochloride

Into a 50-mL round-bottom flask was placed dichloromethane (10 mL) and tert-butyl N-[1-[(1R.,3r,5S)-3-(3-oxo-3,4-dihydro-2H-1,4-benzo[b][1,4]oxazine-6-carboxamido)-8-azabicyclo[3.2.1]octane-8-sulfonyl]piperidin-4-yl]carbamate (100 mg, 0.18 mmol, 1.00 equiv). To the above hydrogen chloride (gas) was introduced. The resulting solution was stirred for 3 h at 10Β° C., The reaction mixture was then concentrated under vacuum. The crude product (80 mg) was purified by Prep-HPLC with the following conditions (Prep_HPLC_MC5): Column, X Select C18, 19*250 mm, 5 um; mobile phase, A: Water/0.05% TEA, Mobile Phase B. ACN; Flow rate: 30 mL/min; Gradient: 5% B to 36% B in 12.5 min; Detector, 254 nm. The isolated purified product was dissolved in 2 ml concentrated hydrochloric acid and this solution concentrated under vacuum. This resulted in 45.7 mg (52%) of N-[(1R,3r,5S)-8-(4-aminopiperidine-1-sulfonyl)-8-azabicyclo[3.2.1]octan-3-yl]-3-oxo-3,4-dihydro-2H-1,4-benzo[b][1,4]oxazine-6-carboxamide hydrochloride as a white solid. 1H NMR (400 MHz, D2O) Ξ΄: 7.28 (q, J=8.4 Hz, 1H), 7.18 (s, 1H), 6.98 (d, J=8.4 Hz, 1H), 4.60 (s, 2H), 4.10-3.95 (m, 3H), 3.74 (d, J=13.2 Hz, 2H), 3.35-3.25 (m, 1H), 2.88 (t, J=12 Hz, 2H), 2.25-2.18 (m, 2H), 2.10-1.98 (m, 6H), 1.91 (d, J=14.8 Hz, 2H), 1.67-1.52 (rn, 2H) ppm. LCMS (method A, ESi): RT=1.40 min, m/z=464.0 [Mβˆ’HCl+H]+.

Example 19

Synthesis of N-((2S,4S)-1-(4-aminopiperidin-1-ylsulfonyl)-2-methylpiperidin-4-yl)-5-ethyl-1,2-thiazole-3-carboxamide hydrochloride (Cpd. No. 605)

Step 1:Synthesis of ethyl 2-amino-4-oxohex-2-enoate

Into a 250-mL round-bottom flask was placed ethyl 2,4-dioxohexanoate (10 g, 58.08 mmol, 1.00 equiv), benzene (100 mL), CH3COONH4 (13.4 g, 173.84 mmol, 2.99 equiv), and acetic acid (10 mL). The resulting solution was stirred at 80Β° C. overnight. The reaction mixture was cooled and concentrated under vacuum. The residue was diluted with 200 mL of ice-water and the pH adjusted to 8 with Na2CO3 (aq. Sat.). The resulting mixture was extracted with 3Γ—100 mL of ethyl acetate and the organic layers combined, dried over anhydrous sodium sulfate and concentrated under vacuum. The residue was chromatographed on a silica gel column with ethyl acetate/petroleum ether (1:10-1:5). This resulted in 7 g (70%) of ethyl 2-amino-4-oxohex-2-enoate as yellow oil. 1H NMR (400 MHz, CDCl3) Ξ΄: 5.92 (s, 1H), 4.36-4.30 (m, 2H), 2.49-2.44 (m, 2H), 1.28-1.24 (m, 3H). 1.14-1.11 (m, 3H) ppm.

Step 2:Synthesis of ethyl 5-ethyl-1,2-thiazole-3-carboxylate

Into a 250-mL round-bottom flask was placed ethyl 2-amino-4-oxohex-2-enoate (4 g, 23.37 mmol, 1.00 equiv), tetrahydrofuran (50 mL), and P2S5 (2.6 g, 11.70 mmol, 0.50 equiv). The mixture was stirred overnight at room temperature. Then the mixture was concentrated and the residue was dissolved in ethyl acetate (20 mL). This solution was cooled to 0Β° C. and H2O2 (30%, 10 mL) was added dropwise . The resulting mixture was stirred for 10 min at room temperature. To the mixture was added activated charcoal. After filtration, the filtrate was diluted with H2O (20 mL). This was extracted with EA (20 mLΓ—3). The organic layers were combined, dried over anhydrous sodium sulfate and concentrated under vacuum. This resulted in 2.44 g (56%) of ethyl 5-ethyl-1,2-thiazole-3-carboxylate as brown oil. LCMS (method A, ESI): RT=1.36 min, m/z=186.1 [M+H]+.

Step 3:Synthesis of 5-ethyl-1,2-thiazole-3-carboxylic acid

Into a 100-mL round-bottom flask was placed ethyl 5-ethyl-1,2-thiazole-3-carboxylate (2.44 g. 13.17 mmol., 1.00 equiv), methanol (10 mL), water(10 mL), tetrahydrofuran (10 mL) and LiOH.H2O (1.66 g, 39.56 mmol, 3.00 equiv). The resulting solution was stirred for 1 h at room temperature. The reaction mixture was then concentrated under vacuum. The residue was diluted with 30 mL of H2O and extracted with 5Γ—30 mL of dichloromethane. The organic layers were combined, dried over anhydrous sodium sulfate and concentrated under vacuum. This resulted in 1.44 g (70%) of 5-ethyl-1,2-thiazole-3-carboxylic acid as a brown solid. 1H NMR (400 MHz, CDCl3) Ξ΄: 7.63 (s, 1H), 3.04-2.96 (m, 2H), 1.42-1.19 (m, 3H) ppm. LCMS (method D, ESI): RT=1.09 min, m/z=158.2 [M+H]+.

Step 4:Synthesis of (2S)-tert-butyl 4-(5-ethyl-1,2-thiazole-3-carboxamido)-2-methylpiperidine-1-carboxylate

Into a 250-mL round-bottom flask was placed 5-ethyl-1,2-thiazole-3-carboxylic acid (1.5 g, 9.54 mmol, 1.00 equiv), EDCI (2.92 g, 15.23 mmol, 1.60 equiv), 1H-1,2,3-benzotriazol-1-ol (2.1 g, 15.54 mmol, 1.63 equiv), dichloromethane (20 mL), and (2S)-tert-butyl 4-amino-2-methylpiperidine-1-carboxylate (2.45 g, 11.43 mmol, 1.20 equiv). Then TEA (2.89 g, 28.56 mmol, 2.99 equiv) was added dropwise. The resulting solution was stirred overnight at room temperature. The reaction mixture was diluted with 30 mL of H2O and extracted with 3Γ—30 mL of dichloromethane. Theorganic layers were combined, dried over anhydrous sodium sulfate and concentrated under vacuum. The residue was chromatographed on a combi-flash with eluent (EA:PE=1/1). This resulted in 1.5 g of (2S)-tert-butyl 4-(5-ethyl-1,2-thiazole-3-carboxamido)-2-methylpiperidine-1-carboxylate as a brown oil. LCMS (method D, ESI): RT=1.60 min, m/z-=376.1 [M+Na]+.

Step 5:Synthesis of (2S,4S)-tert-butyl 4-(5-ethyl-1,2-thiazole-3-carboxamido)-2-methylpiperidine-1-carboxylate

tert-Butyl (2S)-4-(5-ethyl-1,2-thiazole-3-carboxamido)-2-methylpiperidine-1-carboxylate (470 mg, 1.33 mmol, 1.00 equiv was purified by Chiral-Prep-HPLC with the following conditions: Column,CHIRALCEL OJ-3, mobile phase, Hex(0.2% IPA): EtOH=70:30, Detector, 254 nm. This resulted in 200 mg (43%) of tert-butyl (2S,4S)-4-(5-ethyl-1,2-thiazole-3-carboxamido)-2-methylpiperidine-1-carboxylate as a yellow solid. ee value: 100%

Step 6:Synthesis of 5-ethyl-N-((2S,4S)-2-methylpiperidin-4-yl)-1,2-thiazole-3-carboxamide

Into a 25-mL round-bottom flask was placed tert-butyl (2S,4S)-4-(5-ethyl-1,2-thiazole-3-carboxamido)-2-methylpiperidine-1-carboxylate (200 mg, 0.57 mmol, 1.00 equiv), dichloromethane (10 mL). To the above hydrogen chloride (gas) was introduced. The resulting solution was stirred for 1 h at room temperature. The resulting mixture was then concentrated under vacuum. This resulted in 150 mg (91%) of 5-ethyl-N-[(2S,4S)-2-methylpiperidin-4-yl]-1,2-thiazole-3-carboxamide hydrochloride as a white solid. LCMS (method C, ESI): RT=0.49 min, m/z=254.4 [Mβˆ’HCl+H]+.

Step 7:Synthesis of tert-butyl 1-((2S,4S)-4-(5-ethyl-1,2-thiazole-3-carboxamido)-2-methylpiperidin-1-ylsulfonyl)piperidin-4-ylcarbamate

Into a 25-mL round-bottom flask was placed 5-ethyl-N-[(2S,4S)-2-methylpiperidin-4-yl]-1,2-thiazole-3-carboxamide hydrochloride (150 mg, 0.52 mmol, 1.00 equiv) and dichloromethane (10 mL). Then TEA (260 mg, 5.00 equiv) added dropwise followed by tert-butyl N-[1-(chlorosulfonyl)piperidin-4-yl]carbamate (750 mg, 2.51 mmol, 4.85 equiv) which was added in several portions. The resulting mixture was stirred for 2 h at room temperature. The mixture was concentrated under vacuum and the residue was chromatographed on a silica gel column with ethyl acetate/petroleum ether (1/1). This resulted in 150 mg (56%) of tert-butyl N-[1-[(2S,4S)-4-(5-ethyl-1,2-thiazole-3-amido)2-methylpiperidine-1-sulfonyl]piperidin-4-yl]carbamate as a yellow solid. LCMS (method C, ESI): RT=1.57 min, m/z=516.2 [M+H]+.

Step 8:Synthesis of N-((2S,4S)-1-(4-aminopiperidin-1-ylsulfonyl)-2-methylpiperidin-4-yl)-5-ethyl-1,2-thiazole-3-carboxamide hydrochloride

Into a 25-mL round-bottom flask was placed tert-butyl N-[1-[(2S,4S)-4-(5-ethyl-1,2-thiazole-3-carboxamido)-2-methylpiperidine-1-sulfonyl]piperidin-4-yl]carbamate (150 mg, 0.29 mmol, 1.00 equiv) and dichloromethane (10 mL). To the above hydrogen chloride (gas) was introduced. The resulting solution was stirred for 1 h at room temperature. The mixture was then concentrated under vacuum. This resulted in 90 mg (68%) of N-[(2S,4S)-1-(4-aminopiperidirie-1-sulfanyl)-2-methylpiperidin-4-yl]-5-ethyl-1,2-thiazole-3-carboxamide hydrochloride as a white solid. 1H NMR (300 MHz, D2O) Ξ΄: 7.46 (s, 1H), 4.06-4.01 (m, 1H), 3.71-3.55 (m, 4H), 3.33-3.20 (m, 2H), 2.95-2.82 (m, 4H), 2.04-197 (m, 4H), 1.80-1.57 (m, 4H), 1.30-1.22 (m, 6H) ppm. LCMS (method A, ESI): RT=1.74 min, m/z=416.2 [Mβˆ’HCl+H]+.

Example 20

Synthesis of N-((2S,4R)-1-(4-aminopiperidin-1-ylsulfonyl)-2-rnethylpiperidin-4-yl)-5-ethyl-1,2-thiazole-3-carboxamide (Cpd. No. 629)

Step 1:Synthesis of (2S,4R)-tert-butyl 4-(5-ethyl-1,2-thiazole-3-carboxamido)-2-methylpiperidine-1-carboxylate

tert-Butyl (2S)-4-(5-ethyl-1,2-thiazole-3-carboxamido)-2-methylpiperidine-1-carboxylate (470 mg, 1.33 mmol, 1.00 equiv) was purified by Chiral-Prep-HPLC with the following conditions: Column: CHIRALCEL OJ-3-; mobile phase, Hex(0.2% IPA): EtOH=70:30 Detector,254nm. This resulted in 100 mg (21%) of test-butyl (2S,4R)-4-(5-ethyl-1,2-thiazole-3-amido)-2-methylpiperidine-1-carboxylate as a yellow solid. ee value: 100%.

Step 2:Synthesis of 5-ethyl-N-((2S,4R)-2-methylpiperidin-4-yl)-1,2-thiazole-3-carboxamide

Into a 25-mL round-bottom flask was placed tert-butyl (2S,4R)-4-(5-ethyl-1,2-thiazole-3-carboxamido)-2-methylpiperidine-1-carboxylate (100 mg, 0.28 mmol, 1.00 equiv) and dichloromethane (10 mL). To the above hydrogen chloride gas) was introduced. The resulting solution was stirred for 1 h at room temperature. The mixture was concentrated under vacuum. This resulted in 70 mg (85%) of 5-ethyl-N-[(2S,4R)-2-methylpiperidin-4-yl]-1,2-thiazole-3-carboxamide hydrochloride as a white solid. LCMS (method C, ESI): RT=0.49 min, m/z=254.2 [Mβˆ’HCl+H]+.

Step 3:Synthesis of tert-butyl 1-((2S,4R)-4-(5-ethyl-1,2-thiazol-3-carboxamido)-2-methylpiperidin-1-ylsulfonyl)piperidin-4-ylcarbamate

Into a 25-mL round-bottom flask was placed 5-ethyl-N-[(2S,4R)-2-methylpiperidin-4-yl]-1,2-thiazole-3-carboxamide hydrochloride (70 mg, 0.24 mmol, 1.00 equiv) and dichloromethane (10 mL). TEA (120 mg) was added dropwise at 0Β° C. test-Butyl N-[1-(chlorosulfonyl)piperidin-4-yl]carbamate (350 mg, 1.17 mmol, 4.85 equiv) was then added in several portions. The resulting solution was stirred for 2 h at room temperature. The mixture was then concentrated under vacuum. The residue was chromatographed on a silica gel column with ethyl acetatelpetroleum ether (1/1). This resulted in 70 mg (56%) of tert-butyl N-[1-[(2S,4R)-4-(5-ethyl-1,2-thiazole-3-carboxamido)-2-methylpiperidine-1-sulfonyl]piperidin-4-yl]carbamate as a yellow solid. LCMS (method C, ESI): RT 1.54 min, m/z=538.2 [M+Na]+.

Step 4:Synthesis of N-((2S,4S)-1-(4-aminopiperidin-1-ylsulfonyl)-2-methylpiperidin-4-yl)-5-ethyl-1,2-thiazole-3-carboxamide

Into a 25-mL round-bottom flask was placed tert-butyl N-[1-[(2S,4R)-4-(5-ethyl-1,2-thiazole-3-carboxamido)-2-methylpiperidine-1-sulfonyl]piperidin-4-yl]carbamate (70 mg, 0.14 mmol, 1.00 equiv) and dichloromethane (10 mL). To the above hydrogen chloride (gas) was introduced. The resulting solution was stirred for 1 h at room temperature. The mixture was then concentrated under vacuum. The crude product was purified by Prep-HPLC with the following conditions: Column: X Bridge RP, 19*150 mm, 5 um; Mobile Phase A:Water/0.05% NH4HCO3, Mobile Phase B: ACN; Flow rate: 30 mL/min; Gradient: 25% B to 45% B in 8 min; 254 nm. This resulted in 13.8 mg (24%) of N-[(2S,4R)-1-(4-aminopiperidine-1-sulfonyl)-2-methylpiperidin-4-yl]-5-ethyl-1,2-thiazole-3-carboxamide as a white solid. 1H NMR (400 MHz, CD3OD) Ξ΄: 7.57 (s, 1H), 4.40-4.25 (m, 1H), 4.25-4.15 (m, 1H), 3.67-3.62 (m, 3H), 3.30-3.15 (m, 1H), 3.06-3.00 (m, 2H), 2.89-2.79 (m, 3H), 1.98-1.85 (m, 5H), 1.80-1.58 (m, 2H), 1.51-1.40 (m, 1H), 1.40-1.36 (m, 6H) ppm. LCMS (method A, ESI): RT=1.68 min, m/z=438.1 [M+Na]+.

Example 21

Synthesis of N-((2S,4S)-1-(4-acetamidophenylsulfonyl)-2-methylpiperidin-4-yl)-2-oxoindoline-5-carboxamide (Cpd. No. 632)

Step 1:Synthesis of (2S)-tert-butyl 4-amino-2-methylpiperidine-1-carboxylate

Into a 1-L round-bottom flask was placed methanol (600 mL), HCOONH4 (32 g, 507.45 mmol, 36.08 equiv) and tert-butyl (2S)-2-methyl-4-oxopiperidine-1-carboxylate (3 g 14.07 mmol, 1.00 equiv). NaCNBH3 (1.7 g, 27.05 mmol, 1.92 equiv) was added batchwise slowly at 0-5Β° C. The resulting solution was stirred for 16 hours at 25Β° C. The reaction mixture was then diluted with 250 mL of ethyl acetate ane: washed with 3Γ—250 mL of brine. The organic layer was dried over anhydrous sodium sulfate and concentrated under vacuum. This resulted in 2.5 g (83%) of tert-butyl (2S)-4-amino-2-methylpiperidine-1-carboxylate as colorless oil. 1H-NMR (400 MHz, CDCl3) Ξ΄: 4.13-4.11 (m, 1H), 3.98-3.97 (m, 1H), 3.49-3.28 (m, 2H), 2.24-2.10 (m, 2H), 1.76-1.75 (m, 2H), 1.45 (s, 9H), 1.27 (d, J=6.0 Hz, 3H) ppm. LCMS (method D, ESI): RT=1.04 min, m/z=215.0 [M+H]+.

Step 2:Synthesis of (2S)-tert-butyl 4-(benzyloxycarbonylamino)-2-methylpiperidine-1-carboxylate

Into a 250-mL round-bottom flask was placed water (50 mL), tetrahydrofuran (50 mL), sodium carbonate (3.7 g, 34.91 mmol, 2.99 equiv), and tert-butyl (2S)-4-amino-2-methylpiperidine-1-carboxylate (2.5 g, 11.67 mmol, 1.00 equiv). Then benzyl chloroformate (4 g, 23.45 mmol, 2.01 equiv) was added dropwise at 0-5Β° C. The resulting solution was stirred for 16 hours at 25Β° C. The resulting mixture was concentrated under vacuum. The residue was diluted with 100 mL of ethyl acetate and washed with 3Γ—100 mL of brine. The organic layer was dried over anhydrous sodium sulfate and concentrated under vacuum. The residue was chromatographed on a silica gel column with ethyl acetate/petroleum ether (1/1). This resulted in 2 g (49%) of tert-butyl (2S)-4-[[(benzyloxy)carbonyl]amino]-2-methylpiperidine-1-carboxylate as colorless oil. 1H-NMR (300 MHz, CD3OD) Ξ΄: 7.36-7.30 (m, 5H), 5.09 (s, 2H), 4.10-4.08 (m, 1H), 3.76-3.70 (m, 2H), 3.27-3.17 (m, 1H), 1.97-1.78 (m, 3H), 1.62-1.55 (m, 1H), 1.41(s, 9H), 1.25 (d, J=8.0 Hz, 3H) ppm. LCMS (method D, ESI): RT=1.57 min, m/z=349.3 [M+H]+.

Step 3:Synthesis of Benzyl (2S)-2-methylpiperidin-4-ylcarbamate

Into a 25-mL round-bottom flask was placed tert-butyl (2S)-4-[[(benzyloxy)carbonyl]amino]-2-methylpiperidine-1-carboxylate (400 mg, 1.15 mmol, 1.00 equiv) and dichloromethane (6 mL). Trifluoroacetic acid (3 mL) was then added dropwise at 0-5Β° C. The resulting solution was stirred for 30 min at 25Β° C. The mixture was concentrated under vacuum which resulted in 300 mg (crude) of benzyl N-[(2S)-2-methylpiperidin-4-yl]carbamate as a yellow liquid. LCMS (method A, ESI): RT=1.07 min, m/z=249.1 [M+H]+.

Step 4:Synthesis of benzyl (2S)-1-(4-acetamidophenylsulfonyl)-2-methylpiperidin-4-ylcarbamate

Into a 50-mL round-bottom flask was placed benzyl N-[(2S)-2-methylpiperidin-4-yl]carbamate (300 mg, 1.21 mmol, 1.00 equiv) and triethylamine (600 mg, 5.93 mmol, 4.00 equiv) in dichloromethane (30 mL). This was followed by the addition of 4-acetamidobenzene-1-sulfonyl chloride (720 mg, 3.08 mmol, 2.00 equiv) dropwise with stirring at 0Β° C. The resulting solution was stirred for 16 hours at 25Β° C. The mixture was then concentrated under vacuum. The residue was chromatographed on a silica gel column with ethyl acetate/petroleum ether (2/1). This resulted in 300 mg (56%) of benzyl N-[(2S)-1-[(4-acetamidobenzene)sulfonyl]-2-methylpiperidin-4-yl]carbamate as a yellow solid. LCMS (method D, ESI): RT=1.40 min, m/z=446.2 [M+H]+.

Step 5:Synthesis of N-(4-((2S)-4-amino-2-methylpiperidin-1-ylsulfonyl) phenyl)acetamide

Into a 50-mL round-bottom flask was placed benzyl N-[(2S)-1-[(4-acetamidobenzene)sulfonyl]-2-methylpiperidin-4-yl]carbamate (300 mg, 0.67 mmol, 1.00 equiv) and trifluoroacetic acid (10 mL). The resulting solution was stirred for 1 hour at 60Β° C. In an oil bath. The mixture was then concentrated under vacuum. This resulted in 280 mg (crude) of N-[4-[(2S)-4-amino-2-methylpiperidine-1-sulfonyl]phenyl]acetamide as yellow oil. LCMS (method D, ESI): RT=0.96 min, m/z=312.2 [M+H]+.

Step 6:Synthesis of N-(4-((2S,4S)-4-amino-2-methylpiperidin-1-ylsulfonyl)phenyl)acetamide and N-(4-(((2S,4R)-4-amino-2-methylpiperidin-1-yl)sulfonyl)phenyl)acetamide

N-[4-[(2S)-4-amino-2-methylpiperidine-1-sulfonyl]phenyl]acetamide (200 mg, 0.64 mmol, 1.00 equiv) was separated by Prep-SFC with the following conditions: Column, Lux 5u Cellulose-44.6*150 mm, 5 um Chiral-A(LUX-4); mobile phase, 25% IPA with MeOH; Detector, UV 254/220 nm. This resulted in 100 mg (100%) of N-[4-[(2S,4S)-4-amino-2-methylpiperidine-1-sulfonyl]phenyl]acetamide as a yellow solid and 40 mg (98%) of N-[4-[(2S,4R)-4-amino-2-methylpiperidine-1-sulfonyl]phenyl]acetamide as a yellow solid. ee value: 100%.

Step 7:Synthesis of N-((2S,4S)-1-(4-acetamidophenylsulfonyl)-2-methylpiperidin-4-yl)-2-oxoindoline-5-carboxamide

Into a 10-mL round-bottom flask was placed 2-oxo-2,3-dihydro-1H-indole-5-carboxylic acid (48 mg, 0.27 mmol, 2.00 equiv), 1-hydroxybenzotriazole (40 mg, 1.26 mmol, 2.00 equiv), triethylamine (50 mg, 0.49 mmol, 4.00 equiv), N-[4-[(2S,4S)-4-amino-2-methylpiperidine-1-sulfonyl]phenyl]acetamide (40 mg, 0.13 mmol, 1.00 equiv), and dichloromethane (4 mL). N-(3-dimethylaminopropyl)-Nβ€²-ethylcarbodiimide hydrochloride (56 mg, 0.29 mmol, 2.00 equiv) was added batchwise at 0-5Β° C. The resulting solution was stirred for 16 hours at 25Β° C. The mixture was then washed with 3Γ—5 mL of brine and the organic layer concentrated under vacuum. The crude product was purified by Prep-HPLC with the following conditions (2#-Waters 2767-2(HRLC-08)): Column, Xbridge Shield RP 18, 5 um, 19*150 mm; mobile phase, water with 50 mmol NH4HCO3 and CH3CN (10.0% CH3CN up to 28.0% in 2 min, up to 46.0% in 10 min,up to 100.0% in 1 min, down to 10.0% in 1 min); Detector, UV 254 nm. This resulted in 2.6 mg (4%) of N-[(2S,4S)-1-[(4-acetamidobenzene)sulfonyl]-2-methylpiperidin-4-yl]-2-oxo-2,3-dihydro-1H-indole-5-carboxamide as a white solid. 1H-NMR (400 MHz, CD3OD) Ξ΄: 7.84-7.78 (m, 4H), 7.74-7.71 (m, 2H), 6.95 (d, J=8.0 Hz, 1H), 3.95-3.90 (m, 2H), 3.62-3.51(m, 1H), 3.33-3.32 (m, 2H), 3.15-3.04 (m, 1H), 2.19 (s, 3H), 2.06-1.98 (m, 1H), 1.93-1.88 (m, 1H), 1.73-1.68 (m, 2H), 1.40 (d, J=8.0 Hz, 3H) ppm. LCMS (method D, ESI): RT=2.62 min, m/z=471.2 [M+H]+.

Example 22

Synthesis of N-[(1R,3r,5S)-8-(4-aminopiperidine-1-stilfonyl)-8-azabieyclo[3.2.1]octan-3-yl]-5-ethylpyridazine-3-carboxamide trifluoroacetate (Cpd. No. 616)

Step 1:Synthesis of 3-chloro-5-ethylpyridazine

Into a 50-mL round-bottom flask was placed 5-ethyl-2,3-dihydropyridazin-3-one (100 mg, 0.81 mmol, 1.00 equiv) and POCl3 (5 mL). The resulting solution was stirred for 2 hours at 80Β° C. In an oil bath. The mixture was then concentrated under vacuum. The residue was extracted with 1Γ—100 mL, of dichloromethane and the organic layer washed with 50 mL of sodium bicarbonate (aq. sat.) and brine. The organic layer was dried over anhydrous sodium sulfate and concentrated under vacuum. The residue was chromatographed on a silica gel column with ethyl acetatelpetroleum ether (30:100). This resulted in 80 mg (69%) of 3-chloro-54-ethylpyridazine as yellow oil. TLC, Rf=0.2 (PE:EA=10:1).

Step 2:Synthesis of methyl 5-ethylpyridazine-3-carboxylate

Into a 30-mL, pressure tank reactor (100 mL) was placed 3-chloro-5-ethylpyridazine (80 mg, 0.55 mmol, 1.00 equiv), methanol (10 mL), triethylamine (112 mg, 1.11 mmol, 2.02 equiv), and Pd(dppf)Cl2 (148 mg). To the above CO (gas) was introduced and maintained at 30 atm. The resulting solution was stirred for 15 h at 80Β° C. The solids were tittered out. The filtrate was extracted with 2Γ—100 mL of ethyl acetate and the organic layers combined, washed with 50 mL of brine, dried over anhydrous sodium sulfate and concentrated under vacuum. The residue was chromatographed on a silica gel column with ethyl acetate/petroleum ether (30:100). This resulted in 80 mg (86%) of methyl 5-ethylpyridazine-3-carboxylate as yellow oil. LCMS (method C, ESI): RT=0.78 min, m/z=167.0 [M+H]+.

Step 3:Synthesis of 5-ethylpyridazine-3-carboxylic acid

Into a 10-mL round-bottom flask was placed methyl 5-ethylpyridazine-3-carboxylate 80 mg, 0.48 mmol, 1.00 equiv) and C2H5OH (5 mL). This was followed by the addition of a solution of LiOH.H2O (100 mg, 2.4 mmol, 5.00 equiv) in water (1 mL) which was added dropwise with stirring at 0Β° C. The resulting solution was stirred for 3 hour at 20Β° C. The reaction was then quenched by the addition of 50 mL of water. The pH was adjusted to 5 with hydrochloric acid (6N). The mixture was extracted with 2Γ—100 mL of dichloromethane and the combined organic layers dried over anhydrous sodium sulfate and concentrated under vacuum. This resulted in 60 mg (34.7%) of 5-ethylpyridazine-3-carboxylic acid as black oil. LCMS (method D, ESI): RT=0.90 min, m/z=153.0 [M+H]+.

Step 4:Synthesis of tert-butyl N-[1-[(1R,3r,5S)-3-(5-ethylpyridazine-3-carboxamido)-8-azabicyclo[3.2.1]octane-8-sulfonyl]piperidin-4-yl]carbamate

Into a 50-mL round-bottom flask purged and maintained with an inert atmosphere of nitrogen was placed dichloromethane 20 mL) and 5-ethylpyridazine-3-carboxylic acid. (60 mg, 0.39 mmol, 1.00 equiv). To the above was added tert-butyl N-[1-[(1R,3r,5S)-3-amino-8-azabicyclo[3.2.1]octane-8-sulfonyl]piperidin-4-yl]carbamate (150 mg, 0.39 mmol, 0.98 equiv), HOBT (79 mg, 0.58 mmol, 1.49 equiv)), and EDCI (223 mg, 1.17 mmol, 2.99 equiv). This was followed by the addition of a solution of triethylamine (118 mg, 1.17 mmol, 2.99 equiv) in dichloromethane (2 ml) which was added dropwise with stirring at 0Β° C. over 3 min. The resulting solution was stirred for 15 hours at 20Β° C. The mixture was extracted with 2Γ—100 mL of dichloromethane and the organic layers combined, washed with 50 mL, of water and 50 mL of brine, and concentrated under vacuum. The residue was chromatographed on a silica gel column with ethyl acetate/petroleum ether (50:100). This resulted in 50 mg (24%) of tert-butyl N-[1-[(1R,3r,5S)-3-(5-ethylpyridazine-3-carboxamido)-8-azabicyclo[3.2.1.]octane-8-sulfonyl]piperidin-4-yl]carbamate as yellow oil. LCMS (method D, ESI): RT=1.46 min, m/z=523.0 [M+H]+.

Step 5:Synthesis of N-[(1R,3r,5S)-8-(4-aminopiperidine-1-sulfonyl)-8-azabicyclo[3.2.1]octan-3-yl]-5-ethylpyridazine-3-carboxamide trifluoroacetate

Into a 25-mL round-bottom flask was placed tert-butyl N-[1-[(1R,3r,5S)-3-(5-ethylpyridazine-3-carboxamido)-8-azabicyclo[3.2.1]octane-8-sulfonyl]piperidin-4-yl]carbamate (50 mg, 0.10 mmol, 1.00 equiv) and hydrogen chloride/dioxane (10 mL, saturated, this solution was made by introducing hydrogen chloride gas into 1,4-dioxane under 0Β° C. for 6 hours). The resulting solution was stirred for 4 h at 20Β° C. The mixture was then concentrated under vacuum. The crude product was purified by Prep-HPLC with the following conditions: Column: X Select C18, 19*250 mm, 5 um; Mobile Phase A: Water/0.05% TFA, Mobile Phase B: ACN, Flow rate: 30 mL/min; Gradient: 12% B to 52% B in 11.5 min, 254 nm. This resulted in 17.9 mg (35%) of N-[(1R,3r,5S)-8-4-aminopiperidine-1-sulfonyl)-8-azabicyclo[3.2.1]octan-3-yl]-5-ethylpyridazine-3-carboxamide trifluoroacetate as a yellow solid. 1H NMR (300 MHz, CD3OD) Ξ΄: 9.29 (s, 1H), 8.19 (s, 1H), 4.37-4.28 (m, 1H), 4.21-4.11 (s, 2H), 3.86 (d, J=15.0 Hz, 2H), 3.30-3,20 (m, 1H), 2.99-2.80 (m, 4H), 2.45-2.30 (m, 2H), 2.18-2.00 (m, 8H), 1.79-1.61 (m, 2H), 1.40-1.29 (m, 3H) ppm. LCMS (method D, ESI): RT=1.27 min, m/z=423.2 [M+H]+.

Example 23

Synthesis of 2-oxo-N-[1-[(piperidin-4-ylmethane)sulfonyl]piperidin-4-yl]-2,3-dihydro-1H-indole-5-carboxamide trifluoroacetate (Cpd. No. 620)

Step 1: Synthesis of 2-oxo-2,3-dihydro-1H-indole-5-carboxylic acid

Into a 50-mL round-bottom flask was placed methyl 2-oxo-2,3-dihydro-1H-indole-5-carboxylate (800 mg, 4.18 mmol, 1.00 equiv) and methanol (10 mL). This was followed by the addition of a solution of NaOH (670 mg, 16.75 mmol, 4.00 equiv) water (10 mL) dropwise with stirring at 0Β° C. The resulting solution was stirred for 14 h at 20Β° C. The mixture was then concentrated under vacuum and the residue taken up in 20 mL of H2O. This was washed with 2Γ—5 mL, of dichloromethane. The pH was adjusted to 4 with hydrochloric acid (1 N) and extracted with 5Γ—50 mL of ethyl acetate and the organic layers combined. Concentration resulted in 592 mg (80%) of 2-oxo-2,3-dihydro-1H-indole-5-carboxylic acid as a yellow solid. 1H NMR (400 MHz, DMSO) Ξ΄: 12.5 (brs, 1H), 10.7 (s, 1H), 7.82 (d, J=8.4 Hz, 1H), 7.76 (s, 1H), 6.88 (d, 1H), 3.54 (s, 2H) ppm. LCMS (method A, ESI): RT=0.97 min, m/z=178.0 [M+H]+.

Step 2:Synthesis of tert-butyl 4-(2-oxo-2,3-dihydro-1H-indole-5-carboxamido)piperidine-1-carboxylate

Into a 25-mL round-bottom flask was placed tert-butyl 4-aminopiperidine-1-carboxylate (300 mg, 1.50 mmol, 1.00 equiv), dichloromethane (10 mL), 2-oxo-2,3-dihydro-1H-indole-5-carboxylic acid (319 mg, 1.80 mmol, 1.20 equiv), EDCI (344 mg, 1.79 mmol, 1.20 equiv), and HOBT (304 mg, 2.25 mmol, 1.50 equiv). This was followed by the addition of TEA (454 mg, 4.49 mmol, 3.00 equiv) dropwise with stirring at 0Β° C. The resulting solution was stirred for 14 h at 20Β° C. The solids were collected by filtration. This resulted in 393 mg (73%) of tert-butyl 4-(2-oxo-2,3-dihydro-1H-indole-5-amido)piperidine-1-carboxylate as a yellow solid. LCMS (method C, ESI): RT=0.78 min, m/z=304.0 [M+Hβˆ’56]+.

Step 3:Synthesis of 2-oxo-N-(piperidin-4-yl)-2,3-dihydro-1H-indole-5-carboxamide hydrochloride

Into a 25-mL round-bottom flask was placed tert-butyl 4-(2-oxo-2,3-dihydro-1H-indole-5-carboxamido)piperidine-1-carboxylate (250 mg, 0.70 mmol, 1.00 equiv) and hydrogen chloride/dioxane (3 mL, saturated, this solution was made by introducing hydrogen chloride gas into 1,4-dioxane under 0Β° C. for 6 hours). The resulting solution was stirred for 2 h at 20Β° C. The mixture was then concentrated under vacuum. This resulted in 200 mg (97%) of 2-oxo-N-(piperidin-4-yl)-2,3-dilaydro-1H-indole-5-carboxamide hydrochloride as a light yellow solid. 1H NMR (400 MHz, D2O) Ξ΄: 7.65 (s, 2H), 6.95(s, 1H), 4.04 (t, J=10.4 Hz, 1H), 3.54 (s, 2H), 3.42 (d, J=13.2 Hz, 2H), 3.12-3.01 (m, 2H), 2.13 (d, J=14.0 Hz, 2H), 1.81-1.65 (m, 2H) ppm. LCMS (method A, ESI): RT=0.89 min, m/z=260.0 [M+H]+.

Step 4:Synthesis of benzyl 4-[[4-(2-oxo-2,3-dihydro-1H-indole-5-carboxamido)piperidine-1-sulfonyl]methyl]piperidine-1-carboxylate

Into a 50-mL round-bottom flask was placed 2-oxo-N-(piperidin-4-yl)-2,3-dihydro-1H-indole-5-carboxamide hydrochloride (80 mg, 0.27 mmol, 1.00 equiv) and NMP (16 mL). This was followed by the addition of TEA (82 mg, 0.81 mmol, 3.00 equiv) dropwise with stirring at 0Β° C. To this was then added benzyl 4-[(chlorosulfonyl)methyl]piperidine-1-carboxylate (135 mg, 0.41 mmol, 1.50 equiv) in several batches at 0Β° C. The resulting solution was stirred for 2 h at 20Β° C. The mixture was concentrated under vacuum. The residue was chromatographed on a silica gel column with dichloromethane/methanol (50:1-20:1). The collected fractions were combined and concentrated under vacuum. This resulted in 100 mg (67%) of benzyl 4-[[4-(2-oxo-2,3-dihydro-1H-indole-5-carboxamido)piperidine-1-sulfonyl]methyl]piperidine-1-carboxylate as a yellow solid. LCMS (method C, ESI): RT=1.04 min,m/z=555.0 [M+H]+.

Step 5:Synthesis of 2-oxo-N-[1-[(piperidin-4-ylmethane)sulfonyl]piperidin-4-yl]-2,3-dihydro-1H-indole-5-carboxamide trifluoroacetate

Into a 25-mL round-bottom flask was placed benzyl 4-[[4-(2-oxo-2,3-dihydro-1H-indole-5-carboxamido)piperidine-1-sulfonyl]methyl]piperidine-1-carboxylate (80 mg, 0.14 mmol, 1.00 equiv) and hydrochloric acid (12 N, 5 mL). The resulting solution was stirred for 2 h at 20Β° C. The mixture was then concentrated under vacuum. The crude product was purified by Prep-HPLC with the following conditions: Column: X Bridge C18, 19*150 mm, 5 um; Mobile Phase A: Water/0.05% TFA, Mobile Phase B: ACN; Flow rate: 30 mL/min; Gradient: 15% B to 43% B in 10 min; Detector: 254 nm. This resulted in 13.2 mg (17%) of 2-oxo-N-[1-[(piperidin-4-ylmethane)sulfonyl]piperidin-4-yl]-2,3-dihydro-1H-indole-5-carboxamide trifluoroacetate as a white solid. 1H NMR (400 MHz, D2O) Ξ΄: 7.61 (s, 2H), 7.00 (d, J=4.4 Hz, 1H), 4.00-3.90 (m, 1H), 3.75-3.66 (m, 2H), 3.60 (s, 2H), 3.43-3.37 (m, 2H), 3.15 (d, J=6.4 Hz, 2H), 3.05-2.92 (m, 4H), 2.31-2.18 (m, 1H), 2.15-1.97 (m, 4H), 1.69-1.50 (m, 4H) ppm. LCMS (method A, ESI): RT=1.03 min, m/z=421.1 [M+H]+.

Example 24

Synthesis of N-(azetidin-3-yl)-1-cyclopropyl-1H-1,2,3-triazole-4-carboxamide

Step 1:Synthesis of Ethyl 2-diazo-3-oxopropanoate

Oxalyl chloride (87.9 g, 693 mmol) was added to a cold solution of N,N-dimethylformamide (42.3 g, 578 mmol) in CHCl3 (150 mL) and the reaction was stirred at room temperature for 30 min, followed by heating at 40Β° C. for a further 1 h. After chilling the reaction to βˆ’10Β° C., ethyl 2-diazoacetate (63.0 g, 552 mmol) was added and the mixture was stirred at room temperature for 2 h. The mixture was then concentrated and the residue was diluted with ether(200 mL), the solid was collected by filtration and dissolved in 10% aq. HOAc(200 mL), then sitrred for a further 1 h. The resulting mixture was extracted with ethyl acetate (300 mLΓ—3) and the organic was washed with saturated Na2CO3 aq.(300 mL) and brine (300 mL), dried over Na2SO4, filtered and concentrated to give crude ethyl 2-diazo-3-oxopropanoate (27 g, 32.8%) as red oil, which was used for next step without further purification. 1H-NMR (400 MHz, CD3OD) Ξ΄ ppm: 9.67 (s, 1H), 4.33 (q, J=7.2 Hz, 2H), 1.32 (t, J=7.2, 3H).

Step 2:Synthesis of ethyl 1-cyclopropyl-1H-1,2,3-triazole-4-carboxylate

To a solution of ethyl 2-diazo-3-oxopropanoate (27 g, 189 mmol) in EtOH (100 mL) was added acetic acid (28.3 g, 472 mmol). Cyclopropanamine (10.7 g, 189 mmol) was added slowly and the mixture was stirred at room temperature overnight. The solvent was removed and saturated Na2CO3 aq was added to the residue to bring the pH to 8. The mixture was extracted with ethyl acetate (200 mLΓ—3), washed with brine(100 mL), dried over Na2SO4, filtered and concentrated. The resulting residue was purified by flash chromatography (PE:EA-2:1) to give crude ethyl 1-cyclopropyl-1H-1,2,3-triazole-4-carboxylate (18.5 g, 54.0%) as yellow oil. ES:LCMS (m/z): 182.2 [M+H]+.

Step 3:Synthesis of 1-cyclopropyl-1H-1,2,3-triazole-4-carboxylic acid

To a solution of ethyl 1-cyclopropyl-1H-1,2,3-triazole-4-carboxylate (18.5 g, 102 mmol) in THF (80 mL)/H2O (40 mL) was added lithium hydroxide hydrate (4.5 g, 107 mmol), the resulting mixture was stirred at room temperature for 3 hr. The solvent was removed and the residue was dissolved in H2O (50 mL), extracted with EA (100 mL). The organic phase was discarded and the water phase was acidified with 2N HCl until the pH=5, The aqueous solution was extracted with DCM:MeOH=10:1 (1.5 L). The organic layer was dried and concentrated to afford 6.3 g of 1-cyclopropyl-1H-1,2,3-triazole-4-carboxylic acid as white solid. The aqueous layer was concentrated to afford another 11.4 g crude product, which was used for next step without further purification. ESI-LCMS (m/z): 154.1 [M+H]+.

Step 4:Synthesis of tert-butyl 3-(1-cyclopropyl-1H-1, 2, 3-triazole-4-carboxamido)azetidine-1-carboxylate

A solution of 1-cyclopropyl-1H-1,2,3-triazole-4-carboxylic acid (2 g, 13.0 mmol) in thionyl chloride (10 mL) was stirred at 65Β° C. for 2 h. The reaction mixture was concentrated under reduced pressure. Then the reaction residue was diluted with DMF (5 mL) and added dropwise to the solution of tert-butyl 3-aminoazetidine-1-carboxylate (2.23 g, 13.0 mmol) and DIPEA (4.19 g, 32.5 mmol) in DCM (15 mL) under 0Β° C. The resulting mixture was stirred at room temperature overnight. The solvent was removed and the residue was diluted with ethyl acetate (200 mL), washed with water (10 mLΓ—3) and brine (50 mL), dried over Na2SO4, filtered and concentrated. The resulting residue was purified by Flash chromatography (DCM: NH3 in MeOH(7N)=100:0˜50:1) to give tert-butyl 3-(1-cyclopropyl-1H-1,2,3-triazole-4-carboxamido)azetidine-1-carboxylate (3 g, 75.1%) as a yellow solid. ESI-LCMS (m/z): 252.2 [Mβˆ’55]+.

Step 5:Synthesis of N-(Azetidin-3-yl)-1-cyclopropyl-1H-1,2,3-triazole-4-carboxamide

A solution of tert-butyl 3-(1-cyclopropyl-1H-1,2,3-triazole-4-carboxamido)azetidine-1-carboxylate (3.0 g, 9.8 mmol) in HCl/MeOH (20 mL) was stirred at 50° C. for 2 h. After completion, the solvent was removed in vacuo. The residue was dissolved in NH3/MeOH (7 mol/L, 20 mL) and stirred for 30 min. The solvent was removed and the residue was purified by Flash chromatography (DCM: NH3 in MeOH(7N)=100:0˜30:1˜15:1) to give N-(azetidin-3-yl)-1-cyclopropyl-1H-1,2,3-triazole-4-carboxamide (1.6 g, 80%) as a white solid. ESI-LCMS (m/z): 208.1 [M+H]+. 1H-NMR (400 MHz, CD3OD) δ ppm: 8.38 (s, 1H), 4.92-4.86 (m, 1H), 3.98-3.97 (m, 1H), 3.82-3.72 (m, 4H), 1.26-1.20 (m, 4H),

Example 25

Synthesis of 5-cyclopropylpyridazine-3-carboxylic acid

Step 1:Synthesis of 5-cyclopropylpyridazin-3-ol

To a solution of 5-chloropyridazin-3-ol (1.0 g, 7.7 mmol) in toluene/H2O (100: 5, 50 mL) was added sequentially cyclopropylboronic acid (987 mg, 11.5 mmol), K3PO4 (4.51 g, 23.0 mmol), diacetoxypalladium (86.2 mg, 384 ΞΌmol) and tricyclohexylphosphine (107 mg, 384 ΞΌmol). The reaction mixture was stirred at 100Β° C. under N2 atmosphere for 20 h. then concentrated in vacuum to remove the solvent Water (20 mL) was added and the solution was acidified with hydrochloric acid (4 M) to pH=3. The solution was extracted with EtOAc (200 mLΓ—3) and the combined organic layer were washed with saturated NaCl solution, dried over Na2SO4, concentrated to give a brown residue then purified by silica chromatography (PE: EA=1:1) to afford the desired product (350 mg, 34% yield) as white solid. ESI-LCMS (m/z): 137.1 [M+1]+.

Step 2:Synthesis of 3-chloro-5-cyclopropylpyridazine

A solution of 5-cyclopropylpyridazin-3-ol (350 mg, 2.6 mmol) in phosphorus oxychloride (10 mL) was stirred at 80Β° C. for 2 h. The remaining POCl3 was removed under vacuum then the residue was cooled and added to 20 g of ice. The reaction mixture was neutralized with saturated NaHCO3 solution and extracted with EtOAc (40 mLΓ—3), the combined organic extract is washed with brine (100 mLΓ—2), dried over Na2SO4 and the solvent is removed under vacuum, the resulting residue was purified by silica-gel chromatography (PE: EA=2:1) to afford the product 3-chloro-5-cyclopropylpyridazine as a colorless oil (200 mg, 50% yield). ESI-LCMS (m/z): 155.2 [M+1]+.

Step 3:Synthesis of ethyl 5-cyclopropylpyridazine-3-carboxylate

Potassium acetate (284 mg, 2.9 mmol) was added to a solution of 3-chloro-5-cyclopropylpyridazine (150 mg, 1.0 mmol) in ethanol (10 mL). The mixture was degassed, then Pd(dppf)Cl2 (35.4 mg, 0.05 mmol) was added. The resulting mixture was heated under an atmosphere of CO at 70Β° C. for 20 hr. The reaction mixture was filtrated and the filtrate was concentrated under reduced pressure. The residue was purified by column chromatography (PE:EA=1:1) to obtain the desired product ethyl 5-cyclopropylpyridazine-3-carboxylate (100 mg, 54% yield, colorless oil). ESI-LCMS (m/z): 193.1 [M+H]+; 1HNMR (400 MHz, CD3OD) Ξ΄ ppm: 9.06 (d, J=2.4 Hz, 1H), 7.81 (d, J=2.4 Hz, 1H), 7.39 (q, J=6.8 Hz, 2H), 2.11-1.92 (m, 1H), 1.34 (t, J=6.8 Hz, 3H), 0.96-0.93 (m, 2H).

Step 4:Synthesis of 5-cyclopropylpyridazine-3-carboxylic acid

To a solution of methyl 5-cyclopropylpyridazine-3-carboxylate (185 mg, 1.03 mmol) in THF/H2O (8 mL/2 mL) was added lithium hydroxide hydrate (64.6 mg, 1.54 mmol). The reaction mixture was stirred at room temperature for 3h. Progress of the reaction was monitored by TLC and LCMS. After completion, the mixture was adjusted to pH=5 with 1N HCl, then concentrated directly to 5-cyclopropylpyridazine-3-carboxylic acid (170 mg, 94.6%) as yellow solid and used in next step directly. ESI-LCMS (m/z): 165 [M+1]+.

Example 26

Synthesis of 2-(3-(1-(3-Aminoazetidin-1-yl)ethyl)-2-chlorophenoxy)ethan-1-ol

Step 1:Synthesis of 1-(2-chloro-3-methoxyphenyl)ethanol

A mixture of 2-chloro-3-methoxybenzaldehyde (2.38 g, 14 mmol) in THF (50 mL) was stirred at 0Β° C., and a solution of methylmagnesium bromide (5.6 mL, 16.7 mmol, 3M) in ether was added. The resulting mixture was stirred overnight. The reaction mixture was diluted with 1 N HCl (50 mL) and extracted with ethyl acetate (50 mLΓ—3), the combined organic phase was washed with brine, dried over sodium sulfate and. concentrated to afford 1-(2-chloro-3-methoxyphenyl)ethanol (2.60 g 99.6%) as a yellow oil. 1HNMR (400 MHz, CD3OD) Ξ΄ ppm: 7.49 (d, J=8.4 Hz, 1H), 6.90-6.85 (m, 2H), 5.25 (q, J=6.4, 12.8 Hz, 1 H), 3.81 (s, 3H), 1.48 (d, J=6.4 Hz, 3H).

Step 2:Synthesis of 1-(2-chloro-3-methoxyphenyl)ethanone

A mixture of 1-(2-chloro-3-methoxyphenyl)ethanol (2.0 g. 10.7 mmol) and manganese(IV) oxide (4.65 g, 53.5 mmol) in DCM (50 mL) was heated to 40Β° C. and stirred overnight. The reaction mixture was filtered through Celite and the filtrate was concentrated to afford 1-(2-chloro-3-methoxyphenyl)ethanone (1.83 g, 89.8%) as a yellow oil. ESI-LCMS (m/z): 185.0 [M+1]+.

Step 3:Synthesis of 1-(2-chloro-3-hydroxyphenyl)ethanone

A mixture of 1-(2-chloro-3-methoxyphenyl)ethanone (540 mmol, 2.92 mmol) and aluminum trichloride (972 mg, 7.29 mmol) in monochlorobenzene (10 mL) was stirred at 120Β° C. for 2 hrs. After cooling to rt, the reaction mixture was added dropwise into 1N HCl in a water bath and the mixture was extracted with ethyl acetate (20 mLΓ—3). The combined organic phase was washed with brine, dried over sodium sulfate and concentrated. The residue was purified by chromatography (PE:EA=5:1) to afford 1-(2-chloro-3-hydroxyphenyl)ethanone (400 mg, 80.3%) as a yellow solid ESI-LCMS (m/z): 171.0[M+H]+.

Step 4:Synthesis of 1-(2-chloro-3-(2-hydroxyethoxy)phenyl)ethanone

A mixture of 1-(2-chloro-3-hydroxyphenyl)ethanone (330 mg, 1.93 mmol), 2-bromoethanol (482 mg, 3.86 mmol) and K2CO3 (800 mg, 5.79 mmol) in DMF (10 mL) was heated to 80Β° C. overnight. Water was added and the mixture was extracted with ethyl acetate (30 mLΓ—3), the combined organic phase was washed with brine, dried over sodium sulfate and concentrated. The residue was purified by chromatography (DCM: McOH=50:1) to afford 1-(2-chloro-3-(2-hydroxyethoxy)phenyl)ethanone (400 mg, 79.2%) as a yellow oil. ESI-LCMS (m/z): 251.1 [M+H]+.

Step 5:Synthesis of tert-butyl 1-(1-(2-chloro-3-)2-hydroxyethoxy)phenyl)ethyl)azetidin-3-ylcarbamate

A mixture of 1-(2-chloro-3-(2-hydroxyethoxy)phenyl)ethanone (214 mg, 1 mmol), tert-butyl azetidin-3-ylcarbamate (206 mg, 1.20 mmol), acetic acid (120 mg, 2.00 mmol) and NaBH3CN (125 mg, 2.00 mmol) in MeOH (10 ml) was stirred at 70Β° C. overnight. The reaction mixture was concentrated and adjusted pH=8-9 with a saturated solution of Na2CO3. The resulting mixture was extracted with DCM (30 mLΓ—3) and the combined organic phase was washed with brine, dried over sodium sulfate and concentrated. The residue was purified by prep-TLC (DCM: MeOH=20:1) to afford tert-butyl (1-(1-(2-chloro-3-(2-hydroxyethoxy)phenyl)ethyl)azetidin-3-yl) carbamate (220 mg, 52.7%) as a yellow oil. ESL-LCMS (m/z): 371.2 [M+1]+.

Step 6:Synthesis of 2-(3-(1-(3-Aminoazetidin-1yl)ethyl)-2-chlorophenoxy)ethanol

A mixture of tert-butyl (1-(1-(2-chloro-3-(2-hydroxyethoxy)phenyl)ethyl and azetidin-3-yl)carbamate (200 mg, 539 ΞΌmol) in a solution of HCl/MeOH (10 mL, 3N) was stirred at it for 3 hrs. The reaction mixture was concentrated under reduced pressure to afford 2-(3-(1-(3-aminoazetidin-1-yl)ethyl)-2-chlorophenoxy)ethanol (120 mg, 68.9%) as a yellow oil. ESI-LCMS (m/z): 271.2 [M+1]+.

Example 27

Synthesis of (S)-N-(1-(1-(2-chloro-3-(2-hydroxyethoxy)phenyl)ethyl)azetidin-3-yl)-1-cycloprpyl-1H-1,2,3-triazole-4-carboxamide (Cpd. No, 831)

Step 1:Synthesis of N-(1-(1-(2-Chloro-3-(2-hydroxyethoxy)phenyl) ethyl)azetidin-3-yl)-1-cyclopropyl-1H-1,2,3-triazole-4-carboxamide

A mixture of 1-cyclopropyl-1H-1,2,3-triazole-4-carboxylic acid (22.9 mg, 150 ΞΌmol), 2 (3-(1-(3-aminoazetidin-1-yl)ethyl)-2-chlorophenoxy)ethanol (40.6 mg, 0.15 mmol), HATU (85.4 mg, 225 ΞΌmol) and DIPEA (38.6 mg, 300 ΞΌmol) in DMF (2 mL) was stirred at rt for 2 h. water was added and the mixture was extracted with ethyl acetate (10 mLΓ—3), the combined organic phase was washed with brine, dried over sodium sulfate and concentrated. The residue was purified by Pre-TLC (DCM: MEOH=20:1) to afford N-(1-(1-(2-chloro-3-(2-hydroxyethoxy)phenyl)ethyl)azelidin-3-yl)-1-cyctopropyl-1H-1,2,3-triazole-4-carboxamide (15 mg 24.6%) as a wtite solid. ESI-LCMS (m/z): 406.1 [M+23]+. 1HNMR (400 MHz, CD3OD) Ξ΄ ppm: 8.38 (s, 1H), 7.43 (d, J=8.4 Hz, 1H), 7.00-6.93 (m, 2H), 4.66-4.59 (m, 1H), 4.06-3.95 (m, 4H), 3.89-3.86 (m, 2H), 3.83-3.79 (m, 1H), 3.53-3.50 (m, 1H), 3.22 (t, J=7.2 Hz, 1H), 3.04 (t, J=7.2 Hz, 1H), 1.30-1.19 (m, 7H).

Step 2:Synthesis of (S)-N-(1-(1-(2-chloro-3-(2-hydroxyethoxy)phenyl)ethyl) azefidin-3-yl)-1-cyclopropyl-1H-1,2,3-triazole-4-carboxamide

N-(1-(1-(2-chloro-3-(2-hydroxyethoxy)phenyl)ethyl)azetidin-3-yl)-1-cyclopropyl-1H-1,2,3-triazole-4-carboxamide (350 mg, 862 ΞΌmol) was separated by chiral HPLC to obtain two single enantiomers, (isomer1:160 mg, white solid, Ret time 5.02 min; isomer 2:170 mg, Ret time 6.51 min), absolute stereochemistry is undefined, the isomer (Ret time:5.02 rani) was assumed to be S configuration, (S)β€”N-(1-(1-(2-chloro-3-(2-hydroxyethoxy)phenyl)ethyl)azetidin-3-yl)-1-cyclopropyl-1H-1,2,3-triazole-4-carboxamide (160 mg, 45.8%) as a white solid. ESI-LCMS (m/z): 406.2 [M+1]+. 1HNMR (400 MHz, CD3OD) Ξ΄ ppm: 8.38 (s, 1H), 7.44 (d, J=8.4 Hz, 1H), 6.99-6.94 (m, 2H), 4.63 (t, J=7.2 Hz, 1H), 4.06-3.98 (m, 4H), 3.89-3.86 (m, 2H), 3.82 (t, J=7.2 Hz, 1H), 3.52 (t, J=7.2 Hz, 1H), 3.22 (t, J=7.2 Hz, 1H), 3.05 (t, J=7.2 Hz, 1H), 1.27-1.21 (m, 7H). SFC conditions: Instrument: SFC-80 (Thar, Waters) t; Column: REGISCELL 20*250 mm, 5 um (Dacel); Column temperature: 35Β° C.; Mobile phase: CO2/MEOH(0.2% methanol amina)=60/40: Flow rate: 80 g/min: Back pressure: 100 bar; Detection wavelength: 214 nm; Cycle time: 8.8 min; Sample solution: 350 mg dissolved. in 15 ml Methanol; injection volume: 3 mL.

Example 28

Synthesis of N-(1-((1-(4-Chlorobenzyl)-1H-pyrazol-4-yl)methyl)azetidin-3-yl)-1-cyclopropyl-1H-1,2,3-triazole-4-carboxamide (Cpd. No. 985)

Step 1:Synthesis of 1-(4-Chlorobenzyl)-1H-pyrazole-4carbaldehyde

To a solution of 1H-pyrazole-4-carbaldehyde (70 mg, 728 ΞΌmol) in MeCN (5 mL) was added 1-(bromomethyl)-4-chlorobenzene (149 mg, 728 ΞΌmol) and cesium carbonate (472 mg, 1.45 mmol), The mixture was stirred at rt, for 2 h. The mixture was concentrated, diluted with EA and water. The organic phase was washed with brine (10 mLΓ—2), dried over Na2SO4 and concentrated to give 1-(4-chlorobenzyl)-1H-pyrazole-4-carbaldehyde (162 mg, 101%) as a white solid, which was used in the next step without Farther purification. ESI-LCMS (m/z): 221[M+H]+.

Step 2:Synthesis of N-(1-((1-(4-Chlorobenzyl)-1H-pyrazol-4-yl)methyl)azetidin-3-yl)-1-cyclopropyl-1H-1,2,3-triazole-4-carboxamide

A mixture of N-(azetidin-3-yl)-1-cyclopropyl-1H-1,2,3-triazole-4-carboxamide (62 mg, 299 ΞΌmol), 1-(4-chlorobenzyl)-1H-pyrazole-4-carbaldehyde (65.9 mg, 299 ΞΌmol), and sodium cyanoborohydride (56.3 mg, 897 ΞΌmol) in MeOH (10 mL) was stirred at 60Β° C. for 16 h. The mixture was cooled and concentrated. The residue was diluted with EA, washed with water (10 mL) and brine (10 mLΓ—2), dried over Na2SO4 and concentrated. The residue was purified by prep-HPLC to give N-(1-((1-(4-chlorobenzyl)-1H-pyrazol-4-yl)methyl)azetidin-3-yl)-1-cyclopropyl-1H-1,2,3-triazole-4-carboxamide (70 mg, 56:9%) as a white solid, ESI-LCMS (m/z): 412[M+H]+; 1HNMR (400 MHz, CD3OD) Ξ΄ ppm: 8.38 (s, 1H), 7.67 (s, 1H), 7.50 (s, 1H), 7.35 (d, J=8.0 Hz, 2H), 7.21(d, J=8.0 Hz, 2H), 5.31(s, 2H), 4.65-4.61 (m, 1H), 4.00-3.96 (m, 1H), 3.71-3.67 (m, 2H), 3.61 (s, 2H), 3.22(t, J=8.0 Hz, 2H), 1.30-1.24 (m, 2H), 1.21-1.19 (m, 2H),

Example 29

Synthesis of N-(1-((1-(4-chlorobenzyl)-1H-pyrazol-4-yl)methyl)azetidin-3-yl)-5-cyclopropylpyridazine-3-carboxamide (Cpd No. 929)

Step 1:Synthesis of tert-butyl (1-((1-(4-chlorobenzyl)-1H-pyrazol-4-yl)methyl)azetidin-3-yl)carbamate

A mixture of 1-(4-chlorobenzyl)-1H-pyrazole-4-carbaldehyde (200 mg, 0.9063 mmol.), tert-Butyl (azetidin-3-yl)carbamate hydrochloride (377 mg, 1.81 mmol) and acetic acid (54.4 mg, 0.9063 mmol) were dissolved in MeOH (40 ml). After stirred, for 2 h at r.t., sodium cyanoborohydride (142 mg, 2.26 mmol.) was added to the solution. The mixture was stirring over night at r.t. Then, the solution was concentrated under reduced pressure and the residue purified by flash column chromatography (eluant: DCM:McOH=10:1 (600 ml). To furnish ten-butyl (1-((1-(4-chlorobenzyl)-1H-pyrazol-4-yl)methyl)azetidin-3-yl)carbamate (273 mg, 54.2%) as colorless oil. ESI-LCMS (m/z): 377[M+H]+.

Step 2:Synthesis of 1-((1-(4-chlorobenzyl)-1H-pyrazol-4-yl)methyl)azetidin-3-amine

tert-Butyl (1-((1-(4-chlorobenzyl)-1H-pyrazol-4-yl)methyl)azetidin-3-yl)carbamate (273 mg, 0.4908 mmol) was dissolved in HCl in MeOH (3M) (20 ml). The solution was stirring over night at 50Β° C. After cooled to r.t., the solution was concentrated to afford 1-((1-(4-chlorobenzyl)-1H-pyrazol-4-yl)methyl)azetidin-3-amine (200 mg,71.7%) as yellow solid, which was used for next step without purification. ESI-LCMS (m/z): 277[M+H]+.

Step 3:Synthesis of N-(1-((1-(4-chlorobenzyl)-1H-pyrazol-4-yl)methyl)azetidin-3-yl)-5-cyclopropylpyridazine-3-carboxatmide

5-eyelopropylpyridazine-3-carboxylic acid (60 mg, 0.3654 mmol) and HATU (250 mg, 0.6577 mmol) were dissolved in DMF (6 ml). After stirred for 1 h r.t.,1-((1-(4-chlorobenzyl)-1H-pyrazol-4-yl)methyl)azetidin-3-amine (219 mg, 0.3836 mmol) and triethylamine (110 mg, 1.09 mmol) were added to the solution. Then, the mixture was stirring for 4 h at r.t. Then, ethyl acetate (100 ml) was added and the ethyl acetate layer was washed by brine (50 ml.Γ—1), dried by Na2SO4, and concentrated. The residue was purified by Prep-HPLC to afford N-(1-((1-(4-chlorobenzyl)-1H-pyrazol-4-yl)methyl)azetidin-3-yl)-5-cyclopropylpyridazine-3-carboxamide (72 mg, 46.7%) as white solid. ESI-LCMS (m/z): 423[M+H]+; 1HNMR (400 MHz, CD3OD) Ξ΄ ppm: 9.15 (s, 1H), 7.86 (s, 1H), 7.69 (s, 1H), 7.51 (s, 1H), 7.36-7.32 (m, 2H), 7.20 (d, J=8.1 Hz, 2H), 5.32 (s, 2H), 4.72-4.68 (m, 1H), 3.74-3.70 (m, 2H), 3.63 (s, 2H), 3.30-3.26 (m, 2H), 2.12-2.08 (m, 1H), 1.33-1.28 (m, 2H), 1.04-1.00 (m, 2H).

Example 30

Synthesis of N-(1-((1-(4-chlorobenzyl)-1H-pyrazol-4-yl)methyl)azetidin-3-yl)-4-cyclopropylpicolinarnide (Cpd. No. 930)

Step 1:Synthesis of tert-butyl 3-(4-bromopicolinamido)azetidine-1-carboxylate

To a solution of 4-bromopicolinic acid (10.0 mmol, 2.02 g), HATU (15.0 mmol, 5.7 g), HOAT (15.0 mmol, 2.04 g) and DIPEA (20.0 mmol, 2.58 g) in DMF (50 ml) was added tert-butyl 3-aminoazetidine-1-carboxylate (10.0 mmol, 1.72 g) and stirred at r.t. overnight. Added ethyl acetate (300 ml), washed with water (150 mlΓ—6), dried over Na2SO4, concentrated and the residue was crystallized with ethyl acetate:petroleum ether=1:5 to give pale yellow powder (2.63 g, 74%). ESI-LCMS (m/z): 356 [M+H]+.

Step 2:Synthesis of tert-butyl 3-(4-cyclopropylpicolinamido)azetidiner-1-carboxylate

To a solution of tert-butyl 3-(4-bromopicolinamido)azetidine-1-carboxylate (16.2 mmol, 5.8 g), cyclopropylboronic acid (32.4 mmol, 22.8 g), K3PO4 (48.5 mmol, 10.2 g) in dioxane (50 mL) was added Pd(dppf)Cl2 (1.61 mmol, 1.2 g). The mixture was degassed under reduced pressure while stirring and recharged with argon gas, this procedure was repeated for seven times and then heated to 100Β° C. overnight. The solvent was removed and the residue was purified by column chromatography (eluant: ethyl acetate:petroleum ether=1:3) to give tert-butyl 3-(4-cyclopropylpieolinamido)azetidine-1-carboxylate as a white solid (2.6 g, 50.5%). ESI-LCMS (m/z): 318 [M+H]+.

Step 3:Synthesis of N-(azetidin-3-yl)-4-cyclopropylpicolinamide

tert-Butyl 3-(4-cyclopropylpicolinamido)azetidine-1-carboxylate (1.1 g, 3.46 mmol) in 3N HCl in MeOH (50 ml) was stirred at room temperature for 16 h. LCMS showed the reaction was completed, the solvent was removed under reduced pressure, then NH3 in MeOH (7N, 10 ml) was added and concentrated. The crude product was purified by flash column chromatography (40 g silica gel column, eluted with DCM:NH3 in MeOH (7N)=10:1) to give the desired product N-(azetidin-3-yl)-4-cyclopropylpicolinamide (537 mg, 71.5%) as a white solid.

Step 4:Synthesis of N-(1-((1-(4-chlorobenzyl)-1H-pyrazol-4-yl)methyl)azetidin-3-yl)-4-cyclopropylpicolinamide

A mixture of N-(azetidin-3-yl)-4-cyclopropylpieotinamide (50 mg, 0.2301 mmol), 1-(4-ehlorobenzyl)-1H-pyrazole-4-carbaldehyde (50.7 mg, 0.2301 mmol) and HOAc (34.5 mg, 0.6903 mmol) in MeOH (10 ml) was stirred at r.t. for 16 h. LCMS showed the reaction was completed, the solvent was removed under reduced pressure, NH3 in MeOH (7N, 10 ml) was added and concentrated, the crude product, which was purified by Prep-TLC (eluant: DCM:NH3 in MeOH (7N)=20:1) to give the desired product N-(1-((1-(4-chlorobenzyl)-1H-pyrazol-4-yl)methyl)azetidin-3-yl)-4-cyclopropylpicolinamide (30 mg, 30.9%) as a colorless oil. ESI-LCMS (m/z): 422[M+H]+;1HNMR (400 MHz, CD3OD) Ξ΄ ppm: 8.44 (d, J=5.2 Hz, 1H), 7.76 (s, 1H), 7.68 (s, 1H), 7.51 (s, 1H), 7.35-7.32 (m, 2H), 7.28-7.26 (m, 1H), 7.20 (d, J=8.4 Hz, 2H), 5.32 (s, 2H), 4.67-4.63 (m, 1H), 3.73-3.69 (m, 2H), 3.62 (s, 2H), 3.26-3.22 (m, 2H), 2.05-2.01 (m, 1H), 1.20-1.15 (m, 2H), 0.91-0.87 (m, 2H).

Example 31

Synthesis of N-(1-((1-(4-chlorobenzyl)-1H-pyrazol-4-yl)methyl)azetidin-3-yl)-4-cyclopropyl-1H-imidazole-2-carboxarnide (Cpd. No. 927)

Step 1:Synthesis of 4-cyclopropyl-1-((2-(trimethylsilyl)ethoxy)methyl)-1H-imidazole

To a solution of 5-cyclopropyl-1H-imidazole (5.16 g, 47.7 mmol) in anhydrous THF (50 mL) was added NaH (2.85 g, 71.5 mmol) portion-wise at 0Β° C. under nitrogen atmosphere and the mixture was stirred 0Β° C. for 0.5 h. To the reaction mixture was added, SEM-Cl (11.9 g, 71.5 mmol) dropwise at 0Β° C. under nitrogen atmosphere and the mixture was stirred at 0Β° C. for 2 h. The mixture was concentrated in vacuo and the residue was purified with column chromatograph on silica gel (petroleum ether:ethyl acetate=2:1) to afford 4-cyclopropyl-1-((2-(trimethylsilyl)ethoxy)methyl)-1H-imidazole (2.10 g,18.4%) as a yellow liquid. ESI-LCMS (m/z): 239[M+H]+.

Step 2:Synthesis of 4-cyclopropyl-1-((2-(trimethylsilyl)ethoxy)methyl)-1H-imidazole-2-carboxylic acid

Into the stirred solution of 4-cyclopropyl-1-((2-(trimethylsilyl)ethoxy)methyl)-1H-imidazole (400 mg, 1.7 mmol) in THF (20 mL) was added BuLi (0.7 mL, 2.5 M) at βˆ’70Β° C., the mixture was stirred at βˆ’70Β° C. for 1 h, then solid CO2 was added at βˆ’70Β° C., stirred for the next 1 h, acidified with HCl (1 M). Concentrated in vacuum to obtained desired product (350 mg, yellow oil, Y: 74%). ESI-LCIS (m/z): 283[M+H]+.

Step 3:Synthesis of tert-butyl 3-(4-cyclopropyl-1-((2-(trimethylsilyl)ethoxy)methyl)-1H-imidazole-2-carboxamido azetidine-1-carboxylate

Into the stirred solution of 4-cyclopropyl-1-((2(trimethylsilyl)ethoxy)methyl)-1H-imidazole-2-carboxylic acid (350 mg, 1.23 mmol), tert-butyl 3-aminoazetidine-1-carboxylate (316 mmol, 1.84 mmol) and HATU (700 mg, 1.84 mmol) in DMF (10 mL) was added DIPEA (478 mg, 3.7 mmol). The mixture was stirred at rt. for 2 h. Concentrated in vacuum to remove the solvent, the residue was purified by Pre-TLC (petroleum ether:ethyl acetate 1:1) to afford tert-butyl 3-(4-cyclopropyl-1-((2-(trimethylsilyl)ethoxy)methyl)-1H-imidazole-2-carboxamido)azetidin-1-carboxylate as a colorless oil (200 mg, 37%). ESI-LCMS 437[M+H]+.

Step 4:Synthesis of N-(azetidin-3-yl)-4-cyclopropyl-1H-imidazole-2-carboxamide

Into the stirred solution of tert-butyl 3-(4-cyclopropyl-1-((2-(trimethylsilyl)ethoxy)methyl)-1H-imidazole-2-carboxamido)azetidine-1-carboxylate (200 mgn 0.5 mmol) in DCM (10 mL) was added TFA (444 mg, 4.6 mmol). The mixture was stirred at r.t. for 2 h. Concentrated in vacuum to remove the solvent to obtained the residue, basified with saturated NaHCO3, extracted with EtOAc (30 mLΓ—3), combined the organic layer, dried over Na2SO4, concentrated in vacuum to obtained the crude N-(azetidin-3-yl)-4-cyclopropyl-1H-imidazole-2-carboxamide, which was used without further purification (80 mg, brown oil. Y: 84%). ESI-LCMS (m/z): 207[M+H]+.

Step 5:Synthesis of N-(1-((1-(4-chlorobenzyl)-1H-pyrazol-4-yl)methyl)azetidin-3-yl)-4-cyclopropyl-1H-imidazole-2-carboxamide

Into the stirred solution of N-(azetidin-3-yl)-4-cyclopropyl-1H-imidazole-2-carboxamide (400 mg, 1.9 mmol) and 1-(4-chlorobenzyl)-1H-pyrazole-4-carbaldehyde (425 mg, 1.9 mmol) in MeOH (20 mL) was added NaBH3CN (600 mg, 9.6 mmol). The mixture was stirred at 60Β° C. for 20 h. The product was purified by reversed phase prep-HPLC (TPA, CH3CN: H2O=5%-95%) to afford N-(1-((1-(4-chlorobenzyl)-1H-pyrazol-4-yl)methypazetidin-3-yl)-4-cyclopropyl-1H-imidazote-2-carboxamide (49 mg, 6%). ESI-LCMS (m/z): 411[M+H]+;1HNMR (400 MHz, CD3OD) Ξ΄ ppm: 7.92 (s, 1H), 7.67 (s, 1H), 7.36-7.34 (m, 2H), 7.24 (d, J=8.8 Hz, 2H), 6.91 (brs, 1H), 5.36 (s, 2H), 4.77-4.74 (m, 1H), 4.31-4,26 (m, 4H), 4.16-4.11 (m, 2H), 1.91-1.87 (m, 1H), 0.93-0.90 (m, 2H), 0.75-0.72 (m, 2H).

Example 32

Synthesis of 1-cyclopropyl-N-(1-((1-(4-methoxybenzyl)-1H-pyrazol-4-yl)methyl)azetidin-3-yl)-1H-1,2,3-triazole-4-carboxamide (Cpd. No. 932)

Step 1:Synthesis of 1-(4-methoxybenzyl)-1H-pyrazole-4-carbaldehyde

To a mixture of 1H-pyrazole-4-carbaldehyde (100 mg, 1.04 mmol) and 1-(chloromethyl)-4-methoxybenzene (162 mg, 1.04 mmol) in CH3CN (6 mL) was added potassium carbonate (287 mg, 2.08 mmol), the resulting mixture was stirred at reflux for 1 h. The mixture was poured into water (20 nit) and extracted with EtQAc (3Γ—20 mL). The organic layer was dried over Na2SO4 and concentrated to give 1-(4-methoxybenzyl)-1H-1-pyrazole-4-carbaldehyde (220 mg, 93.3%) as a colorless oil. ESI-LCMS (m/z): 217[M+H]+.

Step 2:Synthesis of 1-cyclopropyl-N-(1-((1-(4-methoxybenzyl)-1H-pyrazol-4-yl)methyl)azetidin-3-yl)-1H-1,2,3-triazole-4-carboxamide

To a mixture of N-(azetidin-3-yl)-1-cyclopropyl-1H-1,2,3-triazole-4-carboxamide (50 mg, 0.2412 mmol) and 1-(4-methoxybenzyl)-1H-pyrazole-4-carbaldehyde (62.5 mg, 0.2894 mmol) in methanol (5 mL) was added acetic acid (724 ΞΌg, 0.01206 mmol), the mixture was stirred at r.t. for 15 min, then sodium cyanoborohydride (30.3 mg, 0.4824 mmol) was added, the resulting mixture was stirred at 40Β° C. overnight. The mixture was concentrated under reduced pressure. The residue was dissolved in aqueous solution of Na2CO3 and extracted with EtOAc (3Γ—20 mL). The organic layer was dried over Na2SO4 and concentrated. The residue was purified by prep-TLC (CH2Cl2/NH3.MeOH=20/1) to give]-cyclopropyl-N-(1-((1-(4-methoxybenzyl)-1H-pyrazol-4-yl)methyl)azetidin-3-yl)-1H-1,2,3-triazole-4-carboxamide (53 mg, 53.9%) as a white solid. ESI-LCMS (m/z): 408[M+H]+;1HNMR (400 MHz, CD3OD) Ξ΄ ppm: 8.39 (s, 1H), 7.62 (s, 1H), 7.48 (s, 1H), 7.19 (d, J=8.4 Hz, 2H), 6.90 d, J=8.4 Hz, 2H), 5.24 (s, 2H), 4.64-4.62 (m,1H), 3.99-3.98 (m, 1H), 3.79 (s, 3H), 3.73-3.69 (m, 2H), 3.63 (s, 2H), 3.27-3.23 (m, 2H), 1.28-1.22 (m, 4H).

Example 33

SMYD3 Biochemical Assay

General Materials

S-adenosylmethionine (SAM), S-adenosylhomocysteine (SAH), Tris, Tween20, dimethylsulfoxide (DMSO), bovine skin gelatin (BSG), and Tris(2-carboxyethyl)phosphine hydrochloride solution (TCEP) were purchased from Sigma-Aldrich at the highest level of purity possible. 3H-SAM was purchase from American Radiolabeled Chemicals with a specific activity of 80 Ci/mmol. 384-well opaque white OptiPlates and SPA beads (Perkin Elmer, catalog # RPNQ0013) were purchased from PerkinElmer.

Substrates

N-terminally GST-tagged iMEKK2 (MAP3K2) protein corresponding to reference sequence AAF63496.3 was purchased from Life Technologies (catalog # PV4010). This protein was expressed in High Five insect cells and purified to >85% purity. Protein identity was confirmed by MS/MS analysis after proteolylic digestion. The protein sequence used was:

(SEQ ID No. 1)
MAPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGL
EFPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVL
DIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTH
PDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIA
WPLQGWQATFGGGDHPPKSDLVPRHNQTSLYKKAGTMDDQQALNSIMQDL
AVLHKASRPALSLQETRKAKSSSPKKQNDVRVKFEHRGEKRILQFPRPVK
LEDLRSKAKIAFGQSMDLHYTNNELVIPLTTQDDLDKALELLDRSIHMKS
LKILLVINGSTQATNLEPLPSLEDLDNTVFGAERKKRLSIIGPTSRDRSS
PPPGYIPDELHQVARNGSFTSINSEGEFIPESMEQMLDPLSLSSPENSGS
GSCPSLDSPLDGESYPKSRMPRAQSYPDNHQEFSDYDNPIFEKFGKGGTY
PRRYHVSYHHQEYNDGRKTFPRARRTQGNQLTSPVSFSPTDHSLSTSSGS
SIFTPEYDDSRIRRRGSDIDNPTLTVMDISPPSRSPRAPTNWRLGKLLGQ
GAFGRVYLCYDVDTGRELAVKQVQFDPDSPETSKEVNALECEIQLLKNLL
HERIVQYYGCLRDPQEKTLSIFMEYMPGGSIKDQLKAYGALTENVTRKYT
RQILEGVHYLHSNMIVHRDIKGANILRDSTGNVKLGDFGASKRLQTICLS
GTGMKSVTGTPYWMSPEVISGQGYGRKADIWSVACTVVEMLTEKPPWAEF
EAMAAIFKIATQPTNPKLPPHVSDYTRDFLKRIFVEAKLRPSADELLRHM
FVHYH.

Molecular Biology

Full-length human SMYD3 isoform 1 (BAB86333) was inserted into a modified pET21b plasmid containing a His6 tag and TEV and SUMO cleavage sites. Because two common variants of SMYD3 exist in the population, site directed mutagenesis was subsequently performed to change amino acid 13 from an asparagine to a lysine, resulting in plasmid pEPZ533. A lysine at position 13 conforms to the more commonly occurring sequence (NP_001161212).

Protein Expression

E. coil (BL21 codonplus RIL strain, Stratagene) were transformed with plastnid pEPZ553 by mixing competert cells and plasmid DNA and incubating on ice for 30 minutes followed by heat shock at 42Β° C. for 1 minute and cooling on ice for 2 minutes. Transformed cells were grown and selected on LB agar with 100 ΞΌg/mL ampicillin and 17 ΞΌg/mL chloramphenicol at 37Β° C. overnight. A single clone was used to inoculate 200 mL of LB medium with 100 ΞΌg/mL ampicillin and 17 ΞΌg/mL chloramphenicol and incubated at 37Β° C. on an orbital shaker at 180 rpm. Once in log growth, tile culture was diluted 1:100 into 2 L of LB medium and grown until OD600 was about 0.3 after which the culture was incubated at 15Β° C. and 160 rpm. Once OD600 reached about 0.4, IPTG was added to a final concentration of 0.1 mM and the cells were grown overnight at 15Β° C. and 160 rpm. Cells were harvested by centrifugation at 8000 rpm, for 4 minutes at 4Β° C. and stored at βˆ’80Β° C. for purification.

Protein Purification

Expressed full-length human His-tagged SMYD3 protein was purified from cell paste by Nickel affinity chromatography after equilibration of the resin with Buffer A (25 mM Tris, 200 mM NaCl, 5% glycerol, 5 mM Ξ²-mercaptoethanol, pH7.8). The column was washed with Buffer B (Buffer A plus 20 mM imidazole) and His-tagged SMYD3 was eluted with Buffer C (Buffer A plus 300 mM imidazole). The His tag, TEV and SUMO cleavage sites were removed generating native SMYD3 by addition of ULP1 protein at a ratio of 1:200 (ULP1:SMYD3). Imidazole was removed by dialysis overnight in Buffer A. The dialyzed solution was applied to a second Nickel column and the native SMYD3 protein was collected from the column flow-through. The flow-through was dialyzed in Buffer D (25 mM Tris, 5% glycerol, 5 mM Ξ²-mercaptoethanol, 50 mM NaCl, pH7.8) and ULP1 was removed using a Q sepharose fast flow column, SMYD3 was eluted in Buffer A and further purified using an S200 size-exclusion column equilibrated with Buffer A. SMYD3 was concentrated to 2 mg/mL with a final purity of 89%.

Predicted Translation:

SMYD3(Q9H7B4)
(SEQ ID No. 2)
MEPLKVEKFATAKRGNGLRAVTPLRPGELLFRSDPLAYTVCKGSRGVVCD
RCLLGKEKLMRCSQCRVAKYCSAKCQKKAWPDHKRECKCLKSCKPRYPPD
SVRLLGRVVFKLMDGAPSESEKLYSFYDLESNINKLTEDKKEGLRQLVMT
FQHFMREEIQDASQLPPAFDLFEAFAKVICNSFTICNAEMQEVGVGLYPS
ISLLNHSCDPNCSIVFNGPHLLLRAVRDIEVGEELTICYLDMLMTSEERR
KQLRDQYCFECDCFRCQTQDKDADMLTGDEQVWKEVQESLKKIEELKAHW
KWEQVLAMCQAIISSNSERLPDINIYQLKVLDCAMDACINLGLLEEALFY
GTRTMEPYRIFFPGSHPVRGVQVMKVGKLQLHQGMFPQAMKNLRLAFDIM
RVTHGREHSLIEDLILLLEECDANIRAS.

General Procedure for SMYD3 Enzyme Assays on MEKK2 Protein Substrate

The assays were all performed. In a buffer consisting of 25 mM Tris-Cl pH 8.0, 1 mM TCEP, 0.005% BSG, and 0.005% Tween 20, prepared on the day of use, Compounds in 100% DMSO (1 ul) were spotted into a 384-well white opaque OptiPlate using a Bravo automated liquid handling platform outfitted with a 384-channel head. (Agilent Technologies). DMSO (1 ul) was added to Columns 11, 12, 23, 24, rows A-H for the maximum signal control and 1 ul of SAH, a known product and inhibitor of SMYD3, was added to columns 11, 12, 23, 24, rows I-P for the minimum signal control. A cocktail (40 ul) containing the SMYD3 enzyme was added by Multidrop Combi (Thermo-Fisher).The compounds were allowed to incubate with SMYD3 for 30 min at room temperature, then a cocktail (10 ul) containing SAM and MEKK2 was added to initiate the reaction (final volume=51 ul). The final concentrations of the components were as follows: SMYD3 was 0.4 nM, 3H-SAM was 8 nM, MEKK2 was 12 nM, SAH in the minimum signal control wells was 1 mM, and the DMSO concentration was 2%. The assays were stopped by the addition of non-radiolabeled SAM (10 ul) to a final concentration of 100 uM, which dilutes the 3H-SAM to a level where its incorporation into MEKK2 is no longer detectable. Radiolabeled MEKK2 was detected using a scintillation proximity assay (SPA). 10 uL of a 10 mg/mL solution of SPA beads in 0.5 M citric acid was added and the plates centrifuged at 600 rpm for 1 min to precipitate the radiolabeled MEKK2 onto the SPA beads. The plates were then read in a PerkinElmer TopCount plate reader to measure the quantity of 3H-labeled MEKK2 as disintegrations per minute (dpm) or alternatively, referred to as counts per minute (cpm).

% Inhibition Calculation

%   ? = 100 - ? Γ— 100 ?  indicates text missing or illegible when filed 

Where dpm=disintegrations per minute, cmpd=signal in assay well, and nun and max are the respective minimum and maximum signal controls.

Four-Parameter IC50 fit

Y = Bottom + ? ? )  ? ?  indicates text missing or illegible when filed 

Where top and bottom are the normally allowed to float, but may be fixed at 100 or 0 respectively in a 3-parameter fit. The Hill Coefficient normally allowed to float but may also he fixed at I in a 3-parameter fit. Y is the % inhibition and X is the compound concentration.

SMYD3 biochemical assay data for representative Compounds of the Disclosure are presented in Tables 1A and 3A in the column titled β€œSMYD3 Biochem IC50 (ΞΌM).”

Example 34

SMYD3 Cell Assay

Trimethyl-MEKK2-In-Cell Western Assay

293T/17 adherent cells were purchased from ATCC (American Type Culture Collection), Manassas, Va., USA. MEM/Glutamax medium, Optimem Reduced Serum medium, penicillin-streptomycin, 0.05% trypsin and 1Γ— D-PBS were purchased from Life Technologies, Grand Island, N.Y., USA. PBS-10Γ— was purchased from Ambion, Life Technologies, Grand Island, N.Y., USA. PBS with Tween 20 (PESI (10Γ—)) was purchased from KPL, Gaithersburg, Md., USA.. Tet System FBS-approved. FBS US Source was purchased from Clontech, Mountain View, Calif., USA. Odyssey blocking buffer, 800CW goat anti-rabbit IgG (H+L) antibody, 680CW Goat anti-mouse IgG (H+L) and Licor Odyssey infrared scanner were purchased from Licor Biosciences, Lincoln, Nebr., USA. Tri-methyl-Lysine [A260]-MEKK2 antibody, MEKK2 and SMYD3 plasmids were made at Epizyme. Anti-flag monoclonal mouse antibody was purchased from Sigma, St. Louis, Mo., USA. Methanol was purchased from VWR, Franklin, Mass., USA. 10% Tween 20 was purchased from KPL, Inc., Gaithersburg, Md., USA. Fugene was purchased from Promega, Madison, Wis., USA. The Biotek ELx405 was purchased from BioTek, Winooski, Vt., USA. The multidrop combi was purchased from Thermo Scientific, Waltham, Mass., USA.

293T/17 adherent cells were maintained in growth medium (MEM/Glutamax medium supplemented with 10% v/v Tet System FBS and cultured at 37Β° C. under 5% CO2.

Cell Treatment, In Cell Western (ICW) for Detection of Trimethyl-Lysinc-MEKK2 and MEKK2

293T/17 cells were seeded in assay medium at a concentration of 33,333 cells per cm2 in 30 mL medium per T150 flask and incubated at 37Β° C. under 5% CO2. Plasmids were prepared for delivery to cells by first mixing 1350 ΞΌL Opti-MEM with Fugene (81 ΞΌL) in a sterile Eppendorf and incubated for five minutes at room temperature (RT). MEKK2-flag (13.6 ug/T150) MEKK2 p3Γ— Flag-CMV-14 with C-3Γ— Flag and SMYD3 (0.151 ug/T150) SMYD3 p3Γ— Flag-CMV-14 without C-3Γ— Flag plasmids were aliquotted to a 1.7 mL sterile microfuge tube. The gene ID for MEKK2 and SMYD3 is NM_006609.3 and Q9H7B4, respectively. Entire volume of Opti-MEM/Fugene mixture was then added to a microfuge tube containing DNA plasmic!, mixed and then incubatedΓ—15 minutes at RT. The medium on the 293T/17 cells was refreshed, and the DNA/Fugene complex is added aseptically to each flask, rocked gently, and incubated at 37Β° C. for 5 hours. Medium was then removed, and cells were washed once with PBS in the flask. Trypsin 0.05% (3 mL) was added and cells incubated for three minutes. Room temperature MEM+10% Tet system EBS was added and cells were mixed gently, and counted using the Vi-cell. Cells were seeded at 100,000 cells/mL in 50 ΞΌL MEM/10% Tet FBS/Pen/Strep to a 384 well black/clear poly-D-lysine coated plate containing test agent diluted in DMSO. The final top concentration of test compound was 40 ΞΌM. The total concentration of DMSO did not exceed 0.2% (v/v). Plates were incubatedΓ—30 minutes at RT in low-airflow area, followed by incubation at 37Β° C. under 5% CO2 for 24 hours. Medium was aspirated from all wells of assay plates prior to fixation and permeavilization with ice cold (βˆ’20Β° C.) methanol (90 ΞΌL/well) for ten minutes. Plates were rinsed with PBS three times on BioTek ELx405. PBS was removed with a final aspiration and Odyssey blocking buffer (50 ΞΌL/well) was added to each well and incubated for one hour at RT. Primary antibody solution was prepared (anti-trimethyl-MEKK2 at 1:600 dilution plus mouse anti-flag antibody at 1:10,000 dilution in diluent (Odyssey Blocking buffer+0.1% Tween 20)) and 20 ΞΌL per well was dispensed using the Multidrop Combi. Assay plates were then sealed withβ€” foil, and incubated overnight at 4Β° C. Plates were washed five times with PBS-Tween (1Γ—) on Biotek ELx405 and blotted on paper towel to remove excess reagent. Detection antibody solution (IRDye 800 CW goat anti-rabbit IgG diluted 1:400 in diluent (Odyssey Blocking buffer+0.1% Tween 20), plus IRDye 680CW goat anti-mouse IgG at 1:500 in diluent (Odyssey Blocking buffer+0.1% Tween 20) was added (20 ΞΌL/well) and incubated in dark for one hour at RT. Plates were then washed four times with PBS-I (1Γ—) on ELx405. A final rinse with water was performed (115 ΞΌL/wellΓ—three washes on the ELx405). Plates were then centriftiged upside down, on paper towel, at 200Γ—g to remove excess reagent. Plates were left to dry in dark for one hour. The Odyssey Imager was used to measure the integrated intensity of 700 and 800 wavelengths at resolution of 84 ΞΌm, medium quality, focus offset 4.0, 700 channel intensity=3.5 to measure the MEKK2-flag signal, 800 channel intensity=5 to measure the Trimethyl-MEKK2 signal of each well.

Calculations:

First, the ratio for each well was determined by:

( ? ? ) ?  indicates text missing or illegible when filed 

Each plate included fourteen control wells of DMSO only treatment (Minimum Inhibition) as well as fourteen control wells for maximum inhibition (Background). The average of the ratio values for each control type was calculated and used to determine the percent inhibition for each test well in the plate. Reference compound was serially diluted two-fold in DMSO for a total of nine test concentrations, beginning at 40 ΞΌM. Percent inhibition was calculated (below).

Percent   Inhibition = 100 - ( ( ? ? ) Γ— 100 ) ?  indicates text missing or illegible when filed 

Non-linear regression curves were generated to calculate the lC50 and dose-response relationship using triplicate wells per concentration of compound.

SMYD3 cell assay data for representative Compounds of the Disclosure are presented in Tables 1A and 3A in the column titled β€œSMYD3 Cell IC50 (ΞΌM).”

Example 35

SMYD2 Biochemical Assay

General Materials

S-adenosylmethionine (SAM), S-adenosylhomocyste (SAH), bicine, Tween20, dimethylsulfoxide (DMSO), bovine skin gelatin (BSG), and Tris(2-carboxyethyl)phosphine hydrochloride (TCEP) were purchased from Sigma-Aldrich at the highest level of purity possible. 3H-SAM was purchase from American Radiolabeled Chemicals with a specific activity of 80 Ci/mmol. 384-well streptavidin Flashplates were purchased from PerkinElmer.

Substrates

Peptide was synthesized with a N-terminal linker-affinity tag motif and a C-terminal amide cap by 21st Century Biochemicals. The peptide was high high-perfomance liquid chromatography (HPLC) purified to greater than 95% purity and confirmed by liquid chromatography mass spectrometry (LC-MS). The sequence was ARTKQTARKSTGGKAPRKQLATKAARKSA(K-Biot)-amide. (SEQ ID NO: 3)

Production of Recombinant SMYD2 Enzymes for Biochemical Enzyme Activity Assays

Full length SMYD2 (NP_064582.2) was cloned into a pFastbac-Htb-lic vector with an N-terminal His6 tag and FLAG tag, preceded by a TEV protease cleavage site. The protein was expressed in Sf9 insect cells. Cells were resuspended in lysis buffer (25 mM HEPES-NaOH, pH 7.5, 200 mM NaCl, 5% glycerol, and 5 mM Ξ²-ME) and lysed by sonication. The protein was purified by Ni-NTA (Qiagen), followed by TEV cleavage to remove the His6 tag, subtractive Ni-NTA (Qiagen), and gel filtration chromatography using an S200 column (GE Healthcare). Purified protein was stored in 20 mM Tris-HCl, pH 8.0, 100 mM NaCl, and 1 mM TCEP.

General Procedure for SMYD2 Enzyme Assays on Peptide Substrates

The assays were all performed in a buffer consisting of 20 mM Bicine (pH=7.6), 1 mM TCEP, 0.005% Bovine Skin Gelatin, and 0.002% Tween20, prepared on the day of use. Compounds in 100% DMSO (1 ΞΌl) were spotted into a polypropylene 384-well V-bottom plates (Greiner) using a Platemate Plus outfitted with a 384-channel head (Thermo Scientific). DMSO (1 ul) vas added to Columns 11, 12, 23, 24, rows A-H for the maximum signal control and 1 ul of SAH, a known product and inhibitor of SMYD2, was added to columns 11, 12, 23, 24, rows I-P for the minimum signal control. A cocktail (40 ul) containing the SMYD2 enzyme was added by Multidrop Combi (Thermo-Fisher). The compounds were allowed to incubate with SMYD2 for 30 min at room temperature, then a cocktail (10 ul) containing 3H-SAM and peptide was added to initiate the reaction (final volume=51 ul). The final concentrations of the components were as follows: SMYD2 was 1.5 nM, 3H-SAM was 10 nM, and peptide was 60 nM, SAH in the minimum signal control wells was 1000 uM, and the DMSO concentration was 2%. The assays were stopped by the addition of non-radioactive SAM (10 ul) to a final concentration of 600 uM, which dilutes the 3H-SAM to a level where its incorporation into the peptide substrate is no longer detectable. 50 ul of the reaction in the 384-well polypropylene plate was then transferred to a 384-well Flashplate and the biotinylatcd peptides were allowed to bind to the streptavidin surface for at least 1 hour before being washed three times with 0.1% Tween20 in a Biotek ELx405 plate washer. The plates were then read in a PerkinElmer TopCount plate reader to measure the quantity of 3H-labeled peptide bound to the Flashplate surface, measured as disintegrations per minute (dpm) or alternatively, referred to as counts per minute (cpm).

% Inhibition Calculation

 %  ? = 100 - ( ? ? ) Γ— 100  ?  indicates text missing or illegible when filed

Where dpm=disintegrations per minute, cmpd=signal in assay well, and min andmax are the respective minimum and maximum signal controls.

Four-Parameter IC50 fit

%   inhibition = Bottom + ? ?  indicates text missing or illegible when filed 

Where top and bottom are the normally allowed to float, but may be fixed at 100 or 0 respectively in a 3-parameter fit. The Hill Coefficient normally allowed to float but may also be fixed at 1 in a 3-parameter fit. I is the compound concentration.

SMYD2 biochemical assay data for representative Compounds of the Disclosure are presented in Tables 4A and 6A in the column titled β€œSMYD2 Biochem IC50 (ΞΌM).”

Having now fully described this invention, it will be understood by those of ordinary skill in the art that the same can be performed within a wide and equivalent range of conditions, formulations, and other parameters without affecting the scope of the invention or any embodiment thereof.

Other embodiments of the invention will be apparent to those skilled in the art from consideration of the specification and practice of the invention disclosed herein. It is intended that the specification and examples be considered as exemplary only, with a true scope and spirit of the invention being indicated by the following claims.

All patents and publications cited herein are fully incorporated by reference herein in their entirety.

Claims

1. A compound having Formula I:

or a pharmaceutically acceptably: salt or hydrate thereof,

wherein:

A is selected from the group consisting of 1,2,4-triazolyl, 1-imidazolyl, 1-isoquinolinyl, 1-pyrazolyl, 2-(1,2,3,4-tetrahydroquinolinyl), 2-benzo[d]imidazolyl, 2-benzo[d]thiazolyl, 2-chromenyl-4-one, 2-furanyl, 2-imidazo[1,2-b]pyridazinyl, 2-imidazolyl, 2-indolyl, 2-naphthalenyl, 2-pyrazinyl, 2-pyridyl, 2-pyrimidinyl, 2-pyrrolidinyl, 2-pyrrolyl, 2-quinolinyl, 2-quinoxalinyl, 2-thiazolo[5,4-c]pyridinyl, 2-thiazolyl, 2-thiophenyl, 3-(1,2,3,4-tetrahydroisoquinoline), 3-(1,2,4-oxadiazolyl), 3-imidazo[1,2-a]pyrimidinyl, 3-indazolyl, 3-indolyl, 3-isothiazolyl, 3-pyrazolyl, 3-pyridazinyl, 3-pyridinyl-2-one, 3-pyridyl, 3-pyrrolo[3,2-b]pyridinyl, 3-quinolinyl, 4-(2,2-difluorobenzo[d][1,3]dioxolyl), 4-cyclohexanyl-1-amine, 4-imidazolyl, 4-indolinyl-2-one, 4-indolyl, 4-isothiazolyl, 4-oxazolyl, 4-piperidinyl, 4-pyrazolyl, 4-pyridyl, 4-quinolinyl, 5-(1,3-dihydro-2H-benzo[d]imidazolyl-2-one), 5-(1,3-dihydro-2H-pyrrolo[2,3-b]pyridinyl-2-one), 5-(1,3-dihydro-2H-pyrrolo[2,3-c]pyridi nyl-2-one), 5-(2,2-difluorobenzo[d][1,3]dioxolyl), 5-(2,4-dihydro-3H-1,2,4-triazol-3-one), 5-4H-furo[3,2-b]pyrrolyl, 5-benzo[c][1,2,5]oxadiazolyl, 5-benzo[d][1,3]dioxolyl, 5-benzo[d]oxazolyl-2(3H)-one, 5-bicyclo[2.2.1]heptyl-2-ene, 5-indolinyl-2,3-dione, 5-indolyl-2-one, 5-indolyl, 5-isoindolinyl-1-one, 5-isoxazolyl, 5-pyrazolo[3,4-c]pyridinyl, 5-pyrazolyl, 5-pyrimidinyl, 5-thiazolyl, 6-(1,2,3,4-tetrahydronaphthalenyl), 6-(3,4-dihydroquinolinyl-2(1H)-one), 6-(3,4-dihydroquinoxalinyl-2(1H)-one), 6-(4,5-dihydropyddazinyl-3(2H)-one), 6-benzo[b][1,4]oxazinyl-3-one, 6-benzo[d]imidazolyl, 6-benzo[d]oxazolyl-2(3H)-one, 6-benzo[d]thiazolyl, 6-chromenyl-2-one, 6-imidazo[2,1-b]thiazole, 6-indazolyl, 6-indolinyl-2-one, 6-indolyl, 6-isoquinolinyl, 6-quinolinyl, 6-quinoxalinyl, 6-quinoxalinyl-2(1H)-one, 7-(3,4-dihydroquinolinyl-2(1H)-one), 7-(3,4-dihydroquinoxalin-2(1H)-one), 7-benzo[b][1,4]oxazinyl-3-one, 7-indolinyl-2-one, 7-quinolinyl, 8-benzo[b][1,4]oxazinyl-3-one, cyclopropanyl, phenyl, 4-(prop-1-en-1-yl)-imidazole, 1-butanyl-imidazole, sec-butylcyclopropane, 2-(ethylsulfonyl)propanyl, 1-isobutylpyrrolidine, 4-pyridyl 1-oxide, and 5-benzo[c][1,2,5]oxadiazolyl 1-oxide, each of which is optionally substituted with one, two, or three substituents independently selected from the group consisting of halo, hydroxy, alkoxy, amino, alkylamino, dialkylamino, (amino)alkyl, (alkylamino)alkyl, (dialkylamino)alkyl, C1-6 alkyl, haloalkyl, hydroxyalkyl, (carboxamido)alkyl, (cycloalkyl)alkyl, optionally substituted C3-12 cycloalkyl, optionally substituted C6-14 aryl, optionally substituted 5- to 14-membered heteroaryl, optionally substituted 4- to 14-membered heterocyclo, aralkyl,β€”N(H)C(═O)R6,β€”C(═O)R7, andβ€”S(═O)2R8;

Y is selected from the group consisting of β€”C(R5a)(R5b)C(═O)β€”, β€”C(═O)β€”, and β€”S(═O)2β€”;

B is selected from the group consisting of C1-10 alkylenyl, optionally substituted C3-12 cycloalkylenyl, optionally substituted C6-14 arylenyl, optionally substituted 4- to 14-membered heterocyclenyl, and β€”C(H)R1R2,

with the proviso that B is not optionally substituted pyrrolidinenyl;

X is selected from the group consisting of β€”N(R3)β€”, β€”S(═O)2β€”, β€”S(═O)2N(R3)β€”, β€”N(R3)S(═O)2β€”, β€”S(═O)2C(R4)(H)β€”, β€”C(═O)β€”, β€”C(═O)N(R3)β€”, β€”N(R3)C(═O)β€”, β€”C(═O)Oβ€”, β€”OC(═O)β€”, β€”C(═O)C(R4)(H)N(R3)β€”, β€”N(R3)C(═O)C(R4)(H)β€”, and β€”C(═O)C(R4)(H)β€”; or X is absent;

Z is selected from the group consisting of hydrogen, optionally substituted C1-6 alkyl, fluoroalkyl, hydroxyalkyl, (amino)alkyl, (alkylamino)alkyl, (dialkylamino)alkyl, (cycloalkylamino)alkyl, (heterocyclo)alkyl, (cycloalkyl)alkyl, (amino)(hydroxy)alkyl, (amino)(aryl)alkyl, (hydroxy)(aryl)alkyl, (aralkylamino)alkyl,(hydroxyalkylamino)alkyl, alkoxyalkyl, optionally substituted C6-14 aryl, optionally substituted 4- to 14-membered heterocyclo, optionally substituted 5- to 14-membered heteroaryl, optionally substituted C3-12 cycloalkyl, aralkyl, and (heteroaryl)alkyl; or

Z is β€”CH(R9a)(R9b);

R9a is selected from the group consisting of hydrogen, C1-6 alkyl, fluoroalkyl, hydroxyalkyl, (amino)alkyl, (alkylamino)alkyl, (dialkylamino)alkyl, alkoxyalkyl, optionally substituted C6-14 aryl, optionally substituted 4- to 14-membered heterocyclo, optionally substituted 5- to 14-membered heteroaryl, optionally substituted C3-12 cycloalkyl, aralkyl, and (heteroaryl)alkyl;

R9b is selected from the group consisting of optionally substituted C6-14 aryl, optionally substituted 4- to 14-membered heterocyclo, optionally substituted 5- to 14-membered heteroaryl, optionally substituted C3-12 cycloalkyl, aralkyl, and (heteroaryl)alkyl;

R1 is selected from the group consisting of hydrogen, C1-6 alkyl, (amino)alkyl, (alkylamino)alkyl, (dialkylamino)alkyl, hydroxyalkyl, alkoxyalkyl, aryloxyalkyl, optionally substituted C3-12 cycloalkyl,optionally substituted 4- to 14-membered heterocyclo, optionally substituted C6-14 aryl, aralkyl, and alkoxycarbonyl.

R2 is selected from the group consisting of C1-6 alkyl, optionally substituted C3-12 cycloalkyl, optionally substituted C6-14 aryl, optionally substituted 5- to 14-membered heteroaryl, optionally substituted 4- to 14-membered heterocyclo, and (heteroaryl)alkyl;

R3 is selected from the group consisting of hydrogen and C1-4 alkyl; and

R4 is selected from the group consisting of hydrogen, C1-4 alkyl, hydroxy, amino, alkylamino, dialkylamino, cycloalkylamino, (amino)alkyl, (alkylamino)alkyl, (dialkylamino)alkyl, and hydroxyalkyl.

R5a is selected from the group consisting of hydrogen and C1-4 alkyl;

R5b is selected from the group consisting of hydrogen, C1-4 alkyl, and 4- to 14-membered heterocyclo;

R6 is C1-4 alkyl;

R7 is C1-4 alkyl; and

R8 is selected from the group consisting of C1-4 alkyl, amino, alkylamino, and dialkylamino,

wherein β€”Xβ€”Z is attached to any available carbon or nitrogen atom of B, R1, or R2,

with the proviso that said compound having Formula I is not N-(1-((4-acetamidophenyl)sulfonyl)piperidin-4-yl)benzamide.

2-6. (canceled)

7. The compound of claim 1, or a pharmaceutically acceptable salt or hydrate thereof, having Formula II:

wherein X is absent and Z is (amino)alkyl.

8. (canceled)

9. The compound of claim 1, or a pharmaceutically acceptable salt or hydrate thereof, having Formula III, Formula IV, or Formula V:

wherein R10a, R10b, R11a, and R11b are each independently selected from the group consisting of hydrogen and C1-4 alkyl.

10. The compound of claim 9, or a pharmaceutically acceptable salt or hydrate thereof, wherein X is β€”N(R3)C(═O)β€” and Z is (amino)alkyl.

11. (canceled)

12. (canceled)

13. The compound of claim 1, or a pharmaceutically acceptable salt or hydrate thereof, having Formula VI, Formula VII, or Formula VIII:

wherein R12a, R12b, R13a, and R13b are each independently selected from the group consisting of hydrogen and C1-4 alkyl.

14. The compound of claim 13, or a pharmaceutically acceptable salt or hydrate thereof, wherein:

X is selected from the group consisting of β€”C(═O)C(R4)(H)β€”, β€”C(═O)β€”, and β€”S(═O)2β€”;

R4 is selected from the group consisting of hydrogen and amino; and

Z is selected from the group consisting of (amino)alkyl, (alkylamino)alkyl, (dialkylamino)alkyl, (heterocyclo)alkyl, optionally substituted C3-12 cycloalkyl, optionally substituted C6-14 aryl, aralkyl, and (hetaroaryl)alkyl.

17. The compound of claim 1, or a pharmaceutically acceptable salt or hydrate thereof, having Formula IX, Formula X, or Formula XI:

wherein R1 is selected from the group consisting of hydrogen, C1-6 alkyl, alkoxycarbonyl, and optionally substituted C6-14 aryl.

19-26. (canceled)

27. The compound of claim 1, or a pharmaceutically acceptable salt or hydrate thereof, wherein Y is β€”C(═O)β€”.

28. The compound of claim 1, or a pharmaceutically acceptable salt or hydrate thereof, wherein A is selected from the group consisting of 1,2,4-triazolyl, 2-(1,2,3,4-tetrahydroquinolinyl), 2-indolyl, 2-thiazolyl, 3-(1,2,4-oxadiazolyl), 3-isothiazolyl, 5-(1,3-dihydro-2H-benzo[d]imidazolyl-2-one), 5-(1,3-dihydro-2H-pyrrolo[2,3-b]pyridinyl-2-one), 5-(1,3-dihydro-2H-pyrrolo[2,3-c]pyridinyl-2-one), 5-(2,2-difluorobenzo[d][1,3]dioxolyl), 5-benzo[d]oxazolyl-2(3H)-one, 5-indolinyl-2-one, 6-benzo[b][1,4]oxazinyl-3-one, and 6-isoquinolinyl.

29. The compound of claim 28, or a pharmaceutically acceptable salt or hydrate thereof, wherein A is 2-indolyl.

30. The compound of claim 1, or a pharmaceutically acceptable salt or hydrate thereof, wherein Y is β€”C(═O)β€” and A is 2-indolyl.

31. The compound of claim 1, or a pharmaceutically acceptable salt or hydrate thereof, having Formula XIV:

32-44. (canceled)

45. A compound having Formula XII:

or a pharmaceutically acceptable salt or hydrate thereof,

wherein:

A1 is selected from the group consisting of 1,2,3-triazolyl, 1,2,4-triazolyl, 1-imidazolyl, 1-isoquinolinyl, 1-pyrazolyl, 2-(1,2,3,4-tetrahydroquinolinyl), 2-benzo[d]imidazolyl, 2-benzo[d]thiazolyl, 2-chromenyl-4-one, 2-furanyl, 2-imidazo[1,2-b]pyridazinyl, 2-imidazolyl, 2-indolyl, 2-naphthalenyl, 2-pyrazinyl, 2-pyridyl, 2-pyrimidinyl, 2-pyrrolidinyl, 2-pyrrolyl, 2-quinolinyl, 2-quinoxalinyl, 2-thiazolo[5,4-c]pyridinyl, 2-thiazolyl, 2-thiophenyl, 3-(1,2,3,4-tetrahydroisoquinoline), 3-(1,2,4-oxadiazolyl), 3-imidazo[1,2-a]pyrimidinyl, 3-indazolyl, 3-indolyl, 3-isothiazolyl, 3-pyrazolyl, 3-pyridazinyl, 3-pyridinyl-2-one, 3-pyridyl, 3-pyrrolo[3,2-b]pyridinyl, 3-quinolinyl, 4-(2,2-difluorobenzo[d][1,3]dioxolyl), 4-cyclohexanyl-1-amine, 4-imidazolyl, 4-indolinyl-2-one, 4-indolyl, 4-isothiazolyl, 4-oxazolyl, 4-piperidinyl, 4-pyrazolyl, 4-pyridyl, 4-quinolinyl, 5-(1,3-dihydro-2H-benzo[d]imidazolyl-2-one), 5-(1,3-dihydro-2H-pyrrolo[2,3-b]pylidinyl-2-one), 5-(1,3-dihydro-2H-pyrrolo[2,3-c]pyridinyl-2-one), 5-(2,2-difluorobenzo[d][1,3]dioxolyl), 5-(2,4-dihydro-3H-1,2,4-triazolyl-3-one), 5-4H-furo[3,2-b]pyrrolyl, 5-benzo[c][1,2,5]oxadiazolyl, 5-benzo[d][1,3]dioxolyl, 5-benzo[d]oxazolyl-2(3H)-one, 5-bicyclo[2.2.1]heptyl-2-ene, 5-indolinyl-2,3-dione, 5-indolinyl-2-one, 5-indolyl, 5-isoindolinyl-1-one, 5-isoxazolyl, 5-pyrazolo[3,4-c]pyridinyl, 5-pyrazolyl, 5-pyrimidinyl, 5-thiazolyl, 6-(1,2,3,4-tetrahydronaphthalenyl), 6-(3,4-dihydroquinolinyl-2(1H)-one), 6-(3,4-dihydroquinoxaliyl-2(1H)-one), 6-(4,5-dihydropyridazinyl-3(2H)-one), 6-benzo[b][1,4]oxazinyl-3-one, 6-benzo[d]imidazolyl, 6-benzo[d]oxazolyl-2(3H)-one, 6-benzo[d]thiazolyl, 6-chromenyl-2-one, 6-imidazo[2,1-b]thiazole, 6-indazolyl, 6-indolinyl-2-one, 6-indolyl, 6-isoquinolinyl, 6-quinolinyl, 6-quinoxalinyl, 6-quinoxalinyl-2(1H)-one, 7-(3,4-dihydroquinolinyl-2(1H)-one), 7-(3,4-dihydroquinoxalin-2(1H)-one), 7-benzo[b][1,4]oxazinyl-3-one, 7-indolinyl-2-one, 7-quinolinyl, 8-benzo[b][1,4]oxazinyl-3-one, cyclopropanyl, phenyl, 4-(prop-1-en-1-yl)-imidazole, 1-butanyl-imidazole, sec-butylcyclopropane, 2-(ethylsulfonyl)propanyl, 1-isobutylpyrrolidine, 4-pyridyl 1-oxide, and 5-benzo[c][1,2,5]oxadiazolyl 1-oxide, each of which is optionally substituted with one, two, or three substituents independently selected from the group consisting of halo, hydroxy,alkoxy, amino, alkylamino, dialkylamino, (amino)alkyl, (alkylamino)alkyl, (dialkylamino)alkyl, C1-6 alkyl, haloalkyl, hydroxyalkyl, (carboxamido)alkyl, (cycloalkyl)alkyl, optionally substituted C3-12 cycloalkyl, optionally substituted C6-14 aryl, optionally substituted 5- to 14-membered heteroaryl, optionally substituted 4- to 14-membered heterocyclo, and aralkyl;

B1 is selected from the group consisting of optionally substituted C3-12 cycloalkylenyl and optionally substituted 4- to 14-membered heterocyclenyl,

X1 is selected from the group consisting of β€”N(R3a)β€”, β€”S(═O)2β€”, β€”S(═O)2N(R3a)β€”, β€”N(R3a)S(═O)2β€”, β€”S(═O)2C(R4a)(H)β€”, β€”C(═O)β€”, β€”C(═O)N(R3a)β€”, β€”N(R3a)C(═O)β€”, β€”C(═O)Oβ€”, β€”OC(═O)β€”,β€”C(═O)C(R4a)(H)N(R3a)β€”, β€”N(R3a)C(═O)C(R4a)(H)β€”, and β€”C(═O)C(R4a)(H)β€”; or X1 is absent;

Z1 is selected from the group consisting of hydrogen, optionally substituted C1-6-alkyl, fluoroalkyl, hydroxyalkyl, (amino)alkyl, (alkylamino)alkyl, (dialkylamino)alkyl, (cycloalkylamino)alkyl, (heterocyclo)alkyl, (cycloalkyl)alkyl, (amino)(hydroxy)alkyl, (amino)(aryl)alkyl, (hydroxy)(aryl)alkyl, (aralkylamino)alkyl, (hydroxyalkylamino)alkyl, alkoxyalkyl, optionally substituted C6-14 aryl, optionally substituted 4- to 14-membered heterocyclo, optionally substituted 5- to 14-membered heteroaryl, optionally substituted C3-12 cycloalkyl, aralkyl, and (heteroaryl)alkyl;

R3a is selected from the group consisting of hydrogen and C1-4 alkyl; and

R4a is selected from the group consisting of hydrogen, C1-4 alkyl, hydroxy, amino, alkylamino, and dialkylamino.

46-50. (canceled)

51. A compound having Formula XIII:

or a pharmaceutically acceptable salt or hydrate thereof, wherein:

X2 is selected from the group consisting of β€”N(R3b)β€”, β€”S(═O)2β€”, β€”S(═O)2N(R3b)β€”, β€”N(R3b)S(═O)2β€”, β€”S(═O)2C(R4b)(H)β€”, β€”C(═O)β€”, β€”C(═O)N(R3b)β€”, β€”N(R3b)C(═O)β€”, β€”C(═O)Oβ€”, β€”OC(═O)β€”,β€”C(═O)C(R4b)(H)N(R3b)β€”, β€”N(R3b)C(═O)C(R4b)(H)β€”, and β€”C(═O)C(R4b)(H)β€”; or X is absent;

Z2 is selected from the group consisting of hydrogen, optionally substituted C1-6 alkyl, fluoroalkyl, hydroxyalkyl, (amino)alkyl, (alkylamino)alkyl, (dialkylamino)alkyl, (cycloalkylamino)alkyl, (heterocyclo)alkyl, (cycloalkyl)alkyl, (amino)(hydroxy)alkyl, (amino)(aryl)alkyl, (hydroxy)(aryl)alkyl, (aralkylamino)alkyl, (hydroxyalkylamino)alkyl, alkoxyalkyl, optionally substituted C6-14 aryl, optionally substituted 4- to 14-membered heterocyclo, optionally substituted 5- to 14-membered heteroaryl optionally substituted C3-12 cycloalkyl, aralkyl, and (heteroaryl)alkyl;

R1a is selected from the group consisting of hydrogen, C1-6 alkyl, and optionally substituted C6-14 aryl;

R3b is selected from the group consisting of hydrogen and C1-4 alkyl; and

R4b is selected from the group consisting of hydrogen, C1-4 alkyl, hydroxy, amino, alkylamino, and dialkylamino.

52-56. (canceled)

57. The compound of claim 1, or a pharmaceutically acceptable salt or hydrate thereof, selected from the group consisting of:

N-(1((4-acetamidophenyl)sulfonyl)piperidin-4-yl)nicotinamide;

N-(1-((4-acetamidophenyl)sulfonyl)piperidin-4-yl)isonicotinamide;

N-(1-((4-acetamidophenyl)sulfonyl)piperidin-4-yl)pyrazine-2-carboxamide;

N-(1-((4-acetamidophenyl)sulfonyl)piperidin-4-yl)-1H-pyrazole-3-carboxamide;

N-(1-((14-acetamidophenyl)sulfonyl)piperidin-4-yl)-1-methyl-1H-pyrazole-5-carboxamide:

N-(1-((4-acetamidophenyl)sulfonyl)piperidin-4-yl)-1-methyl-1H-pyrazole-4-carboxamide;

N-(1((4-acetamidophenyl)sulfonyl)piperidin-4-yl)-1-methyl-1H-imidazole-4-carboxamide;

N-(1((4-acetamidophenyl)sulfonyl)piperidin-4-yl)-1-(cyclopropylmethyl)piperidine-4-carboxamide;

N-((1r,4r)-4-aminocyclohexyl)-1-ethyl-1H-pyrazole-3-carboxamide;

N-((1r,4r)-4-aminocyclohexyl -3-ethylisoxazole-5-carboxamide;

N-((1r,4r)-4-aminocyclohexyl)-1-ethyl-1H-imidazole-4-carboxamide;

N-((1r,4r)-4-aminocyclohexyl)-2-ethyloxazole-4-carboxamide;

N-((1r,4r)-4-aminocyclohexyl)-5-ethylisothiazole-3-carboxamide;

N-((1r,4r)-4-aminocyclohexyl)-4-ethylbenzamide;

N-((1r,4r)-4-aminocyclohexyl)-3-oxo-3,4-dihydro-2H-benzo[b][1,4]oxazine-7-carboxamide;

N-((1r,4r)-4-aminocyclohexyl)-3-oxo-3,4-dihydro-2H-benzo[b][1,4]oxazine-6-carboxamide;

N-((1r,4r)-4-aminocyclohexyl)-3-ethylbenzamide;

N-((1r,4r)-4-aminocyclohexyl)-5-ethylnicotinamide;

3-acetyl-N-((1r,4r)-4-aminocyclohexyl)benzamide:

3-acetamido-N-((1r,4r)-4-aminocyclohexyl)benzamide;

N-((1r,4r)-4-aminocyclohexyl)-3-propionamidobenzamide;

N-((1r,4r)-4-aminocyclohexyl)-3-(hydroxymethyl)benzamide;

N-((1r,4r)-4-aminocyclohexyl)-1-ethyl-3-methyl-1H-pyrazole-5-carboxamide;

N-((1r,4r)-4-aminocyclohexyl)-3-methyl-1-phenyl-1H-pyrazole-5-carboxamide;

N-((1r,4r)-4-aminocyclohexyl)-1-benzyl-3-methyl-1H-pyrazole-5-carboxamide;

1-ethyl-3-methyl-N-(phenyl(piperidin-4-yl)methyl)-1H-pyrazole-5-carboxamide;

3-methyl-1-phenyl-N-(phenyl(piperidin-4-yl)methyl)-1H-pyrazole-5-carboxamide;

1-benzyl-3-methyl-N-(phenyl(piperidin-4-yl)methyl)-1H-pyrazole-5-carboxamide;

N-(4-(aminomethyl)phenyl)-6-hydroxypyridazine-3-carboxamide;

N-(4-(aminomethyl)phenyl -1-methyl-3-(trifluoromethyl)-1H-pyrazole-5-carboxamide;

N-(4-(aminomethyl)phenyl)-1-ethyl-3-methyl -1H-pyrazole-5-carboxamide;

N-(4-(aminomethyl)phenyl)-3-methyl-1-phenyl-1H-pyrazole-5-carboxamide;

N-((1r,4r)-4-aminocyclohexyl)-3-ethyl-1-methyl-1H-pyrazole-5-carboxamide;

N-((1r, 4r)-4-aminocyclohexyl)-4-ethylpicolinamide;

2-oxo-N-(piperidin-4-yl)-1,2,3,4-tetrahydroquinoxaline-6-carboxamide;

N-((1r,4r)-4-aminocyclohexyl)-2-oxoindoline-5-carboxamide;

N-((1r,4r)-4-aminocyclohexyl)-2-oxoindoline-5-carboxamide;

N-((1r,4r)-4-aminocyclohexyl)-2-hydroxyquinoxaline-6-carboxamide;

2-oxo-N-(phenyl(iperidin-4-yl)methyl)indoline-5-carboxamide;

5-amino-N-(phenyl(piperidin-4-yl)methyl)-1H-pyrazole-3-carboxamide;

3-oxo-N-(piperidin-4-yl)-3,4-dihydroquinoxaline-6-carboxamide;

N-((1r,4r)-4-aminocyclohexyl)-2-oxo-2,3-dihydro-1H-pyrrolo[2,3-b]pyridine-5-carboxamide;

3-amino-N-((1r,4r)-4-aminocyclohexyl)-1-methyl-1H-pyrazole-5-carboxamide;

N-(1-(L-tyrosyl)piperidin-4-yl)-2-oxoindoline-5-carboxamide;

2-oxo-N-(piperidin-4-yl)indoline-5-carboxamide;

N-(1-(L-tryptophyl)piperidin-4-yl)-2-oxoindoline-5-carboxamide;

N-(4-(aminomethyl)phenyl -4-propionyl-1H-pyrrole-2-carboxamide;

N-((1r,4r)-4-aminocyclohexyl)-2-butylcyclopropane-1-carboxamide;

N-((1r,4r)-4-aminocyclohexyl)-5-ethylthiophene-2-carboxamide;

5-ethyl-N-(phenyl(piperidin-4-yl)methyl)thiophene-2-carboxamide;

N-(4-(aminomethyl)phenyl)-5-ethylthiophene-2-carboxamide;

N-((1r,4r)-4-aminocyclohexyl)-2-methyl-4H-furo[3,2-b]pyrrole-5-carboxamide;

2-methyl-N-(piperidin-4-yl)-4H-furo[3,2-b]pyrrole-5-carboxamide;

N-((1r,4r)-4-aminocyclohexyl)-2-ethylthiazole-5-carboxamide;

2-ethyl-N-(phenyl(piperidin-4-yl)methyl)thiazole-5-carboxamide;

N-(4-(aminomethyl)phenyl)-2-ethylthiazole-5-carboxamide;

N-((1r,4r)-4-aminocyclohexyl)-3-cyclopropylbutanamide;

3-cyclopropyl-N-(phenyl(piperidin-4-yl)methyl)butanamide;

4-acetyl-N-((1r,4r)-4-aminocyclohexyl)-1H-pyrrole-2-carboxamide;

4-acetyl-N-(piperidin-4-yl)-1H-pyrrole-2-carboxamide;

4-acetyl-N-(4-(aminomethyl)phenyl)-1H-pyrrole-2-carboxamide;

N-((1r,4r)-4-aminocyclohexyl)-3-hydroxy-1-methyl-1H-pyrazole-5-carboxamide;

2-oxo-N-(piperidin-4-yl)-2,3-dihydro-1H-pyrrolo[2,3-b]pyridine-5-carboxamide;

3-hydroxy-1-methyl-N-(piperidin-4-yl)-1H-pyrazol e-5-carboxamide;

N-((1r,4r)-4-aminocyclohexyl)-3-oxo-1,2,3,4-tetrahydroquinoxaline-6-carboxamide;

N-((1r,4r)-4-aminocyclohexyl)-2-oxoindoline-6-carboxamide;

N-(1-(L-tyrosyl)piperidin-4-yl -2-oxoindoline-6-carboxamide;

N-((1r,4r)-4-aminocyclohexyl)-2-oxo-2,3-dihydro-1H-benzo[d]imidazole-5-carboxamide;

N-((1r,4r)-4-aminocyclohexyl)-2-oxo-1,2,3,4-tetrahydroquinoline-6-carboxamide;

6-amino-N-((1r,4r)-4-aminocyclohexyl)-2-naphthamide;

N-((1r,4r)-4-aminocyclohexyl)-2-hydroxyquinoline-6-carboxamide;

N-(phenyl(piperidin-4-yl)methyl)-4-propionyl-1H-pyrrole-2-carboxamide;

N-((1r,4r)-4-aminocyclohexyl)-2-(ethylsulfonyl)propanamide;

N-((1r,4r)-4-aminocyclobexyl)-5-((dimethylamino)methyl)furan-2-carboxamide;

2-amino-N-(phenyl(piperidin-4-yl)methyl)oxazole-4-carboxamide;

N-(4-(aminomethyl)phenyl)-2-methyl-4H-furo[3,2-b]pyrrole-5-carboxamide;

N-(1-(L-tyrosyl)piperidin-4-yl)-1-methyl-2-oxoindoline-5-carboxamide;

N-(1-(L-tryptophyl)piperidin-4-yl)-1-methyl-2-oxoindoline-5-carboxamide;

N-((1r,4r)-4-aminocyclohexyl)-1-methyl-2-oxoindoline-5-carboxamide;

N-((1r,4r)-4-aminocyclohexy)-8-methoxy-3-oxo-3,4-dihydro-2H-benzo[b][1,4]oxazine-6-carboxamide;

N-(1-(1-(L-alanyl)piperidin-4-yl)ethyl)-2-oxoindoline-5-carboxamide;

N-(11-(1(D-alanyl)piperidin-4-yl)ethyl)-2-oxoindoline-5-carboxamide;

N-(1-(L-tvrosyl)piperidin-4-yl)-1-methyl-2-oxoindoline-6-carboxamide;

N-((1r,4r)-4-aminocyclohexyl)-2-oxo-2,3-dihydrobenzo[d]oxazole-5-carboxamide;

N-((1r,4r)-4-aminocyclohexyl)-2-oxo-2,3-dihydrobenzo[d]oxazole-6-carboxamide;

N-((1r,4)-4-aminocyclohexyl -2-oxo-1,2,3,4-tetrahydroquinoline-7-carboxamide;

N-(1-(1-(L-alanyl)piperidin-4-yl)ethyl)-2-oxo-1,2,3,4-tetrahydroquinoline-7-carboxamide;

N-(1-(1-(L-alanyl)piperidin-4-yl)ethyl)-2-oxo-2,3-dihydro-1H-benzo[d]imidazole-5-carboxamide;

N-(1-(1-(L-alanyl)piperidin-4-yl)ethyl)-2-oxo-2,3-dihydrobenzo[d]oxazole-6-carboxamide;

N-(1-(1-(L-alanyl)piperidin-4-yl)ethyl)-2-oxo-2H-chromene-6-carboxamide;

N-(1-(1-(L-alanyl)piperidin-4-yl)ethyl)-2-oxo-1,2,3,4-tetrahydroquinoline-6-carboxamide;

N-(1-(1-(L-alanyl)piperidin-4-yl)ethyl)-6-amino-2-naphthamide;

N-(1-(1-(L-alanyl)piperidin-4-yl)ethyl)-8-methoxy-3-oxo-3,4-dihydro-2H-benzo[b][1,4]oxazine-6-carboxamide;

N-(1-(1-(L-alanyl)piperidin-4-yl)ethyl)-3-hydroxyquinoxaline-6-carboxamide;

2-oxo-N-(piperidin-4-ylmethyl)indoline-5-carboxamide;

(S)-2-oxo-N-(pyrrolidin-3-ylmethyl)indoline-5-carboxamide;

N-((1-(L-tyrosyl)piperidin-4-yl)methyl)-2-oxoindoline-5-carboxamide;

N-((1-(L-tryptophyl)piperidin-4-ylmethyl)-2-oxoindoline-5-carboxamide;

ethyl 2-(1-(L-alanyl)piperidin-4-yl)-2-(2-oxoindoline-5-carboxamido)acetate;

N-((4-hydroxypiperidin-4-yl)methyl)-2-oxoindoline-5-carboxamide;

N-(4-aminobutyl)-2-oxoindoline-5-carboxamide;

(S)-N-(4-(2-aminopropanamido)butyl)-2-oxoindoline-5-carboxamide;

ethyl 5-((1r,4r)-4-aminocyclohexyl)amino)-5-oxopentanoate;

2-methyl-N-(phenyl(piperidin-4-yl)methyl)-3-(pyrrolidin-1-yl)propanamide;

2-methyl-N-(phenyl(piperidin-4-yl)methyl)-4H-furo[3,2-b]pyrrole-5-carboxamide;

N-((1r,4r)-4-aminocyclohexyl)-2-ethylpyrrolidine-2-carboxamide;

N-((1-(L-alanyl)-4-hydroxypiperidin-4-yl)methyl)-2-oxoindoline-5-carboxamide;

N-((1-(L-alanyl)-4-fluoropiperidin-4-yl(methyl)-2-oxoindoline-5-carboxamide;

(R)-N-(4-(2-aminopropanamido)butyl)-2-oxoindoline-5-carboxamide;

N-((1r,4r)-4-aminocyclohexyl)-3-oxo-3,4-dihydro-2H-benzo[b][1,4]oxazine-8-carboxamide;

N-((1r,4r)-4-aminocyclohexyl)-5-bromonicotinamide;

N-((1r,4r)-4-aminocyclohexyl)-5-chloronicotinamide;

N-((1r,4r)-4-aminocyclohexyl)benzo[d]thiazole-6-carboxamide;

N-((1r,4r)-aminocyclohexyl)-2-hydroxyquinoline-7-carboxamide;

N-(1-(1-(L-alanyl)piperidin-4-yl)ethyl)-2-hydroxyquinoline-7-carboxamide;

N-((4-methylpiperidin-4-yl)methyl)-2-oxoindoline-5-carboxamide;

ethyl 2-(2-oxoindoline-5-carboxamido)-2-(piperidin-4-yl)acetate;

6-amino-N-((1r,4r)-4-aminocyclohexyl)nicotinamide;

N-((1r,4r)-4-aminocyclohexyl)-7-fluoro-2-hydroxyquinoline-4-carboxamide;

N-((1r,4r)-4-aminocyclohexyl)-2-chloro-5(4H-1,2,4-triazol-4-yl)benzamide;

N-(((1r,4r)-4-aminocyclohexyl)4H-1,2,4-triazole-3-carboxamide;

N-((1r,4r)-4-aminocyclohexyl)-2-(pyridin-3-yl)acetamide;

N-(4-(3-aminopropanamido)cyclohexyl)-2-oxoindoline-5-carboxamide;

ethyl 4-((2-oxoindoline-5-carboxamido)methyl)piperidine-4-carboxylate;

ethyl 1-(L-alanyl)-4((2-oxoindoline-5-carboxamido)methyl)piperidine-4-carboxylate;

N-(((S)-1-(D-alanyl)pyrrolidin-3-yl)methyl)-2-oxoindoline-5-carboxamide;

N-(((S)-1-(L-alanyl)pyrrolidin-3-yl)methyl)-2-oxoindoline-5-carboxamide;

N-(((R)-1-(L-alanyl)pyrrolidin-3-yl)methyl)-2-oxoindoline-5-carboxamide;

N-((1r,4r)-4-(3-aminopropanamido)cyclohexyl)-4-(5-methyl-1,2,4-oxadiazol-3-yl)benzamide;

N-((1r,4r)-4-aminocyclohexyl)-4-(5-methyl-1,2,4-oxadiazol-3-yl)benzamide;

N-(1-(1-(L-alanyl)piperidin-4-yl)ethyl)isonicotinamide;

N-((1r,4r)-4-(3-aminopropanamido)cyclohexyl)isonicotinamide;

N-((1r,4r)-4-aminocyclohexyl)isonicotinamide;

N-(1-(1-(L-alanyl)piperidin-4-yl)ethyl)nicotinamide;

N-((1r,4r)-4-(3-aminopropanamido)clohexyl)nicotinamide;

N-((1r,4r)4-aminocyclohexyl)nicotinamide;

N-(1-(1-(L-alanyl)piperidin-4-yl)ethyl)pyrimidine-2-carboxamide;

N-((1r,4r)-4-(3-aminopropanamido)cyclohexyl)pyrimidine-2-carboxamide;

N-(1-(1-(L-alanyl)piperidin-4-yl)ethyl)benzo[d][1,3]dioxole-5-carboxamide;

N-((1r,4r)-4-(3-aminopropanamido)cyclohexyl)benzo[d][1,3]dioxole-5-carboxamide;

N-((1r,4r)-4-aminocyclohexyl)benzo[d][1,3]dioxole-5-carboxamide;

N-(1-(1-(L-alanyl)piperidin-4-yl)ethyl)-3-(methylsulfonyl)benzamide;

N-((1r,4r)4-(3-aminopropanamido)cyclohexyl)-3-(methylsulfonyl)benzamide;

N-((1r,4r)-4-aminocyclohexyl)-3-(methylsulfonyl)benzamide;

3-amino-N-((1r,4r)-4-(3-aminopropanamido)cyclohexyl)pyrazine-2-carboxamide;

3-amino-N-((1r,4r)-4-aminocyclohexyl)pyrazine-2-carboxamide;

N-((1r,4r)-4-(3-aminopropanamido)cyclohexyl)-[1,1β€²-biphenyl]-4-carboxamide;

N-((1r,4r)-4-aminocyclohexyl)-[1,1β€²-biphenyl]-1-carboxamide;

N-((1r,4r)-4-(3-aminopropanamido)cyclohexyl)-4-sulfamoylbenzamide;

N-(1-(1-(L-alanyl)piperidin-4-yl)ethyl)-5-fluoronicotinamide;

N-((1r,4r)-4-(3-aminopropanamido)cyclohexyl)-5-fluoronicotinamide;

N-((1r,4r)-4-aminocyclohexyl)-5-fluoronicotinamide;

N-((1r,4r)-4-aminocyclohexyl)-1H-indole-6-carboxamide;

N-((1r,4r)-4-aminocyclohexy)-1H-benzo[d]imidazole-6-carboxamide;

N-(1-(1-(L-alanyl)piperidin-4-yl)ethyl)quinoline-2-carboxamide;

N-((1r,4r)-4-(3-aminopropanamido)cyclohexyl)quinoline-2-carboxamide;

N-((1r,4r)-4-aminocyclohexyl)quinoline-2-carboxamide;

N-((1r,4r)-4-(3-aminopropanamido)cyclohexyl)isoquiniline-6-carboxamide;

N-((1r,4r)-4-aminocyclohexyl)isoquinoline-6-carboxamide;

N-(1-(1-(L-alanyl)piperidin-4-yl)ethyl)2-(1H-indol-3-yl)acetamide;

N-((1r,4r)-4-aminocyclohexyl)-2-(1H-indol--3-yl)acetamide;

3-amino-N-(((1r,4r)-4-(2-(6-methoxynaphthalen-2-yl)propanamido)cyclohexyl)propanamide;

N-((1r,4r)-4-aminocyclohexyl)-2-(6-methoxynaphthalen-2-yl)propanamide;

N-(1-(1-(L-alanyl)piperidin-4-yl)ethyl)isoquinoline-1-carboxamide;

N-((1r,4r)-4-aminocyclohexyl)-1H-indazole-3-carboxamide;

N-((1r,4r)-4-(3-aminobutanamido)cyclohexyl)-2-oxoindoline-5-carboxamide;

N-((1r,4r)-4-(2-aminoacetamido)cyclohexyl)-2-oxoindoline-5-carboxamide;

N-((1r,4r)-4-(2-aminopropanamido)cyclohexyl)-2-oxoindoline-5-carboxamide;

N-((1-(L-alanyl)-4-methylpiperidin-4-yl)methyl)-2-oxoindoline-5-carboxamide;

N-(((R)-1-(D-alanyl)pyrrolidin-3-yl)methyl -2-oxoindoline-5-carboxamide;

N-(4-(3-amino-N-methylpropanamido)cyclohexyl)-2-oxoindoline-5-carboxamide;

N-(1-(1-(L-alanyl)piperidin-4-yl)ethyl)-4-(5-methyl-1,2,4-oxadiazol-3-yl)benzamide;

N-(1-(1-(L-alanyl)piperidin-4-yl)ethyl)-3,5-dimethyl-1H-pyrazole-4-carboxamide;

N-((1r,4)-4-(3-aminopropanamido)cyclohexyl)-3,5-dimethyl-1H-pyrazole-4-carboxamide;

N-((1r,4r)-4-aminocyclohexyl)-3,5-dimethyl-1H-pyrazole-4-carboxamide;

N-(1-(1-(L-alanyl)piperidin-4-yl)ethyl)-2-methylpyrimidine-5-carboxamide;

N-((1r,4r)-4-(3-aminopropanamido)cyclohexyl)-2-methylpyrimidine-5-carboxamide;

N-(1-(1-(L-alanyl)piperidin-4-yl)ethyl)-5-methylpyrazine-2-carboxamide;

N-((1r,4r)-4-aminocyclohexyl)-5-methylpyrazine-2-carboxamide;

N(1-(1-(L-alanyl)piperidin-4-yl)ethyl)-2-aminoisonicotinamide;

N-(1-(1-(L-alanyl)piperidin-4-yl)ethyl)-3-aminopyrazine-2-carboxamide;

N-(1-(1-(L-alanyl)pineridin-4-yl)ethyl)-[1,1β€²-biphenyl]-4-carboxamide;

N-((1r,4r)-4-aminocyclohexyl)-4-sulfamoylbenzamide;

N-(1(1-(L-alanyl)piperidin-4-yl)ethyl)-6-hydroxypyridazine-3-carboxamide;

N-((1r,4r)-4-aminocyclohexyl)-1H-indole-5-carboxamide;

N-(1-(1-(L-alanyl)piperidin4-yl)ethyl)-1H-benzo[d]imidazole-6-carboxamide;

N-(1-(1-(L-alanyl)piperdin-4-yl)ethyl)isoquinoline-6-carboxamide;

N-((1r,4r)-4(2-(1H-indol-3-yl)acetamido)cyclohexyl)-3-aminopropanamide;

N-((1r,4r)4-aminopropanamido)cyclohexyl)isoquinoline-1-carboxamide;

N-((1r,4r)4-aminocyclohexyl)isoquinoline-1-carboxamide;

N-(1-(1-(L-alanyl)piperidin-4-yl)ethyl)-5-fluoro-1H-indole-2-carboxamide;

N-(1-(1-(L-alanyl)piperidin-4-yl)ethyl)-2-hydroxyquinoline-4-carboxamide;

N-((1r,4r)-4-(3-aminopropanamido)cyclohexyl)-2-hydroxyquinoline-4-carboxamide;

N-((1r,4r)-4-aminocyclohexyl)-2-hydroxyquinohne-4-carboxamide;

N-(1-(1-(L-alanyl)piperidin-4-yl)ethyl)-5,6,7,8-tetrahydronaphthalene-2-carboxamide;

N-((1r,4r)-4-(3-aminopropanamido)cyclohexyl)-5,6,7,8-tetrahydronaphthalene-2-carboxamide;

N-((1r,4r)-4-aminocyclohexyl)-5,6,7,8-tetrahydronaphthalene-2-carboxamide;

N-(1-(1-(L-alanyl)piperidin-4-yl)ethyl)pyrazine-2-carboxamide;

N-(1-(1-(L-alanyl)piperidin-4-yl)ethyl)-2-(4-fluorophenyl)acetamide;

3-amino-N-(1r,4r)-4-(2-(4-fluorophenyl)acetamido)cyclohexyl)propanamide;

N-((1r,4r)-4-aminocyclohexyl)-2-(4-fluorophenyl)acetamide;

4-((1-(1-(L-alanyl)piperidin-4-yl)ethyl)carbamoyl)pyridine 1-oxide;

4-(((1r,4r)-4-aminocyclohexyl)carbamoyl)pyridine 1-oxide;

4-amino-N-((1r,4r)-4-aminocyclohexyl)quinoline-6-carboxamide;

N-(1-(1-(L-alanyl)piperidin-4-yl)ethyl)-4-aminoquinoline-6-carboxamide:

(R)-2-oxo-N-(pyrrolidin-3-ylmethyl)indoline-5-carboxamide;

N-(4-(2-amino-N-methylacetamido)cyclohexyl -2-oxoindoline-5-carboxamide;

N-((1r,4r)-4-(3-aminopropanamido)cyclohexyl)-5-methylpyrazine-2-carboxamide;

N-(1-(1-(L-alanyl)piperidin-4-yl)ethyl)-2-(4-bromo-3,5-dimethyl-1H-pyrazol-1-yl)propanamide;

N-(1-(1-(L-alanyl)piperidin-4-yl)ethyl)-4-(3-methyl-5-oxo-4,5-dihydro-1H-pyrazol-1-yl)benzamide;

N-(1-(1-(L-alanyl)piperidin-4-yl)ethyl)-1-methyl-1H-indazole-6-carboxamide;

N-(1-(1-(L-alanyl)piperidin-4-yl)ethyl)-6-methoxy-2-naphthamide;

N-(1-(1-(L-alanyl)piperidin-4-yl)ethyl)-2-methoxyquinoline-4-carboxamide;

N-((1r,4r)-4-(3-aminopropanamido)cyclohexyl)-2-methoxyquinoline-4-carboxamide;

N-((1r,4r)-4-aminocyclohexyl)-2-methoxyquinoline-4-carboxamide;

N-(1-(1-(L-alanyl)piperidin-4-yl)ethyl)-4-oxo-4H-chromene-2-carboxamide;

N-(1-(1-(L-alanyl)piperidin-4-yl)ethyl)-4-hydroxyquinoline-2-carboxamide;

N-(1-(1-(L-alanyl)piperidin-4-yl)ethyl)-4-(4H-1,2,4-triazol-4-yl)benzamide;

N-(1-(1-(L-alanyl)piperidin-4-yl)ethyl)-4-(pyrrolidin-1-yl)benzamide;

N-(1-(1-(L-alanyl)piperidin-4-yl)ethyl)-benzo[d]thiazole-6-carboxamide;

N-(1-(1-(L-alanyl)piperidin-4-yl)ethyl)-5-chloro-1H-indole-2-carboxamide;

N-((1r,4r)-4-(3-aminopropanamido)cyclohexyl)-5-chloro-1H-indole-2-carboxamide;

N-((1r,4r)-4-aminocyclohexyl)-5-chloro-1H-indole-2-carboxamide;

N-(1-(1-(L-alanyl)piperidin-4-yl)ethyl)-1H-1-indole-2-carboxamide;

N-((1r,4r)-4-(3-aminopropanamido)cyclohexyl)-1H-indole-2-carboxamide;

N-((1r,4r)-4-aminocyclohexyl)-1H-indole-2-carboxamide;

N-((1r,4r)4-(3-aminopropanamido)cyclohexyl)-1H-indole-5-carboxamide;

5((1-(1-(L-alanyl)piperidin-4-yl)ethyl)carbamoyl)benzo[c][1,2,5]oxadiazole 1-oxide;

N-(1-(1-(L-alanyl)piperidin-4-yl)ethyl)benzo[c][1,2,5]oxadiazole-5-carboxamide;

N-(1-(1-(L-alanyl)piperidin-4-yl)ethyl)quinoxaline-2-carboxamide;

N-(1-(1-(L-alanyl)piperidin-4-yl)ethyl)imidazo[2,1-b]thiazole-6-carboxamide;

N-(1-(1-(L-alanyl)piperidin-4-yl)ethyl)-4-(1H-imidazol-1-yl)butanamide;

N-((1r,4r)-4-aminocyclohexyl)-5-fluoro-1H-indole-2-carboxamide;

N-(1-(1-(L-alanyl)piperidin-4-yl)ethyl)-1H-benzo[d]imidazole-2-carboxamide;

N-(1-(1-(L-alanyl)piperidin-4-yl)ethyl)-1-methyl-1H-indole-2-carboxamide;

N-((1r,4r)-4-(3-aminopropanamido)cyclohexyl)-1-methyl-1H-indole-2-carboxamide;

N-((1r,4r)-4-aminocyclohexyl)-1-methyl-1H-indole-2-carboxamide;

N-(1-(1-(L-alanyl)piperidin-4-yl)ethyl)-4-aminonicotinamide;

N-(1-(1-(L-alanyl)piperidin-4-yl)ethyl)-1H-indole-4-carboxamide;

N-(1-(1-(L-alanyl)piperidin-4-yl)ethyl)-2-hydroxyisonicotinamide;

N-(1-(1-(L-alanyl)piperidin-4-yl)ethyl)-2-hydroxyisonicotinamide;

N-((1r,4r)-4-aminocyclohexyl)picolinamide;

N-((1r,4r)-4-(3-aminopropanamido)cyclohexyl)pyrazine-2-carboxamide;

N-(1-(1-(L-alanyl)piperidin-4-yl)ethyl)-1-1H-imidazole-2-carboxamide;

N-(1-(1-(L-alanyl)piperidin-4-yl)ethyl)-3-methylisonicotinamide;

N-(1-(1-(L-alanyl)piperidin-4-yl)ethyl)-4-methylnicotinamide;

N-(1-(1-(L-alanyl)piperidin-4-yl)ethyl)-5-methylnicotinamide;

N-(1-(1-(L-alanyl)piperidin-4-yl)ethyl)-6-methylnicotinamide;

N-(1-(1-(L-alanyl)piperidin-4-yl)ethyl)-3-methylisothiazole-4-carboxamide;

N-(1-(1-(L-alanyl)piperidin-4-yl)ethyl)-1-methyl-1H-pyrazole-3-carboxamide;

N-(1-(1-(L-alanyl)piperidin-4-yl)ethyl)-3-(tert-butyl)-1-methyl-1H-pyrazole-5-carboxamide;

N-(1-(1-(L-alanyl)piperidin-4-yl)ethyl)-6-methoxypyrazine-2-carboxamide;

(1r,4S)-N-(1-(1-(L-alanyl)piperidin-4-yl)ethyl)-4-aminocyclohexane-1-carboxamide;

N-(1-(1-(L-alanyl)piperidin-4-yl)ethyl)-4-chloro-2-(trifluoromethyl)benzamide;

4-(((1r,4r)-4-(3-aminopronanamido)cyclohexyl)carbamoyl)pyridine 1-oxide;

N-(1-(1-(L-alanyl)piperidin-4-yl)ethyl)-6-fluoropicolinamide;

N-(1-(1-(L-alanyl)piperidin-4-yl)ethyl)-2,2-difluorobenzo[d][1,3]dioxole-4-carboxamide;

N-(1-(1-(L-alanyl)piperidin-4-yl)ethyl)-3-fluoroisonicotinamide;

N-(1-(1-(L-anayl)piperidin-4-yl)ethyl)-1H-indole-3-carboxamide;

N-((1r,4r)-4-aminocyclohexyl)pyrimidine-2-carboxamide;

N-((1r,4r)-4-(3-aminopropanamido)cyclohexyl)-6-hydroxypyridazine-3-carboxamide;

N-((1r,4r)-4-aminocyclohexyl)-6-hydroxypyridazine-3-carboxamide;

N-((1r,4r)-4-(3-aminopropanamido)cyclohexyl)-1H-indole-6-carboxamide;

N-(1-(1-(L-alanyl)piperidin-4-yl)ethyl)-4,6-dimethyl-2-oxo-1,2-dihydropyridine-3-carboxamide;

N-((1r,4r)-4-aminocyclohexyl)-1-methyl-1H-indazole-6-carboxamide;

N-((1r,4r)-4-aminocyclohexyl)-6-methoxy-2-naphthamide;

N-((1r,4r)-4-aminocyclohexyl -4-oxo-4H-chromene-2-carboxamide;

N-((1r,4r)-4-aminocyclohexyl)-4-(4H-1,2,4-triazol-4-yl)benzamide;

N-((1r,4r)-4-(3-aminopropanamido)cyclohexyl)-4-(pyrrolidin-1-yl)benzamide;

N-((1r,4r)-4-aminocyclohexyl)-4-(pyrrolidin-1-yl)benzamide;

N-((4r,4r)-4-(3-aminopropanamido)cyclohexyl)benzo[d]thiazole-6-carboxamide;

N-(1-(1-(L-alanyl)piperidin-4-yl)ethyl)-1H-indole-5-carboxamide;

N-(1-(1-(L-alanyl)piperidin-4-yl)ethyl)-2,2-difluorobenzo[d][1,3]dioxole-5-carboxamide;

N-((1r,4r)-4-aminocyclohexyl)-2,2-difluorobenzo[d][1,3]dioxole-5-carboxamide;

5-(((1r,4r)-4-aminocyclohexyl)carbamoyl)benzo[c][1,2,5]oxadiazole 1-oxide;

N-((1r,4r)-4-aminocyclohexyl)benzo[c][1,2,5]oxadiazole-5-carboxamide:

4-amino-N-((1r,4r)-4-(3-aminopropanamido)cyclohexyl)nicotinamide;

4-amino-N-((1r,4r)-4-aminocyclohexyl)nicotinamide;

N-((1r,4r)-4-(3-aminopropanamido)cyclohexyl)-1H-indole-4-carboxamide;

N-((1r,4r)-4-aminocyclohexyl)-1H-indole-4-carboxamide;

N-((1r,4r)-4-aminocyclohexyl)-2-hydroxyisonicotinamide;

N-(1r,4r)-4-aminocyclohexyl)-2-hydroxyisonicotinamide;

N-((1r,4r)-4-(3-aminopropanamido)cyclohexyl)-6-hydroxynicotinamide;

N-((1r,4r)-4-aminocyclohexyl)-6-hydroxynicotinamide;

N-(1-(1-(L-alanyl)piperidin-4-yl)ethyl)picolinamide;

N-(4-(3-aminopropanamido)cyclohexyl)picolinamide;

N-((1r,4r)-4-aminocyclohexyl)pyrazine-2-carboxamide;

N-(1-(1-(L-alanyl)piperidin-4-yl)ethyl)-3-(tert-butyl)-1-(3-methylbenzyl)-1H-pyrazole-5-carboxamide;

N-(1-(1-(L-alanyl)piperidin-4-yl)ethyl)-7-methyl-1H-indole-2-carboxamide;

N-(1-(1-(L-alanyl)piperidin-4-yl)ethyl)-6-methoxypicolinamide;

N-(1-(1-(L-alanyl)piperidin-4-yl)ethyl)-5-methoxypyrazine-2-carboxamide;

(1r,4r)-4-amino-N-((1r,4r)-4-(3-aminopropanamido)cyclohexyl)cyclohexane-1-carboxamide;

(1r,4r)-4-amino-N-((1r,4r)-4-aminocyclohexyl)cyclohexane-1-carboxamide;

(2S,4S)-N-(1-(1-(L-alanyl)piperidin-4-yl)ethyl)-4-fluropyrrolidine-2-carboxamide;

(3R)-N-(1-(1-(L-alanyl)piperidin-4-yl)ethyl)-1,2,3,4-tetrahydroisoquinoline-3-carboxamide;

N-((1r,4r)-4-aminocyclohexyl)-2,2-difluorobenzo[d][1,3]dioxole-4-carboxamide;

N-((1r,4r)-4-aminocyclohexyl)-3-fluoroisonicotinamide;

N-(1-(1-(L-alanyl)piperidin-4-yl)ethyl)thiazole-5-carboxamide;

N-(1-(1-(L-alanyl)piperidin-4-yl)ethyl)-5-hydroxypicolinamide;

N-(1-(1-(L-alanyl)piperidin-4-yl)ethyl)-6-oxo-1,4,5,6-tetrahydropyridazine-3-carboxamide;

N-(1-(1-(L-alanyl)piperidin-4-yl)ethyl)-1H-indazole-3-carboxamide;

N-(1-(1-(L-alanyl)piperidin-4-yl)ethyl)-2-(3,5-difluorophenyl)acetamide;

N-(1-(1-(L-alanyl)piperidin-4-yl)ethyl)-2-(pyridin-3-yl)acetamide;

N-(1-(1-(L-alanyl)piperidin-4-yl)ethyl)-2-(pyrimidin-5-yl)acetamide;

N-(1-(1(L-alanyl)piperidin-4-yl)ethyl)-2-(1H-imidazol-1-yl)acetamide;

N-((1r,4r)-4-(3-aminopropanamido)cyclohexyl)imidazo[2,1-b]thiazole-6-carboxamide;

N-((1r,4r)-4-aminocyclohexyl)imidazo[2,1-b]thiazole-6-carboxamide;

N-((1r,4r)-4-aminocyclohexyl)imidazo[2,1-b]thiazole-6-carboxamide;

N-((1r,4r)-4-aminocyclohexyl)-2-methylpyrimidine-5-carboxamide;

2-amino-N-((1r,4r)-4-(3-aminopropanamido)cyclohexyl)isonicotinamide;

2-amino-N-((1r,4r)-4-aminocyclohexyl)isonicotinamide;

N-(1-(1-(L-alanyl)piperidin-4-yl)ethyl)-4-sulfamoylbenzamide;

N-((1r,4r)-4-aminocyclohexyl)-4,6-dimethyl-2-oxo-1,2-dihydropyridine-3-carboxamide;

N-((1r,4r)-4-(3-aminopropanamido)cyclohexyl)-1-methyl-1H-indazole-6-carboxamide;

N-((1r,4r)-4-(3-aminopropanamido)cyclohexyl)-6-methoxy-2-naphthamide;

N-(1r,4r)4-(3-aminopropanamido)cyclohexyl)-4-oxo-4H-chromene-2-carboxamide;

N-((1r,4r)-4-aminocyclohexyl)-4-hydroxyquinoline-2-carboxamide;

N-((1r,4r)-4-(3-aminopropanamido)cyclohexyl)-4-(4H-1,2,4-triazol-4-yl)benzamide;

N-((1r,4r)-4-(3-aminopropanamido)cyclohexyl)-2,2-difluorobenzo[d][1,3]dioxole-5-carboxamide;

5-(((1r,4r)-4-(3-aminopropanamido)cyclohexyl)carbamoyl)benzo[c][1,2,5]oxadiazole 1-oxide;

N-((1r,4r)-4-(3-aminopropanamido)cyclohexyl)benzo[c][1,2,5]oxadiazole-5-carboxamide;

N-((1r,4r)-4-aminocyclohexyl)-4-(1H-imidazol-1-yl)butanamide;

N-(1-(1-(L-alanyl)piperidin-4-yl)ethyl)-2-(6-methoxynaphthalen-2-yl)propanamide;

N-((1r,4r)-4-(3-aminopropanamido)cyclohexyl)-5-fluoro-1H-indole-2-carboxamide;

N-((1r,4r)-4-aminocyclohexyl)-1H-benzo[d]imidazole-2-carboxamide;

N-((1r,4r)-4-aminocyclohexyl)-1-methyl-1H-imidazole-2-carboxamide;

(1r,4r)-N-(1-(1-(L-alanyl)piperidin-4-yl)ethyl)bicyclo[2.2.1]hept-5-ene-2-carboxamide;

N-((1r,4r)-4-aminocyclohexyl)-4-methylnicotinamide;

N-((1r,4r)-4-(3-aminopropanamido)cyclohexyl)-3-(tert-butyl)-1-(3-methylbenzyl)-1H-pyrazole-5-carboxamide;

N-((1r,4r)-4-aminocyclohexyl)-3-(tert-butyl)-1-(3-methylbenzyl)-1H-pyrazole-5-carboxamide;

N-((1r,4r)-4-(3-aminopropanamido)cyclohexyl)-7-methyl-1H-indole-2-carboxamide;

N-((1r,4r)-4-aminocyclohexyl)-7-methyl-1H-indole-2-carboxamide;

N-((1r,4r)-4-(3-aminopropanamido)cyclohexl)-5-methylnicotinamide;

N-((1r,4r)-4-aminocyclohexyl)-5-methylnicotinamide:

N-((1r,4r)-4-aminocyclohexyl)-6-methylnicotinamide;

N-((1r,4r)-4-(3-aminopropanamido)cyclohexyl)-3-methylisothiazole-4-carboxamide;

N-((1r,4r)-4-aminocyclohexyl)-3-methylisothiazole4-carboxamide;

N-((1r,4r)-4-(3-aminopropanamido)cyclohexyl)-1-methyl-1H-pyrazole-3-carboxamide;

N-((1r,4r)-4-aminocyclohexyl)-1-methyl-1H-pyrazole-3-carboxamide;

N-((1r,4r)-4-(3-aminopropanamido)cyclohexyl)-3-(tert-butyl)-1-methyl-1H-pyrazole-5-carboxamide;

N-((1r,4r)-4-aminocyclohexyl)-3-(tert-butyl)-1-methyl-1H-pyrazole-5-carboxamide;

N-((1r,4r)-4-(3-aminopropanamido)cyclohexyl)-6-methoxypicolinamide;

N-((1r,4r)-4-aminocyclohexyl)-6-methoxypicolinamide;

N-((1r,4r)4-(3-aminopropanamido)cyclohexyl)-6-methoxypyrazine-2-carboxamide;

N-((1r,4r)-4-aminocyclohexyl)-6-methoxynyrazine-2-carboxamide;

N-(1-(1-(L-alanyl)piperidin-4-yl)ethyl)-5-aminopicolinamide;

N-((1r,4r)-4-aminocyclohexyl)-4-chloro-2-(trifluoromethyl)benzamide;

N-((1r,4r)-4-aminocyclohexyl)thiazole-5-carboxamide;

N-((1r,4r)-4-aminocyclohexyl)-1H-indole-3-carboxamide;

N-((1r,4r)-4-(3-aminopropanamido)cyclohexyl)-5-hydroxypicolinamide;

N-((1r,4r)-4-aminocyclohexyl)-2-(3,5-difluorophenyl)acetamide;

3-amino-N-((1r,4r)-4-(2-(pyridin-3-yl)acetamido)cyclohexyl)propanamide;

3-amino-N-((1r,4r)-4-(2-(pyrimidin-5-yl)acetamido)cyclohexyl)propanamide;

N-((1r,4r)-4-aminocyclohexyl)-2-(pyrimidin-5-yl)acetamide;

N-((1r,4r)-4-(2-(1H-imidazol-1-yl)acetamido)cyclohexyl)-3-aminopropanamide;

N-((1r,4r)-4-aminocyclohexyl)benzo[d]thiazole-2-carboxamide;

N-(1-(1-(L-alanyl)piperidin-4-yl)ethyl)-1H-indole-6-carboxamide;

N-((1r,4r)-4-(3-aminopropanamido)cyclohexyl)-1H-benzo[d]imidazole-5-carboxamide;

N-(1-(1-(L-alanyl)piperidin-4-yl)ethyl)-4-methoxy-1H-indole-3-carboxamide;

N-((1r,4r)-4-(3-aminopropanamido)cyclohexyl)-4-methoxy-1H-indole-3-carboxamide;

N-((1r,4r)-4-aminocyclohexyl)-4-methoxy-1H-indole-3-carboxamide;

N-((1r,4r)-4-(3-aminopropanamido)cyclohexyl)quinoxaline-2-carboxamide;

N-((1r,4r)-4-(3-aminonropanamido)cyclohexyl)-1H-benzo[d]imidazole-2-carboxamide;

N-((1r,4r)-4-(3-aminopropanamido)cyclohexyl)-4-(1H-imidazol-1-yl)butanamide;

N-((1r,4r)-4-(3-aminopropanamidolcyclohexyl)-2-hydroxyisonicotinamide;

N-(1-(1-(L-alanyl)piperidin-4-yl)ethyl)-6-hydroxynicotinamide;

N-((1r,4r)-4-(3-aminopropanamido)cyclohexyl)-3-methylisonicotinamide;

N-((1r,4r)-4-aminocyclohexyl)-3-methyl)isonicotinamide;

N-((1r,4r)-4-(3-aminopropanamido)cyclohexyl)-4-methylnicotinamide:

N-((1r,4r)-4-(3-aminopropanamido)cyclohexyl)-6-methylnicotinamide;

N-((1r,4r)-4-(3-aminopropanamido)cyclohexyl)-5-methoxypyrazine-2-carboxamide;

N-((1r,4r)-4-aminocyclohexyl)-5-methoxypyrazine-2-carboxamide;

6-amino-N-((1r,4r)-4-(3-aminopropanamido)cyclohexyl)picolinamide;

6-amino-N-((1r,4r)-4-aminocyclohexyl)picolinamide;

N-(1-(1-(L-alanyl)piperidin-4-yl)ethyl)-6-aminonicotinamide;

6-amino-N-((1r,4r)-4-(3-aminopropanamido)cyclohexyl)nicotinamide;

N-((1r,4r)-4-aminocyclohexyl)-6-fluoropicolinamide;

N-((1r,4r)-4-(3-aminopropanamido)cyclohexyl)-3-fluoroisonicotinamide;

N-((1r,4r)-4-(3-aminopropanamido)cyclohexyl)-1H-indole-3-carboxamide;

N-(1-(1-(L-lanyl)piperidin-4-yl)ethyl)-2-methylisonicotinamide;

N-((1r,4r)-4-(3-aminopropanamido)cyclohexyl)-2-methylisonicotinamide;

N-((1r,4r)-4-aminocyclohexyl)-2-methylisonicotinamide;

N-(1-(1-(L-alanyl)piperidin-4-yl)ethyl)benzo[d]thiazole-2-carboxamide;

N-(1-(1-(L-alanyl)piperidin-4-yl)ethyl)-5-methylthiazole-2-carboxamide;

N-((1r,4r)-4-(3-aminopropanamido)cyclohexyl)-5-methylthiazole-2-carboxamide;

N-((1r,4r)-4-aminocyclohexyl)-5-methylthiazole-2-carboxamide;

N-(1-(1-(L-alanyl)piperidin-4-yl)ethyl)-2-oxoindoline-4-carboxamide;

N-((1r,4r)-4-aminocyclohexyl)-2-oxoindoline-4-carboxamide;

N-((1r,4r)-4-(3-aminopropanamido)cyclohexyl)-4,6-dimethyl-2-oxo-1,2-dihydropyridine-3-carboxamide;

N-((1r,4r)-4-aminocyclohexyl 4-(3-methyl-5-oxo-4,5-dihydro-1H-pyrazol-1-yl)benazmide;

N-((1r,4r)-4-(3-aminonpropanamido)cyclohexyl)-4-hydroxyquinoline-2-carboxamide;

N-((1r,4r)-4-aminocyclohexyl)quinoxaline-2-carboxamide;

N-(1-(1-(L-alanyl)piperidin-4-yl)ethyl)-2-(1H-pyrrolo[3,2-b]pyridin-3-yl)acetamide;

N-((1r,4r)-4-(2-(1H-pyrrolo[3,2-b]pyridin-3-yl)acetamido)cyclohexyl)-3-aminopropanamide;

N-((1r,4r)4-aminocyclohexyl)-2-(1H-pyrrolo[3,2-b]pyridin-3-yl)acetamide;

N-(1-(1-(L-alanyl)piperidin-4-yl)ethyl)-2-hydroxynicotinamide;

N-((1r,4r)-4-(3-aminopropanamido)cyclohexyl)-2-hydroxynicotinamide;

N-((1r,4r)-4-aminocyclohexyl)-2-hydroxynicotinamide;

N-((1r,4r)-4-(3-aminopropanamido)cyclohexyl)-1-methyl-1H-imidazole-2-carboxamide;

N-(1-(1-(L-alanyl)piperidin-4-yl)ethyl)-1-methyl-1H-pyrazole-5-caeboxamide;

N-((1r,4r)-4-(3-aminopronanamido)cyclohexyl)-1-methyl-1H-pyrazole-5-carboxamide;

N-((1r,4)-4-aminocyclohexyl)-1-methyl-1H-pyrazole-5-carboxamide;

(1R,4R)-N-((1r,4R)-4-(3-aminopropanamido)cyclohexyl)bicyclo[2.2.1]hept-5-ene-2-carboxamide;

(1r,4r)-N-((1r,4R)-4-aminocyclohexyl)bicyclo[2.2.1]hept-5-ene-2-carboxamide;

N-(1-(1-(L-alanyl)piperidin-4-yl)ethyl)-6-aminopicolinamide;

N-(1-(1-(L-alanyl)piperidin-4-yl)ethyl)-4-aminopyrimidine-5-carboxamide;

4-amino-N-((1r,4r)-4-(3-aminopropanamido)cyclohexyl)pyrimidine-5-carboxamide;

4-amino-N-((1r,4r)-4-aminocyclohexyl)pyrimidine-5-carboxamide;

N-((1r,4r)-4-(3-aminopronanamido)cyclohexyl)-6-fluoronicolinamide;

N-((1r,4r)-4-aminocyclohexyl)-5-hydroxypicolinamide;

N-((1r,4r)-4-aminocyclohexyl -6-oxo-1,4,5,6-tetrahydropyridazine-3-carboxamide;

N-((1r,4r)4-(3-aminopropanamido)cyclohexyl)-1H-indazole-3-carboxamide;

N-((1r,4r)-4-aminocyclohexyl)-2-(1H-imidazol-1-yl)acetamide;

N-((1r,4r)-4-(3-aminopropanamido)cyclohexyl)benzo[d]thiazole-2-carboxamide;

(1r,4r)-4-amino-N-(2-oxoindolin-5-yl)cyclohexane-1-carboxamide;

N-((1r,4r)-4-aminocyclohexyl)-2-oxoindoline-5-sulfonamide;

N-((1r,4r)-4-(3-aminopropanamido)cyclohexyl)-2-oxoindoline-4-carboxamide;

3-amino-N-((1r,4r)-4-(2-(4-bromo-3,5-dimethyl-1H-pyrazol-1-yl)propanamido)cyclohexyl)propanamide;

N-((1r,4r)-4-(3-aminopropanamido)cyclohexyl)-4-(3-methyl-5-oxo-4,5-dihydro-1H-pyrazol-1-yl)benzamide;

(2R,4S)-N-(1-(1-(L-alanyl)piperidin-4-yl)ethyl)-4-hydroxypyrrolidine-2-carboxamide;

(2R,4S)-N-((1r,4r)-4-(3-aminopropanamido)cyclohexyl)-4-hydroxypyrrolidine-2-carboxamide;

(2R,4S)-N-(((1r,4r)-4-aminocyclohexyl)-4-hydroxypyrrolidine-2-carboxamide;

(R)-N-((1r,4r)-4-aminocyclohexyl)-1,2,3,4-tetrahydroquinoline-2-carboxamide;

5-amino-N-((1r,4r)-4-(3-aminopropanamido)cyclohexyl)picolinamide;

5-amino-N-((1r,4r) -4-aminocyclohexyl)picolinamide;

N-((1r,4r)-4-(3-aminopropanamido)cyclohexyl)-4-chloro-2-(trifluoromethyl)benzamide;

N-((1r,4r)-4-(3-aminopropanamido)cyclohexyl)-2,2-difluorobenzo[d][1,3]dioxole-4-carboxamide; carboxamide:

N-(1-(1-(L-alanyl)piperidin-4-yl)ethyl)-3,5-dihydroxy-2-naphthamide;

N-((1r,4r)-4-(3-aminopropanamido)cyclohexyl)thiazole-5-carboxamide;

3-amino-N-((1r,4r)-4-(2-(3,5-difillorophenyl)acetamido)cyclohexyl)propanamide;

5-acetamido-N-((1r,4r)-4-aminocyclohexyl)picolinamide;

N-(1-(1-(L-alanyl)piperidin-4-yl)ethyl)imidazol[1,2-b]pyridazine-2-carboxamide;

N-((1r,4r)-4-(3-aminopropanamido)cyclohexyl)imidazo[1,2-b]pyridazine-2-carboxamide;

N-((1r,4r)-4-aminocyclohexyl)imidazo[1,2-b]pyridazine-2-carboxamide;

N-((1r,4r)-4-aminocyclohexyl)-2-(2-oxoindolin-5-yl)acetamide;

3-amino-N-((1r,4r)-4-((2-oxoindoline)-5-sulfonamido)cyclohexyl)propanamide;

N-(1-(1-(L-alanyl)piperidin-4-yl)ethyl)-2-methyl-3-oxo-3,4-dihydro-2H-benzo[b][1,4]oxazine-6-carboxamide;

N-((1r,4r)-4-(3-aminopropanamido)cyclohexyl)-2-methyl-3-oxo-3,4-dihydro-2H-benzo[b][1,4]oxazine-6-carboxamide;

N-((1r,4r)-4-aminocyclohexyl -2-methyl-3-oxo-3,4-dihydro-2H-benzo[b][1,4]oxazine-6-carboxamide;

N-((1r,4r)-4-((R)-3-aminobutanamido)cyclohexyl)-2-oxoindoline-5-carboxamide;

N-((1r,4r)-4-aminocyclohexyl)-2-(4-bromo-3,5-dimethyl-1H-pyrazol-1-yl)propanamide;

N-((1r,4r)-4-aminocyclohexyl)-4-(1H-1,2,4-triazol-1-yl)benzamide;

N-((1r,4r)-4-(3-aminopropanamido)cyclohexyl)-2-hydroxyquinoline-3-carboxamide;

N-((1r,4r)-4-aminocyclohexyl)-2-(3-(trifluoromethyl)phenyl)acetamide;

3-amino-N-((1r,4r)-4-aminocyclohexyl)-2-methylquinoline-4-carboxamide;

(3R)-N-(4-aminocyclohexyl)-1,2,3,4-tetrahydroisoquinoline-3-carboxamide;

N-((1r,4r)-4-aminocyclohexyl)-3,5-dihydroxy-2-naphthamide;

N-(1-(1-(L-alanyl)piperidin-4-yl)ethyl)-5-acetamidopicolinamide;

5-acetamido-N-((1r,4r)-4-(3-aminopropanamido)cyclohexyl)picolinamide;

N-(1-(1-(L-alanyl)piperidin-4-yl)ethyl)-5-cyclopropyl-1,2,4-oxoadiazole-3-carboxamide;

3-amino-N-((1r,4r)-4-(2-(2-oxoindolin-5-yl)acetamido)cyclohexyl)propanamide;

N-(1-(1-(L-alanyl)piperidin-4-yl)ethyl)-2-(2-oxoindolin-5-yl)acetamide;

(1r,4r)-4-(3-aminopropanamido)-N-(2-oxoindolin-5-yl)cyclohexane-1-carboxamide;

3-amino-N-(2,2-dimethyl-3-((2-oxoindoline)-5-sulfonamido)propyl)propanamide:

N-(1-(1-(L-alanyl)piperidin-4-yl)ethyl)-1-oxoisoindoline-5-carboxamide;

N-((1r,4r)-4-aminocyclohexyl)-2,3-dioxoindoline-5-carboxamide;

N-((1r,4r)-4-(3-aminopropanamido)cyclohexyl)-2-oxoindoline-5-carboxamide;

N-(1-(1-(L-alanyl)piperidin-4-yl)ethyl)-4-(1H-1,2,4-triazol-1-yl)benzamide;

N-((1r,4r)-4-(3-aminopropanamido)cyclohexyl)-4-(1H-1,2,4-triazol-1-yl)benzamide;

N-(1-(1-(L-alanyl)piperidin-4-yl)ethyl)-2-hydroxyquinoline-3-carboxamide;

N-((1r,4r)-4-aminocyclohexyl -2-hydroxyquinoline-3-carboxamide;

N-(1-(1-(L-alanyl)piperidin-4-yl)ethyl)-2-(3-trifluoromethyl)phenyl)acetamide;

3-amino-N-(1r,4r)-4-(2-(3-(trifluoromethyl)phenyl)acetamido)cyclohexyl)propanamide;

3-amino-N-((1r,4r)-4-(3-aminopropanamido)cyclohexyl)-2-methylquinoline-4-carboxamide;

N-((1r,4r)-4-(3-aminopropanamido)cyclohexyl)-3,5-dihydroxy-2-naphthamide;

N-((1r,4r)-4-aminocyclohexyl)-3-hydroxypicolinamide;

N-((1r,4r)-4-(3-aminopropanamido)cyclohexyl)-6-oxo-1,4 5,6-tetrahydropyridazine-3-carboxamide;

(E)-N-((1r,4r)-4-(3-aminopropanamido)cyclohexyl)-3-(1H-imidazol-4-yl)acrylamide;

N-((1r,4r)-4-aminocyclohexyl)-5-cyclopropyl-1,2,4-oxadiazole-3-carboxamide;

N-((1r,4r)-4-(3-aminopropanamido)cyclohexyl)-5-cyclopropyl-1,2,4-oxadiazole-3-carboxamide;

2-amino-N-(2,2-dimethyl-3((2-oxoindoline)-5-sulfonamido)propyl)acetamide;

N-((1r,4r)-4-aminocyclohexyl)-1-oxoisoindoline-5-carboxamide;

N-(1-(1-(L-alanyl)piperidin-4-yl)ethyl)-2,3-dioxoindoline-5-carboxamide;

N-(1-(1-(L-alanyl)piperidin-4-yl)ethyl)-3-amino-2-methylquinoline-4-carboxamide;

N-(1-(1-(L-alanyl)piperidin-4-yl)ethyl)-6-chloro-2-oxoindoline-5-carboxamide;

N-((1r,4r)-4-(3-aminopropanamido)cyclohexyl)-6-chloro-2-oxoindoline-5-carboxamide;

N-((1r,4r)-4-aminocyclohexyl)-6-chloro-2-oxoindoline-5-carboxamide;

N-((1r,4r)-4-aminocyclohexyl)-4-hydroxypyrimidine-5-carboxamide;

(E)-N-(1-(1-(L-alanyl)piperidin-4-yl)ethyl)-3-(1H-imidazol-4-yl)acrylamide;

(E)-N-((1r,4r)-4-aminocyclohexyl)-3-(1H-imidazol-4-yl)acrylamide;

N-(1-(1-(L-alanyl)piperidin-4-yl)ethyl)-1H-pyrazolo[3,4-c]pyridine-5-carboxamide;

N-((1r,4r)-4-aminocyclohexyl)-1H-pyrazolo[3,4-c]pyridine-5-carboxamide;

N-(1-(1-(L-alanyl)piperidin-4-yl)ethyl)-6-fluorobenzo[d]thiazole-2-carboxamide;

N-(1r,4r)-4-(3-aminopropanamido)cyclohexyl)-6-fluorobenzo[d]thiazole-2-carboxamide;

N-((1r,4r)-4-aminocyclohexyl)-6-fluorobenzo[d]thiazole-2-carboxamide;

N-((1r,4r)-4-aminocyclohexyl)-1H-imidazole-2-carboxamide;

N-((1r,4r)-4-(3-aminopropanamido)cyclohexyl)-1-oxoisoindoline-5-carboxamide;

N-((1r,4r)-4-(3-aminopropanamido)cyclohexyl)-2,3-dioxoindoline-5-carboxamide;

N-((1r,4r)-4-(3-aminopropanamido)cyclohexyl)-2-oxoindoline-7-carboxamide;

N-(4-aminocyclohexyl)-2-oxoindoline-7-carboxamide;

N-((1r,4r)-4-aminocyclohexyl)-1-methyl-1H-1,2,4-triazole-5-carboxamide;

3-amino-N-((1r,4r)-4-aminocyclohexyl)-1H-1,2,4-triazole-5-carboxamide;

N-(1-(1-(L-alanyl)piperidin-4-yl)ethyl)-4-hydroxypyrimidine-5-carboxamide;

N-((1r,4)-4-(3-aminopropanamido)cyclohexyl)-4-hydroxypyrimidine-5-carboxamide;

N-(1-(1-(L-alanyl)piperidin-4-yl)ethyl)-3-hydroxypicolinamide;

N-(((1r,4r)-4-(3-aminopropanamido)cyclohexyl)-3-hydroxypicolinamide;

N-(1-(1-(L-alanyl)piperidin-4-yl)ethyl)-5-hydroxynicotinamide;

N-((1r,4r)-4-(3-aminopropanamido)cyclohexyl)-5-hydroxynicotinamide;

N-((1r,4r)-4-aminocyclohexyl)-5-hydroxynicotinamide;

N-(4-aminocyclohexyl)-1H-imidazole-4-carboxamide;

N-(4-(3-aminopropanamido)cyclohexyl)-1H-imidazole-2-carboxamide;

N-((1r,4r)-4-(3-aminopropanamido)cyclohexyl)-2-methyl-1H-indole-5-carboxamide;

N-((1r,4r)-4-aminocyclohexyl -2-methyl-1H-indole-5-carboxamide;

N-((1r,4r)-4-aminocyclohexyl)-1H-imidazole-4-carboxamide;

N-((1r,4r)-4-aminocyclohexyl)-2-methyl-1H-imidazole-5-carboxamide;

N-(1-(1-(L-alanyl)piperidin-4-yl)ethyl)-4H-1,2,4-triazole-3-carboxamide;

N-((1r,4r)-4-(3-aminopropanamido)cyclohexyl)-4H-1,2,4-triazole-3-carboxamide;

N-(1-(1-(L-alanyl)piperidin-4-yl)ethyl)-5-chloro-1H-pyrazole-3-carboxamide;

N-((1r,4r)-4-(3-aminopropanamido)cyclohexyl)-5-chloro-1H-pyrazolle-3-carboxamide;

N-((1r,4r)-(3-aminopropanamido)cyclohexyl)-1H-pyrazolo[3,4-c]pyridine-5-carboxamide;

N-((1r,4r)-4-(3-aminopropanamido)cyclohexyl)-5-oxo-4,5-dihydro-1H-1,2,4-triazole-3-carboxamide;

N-((1r,4r)-4-aminocyclohexyl)-5-oxo-4,5-dihydro-1H-1,2,4-triazole-3-carboxamide;

N-((1r,4r)-4-(3-aminopropanamido)cyclohexyl)thiazolo[5,4-c]pyridine-2-carboxamide;

N-((1r,4r)-4-aminocyclohexyl)thiazolo[5,4-c]pyridine-2-carboxamide;

N-((1r,4r)-4-aminocyclohexyl)-5-ethyl-1H-1,2,4-triazole-3-carboxamide;

N-((1r,4r)-4-(3-aminopropanamido)cyclohexyl)-5-ethyl-4H-1,2,4-triazole-3-carboxamide;

N-((1r,4r)-4-(3-aminopropanamido)cyclohexyl)-1H-imidazole-4-carboxamide;

N-(1-(1-(L-alanyl)piperidin-4-yl)ethyl)-2-methyl-1H-indole-5-carboxamide;

N-((1R,4r)-4-((1r,4R)-4-aminocyclohexane-1-carboxamido)cyclohexyl)-1H-1,2,4-triazole-5-carboxamide;

N-((1r,4r)-4-(4-aminobutanamido)cyclohexyl)-4H-1,2,4-triazole-3-carboxamide;

N-((1r,4r)-4-aminocyclohexyl -5-chloro-1H-1,2,4-triazole-3-carboxamide;

N-((1r,4r)-4-aminocyclohexyl)-5-methyl-1H-imidazole-4-carboxamide;

N-((1r,4r)-4-(3-aminopropanamido)cyclohexyl)-5-methyl-4H-1,2,4-triazole-3-carboxamide;

N-((1r,4r)-4-aminocyclohexyl)-1-methyl-1H-1,2,4-triazole-3-carboxamide;

N-((1r,4r)-4-aminocyclohexyl)-5-chloro-1H-pyrazole-3-carboxamide;

N-(1-(1-(L-alanyl)piperidin-4-yl)ethyl)-5-oxo-4,5-dihydro-1H-1,2,4-triazole-3-carboxamide;

N-(1-(2-(piperidin-4-yl)acetyl)piperidin-4-yl)-4H-1,2,4-triazole-3-carboxamide;

N-((1r,.4r)-4-aminocyclohexyl)-3-iodo-1H-1,2,4-triazole-5-carboxamide;

N-(1-(1-(L-alanyl)piperidin-4-yl)ethyl)-3-methyl-1H-1,2,4-triazole-5-carboxamide;

N-((1r,4r)-4-aminocyclohexyl)-5-methyl-1H-1,2,4-triazole-3-carboxamide;

N-(1-(1-(L-alanyl)piperidin-4-yl)ethyl)thiazolo[5,4-c]pyridine-2-carboxamide;

N-(1-(1-(L-alanyl)piperidin-4-yl)ethyl)-5-ethylthiazole-2-carboxamide;

N-((1r,4r)-4-(3-aminopropanamido)cyclohexyl)-5-ethylthiazole-2-carboxamide;

N-((1r,4r)-4-aminocyclohexyl)-5-ethylthiazole-2-carboxamide;

N-(1-((1r,4r)-4-aminocyclohexane-1-carbonyl)piperidin-4-yl)-4H-1,2,4-triazole-3-carboxamide;

N-(1-(3-aminopropanoyl)piperidin-4-yl)-4H-1,2,4-triazole-3-carboxamide;

(Β±)-trans-N-(1-(4-aminocyclohexane-1-carbonyl)-2-methylpiperidin-4-yl)benzamide;

(Β±)-cis-N-(1-(4-aminocyclohexane-1-carbonyl)-2-methylpiperidin-4-yl)benzamide;

N-((1r,4r)-4-aminocyclohexyl)-2-oxo-2,3-dihydro-1H-pyrrolo[2,3-c]pyridine-5-carboxamide;

N-(1-(4-aminobutanoyl)piperidin-4-yl)-4H-1,2,4-triazole-3-carboxamide;

N-((1r,4r)-4-aminocyclohexyl)-N-methyl-1H-1,2,4-triazole-5-carboxamide;

N-((1r,4r)-4-aminocyclohexyl)-4-methyl-1H-imidazole-2-carboxamide;

(Β±)-trans-N-(1-((3-aminopropyl)sulfonyl)-2-methylpiperidin-4-yl)benzamide;

(Β±)-cis-N-(1-((3-aminopropyl)sulfonyl)-2-methylpiperidin-4-yl)benzamide;

N-((1r,4r)-4-aminocyclohexyl)-6-bromo-2-hydroxyquinoline-3-carboxamide;

N-((1r,4r)-4-(3-aminopropanamido)cyclohexyl)-6-bromo-2-hydroxyquinoline-3-carboxamide;

(Β±)-cis-N-(1-(4-aminocyclohexane-1-carbonyl)-2-methylpiperidin-4-yl)benzamide;

(Β±)-cis-N-(1-((3-aminopropyl)sulfonyl)-2-methylpiperidin-4-yl)-[1,1β€²-biphenyl]-4-carboxamide;

(Β±)-cis-N-(1-((3-aminopropyl)sulfonyl)-2-methylpiperidin-4-yl)-3-ethylbenzamide;

(Β±)-cis-N-(1-(((3-aminopropyl)sulfonyl)-2-methylpiperidin-4-yl)benzamide;

(Β±)-trans-N-(1-(4-aminocyclohexane-1-carbonyl)-2-methylpiperidin-4-yl)benzamide;

2-amino-N-((1r,4r)-4-aminocyclohexyl)-1H-imidazole-4-carboxamide;

(Β±)-trans-N-(1-((3-aminopropyl)sulfonyl)-2-methylpiperidin-4-yl)-3-ethylbenzamide;

N-((1r,4r)-4-aminocyclohexyl)imidazo[1,2-a]pyrimidine-3-carboxamide;

N-((1R,3R,5S)-8-(((1r,4R)-4-aminocyclohexyl)sulfonyl)-8-azabicyclo[3.2.1]octan-3-yl)-2-oxoindoline-5-carboxamide;

N-((1R,3r,5S)-8-((4-aminopiperidin-1-yl)sulfonyl)-8-azabicyclo[3.2.1]octan-3-yl)-6-fluoro-2-oxoindoline-5-carboxamide;

N-((1R,3r,5S)-8-(((1-methylpiperidin-4-yl)methyl)sulfonyl)-8-azabicyclo[3.2.1]octan-3-yl)-2-oxoindoline-5-carboxamide;

N-((1R,3r,5S)-8-((4-aminopiperidin-1yl)sulfonyl)-8-azabicyclo[3.2.1]octan-3yl)-2-oxoindoline-5-carboxamide;

N-((1R,3r,5S)-8-((4-aminopiperidin-1-yl)sulfonyl)-8-azabicyclo[3.2.1]octan-3-yl)-6-chloro-2-oxoindoline-5-carboxamide;

N-((2S,4S)-1((4-aminopiperidin-1-yl)sulfonyl)-2-methylpiperidin-4-yl)-2-oxoindoline-5-carboxamide;

N-((1R,3r,5S)-8-(((1-(3-hydroxypropyl)piperidin-4-yl)methyl)sulfonyl)-8-azabicyclo[3.2.1]octan-3-yl)-2-oxoindoline-5-carboxamide;

N-((2S,4S)-1-(((4-aminopiperidin-1-yl)sulfonyl)-2-methylpiperidin-4-yl)-6-chloro-2-oxoindoline-5-carboxamide;

N-((1R,3R,5S)-8-(((1r,4R)-4-aminocyclohexyl)sulfonyl)-8-azabicyclo[3.2.1]octan-3-yl)-6-chloro-2-oxoindoline-5-carboxamide;

N-((2S)-1-((4-(2-aminopropan-2-yl)phenyl)sulfonyl)-2-methylpiperidin-4-yl)-2-oxoindoline-5-carboxamide;

6-chloro-N-((1R,3r,5S)-8-(((1-(3-hydroxypropyl)piperidin-4-yl)methyl)sulfonyl)-8-azabicyclo[3.2.1]octan-3-yl)-2-oxoindoline-5-carboxamide;

6-chloro-N-((1R,3r,5S)-8-((4-(methylamino)piperidin-1-yl)sulfonyl)-8-azabicyclo[3.2.1]octan-3-yl)-2-oxoindoline-5-carboxamide;

N-((1R,3r,5S)-8-((4-(benzylamino)piperidin-1-yl)sulfonyl)-8-azabicyclo[3.2.1]octan-3-yl)-2-oxoindoline-5-carboxamide;

N-((2S,4S)-1((4-(2-aminopropan-2-yl)phenyl)sulfonyl)-2-methylpiperidin-4-yl)-6-chloro-2-oxoindoline-5-carboxamide;

N-((1R,3r,5S)-8-((4-(methylamino)piperidin-1-yl)sulfonyl)-8-azabicyclo[3.2.1]octan-3-yl-2-oxoindoline-5-carboxamide;

2-oxo-N-((1R,3r 5S)-8-((piperidin-3-ylmethyl)sulfonyl)-8-azabicyclo[3.2.1]octan-3-yl)indoline-5-carboxamide;

N-((1R,3R,5S)-8-(((1s,4S)-4-aminocyclohexyl)sulfonyl)-8-azabicyclo[3.2.1]octan-3-yl)-2-oxoindoline-5-carboxamide;

N-((1R,3r,5S)-8-((4(benzylamino)piperidin-1-yl)sulfonyl)-8-azabicyclo[3.2.1]octan-3-yl)-6-chloro-2-oxoindoline-5-carboxamide;

N-((1R,3r,5S)-8-((4-(dimethylamino)piperidin-1-yl)sulfonyl)-8-azabicyclo[3.2.1]octan-3-yl)-2-oxoindoline-5-carboxamide;

6-chloro-N-((1R,3r,5S)-8-((4-(dimethylamino)piperidin-1-yl)sulfonyl)-8-azabicyclo[3.2.1]octan-3-yl)-2-oxoindoline-5-carboxamide;

6-chloro-2-oxo-N-((1R,3r,5S)-8-(((4,4,4,-trifluorobutyl)piperidin-4-yl)methyl)sulfonyl)-8-azabicyclo[3.2.1]octan-3-yl)indoline-5-carboxamide;

6-chloro-2-oxo-N-((1R 3r,5S)-8-((piperidin-4-ylmethyl)sulfonyl)-8-azabicyclo[3.2.1]octan-3-yl)indoline-5-carboxamide;

2-oxo-N-((1R,3r,5S)-8-((piperidin-4-ylmethyl)sulfonyl)-8-azabicyclo[3.2.1]octan-3-yl)indoline-5-carboxamide;

6-chloro-2-oxo-N-((1R,3S,5S)-8-((((S)-piperidin-3-yl)methyl)sulfonyl)-8-azabicyclo[3.2.1.]octan-3-yl)indoline-5-carboxamide;

N-((2S,4S)-2-methyl-1-((piperidin4-ylmethyl)sulfonyl)piperidin-4-yl)-2-oxoindoline-5-carboxamide;

6-chloro-2-oxo-N-((1R,3R,5S)-8-((((R)-piperidin-3-yl)methyl)sulfonyl)-8-azabicyclo[3.2.1]octan-3-yl)indoline-5-carboxamide;

2-oxo-N-((1R,3r 5S)-8-((piperidin-4-ylmethyl)sulfonyl)-8-azabicyclo[3.2.1]octan-3-yl)-2,3-dihydrobenzo[d]oxazole-6-carboxamide;

N-((1R,3r,5S)-8-((4-aminopiperidin-1-yl)sulfonyl)-8-azabicyclo[3.2.1]oxtan-3-yl)-6-bromo-2-oxoindoline-5-carboxamide;

N-((3S)-1-((4-aminopiperidin-1-yl)sulfonyl)-3-methylpiperidin4-yl)-6-chloro-2-oxoindoline-5-carboxamide;

N-((1R,3r,5S)-8-((4-aminopiperidin-1-yl)sulfonyl)-8-azabicyclo[3.2.1]octan-3-yl)-6-chloro-1-methyl-2-oxoindoline-5-carboxamide;

N-((2S,4S)-1-((4-aminopiperidin-1-yl)sulfonyl)-2-methylpiperidin-4-yl)-5-ethylisothiazole-3-carboxamide;

N-((1R,3r,5S)-8-((4-aminopiperidin-1-yl)sulfonyl)-8-azabicyclo[3.2.1]octan-3-yl)-6-methyl-2-oxoindoline-5-carboxamide;

N-((2S,4S)-1-((4-aminopiperidin-1-yl)sulfonyl)-2-methylpiperidin-4-yl)-5-cyclopropyl-1,3,4-thiadiazole-2-carboxamide;

N-((3R,4R)-1-((4-aminopiperidin-1-yl)sulfonyl)-3-methylpiperidin-4-yl)-6-chloro-2-oxoindoline-5-carboxamide;

N-((1R,3r,5S)-8-((4-aminopiperidin-1-yl)sulfonyl)-8-azahicyclo[3.2.1]octan-3-yl)-3-oxo-3,4-dihydro-2H-benzo[b][1,4]oxazine-6-carboxamide;

N-((1R,3r,5S)-8-((4-aminopiperidin-1-yl)sulfonyl)-8-azabicyclo[3.2.1]octan-3-yl)-5-ethylisothiazole-3-carboxamide;

1-methyl-2-oxo-N-((1R,3r,5S)-8-((piperidin-4-ylmethyl)sulfonyl)-8-azabicyclo[3.2.1]octan-3-yl)indoline-5-carboxamide;

N-((1R,3r,5S)-8-((4-(2-aminopropan-2-yl)phenyl)sulfonyl)-8-azabicyclo[3.2.1]octan-3-yl)-2-oxoindoline-5-carboxamide;

N-((1R,3r,5S)-8-((4-(2-aminopropan-2-yl)phenyl)sulfonyl)-8-azabicyclo[3.25.1]octan-3-yl)-6-chloro-2-oxoindoline-5-carboxamide;

6-chloro-2-oxo-N-((1R,3r,5S)-8-((2-(pyrrolidin-1-yl)ethyl)sulfonyl)-8-azabicyclo[3.2.1]octan-3-yl)indoline-5-carboxamide;

2-oxo-N-((1R,3r 5S)-8-((2-(pyrrolidin-1-yl)ethyl)sulfonyl)-8-azabicyclo[3.2.1]octan-3-yl)indoline-5-carboxamide;

N-((1R,3r,5S)-8-((4-aminopiperidin-1-yl)sulfonyl)-8-azabicyclo[3.2.1]octan-3-yl)-5-ethylpyridazine-3-carboxamide;

6-chloro-1-methyl-2-oxo-N-((1R,3r,5S)-8-((piperidin-4-ylmethyl)sulfonyl)-8-azabicyclo[3.2.1]octan-3-yl)indoline-5-carboxamide;

N-((1R,3r,5S)-8-((4-aminopiperidin-1-yl)sulfonyl)-8-azabicyclo[3.2.1]octan-3-yl)-5-cyclopropyl-1,3,4-thiadiazole-2-carboxamide;

N-((2S,4S)-1-((4-aminopiperidin-1-yl)sulfonyl)-2-methylpiperidin-4-yl)-5-ethylpyridazine-3-carboxamide;

2-oxo-N-(1-((piperidin-4ylmethyl)sulfonyl)piperidin-4-yl)indoline-5-carboxamide;

N-(1-((3-aminopropyl)sulfonyl)piperidin-4-yl)-6-chloro-2-oxoindoline-5-carboxamide;

N-((1R,3r,5S)-8-((4-aminocyclohexyl)sulfonyl)-8-azabicyclo[3.2.1]octan-3-yl)-2,2-difluorobenzo[d][1,3]dioxole-5-carboxamide;

N-((1R,3R,5S)-8-(((1r,4R)-4-aminocyclohexyl)sulfonyl)-8-azabicyclo[3.2.1]octan-3-yl -2,2-difluorobenzo[d][1,3]dioxole-5-carboxamide;

N-(1-((3-aminopropyl)sulfonyl)piperidin-4-yl)-2-oxoindoline-5-carboxamide;

(R)-2-methyl-3-oxo-N-((1R,3r,5S)-8-((piperidin-4-ylmethyl)sulfonyl)-8-azabicyclo[3.2.1]octan-3-yl)-3,4-dihydro-2H-benzo[b][1,4]oxazine-6-carboxamide;

N-((1R,3r,5S)-8-((4-aminopiperidin-1-yl)sulfonyl)-8-azabicyclo[3.2.1]octan-3-yl -2,2-difluorobenzo[d][1,3]dioxole-5-carboxamide;

N-((1R,3R,5S)-8-(((1r,4R)-4-(benzylamino)cyclohexyl)sulfonyl)-8-azabicyclo[3.2.1]octan-3-yl)-2,2-difluorobenzo[d][1,3]dioxole-5-carboxamide;

2,2-difluoro-N-((1R,3r,5S)-8-((piperidin-4-ylmethyl)sulfonyl)-8-azabicyclo[3.2.1]octan-3-yl)benzo[d][1,3]dioxole-5-carboxamide;

N-((2S, 4R)-1-((4-aminopiperidin-1-yl)sulfonyl)-2-methylpiperidin-4-yl)-5-ethylisothiazole-3-carboxamide;

2,2-difluoro-N-((1R,3r,5S)-8(1-methylpiperidin-4-yl)methyl)sulfonyl)-8-azabicyclo[3.2.1]octan-3-yl)benzo[d][1,3]dioxole-5-carboxamide;

N-((2S,4R)-1-((4-aminopiperidin-1-yl)sulfonyl)-2-methylpiperidin-4-yl)-5-cyclopropyl-1,3,4-thiadiazole-2-carboxamide;

N-((2S,4S)-1-((4-acetamidophenyl)sulfonyl)-2-methylpiperidin-4-yl)-2-oxoindoline-5-carboxamide;

N-((1R,3r,5S)-8-((4-aminopiperidin-1-yl)sulfonyl)-8-azabicyclo[3.2.1]octan-3-yl)-5-cyclopropyl-1H-pyrazole-3-carboxamide;

N-((3R,4S)-1-((4-aminopiperidin-1-yl)sulfonyl)-3-methylpiperidin-4-yl)-6-chloro-2-oxoindoline-5-carboxamide;

3-ethyl-N-((1R,3r,5S)-8-((piperidin-4-ylmethyl)sulfonyl)-8-azabicyclo[3.2.1]octan-3-yl)benzamide;

N-((1R,3r,5S)-8-((4-aminopiperidin-1-yl)sulfonyl)-8-azabicyclo[3.2.1]octan-3-yl)-3-oxo-3,4-dihydro-2H-benzo[b][1,4]oxzine-7-carboxamide;

N-((1R,3r,5S)-8-((4-aminopiperidin-1-yl)-8-azabicyclo[3.2.1]octan-3-yl)-1-cyclopropyl-1H-pyrazole-4-carboxamide; p1 N-((1R,3R,5S)-8-((1r,4R)-4-aminocyclohexane-1-carbonyl)-8-azabicyclo[3.2.1]octan-3-yl)-2-oxoindoline-5-carboxamide;

N-((2S,4S)-1-((4-aminopiperidin-1-yl)sulfonyl)-2-methylpiperidin-4-yl)-1-cyclopropyl-1H-pyrazole-4-carboxamide;

N-((2S)-1-((1r,4S)-4-aminocyclohexane-1-carbonyl)-2-methylpiperidin-4-yl)-6-chloro-2-oxoindoline-5-carboxamide;

N-(1-((4-acetamidophenyl)sulfonyl)piperidin-4-yl)-6-chloro-2-oxoindoline-5-carboxamide;

N-((2S,4S)-1-((1r,4S)-4-aminocyclohexane-1-carbonyl)-2-methylpiperidin-4-yl)-2-oxoindoline-5-carboxamide;

N-(1((4-acetamidophenyl)sulfonyl)piperidin-4-yl)-2-oxoindoline-5-carboxamide;

N-((1R,3r,5S)-8-((4-aminopiperidin-1-yl)sulfonyl)-8-azabicyclo[3.2.1]octan-3-yl)-3-cyclopropylisoxazole-5-carboxamide;

5-cyclopropyl-N-[1-(propan-2-yl)azetidin-3-yl]pyridazine-3-carboxamide;

5-cyclopropyl-N-{1-[(1S)-1-phenylethyl]azetidin-3-yl}pyridazine-3-carboxamide;

5-cyclopropyl-N-{1-[(1R)-1-phenylethyl]azetidin-3-yl}pyridazine-3-carboxamide;

N-{1-[5-chloro-1-methyl-1H-imidazol-4-yl)methyl]azetidin-3-yl}-5-cycloprpoylpyridazine-3-carboxamide;

5-cyclopropyl-N-{1-[1-(2,5-dichlorophenyl)ethyl]azetidin-3yl}pyridazine-3-carboxamide;

5-cyclopropyl -N-(1-{1-[3-(2-hydroxyethoxy)-2-methoxyphenyl]ethyl}azetidin-3-yl)pyridazine-3-carboxamide;

N-(1-benzylazetidin-3-yl)-5-cyclopropylpylidazine-3-carboxamide;

N-(1-{1-[2-chloro-3-(2-hydroxyethoxy)phenyl]ethyl}azetidin-3-yl)-5-cyclopropylpyridazine-3-carboxamide;

5-cyclopropyl-N-(1-ehtylazetidin-3-yl)pyridazine-3-carboxamide;

5-cycloprpyl-N-[1-(propan-2-yl)piperidin-3-yl]pyridazine-3-carboxamide;

N-(5-hydroxy-3-oxo-3,4-dihydro-2H-1,4-benzoxazin-7-yl)-3-(methylamino)cyclohexane-1-carboxamide;

N-(1-{1-[4-(benzyloxy)phenyl]ethyl}azetidin-3-yl)-5-cyclopropylpyridazine-3-carboxamide;

5-cyclopropyl-N-(1-{[1-(2-phenylethyl)-1H-imidazol-4-yl]methyl}azetidin-3-yl)pyridazine-3-carboxamide;

N-[1-(azetidin-3-yl)ethyl]-5-cyclopropylpyridazine-3-carboxamide;

5-cyclopropyl-N-{1-[1-(propan-2-yl)azetidin-3yl]ethyl}pyridazine-3-carboxamide;

5-cyclopropyl-N-{1-[(1S)-1-(2-methoxyphenyl)ethyl]azetidin-3-yl}pyridazine-3-carboxamide;

5-cyclopropyl-N-{1-[(1R)-1-(2-methoxyphenyl)ethyl]azetidin-3-yl}pyridazine-3-carboxamide;

N-{1-[1-(2-chloro-3-methoxyphenyl)ethyl]azetidin-3-yl}-5-cyclopropylpyridazine-3-carboxamide;

5-cyclopropyl-N-{1-[1-(4-methoxyphenyl)ethyl]azetidin-3-yl}pyridazine-3-carboxamide;

5-cyclopropyl-N-{1-[1-(2,3-dimethoxyphenyl)ethyl]azetidin-3-yl}pyridazine-3-carboxamide;

N-{1-[(1S)-1-(3-chlorophenyl)propyl]azetidin-3-yl}-5-cyclopropylpyridazine-3-carboxamide;

5-cyclopropyl-N-[3-(dimethylamino)propyl]pyridazine-3-carboxamide;

5-cyclopropyl-N-[2-(dimethylamino)ethyl]pyridazine-3-carboxamide;

5-cyclopropyl-N-(1-(1-methylpiperidin-2-yl)ethyl )pyridazine-3-carboxamide;

1-cycloprooyl-N-(1-isopropylazetidin-3-yl)-1H-imidazole-4-carboxamide;

5-cyclopropyl-N-(1-(1-(3-methoxyphen yl)ethyl)azetidin-3-yl)pyridazine-3-carboxamide;

5-cyclopropyl-N-(1-(piperidin-2-yl)ethyl)pyridazine-3-carboxamide;

5-cyclopropyl-N-(8-methyl-8-azabicyclo[3.2.1]octan-3-yl)pyridazine-3-carboxamide;

5-cyclopropyl-N-[1-(propan-2-yl)azetidin-3-yl]-1H-imidazole-2-carboxamide;

5-cyclopropyl-N-{1-[(1S)-1-phenylethyl]azetidin-3-yl}-1H-imidazole-2-carboxamide;

5-cyclopropyl-N-{1-[(1R)-1-phenylethyl]azetidin-3yl}-1H-imidazole-2-carboxamide;

5-cyclopropyl-N-[1-(propan-2-yl)piperidin-4-yl]pyridazine-3-carboxamide;

5-cyclopropyl-N-(1-methylpiperidin-4-yl)pyridazine-3-carboxamide;

5-cyclopropyl -N-(1-methylpiperidin-3-yl)pyridazine-3-carboxamide;

1-cyclopropyl-N-(1-isopropylazetidin-3-yl)-1H-imidazole-4-carboxamide;

N-(1-((1-(4-chlorobenzyl)-1H-pyrazol-4-yl)methyl)azetidin-3-yl)-4-cyclopropyl-1H-imidazole-2-carboxamide;

5-cyclopropyl-N-(1-(4-((1-methyl-1H-pyrazol-4-yl)methoxy)benzyl)azetidin-3-yl)pyridazine-3-carboxamide;

N-(1-((1-(4-chlorobenzyl)-1H-pyrazol-4-yl)methyl)axetidin-3yl)-5-cyclopropylpyridazine-3-carboxamide;

N-(1-((1-(4-chlorobenzyl)-1H-pyrazol-4-yl)methyl)azetidin-3-yl)-4-cyclopropylpicolinamide;

N-(1-((1-benzyl-1H-pyrazol-4-yl)methyl)azetidin-3-yl)-5-cyclopropylpyridazine-3-carboxamide;

5-cyclopropyl-N-(1-(1-(3-methoxyphenyl)ethyl)azetidin-3-yl)pyridazine-3-carboxamide;

N-(1-(4-((1H-pyrazol-1-yl)methyl)benzyl)azetidin-3-yl)-5-cyclopropylpyridazine-3-carboxamide;

N-(1-benzyl-1H-pyrazol-4-yl)methyl)azetidin-3-yl)-5-cyclopropylisoxazole-3-carboxamide;

5-cyclopropyl-N-(1-(1-(4-methoxyphenyl)ethyl)azetidin-3-yl)pyridazine-3-carboxamide;

4-cyclopropyl-N-(1-isopropylazetidin-3-yl)picolinamide;

4-cyclopropyl-N-(1-(1-(2,5-dichlorophenyl)ethyl)azetidin-3-yl)picolinamide;

N-(1-(1-(2-chloro-3-(2-hydroxyethoxy)phenyl)ethyl)azetidin-3-0yl)-4-cyclopropylpicolinamide;

N-(1-(1-(2-chloro-3-methoxyphenyl)ethyl)azetidin-3-yl)-5-cyclopropylpyridazine-3-carboxamide;

N-(1-((1-benzyl-1H-pyrazol-4-yl)methyl)azetidin-3-yl)-4-cyclopropylpicolinamide;

N-(1-(4-(benzyloxy)benzyl)azetidin-3-yl)-4-cyclopropylpicolinamide;

5-cyclopropyl-N-(1-(1-methylpiperidin-2-yl)ethyl)pyridazine-3-carboxamide;

N-(1-((1-benzyl-1H-pyrazol-4-yl)methyl)azetidin-3-yl)-5-cyclopropyl-1H-imidazole-2-carboxamide;

5-cyclopropyl-N-(1-piperidin-2-yl)ethyl)pyridazine-3-carboxamide;

4-cyclopropyl-N-(1-(1-(2,3-dimethoxyphenyl)ethyl)azetidin-3-yl)picolinamide;

N-(1-((1-benzyl-1H-pyrazol-4-yl)methyl)azetidin-3-yl)-5-cyclopropyl-1,3,4-thiadizazole-2-carboxamide;

N-(1-((-(4-chlorobenzyl)-1H-pyrazol-4-yl)methyl)azetidin-3-yl)-1-cyclopropyl-1H-imidazole-4-carboxamide;

N-(1-((1-benzyl-1H-pyrazol-4-yl)methyl)azetidin-3-yl)-5-cyclopropyl-1,3,4-oxadiazole-2-carboxamide;

N-(1-((1-benzyl-1H-pyrazol-4-yl)methyl)azetidin-3-yl)-1-cyclopropyl-1H-imidazole-4-carboxamide;

5-cyclopropyl-N-((1R,5S)-8-methyl-8-azabicyclo[3.2.1]octan-3-yl)pyridazine-3-carboxamide;

5-cyclopropyl-N-((1R,3r,5S)-8-methyl-8-azabicyclo[3.2.1]octan-3-yl)pyridazine-3-carboxamide; and

N-(1-((1-(4-chlorobenzyl)-1H-pyrazol-4-yl)methyl)azetidin-3-yl)-5-cyclopropyl-1,3,4-oxadiazole-2-carboxamide.

58. (canceled)

59. A pharmaceutical composition comprising the compound of claim 1, or a pharmaceutically acceptable salt or solvate thereof, and a pharmaceutically acceptable carrier.

60. A method of treating a patient comprising administering to the patient a therapeutically effective amount of the compound of claim 1, or a pharmaceutically acceptable salt or hydrate thereof, wherein the patient has cancer.

61. The method of claim 60, wherein the cancer is selected from the group consisting of adrenal cancer, acinic cell carcinoma, acoustic neuroma, acral lentigious melanoma, acrospiroma, acute eosinophilic leukemia, acute erythroid leukemia, acute lymphoblastic leukemia, acute megakaryoblastic leukemia, acute monocylic leukemia, acute promyelocylic leukemia, adenocarcinoma, adenoid cystic carcinoma, adenoma, adenomatoid odontogenic tumor, adenosquamous carcinoma, adipose tissue neoplasm, adrenocortical carcinoma, adult T-cell leukemia/lymphoma, aggressive NK-cell leukemia, AIDS-related lymphoma, alveolar rhabdomyosarcoma, alveolar soft part sarcoma, ameloblastic fibroma, anaplastic large cell lymphoma, anaplastic thyroid cancer, angioimmunoblastic T-cell lymphoma, angiomyolipoma, angiosarcoma, astrocyloma, atypical teratoid rhabdoid tumor, B-cell chronic lymphocylic leukemia, B-cell prolymphocylic leukemia, B-cell lymphoma, basal cell carcinoma, biliary tract cancer, bladder cancer, blastoma, bone cancer, Brenner tumor, Brown tumor, Burkitt's lymphoma, breast cancer, brain cancer, carcinoma, carcinoma in situ, carcinosarcoma, cartilage tumor, cementoma, myeloid sarcoma, chondroma, chordoma, choriocarcinoma, choroid plexus papilloma, clear-cell sarcoma of the kidney, craniopharyngioma, cutaneous T-cell lymphoma, cervical cancer, colorectal cancer, Degos disease, desmoplastic small round cell tumor, diffuse large B-cell lymphoma, dysembryoplastic neuroepithelial tumor, dysgerminoma, embryonal carcinoma, endocrine gland neoplasm, endodermal sinus tumor, enteropathy-associated T-cell lymphoma, esophageal cancer, fetus in few, fibroma, fibrosarcoma, follicular lymphoma, follicular thyroid cancer, ganglioneuroma, gastrointestinal cancer, germ cell tumor, gestational choriocarcinoma, giant cell fibroblastoma, giant cell tumor of the bone, glial tumor, glioblastoma multiforme, glioma, gliomatosis cerebri, glucagonoma, gonadoblastoma, granulosa cell tumor, gynandroblastoma, gallbladder cancer, gastric cancer, hairy cell leukemia, hemangioblastoma, head and neck cancer, hemangiopericyloma, hematological malignancy, hepatoblastoma, hepatosplenic T-cell lymphoma, Hodgkin's lymphoma, non-Hodgkin's lymphoma, invasive lobular carcinoma, intestinal cancer, kidney cancer, laryngeal cancer, lentigo maligna, lethal midline carcinoma, leukemia, leydig cell tumor, liposarcoma, lung cancer, lymphangioma., lymphangiosarcoma, lymphoepitheliotna, lymphoma, acute lymphocylic leukemia, acute myelogeous leukemia, chronic lymphocylic leukemia, liver cancer, small cell lung cancer, non-small cell lung cancer, MALT lymphoma, malignant fibrous histiocyloma, malignant peripheral nerve sheath tumor, malignant triton tumor, mantle cell lymphoma, marginal zone B-cell lymphoma, mast cell leukemia, mediastinal germ cell tumor, medullary carcinoma of the breast, medullary thyroid cancer, medulloblastoma, melanoma, meningioma, merkel cell cancer, mesothelioma, metastatic urothelial carcinoma, mixed Mullerian tumor, mucinous tumor, multiple myelotna, muscle tissue neoplasm, mycosis fungoides, myxoid liposarcoma, myxoma, myxosarcoma, nasopharyngeal carcinoma, neurinoma, neuroblastoma, neurofibroma, neuroma, nodular melanoma, ocular cancer, oligoastrocyloma, oligodendroglioma, oncocyloma, optic nerve sheath meningioma, optic nerve tumor, oral cancer, osteosarcoma, ovarian cancer, Pancoast tumor, papillary thyroid cancer, paraganglioma, pinealoblastoma, pineocyloma, pituicyloma, pituitary adenoma, pituitary tumor, plasmacyloma, polyembryoma, precursor T-lymphoblastic lymphoma, primary central nervous system lymphoma, primary effusion lymphoma, preimary peritoneal cancer, prostate cancer, pancreatic cancer, pharyngeal cancer, pseudomyxoma periotonei, renal cell carcinoma, renal medullary carcinoma, retinoblastoma, rhabdomyoma, rhabdomyosarcotna, Richter's transformation, rectal cancer, sarcoma, Schwannotnatosis, seminoma, Sertoli cell tumor, sex cord-gonadal stromal tumor, signet ring cell carcinoma, skin cancer, small blue round cell tumors, small cell carcinoma, soft tissue sarcoma, somatostatinoma, soot wart, spinal tumor, splenic marginal zone lymphoma, squamous cell carcinoma, synovial sarcoma, Sezary's disease, small intestine cancer, squamous carcinoma, stomach cancer, T-cell lymphoma, testicular cancer, thecoma, thyroid cancer, transitional cell carcinoma, throat cancer, urachal cancer, urogenital cancer, urothelial carcinoma, uveal melanoma, uterine cancer, verrucous carcinoma, visual pathway glioma, vulvar cancer, vaginal cancer, Waldenstrom's macroglobitlinemia, Warthin's tumor, and Wilms' tumor.

62-67. (canceled)

68. A kit comprising the compound of claim 1, or a pharmaceutically acceptable salt or hydrate thereof, and instructions for administering the compound, or a pharmaceutically acceptable salt or hydrate thereof, to a patient having cancer.

69. (canceled)

70. A method of treating a SMYD protein mediated disorder comprising administering to a subject in need thereof a compound of claim 1, or a pharmaceutically acceptable salt or hydrate thereof in an effective amount to treat the SMYD protein mediated disorder.

Resources

Images & Drawings included:

Sources:

Similar patent applications:

Recent applications in this class: