Patent application title:

METHODS AND AGENTS FOR ENHANCING T CELL THERAPIES

Publication number:

US20210171957A1

Publication date:
Application number:

17/079,380

Filed date:

2020-10-23

Abstract:

Methods are described for enhancing the tumor homing or penetration activity of T-cells to improve cancer treatment, by exposing T-cells in vitro, ex vivo or in vivo to an agent that inhibits fidgetin-like 2 activity, such as by using an RNA interference agent.

Inventors:

Assignee:

Interested in similar patents?

Get notified when new applications in this technology area are published.

Classification:

C12N15/1137 »  CPC main

Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor; Recombinant DNA-technology; DNA or RNA fragments; Modified forms thereof; Non-coding nucleic acids modulating the expression of genes, e.g. antisense oligonucleotides against enzymes

A61K9/0009 »  CPC further

Medicinal preparations characterised by special physical form; Galenical forms characterised by the drug release technique; Application systems commanded by energy involving or responsive to electricity, magnetism or acoustic waves; Galenical aspects of sonophoresis, iontophoresis, electroporation or electroosmosis

C12N2510/00 »  CPC further

Genetically modified cells

C12N2310/14 »  CPC further

Structure or type of the nucleic acid; Type of nucleic acid interfering N.A.

C12N2310/122 »  CPC further

Structure or type of the nucleic acid; Type of nucleic acid catalytic nucleic acids, e.g. ribozymes Hairpin

C12N2310/531 »  CPC further

Structure or type of the nucleic acid; Physical structure partially self-complementary or closed Stem-loop; Hairpin

C12N5/0636 »  CPC further

Undifferentiated human, animal or plant cells, e.g. cell lines; Tissues; Cultivation or maintenance thereof; Culture media therefor; Animal cells or tissues; Human cells or tissues; Vertebrate cells; Cells from the blood or the immune system T lymphocytes

C12N15/113 IPC

Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor; Recombinant DNA-technology; DNA or RNA fragments; Modified forms thereof Non-coding nucleic acids modulating the expression of genes, e.g. antisense oligonucleotides

A61K9/00 IPC

Medicinal preparations characterised by special physical form

A61K35/17 »  CPC further

Medicinal preparations containing materials or reaction products thereof with undetermined constitution; Materials from mammals; Compositions comprising non-specified tissues or cells; Compositions comprising non-embryonic stem cells; Genetically modified cells; Blood; Artificial blood Lymphocytes; B-cells; T-cells; Natural killer cells; Interferon-activated or cytokine-activated lymphocytes

A61P35/00 »  CPC further

Antineoplastic agents

Description

CROSS-REFERENCE TO RELATED APPLICATIONS

This application claims priority to U.S. Provisional Application No. 62/926,238, filed Oct. 25, 2019, which is hereby incorporated by reference in its entirety.

INCORPORATION OF SEQUENCE LISTING

The “.txt” Sequence Listing filed with this application by EFS and which is entitled P-589147-US-SQL-09FEB2021_ST25.txt, is 81.7 kilobytes in size and which was created on Feb. 9, 2021, is hereby incorporated by reference. The sequence listing submitted herewith is identical to the sequence listing forming part of the international application.

BACKGROUND

Adoptive cell therapy with genetically modified T-cells ex vivo holds the promise of improving outcomes for patients with solid tumors and has the potential to reduce treatment complications for all cancer patients. Although T-cells that express chimeric antigen receptors (CARs) specific for CD19 have had remarkable success for B-cell-derived malignancies, which has led to their approval by the U.S. Food and Drug Administration, CAR T-cells have been less effective for solid tumors. Other adoptive T cell therapies including tumor infiltrating lymphocyte therapy, engineered T cell receptor therapy and natural killer (NK) cell therapy similarly have great potential for therapeutic benefit.

Lack of CAR T-cell efficacy in solid tumors is multifactorial. Major roadblocks include: (1) the availability of targeted antigens and their heterogeneous expression; (2) the homing of T cells to tumor sites and cells, and; (3) the immunosuppressive tumor microenvironment. While there is a major focus by Pharma/Biotech/Academic institutions to address the roadblocks 1 and 3 by expansion of the repertoire of targetable antigens or engineering CAR-T cells to resist the immunosuppressive environment, very limited evidence is available on the efforts of enhancing homing or migration of CAR T-cells to tumor sites and within tumors. In addition, amalgamation approaches to cancer immunotherapies have focused on combination of CAR T-cells with checkpoint blockade, oncolytic viruses, chemotherapy, radiation, and/or small molecules. Although recent successes in checkpoint blockade and oncolytic viruses have shown promise, the remaining combinations are beset with side-effects. Enhancement of the efficacy of CAR T-cell other T cell therapies is desirable.

BRIEF SUMMARY

In one aspect, a method for enhancing the tumoricidal activity of T cells is provided comprising the step of reducing fidgetin-like 2 (FL2) expression or activity in the T cells. In one embodiment, the tumoricidal activity is against a carcinoma, a sarcoma, a lymphoma, a leukemia, a myeloma or a mixed type tumor. In one embodiment, the tumor or cancer is colorectal cancer, pancreatic cancer, liver cancer, intrahepatic bile ductal cancer, esophageal cancer, bladder cancer, non-Hodgkin's lymphoma or kidney cancer. In one embodiment the cancer is a rare cancer. In one embodiment, a mixed type tumor is derived from a single germ cell layer that differentiates into more than one cell type. In one embodiment a mixed type tumor is derived from more than one germ cell layer. In one embodiment, the tumoricidal activity is against a solid tumor. In one embodiment, the tumoricidal activity is against a liquid tumor. In one embodiment, the tumoricidal activity is against a bone marrow tumor. In one embodiment, the tumoricidal activity is against a blood cancer. In one embodiment, enhancing the tumoricidal activity comprises enhancing the migration of T cells toward a tumor site or tumor cells, enhancing the penetration or infiltration of T cells into a tumor, enhancing the penetration or infiltration of T cells into a bodily site comprising tumor cells, or any combination of any of the foregoing. In one embodiment, the T cells are endogenous T cells or from adoptive T cell therapy. In one embodiment, the T cells are autologous T cells, CAR-T cells, tumor infiltrating lymphocytes, engineered T cell receptor lymphocytes, macrophages, microglia, or natural killer cells.

In one embodiment, reducing FL2 expression or activity in the T cells is carried out in vivo, ex vivo or in vitro. In one embodiment, the in vivo reducing FL2 expression or activity comprises administering an inhibitor of FL2 to a subject parenterally, administration into a tissue, administration into an organ, administration intratumorally or adjacent to a tumor. In one embodiment the inhibitor of FL2 is administered in or near a lymph node.

In one embodiment, the ex vivo reducing FL2 expression or activity comprises exposing T cells ex vivo to an inhibitor of FL2. In one embodiment, the T cells are subsequently infused into a subject or into a site within the subject. In one embodiment, the in vitro reducing FL2 expression or activity comprises exposing T cells in vitro to an inhibitor of FL2.

In one embodiment the T cells are autologous, allogeneic, lymphoid progenitors or pluripotent stem cells. In one embodiment, the T cells are obtained from the subject. In one embodiment the T cells are obtained from a cell line. In one embodiment the T cells are obtained from a donor. In one embodiment the subject's T cells are processed into CAR-T cells. In one embodiment, the T cells or CAR-T cells are subsequently infused into a subject or a site within the subject.

In one embodiment, the inhibitor of FL2 is a RNA interference agent. In one embodiment, the RNA interference agent is shRNA or siRNA. In one embodiment, the siRNA comprises a sequence selected from

(SEQ ID NO: 1)
UUACACAGUAUUAAAGCGAUU;
(SEQ ID NO: 2)
UCGCUUUAAUACUGUGUAAUU;
(SEQ ID NO: 3
CAUCUGAAACCUAGGGUCUUU;
(SEQ ID NO: 4)
AGACCCUAGGUUUCAGAUGUU;
(SEQ ID NO: 5)
GUGACUUAUGCUAGGAGGAUU;
(SEQ ID NO: 6)
UCCUCCUAGCAUAAGUCACUU;
(SEQ ID NO: 7)
GGUCAGAAGCAGAAUGUAUUU;
(SEQ ID NO: 8)
AUACAUUCUGCUUCUGACCUU;
(SEQ ID NO: 9)
CGCCGGCCCACAAGUUGGAdTdT;
(SEQ ID NO: 10)
UCCAACUUGUGGGCCGGCGdTdT;
(SEQ ID NO: 11)
CAGCUCGAGCCCUUUGACAdTdT;
(SEQ ID NO: 12)
UGUCAAAGGGCUCGAGCUGdTdT;
(SEQ ID NO: 13)
CCUCCAACCUCCUCAAGAGdTdT;
(SEQ ID NO: 14)
CUCUUGAGGAGGUUGGAGGdTdT;
(SEQ ID NO: 15)
CGUUGCUGCUCAUCAGCGAdTdT;
(SEQ ID NO: 16)
UCGCUGAUGAGCAGCAACGdTdT;
(SEQ ID NO: 17)
fUfUmA fCmAfC AGU AUU AAA GCG ATT;
(SEQ ID NO: 18)
(Phos) U CGC UUU AAU ACU G UG UAA TT;
(SEQ ID NO: 34)
5′-UUACACAGUAUUAAAGCGATT-3′;
(SEQ ID NO: 35)
(Phos) 5′ - mUmCGCUUUAAUACUGUGUAATT-3′;
(SEQ ID NO: 36)
(Phos) 5′ - mU(s)mC(s)GCUUUAAUACUGUGUAATT-3′;
(SEQ ID NO: 37)
(Phos) 5′ - fUfCGCUUUAAUACUGUGUAATT -3′;
(SEQ ID NO: 38)
(Phos) 5′ -fU(s)fC(s)GCUUUAAUACUGUGUAATT-3′;
(SEQ ID NO: 39)
(Phos) 5′ - mU(s)mC(s)GCUUUAAUAmCfUmGfUmGfUmAmATT-
3′;
(SEQ ID NO: 40)
(Phos) 5′ - U(s)CGCUUUAAUACUGUGUAATT-3′;
(SEQ ID NO: 41)
(Phos) 5′ - mUfCmGfCmUfUmUAAfUmAfCmUGmUmGfUmAmATT;
(SEQ ID NO: 42)
5′-mUmUmAmCmAmCmAmGmUmAmUmUmAmAmAmGmCmGmAmUmU-3′;
(SEQ ID NO: 43)
(Phos) 5′ - mUmCmGmCmUmUmUmAmAmUmAmCmUmGmUmGmUmAmA
mUmU-3′;
(SEQ ID NO: 44)
5′ mUmUmAmCmAmCmAmGmUmAmUmUmAmAmAmGdCdGdATT-3′;
(SEQ ID NO: 45)
5′ mUmUmAmCmAmCmAmGmUmAmUmUmAmAmAmGdCmGmATT-3′;
(SEQ ID NO: 46)
5′ UUACACAGUAUUAAAGCGA-3′;
(SEQ ID NO: 47)
(Phos) 5′ - U(s)CGCUUUAAUACUGUGUAATT-3′;
(SEQ ID NO: 48)
(Phos) 5′ - UCGCUUUAAUACUGUGUAATT-3′;
(SEQ ID NO: 49)
(Phos) 5′ - U(s)C(s)GCUUUAAUACUGUGUAATT-3′;
(SEQ ID NO: 50)
5′-mUmUACACAGUAUUAAAGCGA-3′;
(SEQ ID NO: 51)
(Phos) 5′ - U(s)CGCUUUAAUACUGUGUmAmATT-3′;
(SEQ ID NO: 52)
(Phos) 5′ - UCGCUUUAAUACUGUGUAATT-3′;
(SEQ ID NO: 53)
(Phos) 5′ - U(s)C(s)GCUUUAAUACUGUGUAA T(s)T-3′;
(SEQ ID NO: 54)
5′ 1U1U1A1C1ACAGUAUUAAAGCGATT-3′;
SEQ ID NO: 55)
(Phos) 5′ - UCGCUUUAAUACUG1U1G1U1A1A TT -3′;
(SEQ ID NO: 56)
5′ fUfU1AfC1ACAGUAUUAAAGCGA-3′;
or
(SEQ ID NO: 57)
(Phos) 5′ - mU(s)mCmGCUUUAAUACUGUGUAATT -3′,

wherein d(nucleotide)=deoxy-(nucleotide), m(nucleotide)=2′-O-methyl nucleotide, T=thymidine, f(nucleotide)=2′-fluorodeoxy nucleotide, (Phos)=phosphodiester cap; capital letter nucleotide=RNA nucleotide, l(nucleotide)=a locked nucleotide, and (s)=phosphorothioate. For example, in SEQ ID NO:17, fC represents 2′-fluorodeoxy cytidine ribonucleic acid, fU represents 2′-fluorodeoxy uracil ribonucleic acid, and mA represents 2′-O-methyl adenosine ribonucleic acid.

In one embodiment, the siRNA consists of any of the foregoing sequences.

In one embodiment, the siRNA has at least one modification selected from a 3′ overhang, a 5′ overhang, a 5′ phosphorylation, a 2′ sugar modification, a nucleic acid base modification, a phosphate backbone modification, and any combination of any of the foregoing. Any of the siRNA sequences may have a phosphodiester cap.

In one embodiment a shRNA to FL2 comprises the sequence CACCGCTGGAGCCCTTTGACAAGTTCTCGAGAACTTGTCAAAGGGCTCCAGCTTTT (SEQ ID NO:23). one embodiment a shRNA to FL2 consists of the sequence CACCGCTGGAGCCCTTTGACAAGTTCTCGAGAACTTGTCAAAGGGCTCCAGCTTTT (SEQ ID NO:23).

In one embodiment, the FL2 is human FL2. In one embodiment, the siRNA is encapsulated in a nanoparticle. In one embodiment, the siRNA is delivered to T cells by nanoparticles, electroporation/nucleofection, Accel siRNA, a viral vector, peptide, protein or aptamer.

In one embodiment, an immune checkpoint inhibitor is administered to the subject with the T cells. In one embodiment, an immune checkpoint inhibitor is exposed to the T cells ex vivo or in vitro before infusion into the subject.

In one aspect, a method is provided for treating cancer in a subject in need thereof comprising administering to a subject a population of T cells wherein the expression or activity of fidgetin-like 2 (FL2) therein has been reduced. In one embodiment the T cells are tumoricidal against the cancer. In one embodiment, the T cells are targeted to the cancer or to an antigen expressed by the cancer. In one embodiment, the tumoricidal activity is against a carcinoma, a sarcoma, a lymphoma, a leukemia, a myeloma or a mixed type tumor. In one embodiment, the tumor or cancer is colorectal cancer, pancreatic cancer, liver cancer, intrahepatic bile ductal cancer, esophageal cancer, bladder cancer, non-Hodgkin's lymphoma or kidney cancer. In one embodiment the cancer is a rare cancer. In one embodiment, the tumoricidal activity is against a solid tumor. In one embodiment, the tumoricidal activity is against a liquid tumor. In one embodiment, the tumoricidal activity is against a bone marrow tumor. In one embodiment, the tumoricidal activity is against a blood cancer. In one embodiment, the T cells are autologous T cells, CAR-T cells, tumor infiltrating lymphocytes, engineered T cell receptor lymphocytes, macrophages, microglia, or natural killer cells.

In one embodiment, reducing FL2 expression or activity in the T cells is carried out ex vivo or in vitro. In one embodiment, the ex vivo reducing FL2 expression or activity comprises exposing T cells ex vivo to an inhibitor of FL2. In one embodiment, the in vitro reducing FL2 expression or activity comprises exposing T cells in vitro to an inhibitor of FL2. In one embodiment, the T cells are subsequently infused into a subject or a site within the subject.

In one embodiment the T cells are autologous, allogeneic, lymphoid progenitors or pluripotent stem cells. In one embodiment, the T cells are obtained from the subject. In one embodiment the T cells are obtained from a cell line. In one embodiment the T cells are obtained from a donor. In one embodiment the subject's T cells are processed into CAR-T cells. In one embodiment, the T cells or CAR-T cells are subsequently infused into a subject or a site within the subject.

In one embodiment, the inhibitor of FL2 is a RNA interference agent. In one embodiment, the RNA interference agent is shRNA or siRNA. In one embodiment, the siRNA has a sequence selected from any of SEQ ID Nos:1-18 or 34-57.

In one embodiment, the siRNA has at least one modification selected from a 3′ overhang, a 5′ overhang, a 5′ phosphorylation, a 2′ sugar modification, a nucleic acid base modification, a phosphate backbone modification, and any combination of any of the foregoing.

In one embodiment, the FL2 is human FL2. In one embodiment, the siRNA is encapsulated in a nanoparticle.

In one embodiment, the siRNA is delivered to T cells by nanoparticle, electroporation/nucleofection, Accel siRNA, a viral vector, peptide, protein or aptamer.

In one embodiment, an immune checkpoint inhibitor is administered to the subject with the T cells. In one embodiment, an immune checkpoint inhibitor is exposed to the T cells ex vivo or in vitro before infusion into the subject.

In one aspect, a method is provided for treating cancer in a subject in need thereof comprising administering to or near a tumor or tumor site or lymph node within the subject an inhibitor of the expression or activity of fidgetin-like 2 (FL2). In one embodiment, the tumoricidal activity is against a carcinoma, a sarcoma, a lymphoma, a leukemia, a myeloma or a mixed type tumor. In one embodiment, the tumoricidal activity is against a solid tumor. In one embodiment, the tumoricidal activity is against a liquid tumor. In one embodiment, the tumoricidal activity is against a bone marrow tumor. In one embodiment, the tumoricidal activity is against a blood cancer. In one embodiment, the tumor or cancer is colorectal cancer, pancreatic cancer, liver cancer, intrahepatic bile ductal cancer, esophageal cancer, bladder cancer, non-Hodgkin's lymphoma or kidney cancer. In one embodiment the cancer is a rare cancer. In one embodiment, enhancing the tumoricidal activity comprises enhancing the migration of T cells toward a tumor site or tumor cells, enhancing the penetration or infiltration of T cells into a tumor, enhancing the penetration or infiltration of T cells into a bodily site comprising tumor cells, or any combination of any of the foregoing.

In one embodiment, the inhibitor of FL2 is a RNA interference agent. In one embodiment, the RNA interference agent is shRNA or siRNA. In one embodiment, the siRNA has a sequence selected from any of SEQ ID NOs:1-18 or 34-57.

In one embodiment, the siRNA has at least one modification selected from a 3′ overhang, a 5′ overhang, a 5′ phosphorylation, a 2′ sugar modification, a nucleic acid base modification, a phosphate backbone modification, and any combination of any of the foregoing.

In one embodiment, the FL2 is human FL2. In one embodiment, the siRNA is encapsulated in a nanoparticle.

In one embodiment, the siRNA is delivered by implanted wafer, nanoparticle, electroporation/nucleofection, Accel siRNA, a viral vector, peptide, protein or aptamer.

In one embodiment, an immune checkpoint inhibitor is administered to the subject with the inhibitor of FL2.

In one embodiment, a method is provided for treating cancer in a subject in need thereof comprising the steps of (1) determining whether the activity of T cells to migrate to or penetrate into a solid tumor is reduced, and if such activity is reduced, (2) exposing T cells in vitro or ex vivo to an inhibitor that reduces the expression or activity of FL2, and administering the T cells to the subject, or administering to or near a lymph node, tumor or tumor site within the subject, an inhibitor that reduces the expression or activity of FL2, or any combination thereof.

In one embodiment, the T cells are endogenous T cells or the T cells administered for adoptive T cell therapy.

In one embodiment, the determining whether the activity of endogenous T cells or T cells for administration for adoptive T cell therapy to migrate or penetrate into a solid tumor is carried out by an in vitro T-cell migration assay.

In one embodiment, the cancer is a solid tumor, a liquid tumor, a bone marrow tumor or a blood cancer. In one embodiment, the cancer is a carcinoma, a sarcoma, a lymphoma, a leukemia, a myeloma or a mixed type tumor. In one embodiment, the tumor or cancer is colorectal cancer, pancreatic cancer, liver cancer, intrahepatic bile ductal cancer, esophageal cancer, bladder cancer, non-Hodgkin's lymphoma or kidney cancer. In one embodiment the cancer is a rare cancer.

In one embodiment, exposing enhances the migration of T cells toward a tumor site or tumor cells, enhances the penetration or infiltration of T cells into a tumor, enhances the penetration or infiltration of T cells into a bodily site comprising tumor cells, or any combination thereof.

In one embodiment, the T cells are administered for adoptive T cell therapy. In one embodiment, the T cells are autologous T cells, CAR-T cells, tumor infiltrating lymphocytes, engineered T cell receptor lymphocytes, macrophages, microglia or natural killer cells, or are derived from lymphoid progenitor cells or pluripotent stem cells.

In one embodiment, reducing FL2 expression or activity in the T cells is carried out in vivo, ex vivo or in vitro. In one embodiment, the in vivo reducing FL2 expression or activity comprises administering an inhibitor of FL2 to a subject parenterally, into a tissue, into an organ, lymph node, intratumorally or adjacent to a tumor. In one embodiment, the ex vivo reducing FL2 expression or activity comprises exposing T cells ex vivo to an inhibitor of FL2. In one embodiment, the T cells are subsequently infused into a subject or a site within the subject. In one embodiment, the in vitro reducing FL2 expression or activity comprises exposing T cells in vitro to an inhibitor of FL2. In one embodiment, the T cells are subsequently infused into a subject or a site within the subject.

In one embodiment, the T cells are autologous, allogeneic, lymphoid progenitors or pluripotent stem cells. In one embodiment, the T cells are obtained from a cell line or from a donor.

In one embodiment, the inhibitor of FL2 is a RNA interference agent. In one embodiment, the RNA interference agent is shRNA or siRNA. In one embodiment, the siRNA has a sequence selected from any one of SEQ ID NOs:1-18 or 34-57. In one embodiment, the siRNA has at least one modification selected from a 3′ overhang, a 5′ overhang, a 5′ phosphorylation, a 2′ sugar modification, a nucleic acid base modification, a phosphate backbone modification, and any combination of any of the foregoing.

In one embodiment, the FL2 is human FL2.

In one embodiment, the siRNA is encapsulated in a nanoparticle. In one embodiment, the siRNA is delivered by nanoparticles, electroporation/nucleofection, Accel siRNA, a viral vector, peptide, protein or aptamer.

In one embodiment, an immune checkpoint inhibitor is administered to the subject or exposed to T cells in vitro or ex vivo before infusion into the subject.

In one aspect, a method for enhancing the tumoricidal activity of T cells is provided comprising the step of reducing fidgetin-like 1 (FL1) expression or activity in the T cells. In one embodiment, the tumoricidal activity is against a carcinoma, a sarcoma, a lymphoma, a leukemia, a myeloma or a mixed type tumor. In one embodiment, the tumor or cancer is colorectal cancer, pancreatic cancer, liver cancer, intrahepatic bile ductal cancer, esophageal cancer, bladder cancer, non-Hodgkin's lymphoma or kidney cancer. In one embodiment the cancer is a rare cancer. In one embodiment, a mixed type tumor is derived from a single germ cell layer that differentiates into more than one cell type. In one embodiment a mixed type tumor is derived from more than one germ cell layer. In one embodiment, the tumoricidal activity is against a solid tumor. In one embodiment, the tumoricidal activity is against a liquid tumor. In one embodiment, the tumoricidal activity is against a bone marrow tumor. In one embodiment, the tumoricidal activity is against a blood cancer. In one embodiment, enhancing the tumoricidal activity comprises enhancing the migration of T cells toward a tumor site or tumor cells, enhancing the penetration or infiltration of T cells into a tumor, enhancing the penetration or infiltration of T cells into a bodily site comprising tumor cells, or any combination of any of the foregoing. In one embodiment, the T cells are endogenous T cells or from adoptive T cell therapy. In one embodiment, the T cells are autologous T cells, CAR-T cells, tumor infiltrating lymphocytes, engineered T cell receptor lymphocytes, macrophages, microglia, or natural killer cells.

In one embodiment, reducing FL1 expression or activity in the T cells is carried out in vivo, ex vivo or in vitro. In one embodiment, the in vivo reducing FL1 expression or activity comprises administering an inhibitor of FL1 to a subject parenterally, administration into a tissue, administration into an organ, administration intratumorally or adjacent to a tumor. In one embodiment the inhibitor of FL1 is administered in or near a lymph node. Other embodiments are as described above.

In one aspect, a method for enhancing the tumoricidal activity of T cells is provided comprising the step of reducing fidgetin expression or activity in the T cells. In one embodiment, the tumoricidal activity is against a carcinoma, a sarcoma, a lymphoma, a leukemia, a myeloma or a mixed type tumor. In one embodiment, the tumor or cancer is colorectal cancer, pancreatic cancer, liver cancer, intrahepatic bile ductal cancer, esophageal cancer, bladder cancer, non-Hodgkin's lymphoma or kidney cancer. In one embodiment the cancer is a rare cancer. In one embodiment, a mixed type tumor is derived from a single germ cell layer that differentiates into more than one cell type. In one embodiment a mixed type tumor is derived from more than one germ cell layer. In one embodiment, the tumoricidal activity is against a solid tumor. In one embodiment, the tumoricidal activity is against a liquid tumor. In one embodiment, the tumoricidal activity is against a bone marrow tumor. In one embodiment, the tumoricidal activity is against a blood cancer. In one embodiment, enhancing the tumoricidal activity comprises enhancing the migration of T cells toward a tumor site or tumor cells, enhancing the penetration or infiltration of T cells into a tumor, enhancing the penetration or infiltration of T cells into a bodily site comprising tumor cells, or any combination of any of the foregoing. In one embodiment, the T cells are endogenous T cells or from adoptive T cell therapy. In one embodiment, the T cells are autologous T cells, CAR-T cells, tumor infiltrating lymphocytes, engineered T cell receptor lymphocytes, macrophages, microglia, or natural killer cells.

In one embodiment, reducing fidgetin expression or activity in the T cells is carried out in vivo, ex vivo or in vitro. In one embodiment, the in vivo reducing fidgetin expression or activity comprises administering an inhibitor of fidgetin to a subject parenterally, administration into a tissue, administration into an organ, administration intratumorally or adjacent to a tumor. In one embodiment the inhibitor of fidgetin is administered in or near a lymph node. Other embodiments are as described above.

BRIEF DESCRIPTION OF THE DRAWINGS

The subject matter regarded as the invention is particularly pointed out and distinctly claimed in the concluding portion of the specification. The invention, however, both as to organization and method of operation, together with objects, features, and advantages thereof, may best be understood by reference to the following detailed description when read with the accompanying drawings in which:

FIG. 1 depicts time-lapse images for migration of T-cells (red) towards a cancer cell (green) in a 3D co-culture of Jurkat cells (T-cell line) with DU145 cells (prostate cancer cell line). The T-cells (red) show a directional movement (arrows) towards small clusters of cancer cells (green) (hour 0 to hour 5) and with time show phagocytosis of the cancer cells (hour 6 to hour 13). Both the cell lines were pre-stained with membrane specific lipophilic Vybrant dyes and then co-cultured in a 3D Matrigel plug.

FIG. 2A, FIG. 2B, FIG. 2C, FIG. 2D, FIG. 2E, FIG. 2F, FIG. 2G and FIG. 2H show limited penetration of T-cells in prostate cancer spheroids. FIG. 2A. The Jurkat cells (T-cell line) were co-cultured in a Matrigel plug along with a prostate cancer spheroid derived from DU145 cell line. FIG. 2B. Low magnification image of pre-stained Spheroid (green) and the surrounding pre-stained T-cells (red). FIG. 2C to FIG. 2H. Time lapse series tracking the motility and penetration of T-cells (red). Note the migration of T-cells directed towards the edge of spheroid (arrows) (FIG. 2C-FIG. 2F) and then migration away from the spheroid possibly owing to immunosuppressive hypoxic tumor microenvironment.

FIG. 3A, FIG. 3B and FIG. 3C show FL2 knockdown in T-cells enhances migration to cancer spheroids. FIG. 3A. Western blot showing the knockdown of FL2 in Jurkat cells (T-cell line). FIG. 3B. Schematic of trans-well assay for quantifying T-cell migration towards cancer spheroids. The T-cells modified with siRNA+GFP are placed in the upper chamber and the spheroids are in the lower chamber. The trans-well semipermeable membrane is coated with Matrigel to trap the T-cells migrating towards the spheroids. FIG. 3C. Imaging the GFP-positive cells on the transwell membrane 72 hours after co-culture with cancer spheroids (Scale bar=400 um). D. Quantification of GFP-positive T-cells from images show significantly (*; p=0.0159) higher number of T-cells treated with FL2 siRNA migrating towards the cancer spheroids.

FIG. 4A and FIG. 4B show FL2 knockdown in T-cells enhances migration to different cancer spheroids. FIG. 4A. Imaging the GFP-positive cells on the transwell membrane 72 hours after co-culture with cancer spheroids from Prostate cancer cell lines (DU145 and LnCAP) and Lung Cancer cell line (DMS53) (Scale bar=400 um). FIG. 4B. Quantification of GFP-positive T-cells from images show significantly (***; p<0.001; **; p<0.01) higher number of T-cells treated with FL2 siRNA migrating towards the cancer spheroids.

FIG. 5 depicts evaluation of therapy using FL2 siRNA-treated T cells in a xenograft model.

FIG. 6 depicts a human study in which CAR-Ts are treated with any one of several types of FL2 modifications to inhibit FL2 before infusion.

FIG. 7 depicts a method for determining or quantifying whether engineered T cells have sufficient homing or penetration activity to a patient's tumor, prior to CAR-T cell therapy.

FIG. 8 shows the effect of FL2 knockdown on T cell attachment to a Du145 monolayer.

FIG. 9A-B show the effect of FL2 knockdown on attachment of T cells to tumor spheroids.

DETAILED DESCRIPTION

The present subject matter may be understood more readily by reference to the following detailed description which forms a part of this disclosure. It is to be understood that this invention is not limited to the specific products, methods, conditions or parameters described and/or shown herein, and that the terminology used herein is for the purpose of describing particular embodiments by way of example only and is not intended to be limiting of the claimed invention.

Unless otherwise defined herein, scientific and technical terms used in connection with the present application shall have the meanings that are commonly understood by those of ordinary skill in the art. Further, unless otherwise required by context, singular terms shall include pluralities and plural terms shall include the singular.

As employed above and throughout the disclosure, the following terms and abbreviations, unless otherwise indicated, shall be understood to have the following meanings.

In the present disclosure, the singular forms “a,” “an,” and “the” include the plural reference, and reference to a particular numerical value includes at least that particular value, unless the context clearly indicates otherwise. Thus, for example, a reference to “a compound” is a reference to one or more of such compounds and equivalents thereof known to those skilled in the art, and so forth. The term “plurality”, as used herein, means more than one. When a range of values is expressed, another embodiment includes from the one particular and/or to the other particular value.

Similarly, when values are expressed as approximations, by use of the antecedent “about,” it is understood that the particular value forms another embodiment. All ranges are inclusive and combinable. In the context of the present disclosure, by “about” a certain amount it is meant that the amount is within ±20% of the stated amount, or preferably within ±10% of the stated amount, or more preferably within ±5% of the stated amount.

As used herein, the terms “treat”, “treatment”, or “therapy” (as well as different forms thereof) refer to therapeutic treatment, including prophylactic or preventative measures, wherein the object is to prevent or slow down (lessen) an undesired physiological change associated with a disease or condition. Beneficial or desired clinical results include, but are not limited to, alleviation of symptoms, diminishment of the extent of a disease or condition, stabilization of a disease or condition (i.e., where the disease or condition does not worsen), delay or slowing of the progression of a disease or condition, amelioration or palliation of the disease or condition, and remission (whether partial or total) of the disease or condition, whether detectable or undetectable. Those in need of treatment include those already with the disease or condition as well as those prone to having the disease or condition or those in which the disease or condition is to be prevented.

As used herein, the terms “component,” “composition,” “formulation”, “composition of compounds,” “compound,” “drug,” “pharmacologically active agent,” “active agent,” “therapeutic,” “therapy,” “treatment,” or “medicament,” are used interchangeably herein, as context dictates, to refer to a compound or compounds or composition of matter which, when administered to a subject (human or animal) induces a desired pharmacological and/or physiologic effect by local and/or systemic action. A personalized composition or method refers to a product or use of the product in a regimen tailored or individualized to meet specific needs identified or contemplated in the subject.

The terms “subject,” “individual,” and “patient” are used interchangeably herein, and refer to an animal, for example a human, to whom treatment with a composition or formulation in accordance with the present invention, is provided. The term “subject” as used herein refers to human and non-human animals. The terms “non-human animals” and “non-human mammals” are used interchangeably herein and include all vertebrates, e.g., mammals, such as non-human primates, (particularly higher primates), sheep, dog, rodent, (e.g. mouse or rat), guinea pig, goat, pig, cat, rabbits, cows, horses and non-mammals such as reptiles, amphibians, chickens, and turkeys. The compositions described herein can be used to treat any suitable mammal, including primates, such as monkeys and humans, horses, cows, cats, dogs, rabbits, and rodents such as rats and mice. In one embodiment, the mammal to be treated is human. The human can be any human of any age. In an embodiment, the human is an adult. In another embodiment, the human is a child. The human can be male, female, pregnant, middle-aged, adolescent, or elderly. According to any of the methods of the present invention and in one embodiment, the subject is human. In another embodiment, the subject is a non-human primate. In another embodiment, the subject is murine, which in one embodiment is a mouse, and, in another embodiment is a rat. In another embodiment, the subject is canine, feline, bovine, equine, laprine or porcine. In another embodiment, the subject is mammalian.

Conditions and disorders in a subject for which a particular drug, compound, composition, formulation (or combination thereof) is said herein to be “indicated” are not restricted to conditions and disorders for which that drug or compound or composition or formulation has been expressly approved by a regulatory authority, but also include other conditions and disorders known or reasonably believed by a physician or other health or nutritional practitioner to be amenable to treatment with that drug or compound or composition or formulation or combination thereof.

T cell therapy represents a powerful method to harness the body's own immune cells to attack cancer cells. Despite recent advances in immunotherapy, certain tumors and especially solid tumors provide a challenge for attack by T cell therapies. A current need exists to enhance the migration of T cells to and penetration of T cells into tumors, using any type of T cell therapy including but not limited to any type of autologous or allogeneic T cells or genetically modified CAR T-cells. In one embodiment, poor migration and penetration of such immune cells into tumors is a roadblock reducing the effectiveness of a potentially curative therapy.

Trafficking of immune cells toward tumor foci is a dynamic process controlled by an intricate network of interactions at multiple levels. In one embodiment, the tumor microenvironment is inhospitable and inaccessible to the invasion of immune cells, because of, by way of non-limiting examples, hypoxia and low nutrients in solid tumors. Some approaches to improvement of tumor penetration have been by expression of heparinase, or targeting cancer-associated fibroblasts, the main producer of collagen within tumors, with CAR T-cells. However, challenges persist in optimizing T cell therapies.

The inventors herein discovered that by enhancing T-cell motility through downregulation of FL2, the aforementioned problems may be addressed. As will be shown in the Examples herein, exposing T cells to a FL2 inhibitor enables T-cells to migrate to and interact with small clusters or individual cancer cells in vitro. Such enhancement of migration and penetration observed in vitro will translate into enhanced tumor homing and penetration activity in vivo, and enhanced killing of tumor cells, in particular solid tumors. Such downregulation of FL2 can be achieved in vivo by exposing T cells in vivo to an inhibitor of FL2; ex vivo or in vitro methods can be achieved by exposing T cells outside the body to the inhibitor then infusing into the subject. Such therapy can also be applied in vivo at sites of T cell activation such as lymph nodes. These and other aspects of the invention are described in more detail below.

As will be described below, any of the methods or uses described herein of FL2 inhibition are equally applicable to fidgetin and fidgetin-like 1 inhibition.

T-Cell Therapies

The invention herein is applicable to both endogenous T cells and those administered exogenously (i.e., adoptive T-cell therapies), such as but not limited to autologous T cells, CAR-T cells, tumor infiltrating lymphocytes, engineered T cell receptor lymphocytes, macrophages, microglia or natural killer cells. Other sources of T cells useful for T cell therapy are fully embraced herein, such as but not limited to donor T cells, off-the-shelf T cells, and T cell lines. In certain embodiments, the T cells are HLA matched to the patient.

Enhancing the migration to and penetration into tumors of endogenous T-cell may be achieved by administering one or more agents that inhibit FL2 parenterally or at the tumor site or in or near one or more lymph nodes proximal or even distal to the tumor site. Parenteral administering may comprise administering the agent intravenously, intra-arterially, intraperitoneally, intranasally, intramuscularly, intradermally or subcutaneously, or via guided injection, e.g., CT-guided injection, at or near a tumor site or lymph node site.

Adoptive T cells therapies comprise the administration of T cells from an exogenous source, which may be the patient's own T cells expanded and/or engineered ex vivo, or T cells from a cell line or other donor or source. Thus, the T cells may be allogeneic. In one embodiment, the allogeneic T cells are HLA matched to the patient.

Other sources of T cells include lymphoid progenitors or pluripotent stem cells.

Autologous T cells. In one embodiment (other than CAR as described elsewhere herein) comprise the T cell therapy. A patient's T cells (obtained from blood or TILs from a tumor biopsy) may be exposed ex vivo to the cancer antigen and optionally to other factors to expand the population of T cells specific for the patient's tumor. The T cells are also treated ex vivo with an agent to inhibit FL2 activity before infusion. The expanded T cells are then infused into the patient. Non-limiting examples of autologous T cell therapies include those directed to cancer antigens (with exemplary embodiments of target cancers): EBV LMP1/LMP2/EBNA1 (nasopharyngeal carcinoma), gp100 (melanoma), HBV antigens (hepatocellular carcinoma), HPV16 E6 (cervical, head and neck cancer), HPV16 E7 (cervical, vaginal, oropharyngeal cancer), MAGE-A3/4/6/10 (bladder, esophageal, lung, head and neck, NSCLC cancer), MelanA/MART-1 (melanoma), NY-ESO-1 (esophageal, melanoma, NSCLC, ovarian, synovial sarcoma), TGFβRII frameshift mutant (colorectal), and WT1 (acute myeloid leukemia).

In the practice of the invention, an agent that inhibits or knocks down FL2 levels in T cells can be exposed to autologous T cells during any ex vivo processing steps in the isolation, expansion, or other steps carried out before the cells are infused back into the patient. The exposure to the FL2 agent can occur during one or more of these processing steps.

Autologous T therapies may also include co-administration of other drugs such as but not limited to cytokines (such as IL-2 and IL-15); anti-cytokine therapies and other agents to treat cytokine release syndrome; immune checkpoint inhibitors such as ipilimumab, nivolumab, pembrolizumab, atezolizumab, avelumab, durvalumab and cemiplimab-rwlc, as well as an agent that blocks PD-1, PD-L1, CTLA-4, CTLA-4 receptor, PD1-L2, 4-1BB, OX40, LAG-3 or TIM-3. In other embodiment, other immune checkpoint inhibitors are used. Ex vivo use of checkpoint inhibition is described in Kumar et al., 2017, Onco Targets and Therapies 10:3453-3465. Small-molecular antagonists that block biochemical pathways crucial for tumor growth may also be administered.

CAR-T cells are T cells in which are engineered to express a chimeric antigen receptor (CAR) that comprises T cell activating functions and antigen-binding functions, to target the T cells to recognize tumor antigens. T cells from the patient (autologous) or from a donor (allogeneic) are isolated and expanded, then engineered to express the CAR by transducing the CAR gene. In one embodiment, the antigen of the CAR is that of a solid tumor. Some example of clinically tested CAR-T cells including those that target CD19 or CD20 (B cell antigens for B cell cancers), a combination of multiple co-stimulatory domains such as CD28 and 41BB and CD28 and OX40. Other versions include production of cytokines and co-stimulatory ligands. The CAR-T process is known to those of skill in the art.

Non-limiting examples of CAR-T cell therapies include the following antigens (with exemplary embodiments of target cancers): EBV LMP1/LMP2/EBNA1 (nasopharyngeal carcinoma), gp100 (melanoma), HBV antigens (hepatocellular carcinoma), HPV16 E6 (cervical, head and neck cancer), HPV16 E7 (cervical, vaginal, oropharyngeal cancer), MAGE-A3/4/6/10 (bladder, esophageal, lung, head and neck, NSCLC cancer), MelanA/MART-1 (melanoma), NY-ESO-1 (esophageal, melanoma, NSCLC, ovarian, synovial sarcoma), TGFβRII frameshift mutant (colorectal), and WT1 (acute myeloid leukemia). Selection of targets may be guided by following the art, such as described in Liu et al., 2019, Am J Cancer Res 9(2):228-241, incorporated herein by reference.

In the practice of the invention, an agent that inhibits or knocks down FL2 levels in T cells can be exposed to T cells during the ex vivo processing steps in the isolation, expansion, transduction, or other steps before the CAR-T cells are infused into the patient. The exposure to the FL2 agent can occur during one or more of these processing steps.

CAR-T therapies may also include co-administration of other drugs such as but not limited to cytokines (such as IL-2 and IL-15); anti-cytokine therapies and other agents to treat cytokine release syndrome; immune checkpoint inhibitors such as but not limited to ipilimumab (YERVOY), nivolumab (OPDIVO), pembrolizumab (KEYTRUDA), atezolizumab (TECENTRIQ), avelumab (BAVENCIO), durvalumab (IMFINZI) and cemiplimab-rwlc (LIBTAYO), as well as an agent that blocks PD-1, PD-L1, CTLA-4, CTLA-4 receptor, PD1-L2, 4-1BB, OX40, LAG-3 or TIM-3. In other embodiment, other immune checkpoint inhibitors are used. Ex vivo use of checkpoint inhibition is described in Kumar et al., 2017, Onco Targets and Therapies 10:3453-3465. Small-molecular antagonists that block biochemical pathways crucial for tumor growth may also be administered.

CAR-T therapies as embodied herein include any variation on the CAR-T methods, such as but no limited to second, third, fourth and beyond generation therapies. Guidance on the use of immune checkpoint inhibition and CAR-T therapies may be found in Wang et al., 2019, J. Hematol Oncol 12:59, incorporated herein by reference.

In other embodiments, CAR-T and other engineered lymphocyte therapies may be applied to any of the sources of T cells described herein, such as but not limited to lymphoid precursors, pluripotent stem cells, among others.

Tumor infiltrating lymphocytes are white blood cells that have left the bloodstream and migrated towards a tumor. They include T cells and B cells and are part of the larger category of ‘tumor-infiltrating immune cells’ which consist of both mononuclear and polymorphonuclear immune cells, (i.e., T cells, B cells, natural killer cells, macrophages, neutrophils, dendritic cells, mast cells, eosinophils, basophils, etc.) in variable proportions. TILs can often be found in the tumor stroma and within the tumor itself.

TILs can be the source of T cells for the methods described herein. In adoptive T cell transfer therapy, TILs are expanded ex vivo from surgically resected tumors that have been cut into small fragments or from single cell suspensions isolated from the tumor fragments. Multiple individual cultures are established, grown separately and assayed for specific tumor recognition. In one embodiment, TILs are expanded over the course of a few weeks with a high dose of IL-2 in 24-well plates. Selected TIL lines that presented best tumor reactivity are then further expanded in a “rapid expansion protocol” (REP), which uses anti-CD3 activation for a typical period of two weeks. The final post-REP TIL is infused back into the patient. Enhancement of the tumor homing and penetration by FL2 inhibition may be applied during one or more of the ex vivo steps described here. As noted above, therapy with other agents including immune checkpoint inhibitor therapy may accompany TIL therapy.

In one embodiment, the process can also involve a preliminary chemotherapy regimen to deplete endogenous lymphocytes in order to provide the adoptively transferred and FL2 inhibited TILs with enough access to surround the tumor sites. In one embodiment, this chemotherapy regimen is given 7 days before the expanded TIL infusion. This involves pretreatment of the patient with, in one embodiment, a combination of fludarabine and cyclophosphamide. Lympho-depletion is thought to eliminate the negative effects of other lymphocytes that may compete for growth factors and decrease anti-tumor effects of the TILs, depleting regulatory or inhibitory lymphocyte populations.

Engineered T cell receptor lymphocytes (other than CAR-T) are cells with engineered T cell receptors (TCRs), other than CAR. Non-limiting examples of those already in oncology clinical trials for cancer therapy include cancer antigens (and cancers): EBV LMP1/LMP2/EBNA1 (nasopharyngeal carcinoma), gp100 (melanoma), HBV antigens (hepatocellular carcinoma), HPV16 E6 (cervical, head and neck), HPV16 E7 (cervical, vaginal, oropharyngeal), MAGE-A3/4/6/10 (bladder, esophageal, lung, head and neck, NSCLC), MelanA/MART-1 (melanoma), NY-ESO-1 (esophageal, melanoma, NSCLC, ovarian, synovial sarcoma), TGFβRII frameshift mutant (colorectal), and WT1 (acute myeloid leukemia). Other examples are described in Paucek et al., Trends in Immunology 2019 Apr. 1; 40(4):292-309, incorporated herein by reference.

In the practice of the invention, an agent that inhibits or knocks down FL2 levels in T cells can be exposed to T cells during the ex vivo processing steps in the isolation, expansion, transduction, or other steps before the engineered cells are infused into the patient. The exposure to the FL2 agent can occur during one or more of these processing steps.

As noted above, therapy with other agents including immune checkpoint inhibitor therapy may accompany such therapy.

Other T cell sources. Other sources of T cells for T cell engineering and adoptive immunotherapy that may be used in the practice of the present methods are described in Themeli et al., Cell Stem Cell 2015 Apr. 2; 16(4):357-366, incorporated herein by reference.

Macrophages are a type of white blood cell, of the immune system, that engulfs and digests cellular debris, foreign substances, microbes, cancer cells, and anything else that does not have the type of proteins specific to healthy body cells on its surface in a process called phagocytosis. In one embodiment, the homing and/or tumor penetrating activity of macrophages is enhanced by FL2 inhibition as described herein.

Microglia are the resident mononuclear macrophages of the CNS, and constitute ˜5-20% of all glial cells in the CNS parenchyma. In one embodiment, the homing and/or tumor penetrating activity of microglia is enhanced by FL2 inhibition as described herein.

Natural killer (NK) cells are a type of cytotoxic lymphocyte critical to the innate immune system. The role NK cells play is analogous to that of cytotoxic T cells in the vertebrate adaptive immune response. NK cells provide rapid responses to virus-infected cells, acting at around 3 days after infection, and respond to tumor formation. Typically, immune cells detect the major histocompatibility complex (MHC) presented on infected cell surfaces, triggering cytokine release, causing lysis or apoptosis. NK cells are unique, however, as they have the ability to recognize stressed cells in the absence of antibodies and MHC, allowing for a much faster immune reaction. They were named “natural killers” because of the initial notion that they do not require activation to kill cells that are missing “self” markers of MHC class 1. This role is especially important because harmful cells that are missing MHC I markers cannot be detected and destroyed by other immune cells, such as T lymphocyte cells.

Since NK cells recognize target cells when they express non-self HLA antigens (but not self), autologous (patients' own) NK cell infusions have not shown any antitumor effects. Instead, investigators are working on using allogeneic cells from peripheral blood, which requires that all T cells be removed before infusion into the patients to remove the risk of graft versus host disease, which can be fatal. This can be achieved using an immunomagnetic column (CliniMACS). In addition, because of the limited number of NK cells in blood (only 10% of lymphocytes are NK cells), their number needs to be expanded in culture. This can take a few weeks and the yield is donor-dependent. A simpler way to obtain high numbers of pure NK cells is to expand NK-92 cells whose cells continuously grow in culture and can be expanded to clinical grade numbers in bags or bioreactors (Granzin et al., Shaping of Natural Killer Cell Antitumor Activity by Ex Vivo Cultivation, Front Immunol. 2017; 8:458). Clinical studies have shown it to be well tolerated and some antitumor responses have been seen in patients with lung cancer, melanoma, and lymphoma.

In one embodiment, the homing and/or tumor penetrating activity of NK cells is enhanced by FL2 inhibition as described herein, during any one of more steps in the isolation, purification, expansion, or other ex vivo steps before infusion of the NK cells into the subject.

Lymphoid progenitors. In one embodiment, lymphoid progenitors provide a source of off-the-shelf T cells which do not require strict histocompatibility matching between donor and recipient. Moreover. while T cells can cause GVHD, their precursors do not, as they undergo positive and negative selection in the recipient's thymus. Taking advantage of this requires the ability to expand T cell precursors in culture, which is now possible due to advances in understanding T cell development. T cell precursors lack the ability to initiate GVH reactions because they complete their differentiation in the recipient's thymus wherein they become restricted to host MHC and yield T lymphocytes that are host tolerant. When transduced with a CAR, allogeneic lymphoid progenitors yield tumor-targeted T cells without causing GVHD. The main advantage of using T cell precursors for immunotherapy is that this approach does not require strict histocompatibility between donors and recipients.

Pluripotent stem cells. In another embodiment, pluripotent stem cells, which can give rise to a variety of somatic cells, may be used to supply therapeutic T cells for the purposes herein, and which can be further enhanced by the FL2 inhibition described herein. The development of cellular therapeutics relying on functionally validated, banked, broadly histocompatible cell types would have a major impact on the availability of adoptive T cell therapies. Pluripotent stem cells can give rise to a variety of somatic cells and thus have in principle the potential to serve as an endless supply of therapeutic T lymphocytes.

For any of the foregoing T cell therapies or other cell therapies wherein increased homing and/or penetration of the T cell or other cell type to or into a tumor is desirable, cells are exposed to an FL2 inhibitor as described elsewhere herein, for a sufficient time, concentration, dose, or other exposure protocol in order to enhance the tumor homing and/or tumor penetration ability of the so-treated T cells or other cell types. As noted herein, treatment of cells with a checkpoint inhibitor may also be performed.

FL2 Inhibitors

As noted herein, increased homing to or penetration into tumors of T cells may be achieved by inhibiting FL2 expression or activity in the T cells, during in vitro or ex vivo preparation, or after infusion into the patient, or both. In one embodiment, FL2 inhibition is provided during in vitro preparation of T cells. In one embodiment, FL2 inhibition is provided during ex vivo preparation of T cells. In one embodiment, FL2 inhibition is provided in vivo to enhance endogenous T cell activity. In one embodiment, FL2 inhibition is provided during in vitro preparation of T cells and also administered in vivo after infusion of the T cells. In one embodiment, FL2 inhibition is provided during ex vivo preparation of T cells and also administered in vivo after infusion of the T cells.

Non-limiting examples of inhibitors of FL2 include aptamers, nucleic acids, oligonucleotides, and small molecules (of 2000 Daltons or less). In one embodiment, agents that inhibit FL2 expression or activity include nucleic acids such as but not limited to RNA interference agents. Non-limiting examples of RNA interference agents include shRNA and siRNA.

In one embodiment, the RNA interference agent is an siRNA (small interfering RNA). In an embodiment, the siRNA as used in the methods or compositions described herein comprises a portion which is complementary to an mRNA sequence encoding a fidgetin-like 2 protein. In an embodiment, the fidgetin-like 2 protein is a human fidgetin-like 2 protein. In an embodiment, the mRNA is encoded by the DNA sequence NCBI Reference Sequence: NM-001013690.4 (SEQ ID NO:19), and the siRNA is effective to inhibit expression of fidgetin-like 2 protein. In an embodiment, the fidgetin-like 2 protein comprises consecutive amino acid residues having the sequence set forth in SEQ ID NO:20 shown below.

In one embodiment, the siRNA comprises a double-stranded portion (duplex). In an embodiment, the siRNA is 20-25 nucleotides in length. In an embodiment the siRNA comprises a 19-21 core RNA duplex with a one or two nucleotide 3′ overhang on, independently, either one or both strands.

SiRNA oligonucleotides may be modified to enhance their activity and reduce degradation, such as described in Chakraborty et al., 2017, Mol Ther Nucleic Acids 8:132-143, incorporated herein by reference, among other teachings in the art. In one embodiment, the siRNA can be 5′ phosphorylated, or not, and may be modified with any of the known modifications in the art to improve efficacy and/or resistance to nuclease degradation. In an embodiment the siRNA can be administered such that it is transfected into one or more cells. In an embodiment, the siRNA is 5′ phosphorylated.

In an embodiment, the 5′ terminal residue of a strand of the siRNA is phosphorylated. In an embodiment the 5′ terminal residue of the antisense strand of the siRNA is phosphorylated. In one embodiment, a siRNA of the invention comprises a double-stranded RNA wherein one strand of the double-stranded RNA is 80, 85, 90, 95 or 100% complementary to a portion of an RNA transcript of a gene encoding fidgetin-like 2 protein. In an embodiment, the RNA transcript of a gene encoding fidgetin-like 2 protein is an mRNA. In an embodiment, the fidgetin-like 2 protein is a human fidgetin-like 2 protein. In an embodiment, a siRNA of the invention comprises a double-stranded RNA wherein one strand of the RNA comprises a portion having a sequence the same as a portion of 18-25 consecutive nucleotides of an RNA transcript of a gene encoding fidgetin-like 2 protein. In an embodiment, the fidgetin-like 2 protein is a human fidgetin-like 2 protein. In yet another embodiment, a siRNA of the invention comprises a double-stranded RNA wherein both strands of RNA are connected by a non-nucleotide linker. Alternately, a siRNA of the invention comprises a double-stranded RNA wherein both strands of RNA are connected by a nucleotide linker, such as a loop or stem loop structure.

In one embodiment, a single strand component of a siRNA of the invention is from 14 to 50 nucleotides in length. In another embodiment, a single strand component of a siRNA of the invention is 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, or 28 nucleotides in length. In yet another embodiment, a single strand component of a siRNA of the invention is 21 nucleotides in length. In yet another embodiment, a single strand component of a siRNA of the invention is 22 nucleotides in length. In yet another embodiment, a single strand component of a siRNA of the invention is 23 nucleotides in length. In one embodiment, a siRNA of the invention is from 28 to 56 nucleotides in length. In another embodiment, a siRNA of the invention is 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 51, or 52 nucleotides in length.

In another embodiment, an siRNA of the invention comprises a 3′ overhang. In another embodiment, an siRNA of the invention comprises a 5′ overhang. In another embodiment, an siRNA of the invention comprises at least one 2′-sugar modification, such as but not limited to 2′ azido-2′deoxycytidine ribonucleic acid, 2′-azido-2′deoxyuridine ribonucleic acid, 2′-azido-2′deoxyadenosine ribonucleic acid, 2′-azido-2′-deoxyguanosine ribonucleic acid, 2′-fluoro-2′-deoxyadenosine ribonucleic acid, 2′-fluoro-2′-deoxycytidine ribonucleic acid, 2′-fluoro-2′-deoxyuridine ribonucleic acid, 2-fluorothymidine ribonucleic acid, 2′-O-methyladenosine ribonucleic acid, 2′-O-methylcytidine ribonucleic acid, 2′-O-methylguanosine ribonucleic acid, 2′-O-methyluridine ribonucleic acid, In another embodiment, an siRNA of the invention comprises at least one nucleic acid base modification, such as but not limited. to 2′-fluorodeoxy cytidine ribonucleic acid, 2′-fluorodeoxy uracil ribonucleic acid, 2′-O-methyl adenosine ribonucleic acid. Other nucleotide modifications are described in Chiu et al., 2003, RNA 9(9):1034-1048, and Peacock et al., 2011, J Org Chem 76(18):7295-7300, incorporated herein by reference.

In another embodiment, an siRNA of the invention comprises at least one phosphate backbone modification. In another embodiment, an siRNA of the invention comprises at least one 5′ phosphorylation. As used herein, “at least one” means one or more.

In one embodiment, RNAi inhibition of fidgetin-like 2 protein is effected by a short hairpin RNA (“shRNA”). The shRNA is introduced into the appropriate cell by transduction with a vector. In an embodiment, the vector is a lentiviral vector. In an embodiment, the vector comprises a promoter. In an embodiment, the promoter is a U6 or H1 promoter. In an embodiment the shRNA encoded by the vector is a first nucleotide sequence ranging from 19-29 nucleotides complementary to the target gene/mRNA, in the present case the mRNA encodes fidgetin-like 2 protein. In an embodiment the fidgetin-like 2 protein is a human fidgetin-like 2 protein. In an embodiment the shRNA encoded by the vector also comprises a short spacer of 4-15 nucleotides (a loop, which does not hybridize) and a 19-29 nucleotide sequence that is a reverse complement of the first nucleotide sequence. In an embodiment the siRNA resulting from intracellular processing of the shRNA has overhangs of 1 or 2 nucleotides. In an embodiment the siRNA resulting from intracellular processing of the shRNA overhangs has two 3′ overhangs. In an embodiment the overhangs are UU.

In one non-limiting example, a shRNA useful for the purposes herein comprises CACCGCTGGAGCCCTTTGACAAGTTCTCGAGAACTTGTCAAAGGGCTCCAGCTTTT (SEQ ID NO:23). In one embodiment, the shRNA sequence consists of CACCGCTGGAGCCCTTTGACAAGTTCTCGAGAACTTGTCAAAGGGCTCCAGCTTTT (SEQ ID NO:23).

The NCBI Reference Sequence: NM-001013690.4 (nucleic acid encoding Human fidgetin-like 2) is:

(SEQ ID NO: 19)
1 agtgagctat ggggacacta ctgcactgta gcctgggcaa cagagcaaga ccttgtctca
61 aaaatgtata tatattttgg gctttttttc ctaaaacggg aactacaaca gcatatttgc
121 gagctgatga gagtgaccca gcagagaggg aaatggatca gctctgttga agatgcactg
181 gacaccagaa cacgcccagc ccctcaacca gtggccagag cagcacctgg acgtctcctc
241 caccaccccg tcgccggccc acaagttgga gttgccccct gggggtcgcc aacgctgcca
301 ctacgcttgg gcacacgacg acatctcagc cctcactgcc tccaacctcc taaagcgcta
361 tgcagagaag tactctgggg tcttggattc tccctacgag cgtccggccc tgggcgggta
421 cagcgacgcc tccttcctca acggcgccaa aggggatccc gagccctggc cagggccgga
481 gccaccctac cccttggcct cactccacga aggcctccca ggaaccaaat cgggcggtgg
541 cggcggttcc ggggccctgg ggggctcccc agttttagcc gggaacctcc ctgaacccct
601 ctacgccggc aatgcgtgcg ggggcccatc ggcggcgccc gagtacgcgg ccggctacgg
661 cggggggtac ctggcgccgg gttactgcgc gcagacgggc gccgcgctgc ccccgccgcc
721 cccggccgcg ctcctgcagc ccccaccgcc tccggggtac gggccctcag cgccgctgta
781 caactatccc gcagggggct acgcagcgca gcccggctat ggcgcgctcc cgccgccccc
841 aggcccaccc ccggccccct acctgacccc gggcctgccc gcgcccacgc ccctgcccgc
901 gccggcaccg cccaccgcct atggcttccc cacggccgcg ccgggtgccg aatccgggct
961 gtcgctgaag cgcaaggccg ccgacgaggg gcccgagggc cgctaccgca agtacgcgta
1021 cgagcccgcc aaggcccccg tggctgacgg agcctcctac cccgccgcgg acaacggcga
1081 atgtcggggc aacgggttcc gggccaagcc gccaggagcc gcggaggagg cgtcgggcaa
1141 gtacggtggc ggcgtccccc tcaaggtcct gggctccccc gtctacggcc cgcaactgga
1201 gccctttgaa aagttcccgg agcgggcccc ggctcctcgt ggggggttcg ccgtgccgtc
1261 gggggagact cccaaaggcg tggaccctgg ggccctggag ctggtgacga gcaagatggt
1321 ggactgcggg cccccggtgc agtgggcgga tgtggcgggc cagggcgcgc tcaaggcggc
1381 gctggaggag gagctggtgt ggcccctgct caggccgccc gcctacccgg gcagcctgcg
1441 cccgccgcgg accgtcctgc tctttgggcc gcggggcgcg ggcaaagcgc tgctgggccg
1501 ctgcctcgcc acgcagctgg gcgccacgct gttgcgcctg cgcggcgcga ccctggctgc
1561 gcccggcgcc gccgagggcg cgcgcctcct ccaggccgcc ttcgcggccg cgcgctgccg
1621 cccaccctcc gtactcctca tcagcgagct agaggcgctg ctccccgccc gggacgacgg
1681 cgcggcggca gggggcgcgc tgcaggtgcc gctcctggcc tgcctggacg ggggctgcgg
1741 cgcgggggct gacggcgtgc tggttgtggg caccacctcg cggcccgcgg ctctggacga
1801 ggcgacccgc cggcgcttct ctctccgctt ctacgtggcg ctgcccgaca gcccggcccg
1861 cgggcagatc ctgcagcggg cgctggccca gcagggctgc gcgctcagtg agcgggaact
1921 ggcggcgctg gtgcagggca cgcagggctt ctctgggggc gagctggggc agctgtgcca
1981 gcaggcggcg gccggggcgg gcctcccggg gctgcagcgc cccctctcct acaaggacct
2041 ggaggcggcg ctggccaagg tgggccctag ggcctctgcc aaggaactgg actcgttcgt
2101 ggagtgggac aaaatgtacg gctccggaca ctgacggcgc gcgggggagg ccgcgggagc
2161 cgcagtccct ccgtccccgc cgcctccgcg tgggagggat gtcactgact aaacccggct
2221 ggcaggggct ggagtggtga atgtgggatc ggggacagga ggggtctgcc ggtggatatt
2281 ttttttttcg tgggaaggaa aatgcttctg ccaggcagat gccatatgcg ccgtgtactc
2341 aggtttttcc tatttattgt ggactggaag ctcgccatct ccgcccggca gaccgggcag
2401 atccggcatg ggctggcacc cggggcctta agaactcctg ctctcttgcc acaacgcttt
2461 tgtctcctcg ctatctgaat ggcaccctcc ttctccctca ctctctccat cccattctct
2521 gcattctctt ggttttctct cccttttgct ttgtcgctga cacccctgcc caccccatgc
2581 tggccctgtt tctctcctgc ccctccctcc ccagctctcc atccctcacc ctctgtgctt
2641 ctgtctccat ccctggctct ccagcgtccc tggccttttg gtccctgagc tttaatgcct
2701 ttccctgcct tctgttctta tttggactgc agtggccctt tgcaggagct ctggaggccc
2761 aggggctgag gaggagggtt acccctctac ccatctgaaa cctagggtct agggggatca
2821 aggaaaaaaa gtccccaaag aaggggaatt ttttgtttgt ttttgagggg agatcccaga
2881 aatgtagctt gtttcatatt ttagtcttct tatttttgta aaatgtgtag aatttgctgt
2941 ttttcttttt cttttgacaa ctcaggaaga aactgacctc agaaagaatg ttagactttg
3001 gctgctctcc tgtgtgcccc tcacacctgc cccctccccc ccactccatc caggggacca
3061 aattctccca gacactcaaa aaatgagact tacggggaag gggagaggaa gacccagagg
3121 cctcagtgaa accccagcta ttcctggtca gaagcagaat gtattcctaa gggcttcctc
3181 cccagggccg aggcctaggc atgaatgtgg ggagtgggct gtggggtttg agagaaggga
3241 ggccttattc ctctcctgct gctccccacc ccctgcccca cccaacccct ccgctgagtg
3301 ttttctgtga agggctatcc agagttagga tgcccttgcc caattccttc ctgagaccca
3361 gaaggtaggg tgggagggcc caaatgggaa ggtgacctaa gcagaaagtc tccagaaagg
3421 tcatgtcccc tggccctgcc ttggcagagg tccccagtga cttatgctag gaggattcca
3481 tctgggtaga cagtctggcc acaaaatcag ctactggacc tcagccatct ctgctggagg
3541 ctctgaggag gagtgagcat ccctcacttg tgggggctct gtgaggaaat gtgccttccc
3601 cattcccccg gagtcctagg tctggagctc cagggctggg agagggtgag ggagatgggc
3661 aggggtgttt tctctgacct tgggggctta gtctcagtcc tgcctgaact ttccactagg
3721 cttggaaccc ttccaagaac catatttctc tccttcccac caattttccc ttgatgaggc
3781 tttagcagtt tgctcccacc acccccagcc catttcacaa ctctgatctt agtccaaagc
3841 aggggacacg cccccccacc accacttttt ctctctccca tctcagcctc ctgtgcagtt
3901 ccttgcctgc ccgtgcattt cctagagtct actgcctccc ccctggctgg gagggtgtct
3961 gggggggatc tttcaggggc cctggcaccc agggcctgtg ctggcctagg agtgctgacc
4021 agaaggctgc tctgttcccc cccacccccg ttgctttctg gccccctctt tggagccagc
4081 cacccacagg gctttggtgc ctcagaagca gtgggctgcc gggtcacagc cgcaggctgc
4141 aaaagaccct cggagggagc atggagtgag gggttctctc tcaggtgtgt atgtattggg
4201 gggtgggggt gggtggaggg tgtcagggaa gttggggtgg gatcccagcc ttcccttcaa
4261 gaggcaggga gctctgggag gtggagtccc caccgctttc tctactaggc tcctcctgtt
4321 ccccaggctt ggggagcttt gcacaaggag actgccccca gcctagtggc acctacctca
4381 tgggctctgg ggcaggtagg ggaagggcca gtccagctct ggtaatgctg gggggaggca
4441 taccaaagaa tccaggggca gggagtgggg agggtgactt ccgagctggc ctctcccctt
4501 cctctaccca gactggggct gggatcctct cctcccgctg taaccatttc tacctcattt
4561 tgctgcgtgt tgtacatgga cgtatttatc tcctgtctga cgatgctctg cagttgtggt
4621 ctgtctacct cagaagagac tgtattttaa aagaaagtat tacacagtat taaagcgatg
4681 acatgtggtt tgcaaaaaaa aaaaaaaaaa a,

which encodes:

MHWTPEHAQPLNQWPEQHLDVSSTTPSPAHKLELPPGGRQRCHYAWAHD
DISALTASNLLKRYAEKYSGVLDSPYERPALGGYSDASFLNGAKGDPEP
WPGPEPPYPLASLHEGLPGTKSGGGGGSGALGGSPVLAGNLPEPLYAGN
ACGGPSAAPEYAAGYGGGYLAPGYCAQTGAALPPPPPAALLQPPPPPGY
GPSAPLYNYPAGGYAAQPGYGALPPPPGPPPAPYLTPGLPAPTPLPAPA
PPTAYGFPTAAPGAESGLSLKRKAADEGPEGRYRKYAYEPAKAPVADGA
SYPAADNGECRGNGFRAKPPGAAEEASGKYGGGVPLKVLGSPVYGPQLE
PFEKFPERAPAPRGGFAVPSGETPKGVDPGALELVTSKMVDCGPPVQWA
DVAGQGALKAALEEELVWPLLRPPAYPGSLRPPRTVLLFGPRGAGKALL
GRCLATQLGATLLRLRGATLAAPGAAEGARLLQAAFAAARCRPPSVLLI
SELEALLPARDDGAAAGGALQVPLLACLDGGCGAGADGVLVVGTTSRPA
ALDEATRRRFSLRFYVALPDSPARGQILQRALAQQGCALSERELAALVQ
GTQGFSGGELGQLCQQAAAGAGLPGLQRPLSYKDLEAALAKVGPRASAK
ELDSFVEWDKMYGSGH (human fidgetin-like 2; SEQ ID
NO: 20).

In one embodiment, the siRNA that inhibits FL2 comprises a sense or antisense sequence selected from the table below.

RNA sequences Sequence ID
UUACACAGUAUUAAAGCGAUU (sense) SEQ ID NO: 1
UCGCUUUAAUACUGUGUAAUU (antisense) SEQ ID NO: 2
CAUCUGAAACCUAGGGUCUUU (sense) SEQ ID NO: 3
AGACCCUAGGUUUCAGAUGUU (antisense) SEQ ID NO: 4
GUGACUUAUGCUAGGAGGAUU (sense) SEQ ID NO: 5
UCCUCCUAGCAUAAGUCACUU (antisense) SEQ ID NO: 6
GGUCAGAAGCAGAAUGUAUUU ( sense) SEQ ID NO: 7
AUACAUUCUGCUUCUGACCUU (antisense) SEQ ID NO: 8
CGCCGGCCCACAAGUUGGAdTdT (sense) SEQ ID NO: 9
UCCAACUUGUGGGCCGGCGdTdT (antisense) SEQ ID NO: 10
CAGCUCGAGCCCUUUGACAdTdT (sense) SEQ ID NO: 11
UGUCAAAGGGCUCGAGCUGdTdT (antisense) SEQ ID NO: 12
CCUCCAACCUCCUCAAGAGdTdT (sense) SEQ ID NO: 13
CUCUUGAGGAGGUUGGAGGdTdT (antisense) SEQ ID NO: 14
CGUUGCUGCUCAUCAGCGAdTdT (sense) SEQ ID NO: 15
UCGCUGAUGAGCAGCAACGdTdT (antisense) SEQ ID NO: 16
fUfUmA fCmAfC AGU AUU AAA GCG ATT(sense) SEQ ID NO: 17
(Phos) U CGC UUU AAU ACU G UG UAA TT (antisense) SEQ ID NO: 18
5′-UUACACAGUAUUAAAGCGATT-3′ (sense) SEQ ID NO: 34
(Phos) 5′ - mUmCGCUUUAAUACUGUGUAATT-3′ (antisense) SEQ ID NO: 35
(Phos) 5′ - mU(s)mC(s)GCUUUAAUACUGUGUAATT-3′ (antisense) SEQ ID NO: 36
(Phos) 5′ - fUfCGCUUUAAUACUGUGUAATT -3′ (antisense) SEQ ID NO: 37
(Phos) 5′ -fU(s)fC(s)GCUUUAAUACUGUGUAATT-3′(antisense) SEQ ID NO: 38
(Phos) 5′ - mU(s)mC(s)GCUUUAAUAmCfUmGfUmGfUmAmATT-3′ SEQ ID NO: 39
(antisense)
(Phos) 5′ - U(s)CGCUUUAAUACUGUGUAATT-3′ (antisense) SEQ ID NO: 40
(Phos) 5′ - mUfCmGfCmUfUmUAAfUmAfCmUGmUmGfUmAmATT SEQ ID NO: 41
(antisense)
5′ SEQ ID NO: 42
mUmUmAmCmAmCmAmGmUmAmUmUmAmAmAmGmCmGmAmUmU-
3′ (antisense)
(Phos) 5′ - SEQ ID NO: 43
mUmCmGmCmUmUmUmAmAmUmAmCmUmGmUmGmUmAmAmUmU-
3′ (antisense)
5′ mUmUmAmCmAmCmAmGmUmAmUmUmAmAmAmGdCdGdATT-3′ SEQ ID NO: 44
(sense)
5′ mUmUmAmCmAmCmAmGmUmAmUmUmAmAmAmGdCmGmATT-3′ SEQ ID NO: 45
(sense)
5′ UUACACAGUAUUAAAGCGA-3′ (sense) SEQ ID NO: 46
(Phos) 5′ - U(s)CGCUUUAAUACUGUGUAATT-3′ (antisense) SEQ ID NO: 47
(Phos) 5′ - UCGCUUUAAUACUGUGUAATT-3′(antisense) SEQ ID NO: 48
(Phos) 5′ - U(s)C(s)GCUUUAAUACUGUGUAATT-3′(antisense) SEQ ID NO: 49
5′-mUmUACACAGUAUUAAAGCGA-3′(sense) SEQ ID NO: 50
(Phos) 5′ - U(s)CGCUUUAAUACUGUGUmAmATT-3′(antisense) SEQ ID NO: 51
(Phos) 5′ - UCGCUUUAAUACUGUGUAATT-3′ (antisense) SEQ ID NO: 52
(Phos) 5′ - U(s)C(s)GCUUUAAUACUGUGUAA T(s)T-3′ (antisense) SEQ ID NO: 53
5′ 1U1thA1C1ACAGUAUUAAAGCGATT-3′ (sense) SEQ ID NO: 54
(Phos) 5′ - UCGCUUUAAUACUG1U1G1U1A1A TT -3′ (antisense) SEQ ID NO: 55
5′ fUfU1AfC1ACAGUAUUAAAGCGA-3′ (sense) SEQ ID NO: 56
(Phos) 5′ - mU(s)mCmGCUUUAAUACUGUGUAATT -3′ (antisense) SEQ ID NO: 57

wherein d(nucleotide)=deoxy-(nucleotide), m(nucleotide)=2′-O-methyl nucleotide, T=thymidine, f(nucleotide)=2′-fluorodeoxy nucleotide, (Phos)=phosphodiester cap; capital letter nucleotide=RNA nucleotide, l(nucleotide)=a locked nucleotide, and (s)=phosphorothioate. Thus, for example dT represents deoxythymidine, dC represents deoxycytidine, fC represents 2′-fluorodeoxy cytidine ribonucleic acid, fU represents 2′-fluorodeoxy uracil ribonucleic acid, mA represents 2′-O-methyl adenosine ribonucleic acid, mU represents 2′-O-methyl uracil ribonucleic acid, mC represents 2′-O-methyl cytosine ribonucleic acid, and mG represents 2′-O-methyl guanosine ribonucleic acid.

In some embodiments, the siRNA may have a 5′-phosphodiester cap, as abbreviated “(Phos)” in the aforementioned sequences. In some embodiments, the siRNA does not have a 5′-phosphodiester cap. siRNA sequences without a 5′-phosphodiester cap are fully embraced herein.

A phosphorothioate linkage between nucleotides is represented in the sequences by “(s)”.

Locked nucleotides in one embodiment comprise a ribose with a 2′-O, 4′-C methylene bridge, for example, 2′-O, 4′-C methylene adenosine (1A); 2′-O, 4′-C methylene guanosine (1G); 2′-O, 4′-C methylene cytidine (1C); 2′-O, 4′-C methylene uridine (1U); and 2′-O, 4′-C methylene thymine (1T) ribonucleosides. In other embodiments, the locked nucleic acid comprises a methyl group attached to the methylene group. Other types of locked nucleic acids are embraced herein.

In one embodiment, the FL2 siRNA is double-stranded and comprises any complementary sense sequence and antisense sequence from the foregoing table.

Non-limiting examples of such double-stranded sequences include SEQ ID NO:1 and SEQ ID NO: 2, SEQ ID NO:3 and SEQ ID NO: 4, SEQ ID NO:5 and SEQ ID NO: 6, SEQ ID NO:7 and SEQ ID NO: 8, SEQ ID NO:9 and SEQ ID NO: 10, SEQ ID NO:11 and SEQ ID NO: 12, SEQ ID NO:13 and SEQ ID NO: 14, SEQ ID NO:15 and SEQ ID NO: 16, and SEQ ID NO:17 and SEQ ID NO: 18. In some embodiments, the siRNA is single-stranded, selected from among SEQ ID NO:1-18 above.

In one embodiment, a double stranded nucleic acid is provided consisting of complementary nucleic acid molecules selected from among SEQ ID NOs: 34-57 or from among SEQ ID NOS: 1-18 or 34-57. In one embodiment, the double stranded nucleic acid comprises a sense strand and an antisense strand. In one embodiment, the double stranded nucleic acid consists of a sense strand and an antisense strand.

In one embodiment, a double stranded nucleic acid is provided consisting of a sense strand selected from SEQ ID NOs: 1, 3, 5, 7, 9, 11, 13, 15 or 17; and an antisense strand selected from SEQ ID NOs: 2, 4, 6, 8, 10, 12, 14, 16 or 18.

In one embodiment, a double stranded nucleic acid is provided consisting of a sense strand selected from SEQ ID NOs: 1, 17, 34, 42, 44, 45, 46, 50 and 54; and an antisense strand selected from SEQ ID NOs: 2, 18, 35, 36, 37, 38, 39, 40, 41, 43, 47, 48, 49, 51, 52, 53, 55 and 57.

In one embodiment, a double stranded nucleic acid is provided consisting of a sense strand selected from SEQ ID NOs: 1, 17, 34, 42, 44, 45, 46, 50, 54 and 56; and an antisense strand selected from SEQ ID NOs: 2, 4, 6, and 8.

In one embodiment, a double stranded nucleic acid is provided consisting of a sense strand selected from SEQ ID NOs: 1, 3, 5 and 7; and an antisense strand selected from SEQ ID NOs: 18, 35, 36, 37, 38, 39, 40, 41, 43, 47, 48, 49, 51, 52, 53, 55 and 57.

In one embodiment, a double stranded nucleic acid is provided consisting of a sense strand selected from SEQ ID NOs: 1, 3, 5, 7, 9, 11, 13, 15, 17, 34, 42, 44, 45, 46, 50 and 54; and an antisense strand selected from SEQ ID NOs: 2, 4, 6, 8, 10, 12, 14, 16, 18, 35, 36, 37, 38, 39, 40, 41, 43, 47, 48, 49, 51, 52, 53, 55 and 57.

In one embodiment, a double stranded nucleic acid is provided comprising a sense strand selected from SEQ ID NOs: 1, 3, 5, 7, 9, 11, 13, 15, 17, 34, 42, 44, 45, 46, 50 and 54; and an antisense strand selected from SEQ ID NOs: 2, 4, 6, 8, 10, 12, 14, 16, 18, 35, 36, 37, 38, 39, 40, 41, 43, 47, 48, 49, 51, 52, 53, 55 and 57.

In one embodiment, a double-stranded nucleic acid is provided consisting of SEQ ID NO:17 and SEQ ID NO:18; SEQ ID NO:34 and SEQ ID NO:35; SEQ ID NO:34 and SEQ ID NO:36; SEQ ID NO:34 and SEQ ID NO:37; SEQ ID NO:34 and SEQ ID NO:38; SEQ ID NO:34 and SEQ ID NO:39; SEQ ID NO:17 and SEQ ID NO:40; SEQ ID NO:34 and SEQ ID NO:41; SEQ ID NO:42 and SEQ ID NO:43; SEQ ID NO:44 and SEQ ID NO:43; SEQ ID NO:45 and SEQ ID NO:43; SEQ ID NO:46 and SEQ ID NO:47; SEQ ID NO:46 and SEQ ID NO:48; SEQ ID NO:46 and SEQ ID NO:49; SEQ ID NO:50 and SEQ ID NO:51; SEQ ID NO:46 and SEQ ID NO:53; SEQ ID NO:54 and SEQ ID NO:55; or SEQ ID NO:56 and SEQ ID NO:57.

In one embodiment, a double stranded nucleic acid is provided comprising at least one nucleic acid molecule selected from among SEQ ID NOs: 1-18 or 34-57.

In one embodiment, a double stranded nucleic acid is provided comprising two nucleic acid molecules selected from among SEQ ID NOs: 1-18 or 34-57. In one embodiment, the double stranded nucleic acid comprises a sense strand and an antisense strand.

In one embodiment, each strand of the double stranded nucleic acid has no more than 52 nucleotides.

In one embodiment, a double stranded nucleic acid is provided comprising a sense strand comprising a nucleic acid molecule selected from SEQ ID NOs: 1, 17, 34, 42, 44, 45, 46, 50, 54 and 56; and an antisense strand comprising a nucleic acid molecule selected from SEQ ID NOs: 2, 18, 35, 36, 37, 38, 39, 40, 41, 43, 47, 48, 49, 51, 52, 53, 55 and 57.

In one embodiment, a double stranded nucleic acid is provided comprising a sense strand comprising a nucleic acid molecule selected from SEQ ID NOs: 1, 17, 34, 42, 44, 45, 46, 50, 54 and 56; and an antisense strand comprising a nucleic acid molecule selected from SEQ ID NOs: 4, 6, 8, and 10.

In one embodiment, a double stranded nucleic acid is provided comprising a sense strand comprising a nucleic acid molecule selected from SEQ ID NOs: 1, 3, 5, 7 and 9; and an antisense strand comprising a nucleic acid molecule selected from SEQ ID NO: 18, 35, 36, 37, 38, 39, 40, 41, 43, 47, 48, 49, 51, 52, 53, 55 and 57.

In one embodiment, the double-stranded nucleic acid comprises nucleic acid molecules comprising SEQ ID NO:17 and SEQ ID NO:18; SEQ ID NO:34 and SEQ ID NO:35; SEQ ID NO:34 and SEQ ID NO:36; SEQ ID NO:34 and SEQ ID NO:37; SEQ ID NO:34 and SEQ ID NO:38; SEQ ID NO:34 and SEQ ID NO:39; SEQ ID NO:17 and SEQ ID NO:40; SEQ ID NO:34 and SEQ ID NO:41; SEQ ID NO:42 and SEQ ID NO:43; SEQ ID NO:44 and SEQ ID NO:43; SEQ ID NO:45 and SEQ ID NO:43; SEQ ID NO:46 and SEQ ID NO:47; SEQ ID NO:46 and SEQ ID NO:48; SEQ ID NO:46 and SEQ ID NO:49; SEQ ID NO:50 and SEQ ID NO:51; SEQ ID NO:46 and SEQ ID NO:53; SEQ ID NO:54 and SEQ ID NO:55; or SEQ ID NO:56 and SEQ ID NO:57.

In one embodiment, each strand of the double stranded nucleic acid has no more than 52 nucleotides.

In one embodiment, any one of the foregoing nucleic acids has at least one nucleotide is modified or further modified. In one embodiment, the modified nucleotide is selected from 2′-O-methyl-adenosine, 2′-O-methyl-uridine, 2′-O-methyl-cytosine, 2′-O-methyl-guanosine, 2′-O-methyl-thymidine, 2′-fluoro-adenosine, 2′-fluoro-cytidine, 2′-fluoro-guanosine, 2′-fluoro-uracil, 2′-fluoro-thymidine, deoxycytosine, deoxyguanosine, deoxyadenosine, deoxythymidine, deoxyuridine, a locked adenosine, a locked uridine, a locked guanosine, a locked cytidine, a phosphorothioate, and a phosphodiester cap. In one embodiment, at least one additional nucleotide or modified nucleotide is added to an end of the nucleic acid.

As noted above, locked nucleotides in one embodiment comprise a ribose with a 2′-O, 4′-C methylene bridge, for example, 2′-O, 4′-C methylene adenosine (1A); 2′-O, 4′-C methylene guanosine (1G); 2′-O, 4′-C methylene cytidine (1C); 2′-O, 4′-C methylene uridine (1U); and 2′-O, 4′-C methylene thymine (1T) ribonucleosides. In other embodiments, the locked nucleic acid comprises a methyl group attached to the methylene group. Other types of locked nucleic acids are embraced herein.

In other examples, a siRNA directed to FL2 may be selected from among:

SEQ ID NO: 58
5′ - fUfCGCUUUAAUACUGUGUAATT -3′ (antisense)
SEQ ID NO: 59
5′ -fU(s)fC(s)GCUUUAAUACUGUGUAATT-3′(antisense)
SEQ ID NO: 60
5′ - mU(s)mC(s)GCUUUAAUAmCfUmGfUmGfUmAmATT-3′
(antisense)
SEQ ID NO: 61
5′ - U(s)CGCUUUAAUACUGUGUAATT-3′ (antisense)
SEQ ID NO: 62
5′ - mUfCmGfCmUfUmUAAfUmAfCmUGmUmGfUmAmATT
(antisense)
SEQ ID NO: 63
5′-mUmCmGmCmUmUmUmAmAmUmAmCmUmGmUmGmUmAmAmUmU-3′
(antisense)
SEQ ID NO: 64
5′ - U(s)CGCUUUAAUACUGUGUAATT-3′ (antisense)
SEQ ID NO: 65
5′ - UCGCUUUAAUACUGUGUAATT-3′(antisense)
SEQ ID NO: 66
5′ - U(s)C(s)GCUUUAAUACUGUGUAATT-3′(antisense)
SEQ ID NO: 67
5′ - U(s)CGCUUUAAUACUGUGUmAmATT-3′(antisense)
SEQ ID NO: 68
5′ - UCGCUUUAAUACUGUGUAATT-3′ (antisense)
SEQ ID NO: 69
5′ - U(s)C(s)GCUUUAAUACUGUGUAA T(s)T-3′
(antisense)
SEQ ID NO: 70
5′ - UCGCUUUAAUACUG1U1G1U1A1A TT -3′ (antisense)
SEQ ID NO: 71
5′ - mU(s)mCmGCUUUAAUACUGUGUAATT -3′ (antisense)
SEQ ID NO: 72
5′ - U CGC UUU AAU ACU G UG UAA TT (antisense)

wherein the abbreviations are the same as described above.

In one embodiment, a double stranded nucleic acid is provided consisting of a sense strand selected from SEQ ID NOs: 1, 17, 34, 42, 44, 45, 46, 50 and 54; and an antisense strand selected from any one of SEQ ID NOs: 58-72.

In one embodiment, a double stranded nucleic acid is provided consisting of a sense strand selected from SEQ ID NOs: 1, 3, 5 and 7; and an antisense strand selected from any one of SEQ ID NOs: 58-72.

In one embodiment, a double stranded nucleic acid is provided consisting of a sense strand selected from SEQ ID NOs: 1, 3, 5, 7, 9, 11, 13, 15, 17, 34, 42, 44, 45, 46, 50 and 54; and an antisense strand selected from any one of SEQ ID NOs: 58-72.

In one embodiment, a double stranded nucleic acid is provided comprising a sense strand selected from SEQ ID NOs: 1, 3, 5, 7, 9, 11, 13, 15, 17, 34, 42, 44, 45, 46, 50 and 54; and an antisense strand selected from any one of SEQ ID NOs: 58-72.

In one embodiment, a double-stranded nucleic acid is provided consisting of SEQ ID NO:34 and SEQ ID NO:58; SEQ ID NO:34 and SEQ ID NO:59; SEQ ID NO:34 and SEQ ID NO:60; SEQ ID NO:17 and SEQ ID NO:61; SEQ ID NO:34 and SEQ ID NO:62; SEQ ID NO:42 and SEQ ID NO:63; SEQ ID NO:44 and SEQ ID NO:63; SEQ ID NO:45 and SEQ ID NO:63; SEQ ID NO:46 and SEQ ID NO:64; SEQ ID NO:46 and SEQ ID NO:65; SEQ ID NO:46 and SEQ ID NO:66; SEQ ID NO:50 and SEQ ID NO:67; SEQ ID NO:46 and SEQ ID NO:69; SEQ ID NO:54 and SEQ ID NO:70; SEQ ID NO:17 and SEQ ID NO:72, or SEQ ID NO:56 and SEQ ID NO:71.

In one embodiment, a double stranded nucleic acid is provided comprising at least one nucleic acid molecule selected from among SEQ ID NOs: 58-72.

In one embodiment, a double stranded nucleic acid is provided comprising two nucleic acid molecules selected from among SEQ ID NOs: 1-18 or 34-72. In one embodiment, the double stranded nucleic acid comprises a sense strand and an antisense strand.

In one embodiment, each strand of the double stranded nucleic acid has no more than 52 nucleotides.

In one embodiment, a double stranded nucleic acid is provided comprising a sense strand comprising a nucleic acid molecule selected from SEQ ID NOs: 1, 17, 34, 42, 44, 45, 46, 50, 54 and 56; and an antisense strand comprising a nucleic acid molecule selected from any one of SEQ ID NOs: 58-72.

In one embodiment, a double stranded nucleic acid is provided comprising a sense strand comprising a nucleic acid molecule selected from SEQ ID NOs: 1, 3, 5, 7 and 9; and an antisense strand comprising a nucleic acid molecule selected from any one of SEQ ID NOs:58-72.

In one embodiment, the double-stranded nucleic acid comprises nucleic acid molecules comprising SEQ ID NO:34 and SEQ ID NO:58; SEQ ID NO:34 and SEQ ID NO:59; SEQ ID NO:34 and SEQ ID NO:60; SEQ ID NO:17 and SEQ ID NO:61; SEQ ID NO:34 and SEQ ID NO:62; SEQ ID NO:42 and SEQ ID NO:63; SEQ ID NO:44 and SEQ ID NO:63; SEQ ID NO:45 and SEQ ID NO:63; SEQ ID NO:46 and SEQ ID NO:64; SEQ ID NO:46 and SEQ ID NO:65; SEQ ID NO:46 and SEQ ID NO:66; SEQ ID NO:50 and SEQ ID NO:67; SEQ ID NO:46 and SEQ ID NO:69; SEQ ID NO:54 and SEQ ID NO:70; SEQ ID NO:17 and SEQ ID NO:72, or SEQ ID NO:56 and SEQ ID NO:71.

Any of the compositions and uses of siRNA directed to FL2 as described elsewhere herein may utilize any of the foregoing single stranded nucleic acid sequences SEQ ID NOs:58-72, or a double stranded nucleic acids comprising or consisting of any of SEQ ID NOs:58-72.

Any of the nucleic acid sequences described herein may be prepared by any method known in the art, and purified by HPLC or any other method to provide inhibitors suitable for use for the in vitro, ex vivo or in vivo purposes described herein. In some embodiments, the purity of the inhibitor is equal to or greater than 85%. In some embodiment the purity is equal to or greater than 90%. In some embodiments the purity is equal to or greater than 95%. In some embodiment the purity is equal to or greater than 98%. In some embodiments the purity is equal to or greater than 99%. In some embodiments wherein the inhibitor is or comprises a duplex, the purity of the duplex is equal to or greater than 85%. In some embodiments wherein the inhibitor is or comprises a duplex, the purity of the duplex is equal to or greater than 90%. In some embodiments wherein the inhibitor is or comprises a duplex, the purity of the duplex is equal to or greater than 95%. In some embodiments wherein the inhibitor is or comprises a duplex, the purity of the duplex is equal to or greater than 98%. In some embodiments wherein the inhibitor is or comprises a duplex, the purity of the duplex is equal to or greater than 99%. In some embodiments the inhibitor is prepared under current Good Manufacturing Practices. In some embodiments the inhibitor is prepared for human use. In some embodiments the inhibitor is prepare for in vitro or ex vivo use for subsequent administration to humans. In some embodiments the inhibitor is prepared for human administration.

In one aspect, a composition is provided comprising any of the foregoing nucleic acid molecules or double-stranded nucleic acids, and a pharmaceutically acceptable carrier, vehicle, excipient or diluent.

In any of the embodiments described herein, an inhibitor of fidgetin or of fidgetin-like 1 (FL1) may be used to achieve any of the methods and results described herein for inhibitors of fidgetin-like 2 (FL2). Thus, increased homing to or penetration into tumors of T cells may be achieved by inhibiting fidgetin or fidgetin-like 1 expression or activity in the T cells, during in vitro or ex vivo preparation, or after infusion into the patient. Non-limiting examples of inhibitors of fidgetin or fidgetin-like 1 include aptamers, nucleic acids, oligonucleotides, and small molecules (of 2000 Daltons or less). In one embodiment, agents that inhibit fidgetin or fidgetin-like 1 expression or activity include nucleic acids such as but not limited to RNA interference agents. Non-limiting examples of RNA interference agents include shRNA and siRNA.

Thus, in an embodiment, the siRNA (small interfering RNA) as used in the methods or compositions described herein comprises a portion which is complementary to an mRNA sequence encoding a fidgetin protein. In an embodiment, the fidgetin protein is a human fidgetin protein. In an embodiment, the siRNA is effective to inhibit expression of fidgetin protein. In an embodiment, the fidgetin protein comprises consecutive amino acid residues having the sequence set forth in SEQ ID NO:22. In an embodiment, the siRNA is effective to inhibit expression of fidgetin protein.

In an embodiment, the siRNA that inhibits fidgetin comprises a double-stranded portion (duplex). In an embodiment, the siRNA is 20-25 nucleotides in length. In an embodiment the siRNA comprises a 19-21 core RNA duplex with a one or two nucleotide 3′ overhang on, independently, either one or both strands. The siRNA can be 5′ phosphorylated, or not, and may be modified with any of the known modifications in the art to improve efficacy and/or resistance to nuclease degradation. In an embodiment the siRNA can be administered such that it is transfected into one or more cells. In an embodiment, the siRNA is 5′ phosphorylated. Any of the modifications described herein regarding FL2 are further embodiments of the fidgetin inhibitor.

In an embodiment, the 5′ terminal residue of a strand of the siRNA is phosphorylated. In an embodiment the 5′ terminal residue of the antisense strand of the siRNA is phosphorylated. In one embodiment, a siRNA of the invention comprises a double-stranded RNA wherein one strand of the double-stranded RNA is 80, 85, 90, 95 or 100% complementary to a portion of an RNA transcript of a gene encoding fidgetin protein. In an embodiment, the RNA transcript of a gene encoding fidgetin protein is an mRNA. In an embodiment, the fidgetin protein is a human fidgetin protein. In an embodiment, a siRNA of the invention comprises a double-stranded RNA wherein one strand of the RNA comprises a portion having a sequence the same as a portion of 18-25 consecutive nucleotides of an RNA transcript of a gene encoding fidgetin protein. In an embodiment, the fidgetin protein is a human fidgetin protein. In yet another embodiment, a siRNA of the invention comprises a double-stranded RNA wherein both strands of RNA are connected by a non-nucleotide linker. Alternately, a siRNA of the invention comprises a double-stranded RNA wherein both strands of RNA are connected by a nucleotide linker, such as a loop or stem loop structure.

In one embodiment, a single strand component of a siRNA of the invention inhibiting fidgetin is from 14 to 50 nucleotides in length. In another embodiment, a single strand component of a siRNA of the invention is 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, or 28 nucleotides in length. In yet another embodiment, a single strand component of a siRNA of the invention is 21 nucleotides in length. In yet another embodiment, a single strand component of a siRNA of the invention is 22 nucleotides in length. In yet another embodiment, a single strand component of a siRNA of the invention is 23 nucleotides in length. In one embodiment, a siRNA of the invention is from 28 to 56 nucleotides in length. In another embodiment, a siRNA of the invention is 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 51, or 52 nucleotides in length.

In another embodiment, an siRNA of the invention inhibiting fidgetin comprises at least one 2′-sugar modification. In another embodiment, an siRNA of the invention comprises at least one nucleic acid base modification. In another embodiment, an siRNA of the invention comprises at least one phosphate backbone modification. As used herein, “at least one” means one or more.

In one embodiment, RNAi inhibition of fidgetin protein is effected by a short hairpin RNA (“shRNA”). The shRNA is introduced into the appropriate cell by transduction with a vector. In an embodiment, the vector is a lentiviral vector. In an embodiment, the vector comprises a promoter. In an embodiment, the promoter is a U6 or H1 promoter. In an embodiment the shRNA encoded by the vector is a first nucleotide sequence ranging from 19-29 nucleotides complementary to the target gene/mRNA, in the present case the mRNA encodes fidgetin protein. In an embodiment the fidgetin protein is a human fidgetin protein. In an embodiment the shRNA encoded by the vector also comprises a short spacer of 4-15 nucleotides (a loop, which does not hybridize) and a 19-29 nucleotide sequence that is a reverse complement of the first nucleotide sequence. In an embodiment the siRNA resulting from intracellular processing of the shRNA has overhangs of 1 or 2 nucleotides. In an embodiment the siRNA resulting from intracellular processing of the shRNA overhangs has two 3′ overhangs. In an embodiment the overhangs are UU.

In an embodiment, the fidgetin is encoded by a nucleic acid sequence comprising the following:

(SEQ ID NO: 21)
1 gggtttgaaa ttccaacatg gcagaggctg cagtccgtct tcccttcaaa aacttggaat
61 gatttcaaat cataggcacc ttcacttaac cctagcttcc attcatcagc aaacacatcg
121 gatcgatgct acgctaacct atcgggttct ctctccgcgc gttcaggtta aatgaatacc
181 tgacgaaagg gcccacgttt caaggcagtg acatttgata gctgagagga aaagtggctt
241 taatgaaaag caacctttgg aattcctgct tgtgagaaat ccaattcagc tttttgtgct
301 gccagcaaga aatgatcagt agcaccagtg tttatggctt gaagatgcag tggacgccag
361 agcatgccca gtggccagaa cagcactttg acatcacctc aaccactcgg tctcctgccc
421 acaaagttga agcctacaga ggtcatctgc agcgcaccta tcagtacgcc tgggcgaatg
481 atgacatatc tgctctgact gcatccaacc tactaaaaaa atatgcagag aagtattccg
541 gcattttgga aggtcctgtg gaccgacccg tactcagcaa ctattcggac acaccatcag
601 gactagtgaa cggtcggaaa aatgaaagtg aaccctggca gccttccttg aattcagaag
661 ctgtttatcc catgaactgt gttccggatg ttatcactgc cagcaaagct ggagtcagtt
721 cagccctccc tccagcagat gtctctgcga gtataggaag ctctcctggg gtagccagca
781 acctgacaga acctagttat tcaagtagta cctgtggaag ccacactgta cccagtcttc
841 atgcagggct cccatctcag gaatatgccc caggatacaa cggatcatat ttgcattcta
901 cttatagtag ccagccagca cctgcacttc cttcacctca tccgtctcct ttgcatagct
961 ctgggctact acagccccca ccaccacctc ctccgccacc agccttggtc ccaggctaca
1021 atgggacttc taacctctcc agttacagct atccgtctgc tagctatcct cctcagactg
1081 ctgtggggtc tgggtacagc cctggggggg caccgcctcc gccttcagcg tacctgcctt
1141 caggaattcc tgctcccacc cccctacccc ccaccactgt tcctggctac acctaccagg
1201 gccatggttt gacacctatt gcaccgtcgg ctctgacaaa cagttcagca agttctctca
1261 aaaggaaagc tttctacatg gcagggcaag gagatatgga ctccagttat ggaaattaca
1321 gctatggcca acagagatct acacagagtc ctatgtacag aatgcccgac aacagcattt
1381 caaacacaaa tcgggggaat ggctttgaca gaagtgctga aacatcatcc ttagcattta
1441 agccaacgaa gcagctaatg tcctctgaac agcaaaggaa attcagcagc cagtccagta
1501 gggctctgac ccctccttcc tacagtactg ctaaaaattc attgggatca agatccagtg
1561 aatcctttgg gaagtacaca tcgccagtaa tgagtgagca tggggacgag cacaggcagc
1621 tcctctctca cccaatgcaa ggccctggac tccgtgcagc tacctcatcc aaccactctg
1681 tggacgagca actgaagaat actgacacgc acctcatcga cctggtaacc aatgagatta
1741 tcacccaagg acctccagtg gactggaatg acattgctgg tctcgacctg gtgaaggctg
1801 tcattaaaga ggaggtttta tggccagtgt tgaggtcaga cgcgttcagt ggactgacgg
1861 ccttacctcg gagcatcctt ttatttggac ctcgggggac aggcaaaaca ttattgggca
1921 gatgcatcgc tagtcagctg ggggccacat ttttcaaaat tgccggttct ggactagtcg
1981 ccaagtggtt aggagaagca gagaaaatta tccatgcctc ttttcttgtg gccaggtgtc
2041 gccagccctc ggtgattttt gttagtgaca ttgacatgct tctctcctct caagtgaatg
2101 aggaacatag tccagtcagt cggatgagaa ccgaatttct gatgcaactg gacactgtac
2161 taacttcggc tgaggaccaa atcgtagtaa tttgtgccac cagtaaacca gaagaaatag
2221 atgaatccct tcggaggtac ttcatgaaac gacttttaat cccacttcct gacagcacag
2281 cgaggcacca gataatagta caactgctct cacagcacaa ttactgtctc aatgacaagg
2341 agtttgcact gctcgtccag cgcacagaag gcttttctgg actagatgtg gctcatttgt
2401 gtcaggaagc agtggtgggc cccctccatg ccatgccagc cacagacctt tcagccatta
2461 tgcccagcca gttgaggccc gttacatatc aagactttga aaatgctttc tgcaagattc
2521 agcctagcat atctcaaaag gagcttgata tgtatgttga atggaacaaa atgtttggtt
2581 gcagtcagtg ataacttctt tagaaaaaaa aaatgtaatg aatgttggca cacacacata
2641 aaacctgcta catagggaat agagcccctt tecagtagag tttaaattgc aaagggtact
2701 ggggaagatg acgattaagt tgcatcttta gagtcagggt agatttggag gaaaagtgca
2761 tcaaatgaga gcttctgatt tgaaagcccc agatgacaga aagcatatgt ggatgctcag
2821 ttctgttcaa gctagacaac actcaccaag gagcaaggtg caagtgtgtt gatttcagaa
2881 ggacatgaac ctcgtgtgtt gattccattc tgctgttctc gagatttagt tgctgtcaag
2941 tgcctggagt ggtgctttat tttttgtttg cctcacaatt acattggtgg catgtgctaa
3001 tataaagagc tttaacttca aacattattg gactaaagag atgaacagtt gtgttatgac
3061 agaaaaccag atttttgcca ttttaagagc aacagtattc ctcaatcctg tctgttctgc
3121 agtattaagc taagaacagg taaaacaggg taacggtaat ctggacctta atttctgcag
3181 ttcatttctt ttaatgttct tgtctgcaaa aactcaggaa agtgattgtg atttgtacag
3241 tacctcaaag gaatgtgttg aaagcactat gtactgctga gagtaatagg ataggcttca
3301 atgttacttt atattaaaat gtatgtttac ctcaacaatt ggaaaatagc aaggaaaatt
3361 actttgaatg tatccagaaa aatactgaag tgtgatacaa ctgaatattt acagtttaaa
3421 gtagaaatgg aaggattttt ttaagttctt ttactaatta tggggaatta accagagcag
3481 aataattctt tatgtcaata actgcaagag ttcttagtac attgctcctt gataattaag
3541 tgaaaatgtt cttaaaaggt acactggtta attgaaagct acttattcag tttgtgttag
3601 tgtctagacc tgtcagccac aagacctgtt taggaccctg aaagtcacag tacctaaaaa
3661 ctatgactgc ctttttattg cataggtggt agtggtggtg atggtggtgg tagtttgcaa
3721 gttatctctt aaaactgctg ggaatggtgt cattctattc actaatctag cttatagact
3781 tgccgtgctg tttgatagaa tgcagaggat agcaaccaaa acaaatacac aaataaataa
3841 aaacaaaaac caaccaacaa accaacttac atacacatat atatatccac aaagaacctc
3901 tccatctcct ccccttcttt ttgactccac tcttgtcagt gcaattttgc ttctcatttt
3961 gaaatctggg ctgtagtgct cctgctttat ttctacctca gttttgttac atttctcttg
4021 gaaagtaaag tagaaaattg gaagtggaca cacacactgc aatgtagctt gccaaacatg
4081 ttactttgtt ttcttccatc tttcaccgta aatctagttt ccaaagacat cagcatttgt
4141 gcttacttcc acctcagtct accagcccca cccctaccca tggcataagt ggcatttttc
4201 ttaatttcct atttttctcc tgctctctgt caagttgttc tttgtatcct ttaatgcttt
4261 atgtgcaacc tttcattgat agtgggctga tgtttggcaa tgcttctgaa ctgtcacaga
4321 gcaggctgta gctttccaca gccactgccc atgcataagc agaacagcct ggccttttga
4381 atgtattttc ctgggttttt tccccttttc tttttttagt ttagagatgc agtaacaaaa
4441 ctgttgcaaa gcactggcat tttatgtatt caataaataa gtgatgtaca tttttaaaaa
4501 aatttaaata aatgcaatga gaagccccaa gaaag.

The sequence of human fidgetin protein is:

(SEQ ID NO: 22)
1 MISSTSVYGL KMQWTPEHAQ WPEQHFDITS TTRSPAHKVE
AYRGHLQRTY QYAWANDDIS
61 ALTASNLLKK YAEKYSGILE GPVDRPVLSN YSDTPSGLVN
GRKNESEPWQ PSLNSEAVYP
121 MNCVPDVITA SKAGVSSALP PADVSASIGS SPGVASNLTE
PSYSSSTCGS HTVPSLHAGL
181 PSQEYAPGYN GSYLHSTYSS QPAPALPSPH PSPLHSSGLL
QPPPPPPPPP ALVPGYNGTS
241 NLSSYSYPSA SYPPQTAVGS GYSPGGAPPP PSAYLPSGIP
APTPLPPTTV PGYTYQGHGL
301 TPIAPSALTN SSASSLKRKA FYMAGQGDMD SSYGNYSYGQ
QRSTQSPMYR MPDNSISNTN
361 RGNGFDRSAE TSSLAFKPTK QLMSSEQQRK FSSQSSRALT
PPSYSTAKNS LGSRSSESFG
421 KYTSPVMSEH GDEHRQLLSH PMQGPGLRAA TSSNHSVDEQ
LKNTDTHLID LVTNEIITQG
481 PPVDWNDIAG LDLVKAVIKE EVLWPVLRSD AFSGLTALPR
SILLFGPRGT GKTLLGRCIA
541 SQLGATFFKI AGSGLVAKWL GEAEKIIHAS FLVARCRQPS
VIFVSDIDML LSSQVNEEHS
601 PVSRMRTEFL MQLDTVLTSA EDQIVVICAT SKPEEIDESL
RRYFMKRLLI PLPDSTARHQ
661 IIVQLLSQHN YCLNDKEFAL LVQRTEGFSG LDVAHLCQEA
VVGPLHAMPA TDLSAIMPSQ
721 LRPVTYQDFE NAFCKIQPSI SQKELDMYVE WNKMFGCSQ.

Non-limiting examples of siRNA sequences that inhibit fidgetin include:

(SEQ ID NO: 24)
ACUAGUGAACGGUCGGAAA,
(SEQ ID NO: 25)
GCAGAGAAGUAUUCCGGCA,
(SEQ ID NO: 26)
GGCCAUGGUUUGACACCUA
and
(SEQ ID NO: 27)
AGUUGAGGCCCGUUACAUA.

Any of the foregoing sequence may be provided as a double stranded nucleic acid with a complementary sequence. Such siRNA molecules may be provided in any of the compositions described herein and used for any of the purposes described herein for FL2.

The nucleic acid sequences described herein may be prepared by any method known in the art, and purified by HPLC or any other method to provide inhibitors suitable for use for the in vitro, ex vivo or in vivo purposes described herein. In some embodiments, the purity of the inhibitor is equal to or greater than 85%. In some embodiment the purity is equal to or greater than 90%. In some embodiments the purity is equal to or greater than 95%. In some embodiment the purity is equal to or greater than 98%. In some embodiments the purity is equal to or greater than 99%. In some embodiments wherein the inhibitor is or comprises a duplex, the purity of the duplex is equal to or greater than 85%. In some embodiments wherein the inhibitor is or comprises a duplex, the purity of the duplex is equal to or greater than 90%. In some embodiments wherein the inhibitor is or comprises a duplex, the purity of the duplex is equal to or greater than 95%. In some embodiments wherein the inhibitor is or comprises a duplex, the purity of the duplex is equal to or greater than 98%. In some embodiments wherein the inhibitor is or comprises a duplex, the purity of the duplex is equal to or greater than 99%. In some embodiments the inhibitor is prepared under current Good Manufacturing Practices. In some embodiments the inhibitor is prepared for human use. In some embodiments the inhibitor is prepare for in vitro or ex vivo use for subsequent administration to humans. In some embodiments the inhibitor is prepared for human administration.

In any of the embodiments described herein, an inhibitor of fidgetin-like 1 (FL1) may be used to carry out any of the methods and achieve the results described herein for fidgetin-like 2 (FL2). Thus, increased homing to or penetration into tumors of T cells may be achieved by inhibiting fidgetin-like 1 expression or activity in the T cells, during in vitro or ex vivo preparation, or after infusion into the patient. Non-limiting examples of inhibitors of fidgetin-like 1 include aptamers, nucleic acids, oligonucleotides, and small molecules (of 2000 Daltons or less). In one embodiment, agents that inhibit fidgetin-like 1 expression or activity include nucleic acids such as but not limited to RNA interference agents. Non-limiting examples of RNA interference agents include shRNA and siRNA.

Thus, in an embodiment, the siRNA (small interfering RNA) as used in the methods or compositions described herein comprises a portion which is complementary to an mRNA sequence encoding a fidgetin-like 1 protein. In an embodiment, the fidgetin-like 1 protein is a human fidgetin-like 1 protein. In an embodiment, the siRNA is effective to inhibit expression of fidgetin-like 1 protein. In an embodiment, the fidgetin-like 1 protein comprises consecutive amino acid residues having the sequence set forth in SEQ ID NO:29. In an embodiment, the siRNA is effective to inhibit expression of fidgetin protein. In an embodiment, the fidgetin-like 1 protein comprises consecutive amino acid residues having the sequence set forth in SEQ ID NO:28.

In an embodiment, the siRNA that inhibits fidgetin-like 1 comprises a double-stranded portion (duplex). In an embodiment, the siRNA is 20-25 nucleotides in length. In an embodiment the siRNA comprises a 19-21 core RNA duplex with a one or two nucleotide 3′ overhang on, independently, either one or both strands. The siRNA can be 5′ phosphorylated, or not, and may be modified with any of the known modifications in the art to improve efficacy and/or resistance to nuclease degradation. In an embodiment the siRNA can be administered such that it is transfected into one or more cells. In an embodiment, the siRNA is 5′ phosphorylated. Any of the modifications described herein regarding FL2 are further embodiments of the fidgetin-like 1 inhibitor.

In an embodiment, the 5′ terminal residue of a strand of the siRNA is phosphorylated. In an embodiment the 5′ terminal residue of the antisense strand of the siRNA is phosphorylated. In one embodiment, a siRNA of the invention comprises a double-stranded RNA wherein one strand of the double-stranded RNA is 80, 85, 90, 95 or 100% complementary to a portion of an RNA transcript of a gene encoding fidgetin-like 1 protein. In an embodiment, the RNA transcript of a gene encoding fidgetin-like 1 protein is an mRNA. In an embodiment, the fidgetin-like 1 protein is a human fidgetin-like 1 protein. In an embodiment, a siRNA of the invention comprises a double-stranded RNA wherein one strand of the RNA comprises a portion having a sequence the same as a portion of 18-25 consecutive nucleotides of an RNA transcript of a gene encoding fidgetin-like 1 protein. In an embodiment, the fidgetin-like 1 protein is a human fidgetin-like 1 protein. In yet another embodiment, a siRNA of the invention comprises a double-stranded RNA wherein both strands of RNA are connected by a non-nucleotide linker. Alternately, a siRNA of the invention comprises a double-stranded RNA wherein both strands of RNA are connected by a nucleotide linker, such as a loop or stem loop structure.

In one embodiment, a single strand component of a siRNA of the invention inhibiting fidgetin-like 1 is from 14 to 50 nucleotides in length. In another embodiment, a single strand component of a siRNA of the invention is 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, or 28 nucleotides in length. In yet another embodiment, a single strand component of a siRNA of the invention is 21 nucleotides in length. In yet another embodiment, a single strand component of a siRNA of the invention is 22 nucleotides in length. In yet another embodiment, a single strand component of a siRNA of the invention is 23 nucleotides in length. In one embodiment, a siRNA of the invention is from 28 to 56 nucleotides in length. In another embodiment, a siRNA of the invention is 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 51, or 52 nucleotides in length.

In another embodiment, an siRNA of the invention inhibiting fidgetin-like 1 comprises at least one 2′-sugar modification. In another embodiment, an siRNA of the invention comprises at least one nucleic acid base modification. In another embodiment, an siRNA of the invention comprises at least one phosphate backbone modification. As used herein, “at least one” means one or more.

In one embodiment, RNAi inhibition of fidgetin-like 1 protein is effected by a short hairpin RNA (“shRNA”). The shRNA is introduced into the appropriate cell by transduction with a vector. In an embodiment, the vector is a lentiviral vector. In an embodiment, the vector comprises a promoter. In an embodiment, the promoter is a U6 or H1 promoter. In an embodiment the shRNA encoded by the vector is a first nucleotide sequence ranging from 19-29 nucleotides complementary to the target gene/mRNA, in the present case the mRNA encodes fidgetin-like 1 protein. In an embodiment the fidgetin-like 1 protein is a human fidgetin-like 1 protein. In an embodiment the shRNA encoded by the vector also comprises a short spacer of 4-15 nucleotides (a loop, which does not hybridize) and a 19-29 nucleotide sequence that is a reverse complement of the first nucleotide sequence. In an embodiment the siRNA resulting from intracellular processing of the shRNA has overhangs of 1 or 2 nucleotides. In an embodiment the siRNA resulting from intracellular processing of the shRNA overhangs has two 3′ overhangs. In an embodiment the overhangs are UU.

In an embodiment, the fidgetin-like 1 is encoded by a nucleic acid sequence comprising the following:

(SEQ ID NO: 28)
1 gtcagtcccc gcgcttttcg gaggctgcca gcgtcccaca ccagccgcag gtaggatgcg
61 gtgacgggag gcggggcagg ggcgctgctg acccctgtgg agcatcaggg ttggggcgta
121 ggggagaggc gggcgtgtgc ctctggaatg ctgggggtcg cggggcggtg acttcgcggg
181 aggccgtggg aggcgggagc caggcagtgg ctgtgccctt ttgcttctgt cttagcggga
241 gggtggctga cccgctagcc cagaaccaga ctcatccagg attaggaagc tggggcccgg
301 cgtggacggc aggctcgggg ccaggtctgc gggcggcttc ctttggcaga gcctgtccgg
361 gggcggggcc gcttaccgca ggcatttact gggcccagcg gggctctggg cgcccacagc
421 gggggtcagt cagttcccct gtgacccagg caagctctta atctctgtga tgagaaagaa
481 gggctcatac ctttcagggg tcatcgtgag gaatcagaag aagcagtatt ttatagagta
541 ttttctaagt gctgagtcct ctgtctagtg ctttgcagaa ttaaaatacc ttgtcagctc
601 agtgatgttg ctgcgcttct tttataggtg aaaaccggca gaaagacatt aagagatttt
661 cctgcagtca ctgctggcag atgatagagc caggatttga aagcaggcag cctggctcca
721 gaccctgtgc tcttaactcc cgttttgcat caagaacaga atcctatgaa aggcttgcac
781 agtgcttggt actgagtagg cactccgtca gtattttagt agctattatt ccaaaggaca
841 ctgtattcta ggtactaaga caatgtgaat ggaatggaaa acaattcctc cctgcagaag
901 ccaactgtct aggaagacag ataatgacat tattaaaata atcagaacat tggcaaaata
961 aagaagattg aaatgcagtt catatgacag tgctaattaa tcatactttt tagatctagg
1021 aaaggccata aaggttaaat tgacttggaa atggtaaaca agacaatggt tgtgtcactg
1081 atcggtgatg gccagttttt ggttatcctt atttgccatt taaatgattg aattgaaagg
1141 aagaagtaag acttggaaga tgaatattga aggaaaggtg aagatggaaa agagaagggg
1201 gtttattctg agaacagtga ctagaactct gaggtatggt agaaatttca ggataacaga
1261 tgataaaggg gaatgaagcc atggagagga agagaatgat aatattaatt gtgaaagttt
1321 gtgtcaagtg ttttctgagt cacctttctt tcagtttctc atttctagta ttgtataaat
1381 gagtttaaca tcaaaatggt atagtgaaaa aaaggatgaa ctgcttgaca gaagaggtca
1441 gatctagttt tgactctagc ttatttagct ttacagcttt aaataaatta cagtgtcttt
1501 aaagctctgg atcttaagtt ttctaattgt tttttaaaca aagatttgtg aacacctact
1561 tacaatgtga caaatgtctt tgtaaggcat tatgggagat aaaagctgca ttaaacctgg
1621 ctgttgtact tacaagtaat ttggaaggca aaatttcaaa tacttgaacc taaagtaggg
1681 tttcttggtt ttcatttaat tgaaatactg ttaggaaaca aaaatttttc ataaattttt
1741 cttgtggata tgtaagtaaa ttctatatat ctagcaatat gatacatcta tagttctgtt
1801 taaaggtaac aatgtgagga agcttatgcg aataacttga cagaagaaat ctaaagtaaa
1861 agcattttcc tagtaggcta gcttgttctc ttatttcatt tattgtaaca gtttcacttt
1921 ttaataatta tgtgaaatta ggaaacagat attctagggc attctgttta gggtgatgaa
1981 cttattcatg aatgttatta aaaccattta aatatgccat agtttaaatt tgtgatccat
2041 gctgttcaat ctgtgaccta ggatagcagc atcaaggagc attgtgtaca tgcagaagtg
2101 cacagtacct ggagtgaaac tgcttgtgtt cgatttctga taccattcat aactggctgt
2161 gtgatctcaa gtaagttctt taagtctctc agcctcggtt tgtacatttg tgtgataagg
2221 ataatgatag ttttcagatt attttcatag tcattgcttg atttgattct tccaatggtt
2281 cctctcactt tgcagataag aaaactgaag aaccagctgg gcgcggtagc tcacgcctgt
2341 aatcccagca ctttgggagg ctgaggcggg tggattacct gaggtcagga gttcaagacc
2401 agcctgacta acatggcgaa accccatctc tactaaaaat ataaaaatta tccaggggtg
2461 gtggcaggtg cctgtaatcc cagctacttg ggaagctggg gcaggagaag cacttgaacc
2521 cgcgaggtgg aggttgcagt gagctgagag cgccactgcc ctccagcagc ctgggtgaca
2581 gagcgagaca ctgtctcaaa aaaaaataat aataaaataa aaataaacca tcagtgatag
2641 taaaaagctc acttaagctc attcacctag ttttatagat cagacttaaa cctcttgttt
2701 attttgtttt gctttatgta tctatagttc cattgttttt aaaatttaaa attaatttta
2761 aaccttatga atgctttccc tacagataaa attatgtaac tagaacaatt taactcatat
2821 aaattattat ttaatcaagt ccttaatttt gaagacttca tattgatatg tcttgaatac
2881 ttgaaatcta tagttaacta gatatttctc ttataacctg tccttataaa tctacattat
2941 aaataaaaag tccagtgtcc cttccttcag attagcagaa gtttcaaaat tacatttaaa
3001 gtattttctt tgttttcctt catactgatt ttcattttta ttgtttgtta tagaacctct
3061 aaaatgcaga cctccagctc tagatctgtg cacctgagtg aatggcagaa gaattacttc
3121 gcaattacat ctggcatatg taccggaccg aaggcagatg cataccgtgc acagatatta
3181 cgcattcagt atgcatgggc aaactctgag atttcccagg tctgtgctac caaactgttc
3241 aaaaaatatg cagagaaata ttctgcaatt attgattctg acaatgttga atctgggttg
3301 aataattatg cagaaaacat tttaactttg gcaggatctc aacaaacaga tagtgacaag
3361 tggcagtctg gattgtcaat aaataatgtt ttcaaaatga gtagtgtaca gaagatgatg
3421 caagctggca aaaaattcaa agactctctg ttggaacctg ctcttgcatc agtggtaatc
3481 cataaggagg ccactgtctt tgatcttcct aaatttagtg tttgtggtag ttctcaagag
3541 agtgactcat tacctaactc agctcatgat cgagaccgga cccaagactt cccggagagc
3601 aatcgtttga aactccttca gaatgcccag ccacctatgg tgactaacac tgctaggact
3661 tgtcctacat tctcagcacc tgtaggtgag tcagctactg caaaattcca tgtcacacca
3721 ttgtttggaa atgtcaaaaa ggaaaatcac agctctgcaa aagaaaacat aggacttaat
3781 gtgttcttat ctaaccagtc ttgttttcct gctgcctgtg aaaatccaca gaggaagtct
3841 ttttatggtt ctggcaccat tgatgcactt tccaatccaa tactgaataa ggcttgtagt
3901 aaaacagaag ataatggccc aaaggaggat agcagcctgc ctacatttaa aactgcaaaa
3961 gaacaattat gggtagatca gcaaaaaaag taccaccaac ctcagcgtgc atcagggtct
4021 tcatatggtg gtgtaaaaaa gtctctagga gctagtagat cccgagggat acttggaaag
4081 tttgttcctc ctatacccaa gcaagatggg ggagagcaga atggaggaat gcaatgtaag
4141 ccttatgggg caggacctac agaaccagca catccagttg atgagcgtct gaagaacttg
4201 gagccaaaga tgattgaact tattatgaat gagattatgg atcatggacc tccagtaaat
4261 tgggaagata ttgcaggagt agaatttgct aaagccacca taaaggaaat agttgtgtgg
4321 cccatgttga ggccagacat ctttactggt ttaaggggac cccctaaagg aattttgctc
4381 tttggtcctc ctgggactgg taaaactcta attggcaagt gcattgctag tcagtctggg
4441 gcaacattct ttagcatctc tgcttcatcc ttaacttcta aatgggtagg tgagggggag
4501 aaaatggtcc gtgcattgtt tgctgttgca aggtgtcagc aaccagctgt gatatttatt
4561 gacgaaattg attccttgtt atctcaacgg ggagatggtg agcatgaatc ttctagaagg
4621 ataaaaacag aatttttagt tcaattagat ggagcaacaa catcttctga agatcgtatc
4681 ctagtggtgg gagcaacaaa tcggccacaa gaaattgatg aggctgcccg gagaagattg
4741 gtgaaaaggc tttatattcc cctcccagaa gcttcagcca ggaaacagat agtaattaat
4801 ctaatgtcca aagagcagtg ttgcctcagt gaagaagaaa ttgaacagat tgtacagcag
4921 attcgcagtt tacaaactgc tgacattgct accataacac cggatcaagt tcgacccata
4981 gcttacattg attttgaaaa tgcttttaga actgtgcgac ctagtgtttc tccaaaagat
5041 ttagagcttt atgaaaactg gaacaaaact tttggttgtg gaaagtaagt gggatacttg
5101 gaatcaaggc atctctgtag tacagtcttc tttatttttt agcatagaaa gttggggatg
5161 tgttaattgt atttttaaga atatattcta agttctgtac ttcaaataat agcacagatt
5221 ttacatctga ttgacatagt gtatgttaat gtaagttttg ctttccagtg attacctgat
5281 acgtaagcct atttgaacaa agtgagaatg aacttttgtt tctaagaagt ctttatcttg
5341 aagctatata acatgaaaag tgagctcaaa ttttttttag ttgaagatta catataaagt
5401 tgtgtctgat taatattcat cttttattga agaaagtgcc ttctgatggc cacataattc
5461 ttaatgtcag ctagtataat ggtttacatt tggacaaagt attgcttagt gttatttaag
5521 tagatttaag atctcaaagc taaagtgcca atttttactt tcttcagcca atttgttacc
5581 tcttttatgg tttttaattt ttatcaggac taacattttc agaaatagca aggtgtgatc
5641 tagtattaga ttcacagaac tgaaaggtta attaagaatg ttggttattt tcacgggagc
5701 gtgtgatatt taacattaat attttatttg acactacagc ctgtaatact gctctctttc
5761 aaaaacaagt tttcagattt ttataacaga cccattttgt tttatgaaac atgttcatta
5821 cagaaacatg agaaaataga gataagtaaa aagaataaaa gtcactatta tcctaccact
5881 ttgcgggaca cactattaat atttaagcat agattcttcc agatgttttg ttttatacag
5941 cagtaggatt gtgtaatgta ttctctcttg tagcctattc ttcaaagcgt atcttcactt
6001 tccatgttaa cataaatgtc cttttatgat tgtctaggat tccatggatg gatggaatat
6061 aattgagtca tctggtagag cgcatatagg acaggacgct aggttgttta tcttttgttt
6121 attgtaaagg aactatgtgg gatgcatttg gtgatctttt taaaaaatgt ataaatttct
6181 tgagtaattc ctggattaaa gaatatgcac tttttaaagc ttttggcttg cattctaaat
6241 tgtcctcttg aaaaagtagt tcctgtgtaa aactccatct gcactgaatc agagctatgg
6301 cagcattggg cagtaggcag ttttggtatt tgttggcatt ctttttgcat ttattcaaaa
6361 aactgaaggt agtgaacgta gagcaatgaa caacacaaat atccttggtc tcgtggaggt
6421 tatatttaag ttctaatgtt ttctcttgtg aacagtgcaa tttgaaatga caaattgaaa
6481 cacttttagt tgttgaattt agacagtttg tgtatatagt ttaaattttt attcttggtt
6541 tgccttctgt ttttatgtta aaagattgtt gcaattttta gtttttccct ttgtaatatg
6601 tgattgtctt tcattagaat tcattttttg ttttgttttg gttattttga aacagtctcg
6661 ctgtgttgcc taggctggag tgcagtggtg tgatctcagc tcactgcaac ctctgcctcc
6721 tgggttccag tgattcttgt gcctcagtct cccttgtagc tgagaccaca ggtttgcacc
6781 accacaccca gctaattttt gtatttttaa tcgagatggg gtttcaccat gttgcccagg
6841 ctgctctcga actcctggcc tcaaacgatc cacccacctc agcctcctga agtgttggga
6901 ttacaggcat gagccaccac gcctggcctt ttttattaga atttggacgt taaacttctt
6961 gtcttcagtt cttagttata tcttttaaca tcctaaaaca ttccacaata ttcattactg
7021 tctttatccc tttctatttc tatataaaca gcactataaa cttggtttct ttggtattga
7081 tgtcaaggaa ttctctagtt tttctttctt ggtgtttaat tgcagatcac tcccaccttc
7141 ttgggtctag ctatttagat ttatcagcat ttgccctcta gctgttaatg ttttatttag
7201 ctctgaaatt tggtcttaat atttattatc agtttttttc agttacagct tctgccagcc
7261 ctgactttaa gctcccttga tcaccagcca cagggccact tctttctatg gagtttagaa
7321 attgtgacaa ggagagaaag tctagttggt ttagctcatc ttggattaag cagagcccat
7381 gtctctcttg ttagctcaag aaatggtctt tcctgaatta aggtctactc tgttaaataa
7441 gaatctaaac ctgaaaggaa tagtcaggat attttaaagc tggaaagaaa atttgagctg
7501 gggagtcaac tgttgtttct acgttatacc acagagaagc tttctttgtc tcaacacttt
7561 gtgattttga gtgtttctga agcagttgga taggaagctt actgaaactt taagattgct
7621 tactctcgcc acatgcgatt gtcttcatcg aatataataa tcttggatta aattatctca
7681 agtgtggcac tgccctgtct ttagctattg tttcagaaac atgaatgcta gcctgatatt
7741 taatgtcttc aaaaattaca ttcccttagt agaaatacac attttactaa acatgtcact
7801 tggttatggt attaatgctt aacaattttg atatgaatat ggtaattcta atttatgatt
7861 tcaggccttc ttaaatcttt attatacatc taataataat atatgatcct tttgatatgt
7921 attcattctg tggtaaattt ctaattttct gaaattttaa ctcattttct caattctaaa
7981 atatctctca ggtgtgcctt tcatattgac aagctggtct taatggaatc atagtctaaa
8041 gatcatgggc tgtggagcca aatagacctg ttgaattctg gctctgtcat ttactggtga
8101 ctgttggtta cttaattatt caatctcaat tctaaagtga gaatagttta tacctgtctt
8161 gttggagagt gaggattaaa tagtaaaata cagatttaaa aggcctggtt catgttttat
8221 gattgtgcct cttctttgaa tctgccttga ttttgctctt gttgctgtga aggatctttt
8281 cagctatttt gtgtggttgt cctagctcat tctgcttagt gtttgtggta tttgcatcat
8341 attattagag atcatatgcc atctatcttt agttttgtgg aaaaattcta attccaaaga
8401 aatatctctt agttatgttt ctccttttct acactttaga acttttttaa aggtctgtcc
8461 cagattatta tttttctcta ctcatgctta tatgttattt attggtctcc atttttactc
8521 tcccagtgtt tttttaaggg acactttaca gcccaccttt agggatctga ttaaaagaaa
8581 ggattctatc aaggtccatg gcaaaaggac aggttggata aagataacat ctttttactt
8641 ccttcttata ttcctagttc ttgaccttag ttggggagct ggtggtgagg gagcacattt
8701 taaacagttt aagcaggtga ggccatcttg aaggtttgcc ccagcagcct gggtgaatgg
8761 agggagtctt gggagaatag ataagatgca gtcaccactt ttaactcttg cccttaaaaa
8821 atacttttac aacacggctt ataatggaaa gagcattaaa atggacatta gaaaactgcc
8881 agtgattcta accttagaga gtttgtacag actccgtaag atttgttttt ttagtgataa
8941 agggaaattg tactggtcat tccttaataa cacatccaga tttctgttat cacttaccaa
9001 aaatttatga atttgagaat tgcttacaca gtatcaggtg ctgggtactg ggaggtacaa
9061 aacaaagtat agtcaggtaa gggctaactt tattactaat ttggctcatt ataaaaacaa
9121 cgggaaaaca tgaagagagg gctttattaa ggagttaagt cagcataatg gaccacttaa
9181 tatataataa ccacttaaga gaaaaagaaa aattaggaag tccacataag gtggcgtttt
9241 ataaaggcaa catgctgttg ttaagggcac ttgggccatt ggtgttttgt gacagctggg
9301 ctcaggcatc tcaacaagca gcggtgtgcc tgctgaccaa cagggcctgc cacggccagt
9361 gaaacacagc tattagagct ctctcaatcc atttctgctc agaaatgtag agatggcagg
9421 ggaaacgtag ctaagtccca ggttcctcgg atatggcgag ggcaagcact cccatattat
9481 aacaacctgt gcagtcagtg agtccagagc agaggccttg tctcctcctt tgctcacctt
9541 cactcactgc cctggactgt caggccccag ttctcatccc catgtgtgat gaagccatgc
9601 agtcccagag agggagccat cagcgcttgg tagtctcatg ctttagtgtc agagttgcac
9661 cttacctttg tatccaagaa atgcatgcag ctcaactttc ccttaaaagg cttctaggaa
9721 aaaactaccc cagcattttt tttcccccag aagaatatat tagcttaata ataaaaggta
9781 tagtaacaaa ctttccattt aaaatagtgg cctaagccac aaatttacct ttcctgcccg
9841 tatgtgcaaa attttcattg aaatgaaaaa atacacacta agaatcaatc cagtgtgatg
9901 ttggaaaaga gagaaggtta ccattttcaa atatgacagg tgtttctgga ggtcacaagg
9961 caaatggtac tgggttgttg gaatccctga gctaaataat ggctgtgaaa atgccagatg
10021 agattggtta tctcagcagt gcctgggctg tacccctagc ttaggcagca aaataggctg
10081 tgggccagtg gtctggtatc tgaaaggatt gccaagacaa gccttgcgga gctcatgccc
10141 aactgttctt gtggaaccac tgggaagtgg agttccctaa atcaggggga gtcatttaca
10201 gtcgcctggc ttttgtgggc cctgcagcct gagaagtgag tcaggatggc aggtacttgg
10261 ttgccacgtt agacagaagc acaagtattt gatgaagcag tggaacttct tgatgtaact
10321 cactcctgtc tcggtaactt tttacctact tccacatttt tttaagggtc gacccccact
10381 tcctacagtt tctctatatc cttgccactg acacatgcag gcttacgcca agacatagag
10441 gaggtcttgc tcacgccaca gttaacacat ctctatccat ggctgggcaa tatgaaagac
10501 aattgctaag gaagctttct cctgtcagca tactgatcac ttttaaagta taacttaaca
10561 ttacttcccc ttgtaaaaat cctccaatag attcccatct aaatgaaaat aaaatccaaa
10621 ttccttccta gagccaaata tcatttctct tcactctcct ttcttacttt ccttcatccc
10681 actggatctt aaggtgcaac aaacatgttt ctcatatagg aagtgtggta ggcagaattc
10741 tgaagatgtt cctccaagag acccatcccc tgcttattca gtcaaatcta ggtactgctg
10801 ggaagggact ttgcagaggt aatgcggtta cagacctgca gatagggagg ttatcttgaa
10861 ttatttgtgt agggccaatc taatttcaca agtccttaaa agcagagaat gttctctggc
10921 tggttagaga agaggagggc taaagaggca gaagaaagat gtggcagaga ggatgtccaa
10981 gattccgagc atgagaagga ttttctctga agttgcagct ctgtgaatca ggagcccatg
11041 cacgaaggct ggagagaagt ctctaggagc tgacaggagc ctccagacaa tagccaacaa
11101 aaaccagagg tgtcagtcct agaactgcat agaagggaat tctgccagca acctaaataa
11161 gccaggaagc ctcacccaga ggttccagat gagaatccag gccggctgac accttgattt
11221 cagtcttatg ggacccagag cagagaaact ggtagagact cctatacttc tgatgtacag
11281 aactgtgggg tcataactgt gtgtggttct aagctgctaa gtttatggta gtttgttaca
11341 gcagcaatgt ggggtaggga acattacact gttctttgag tgtggaaagc tcttccttac
11401 agctgctgct tcaagttagt aaaatataat ttctccagca agacctcctt tgaccactgg
11461 ggagatagcc tccactaact tccaacacgt gcatgccatc actatcatat tatcctacat
11521 tttttattgg taactgttac taactgaaaa tacttatgct tactgtcttt gtctctaatc
11581 ctatttcaca cccattagaa agttctttac agctagggac tttatgtgca cttcacaacc
11641 atgcaagatt catgagactt ctgaaaaacc caacatcatg agaggcaccc agagaagaag
11701 cagagtgatt cccatcaaag aaaaccattg attcaggaga ctgagtagag ctttagaaag
11761 tctcgatccc agaagacatg gtagccacca aattaaaata ggcagctatt gtattagtat
11821 attgttacat aacaatatca ccacaaactt agtgacttta aacaacacac attaatgacc
11881 ttgtagtttc tttcaggctt agctgggtcc tctgcttcag ggacccacag ggctgcaatg
11941 aaggtgttgg tcaggactgt ggtctcatct gaggcttgtt ggggaaggat ccacttctca
12001 gctcacatgg tggttgggca acattcagtt tcttacagat ggctggacag agggcctcag
12061 ttcttgccat ctgttggctg gaggttgccc tcagttcctt gccatgtagg cattccagtg
12121 tggctgcttg cttcctcaaa gccggcaggg gagagagcct ttccagtagc acagatgtta
12181 ctatcttctg taatgtaatc acacaggcaa cactttgtca tctttgctgt attctgtagg
12241 gtgagagcaa gacacaggtc cttcccactc ttagggaagg gtattaaaaa tgacaactac
12301 caggaggtag ggatcatgga gcctgcttca gaatctatca cagctgtgaa ataaaggccc
12361 aggaaacaag aattctaatg gttaaaataa aaatcttagt ggaagaactg aatttttaaa
12421 atggaaaggg ctgaaacaag atagttaaaa ggaagaataa gctgtggaat tattttacaa
12481 tcttcagcag acagagctag agtgaggagt taagtagtat gacagattcc aggtaactaa
12541 tatccatata atggggaatc tatagaaagt aaaaaggaga gaggtagatg ataattgcat
12601 tattgagagc agataattct tctgagtgaa atacatagtt catatcaaaa gcatctactg
12661 agtgtgtggt gttatatata tatgtaggtt tttcatccag ggttctttgg ctcataactc
12721 ccacagccct tacacagtct tgttataatg ttggatgtgt taggcctcag gtaggcctct
12781 ggtgttctgc cctccttcca ctctaatatt ctcccacctt tctgattgtg ggtcttaaga
12841 ctcaaaattc caagaggaca gggttcagag agcttcccaa tagctgaaca tgtggaggtt
12901 ccgggagagt ggtgtgccca ggtagggcat ggaagcttca agcctcttcc cccatacctt
12961 gccctagcgt ttcttcgtct gtattttttc cagtatagag caataaactg gtgaactaag
13021 tgtt.

The sequence of human fidgetin-like 1 protein is:

(SEQ ID NO: 29)
MQTSSSRSVHLSEWQKNYFAITSGICTGPKADAYRAQILRIQYA
WANSEISQVCATKLFKKYAEKYSAIIDSDNVESGLNNYAENILT
LAGSQQTDSDKWQSGLSINNVFKMSSVQKMMQAGKKFKDSLLEP
ALASVVIHKEATVFDLPKFSVCGSSQESDSLPNSAHDRDRTQDF
PESNRLKLLQNAQPPMVTNTARTCPTFSAPVGESATAKFHVTPL
FGNVKKENHSSAKENIGLNVFLSNQSCFPAACENPQRKSFYGSG
TIDALSNPILNKACSKTEDNGPKEDSSLPTFKTAKEQLWVDQQK
KYHQPQRASGSSYGGVKKSLGASRSRGILGKFVPPIPKQDGGEQ
NGGMQCKPYGAGPTEPAHPVDERLKNLEPKMIELIMNEIMDHGP
PVNWEDIAGVEFAKATIKEIVVWPMLRPDIFTGLRGPPKGILLF
GPPGTGKTLIGKCIASQSGATFFSISASSLTSKWVGEGEKMVRA
LFAVARCQQPAVIFIDEIDSLLSQRGDGEHESSRRIKTEFLVQL
DGATTSSEDRILVVGATNRPQEIDEAARRRLVKRLYIPLPEASA
RKQIVINLMSKEQCCLSEEEIEQIVQQSDAFSGADMTQLCREAS
LGPIRSLQTADIATITPDQVRPIAYIDFENAFRTVRPSVSPKDL
ELYENWNKTFGCGK.

Non-limiting examples of siRNA targeting fidgetin-like 1 include:

(SEQ ID NO: 30)
AGUGAUUACCUGAUACGUA,
(SEQ ID NO: 31)
GUGCACAGAUAUUACGCAU,
(SEQ ID NO: 32)
GAAUAAGGCUUGUAGUAAA
OR
(SEQ ID NO: 33)
GGAUCAAGUUCGACCCAUA.

Any of the foregoing sequence may be provided as a double stranded nucleic acid with a complementary sequence. Such siRNA molecules may be provided in any of the compositions described herein and used for any of the purposes described herein for FL2.

The nucleic acid sequences described herein may be prepared by any method known in the art, and purified by HPLC or any other method to provide inhibitors suitable for use for the in vitro, ex vivo or in vivo purposes described herein. In some embodiments, the purity of the inhibitor is equal to or greater than 85%. In some embodiment the purity is equal to or greater than 90%. In some embodiments the purity is equal to or greater than 95%. In some embodiment the purity is equal to or greater than 98%. In some embodiments the purity is equal to or greater than 99%. In some embodiments wherein the inhibitor is or comprises a duplex, the purity of the duplex is equal to or greater than 85%. In some embodiments wherein the inhibitor is or comprises a duplex, the purity of the duplex is equal to or greater than 90%. In some embodiments wherein the inhibitor is or comprises a duplex, the purity of the duplex is equal to or greater than 95%. In some embodiments wherein the inhibitor is or comprises a duplex, the purity of the duplex is equal to or greater than 98%. In some embodiments wherein the inhibitor is or comprises a duplex, the purity of the duplex is equal to or greater than 99%. In some embodiments the inhibitor is prepared under current Good Manufacturing Practices. In some embodiments the inhibitor is prepared for human use. In some embodiments the inhibitor is prepare for in vitro or ex vivo use for subsequent administration to humans. In some embodiments the inhibitor is prepared for human administration.

Delivery of FL2 Inhibitor Agents

As described herein, the one or more agents that inhibit FL2 in one embodiment is delivered in vivo, in order to increase the homing to or penetration of T-cells to lymph nodes, tumor sites or into tumors. In one embodiment the agent is delivered to or near a lymph node of the patient.

In one embodiment a wafer comprising the FL2 inhibitor agent such as siRNA is implanted at a site. In one embodiment, a composition of the FL2-siRNA-wafer is 2.5% collagen, 7.5% chondroitin sulfate, 82.5% polyvinylpyrrolidone (PVP) and 7.5% PEG400. siRNA will be incorporated into the wafer, and the siRNA will be measured and optimized, for example for size (by scanning electron microscopy, light scattering and atomic force microscopy), pH, charge, rate of delivery, amount of polyplex delivered, minimum fill and leakage, in order to obtain a suitable formulation to achieve good delivery and efficacy of siRNA knockdown. Formulations to be tested will be applied to the site of surgery at the time of CAR-T injection. The FL2-siRNA-wafers (or controls containing nonsense-siRNA) are a gel-like matrix that will be cut to the appropriate size and applied with forceps to the site of surgery.

In another embodiment, the siRNA may be delivered by an implantable delivery device, such as described in Zhang et al., 2019, Sci Adv 5:eaaw5296, incorporated herein by reference.

In one embodiment, albumin-binding phospholipid polymers may be used to traffic inhibitors from blood into lymph. Other examples are described in Liu et al. 2014, Nature 543:113-117. Methods for delivering agents to lymph nodes may be found in Ma et al., Science 2019 Jul. 12; 365(6449):162-168, incorporated herein by reference.

In another embodiment, the agent is used ex vivo or in vitro to induce subsequently infused T-cells to be better able to home to or penetrate into tumor sites and tumors. In one embodiment, the agent is delivered to T cells. In one embodiment, the agent is a RNA interference agent such as a siRNA or shRNA. In one embodiment, the siRNA agent is delivered to T cells by a method such as but not limited to electroporation/nucleofection, Accel siRNA, viral vectors, peptides, proteins, nanoparticles and aptamers. Delivery of siRNA to T cells may be achieved by methods described in Freeley et al., Biochemical Journal 2013 Oct. 15; 455(2):133-147, incorporated herein by reference. Some examples and literature references are provided for guidance but are not intended to be limiting.

Electroporation/nucleofection. Electroporation is a frequently-used physical method for nucleic acid transfer. In this method, the cells and nucleic acid suspended in a special buffer are subjected to high voltage pulses of electricity which generates a potential difference across the membrane and induces temporary pores in the cell membrane. Arabsolghar et al., 2012, Iran J Med Sci 37(3):187-193 described electroporation in more detail. Nucleofection is an electroporation-based transfection method which enables transfer of nucleic acids such as DNA and RNA into cells by applying a specific voltage and reagents. One non-limiting example is described in Iversen et al., 2005, Genet Vaccines Ther 3:2.

The CAR-T manufacturing process is generally amenable to electroporation/nucleofection based knock down for patient derived T-cell (see, for example, https://www.stemcell.com/media/files/wallchart/WA27041-Production_of_Chimeric_Antigen_Receptor_T_cells.pdf) Thus, FL2 knockdown can be conducted during manufacturing. For sustaining knockdown after manufacturing, either a CRISPR based knockout of FL2 in T cells can be performed. In another embodiment, siFL2 wafer can be introduced into lymph nodes.

Accel siRNA. Accel siRNA is a technique provided by Dharmacon to achieve efficient RNA silencing. It is described at https://dharmacon.horizondiscovery.com/rnai/sirna/accell/#overview.

Viral vector. A viral vector may be used to deliver RNA interference nucleic acids such as siRNA. See Tomar et al., 2003, Oncogene 22(36):5712-5715 and Kurreck et al., 2017, J RNAi Gene Silencing 13:545-547.

Peptides and proteins. Cell penetrating peptides and proteins may be used to deliver nucleic acids such as siRNA and shRNA into cells. See, for example, Cummings et al., 2019, Transl Res, in press; Ni et al., 2019, Life (Basel) 9(9); Crombez et al., Biochem Soc Transactions 35(1):44-46; and Pottash et al., 2019, J Biol Engineer 13:19.

Aptamers. Aptamers may also be used to deliver nucleic acids such as siRNA and shRNA into cells. See Krupse et al., 2017, Biomedicines, 5(3):45 and Chu et al., 2006, Nucl Acids Res 34(10):e73.

Nanoparticles. In one embodiment, a nanoparticle is used to deliver the agent to T cells. Preparation of siRNA delivering nanoparticles is known in the art, such as described in Kim et al., 2019, Adv Mater (49)e1903637, epub; Ickenstein et al., 2019, Expert Opin Drug Deliv 16(11): 1205-1226 (Sep. 17 epub). Various methods may be employed to prepare nanoparticles for effective deliver of their payload siRNA or shRNA into T cells.

In one embodiment, nanoparticles comprising tetramethyl orthosilicate (TMOS) are used, wherein the TMOS nanoparticles comprise FL2 siRNA. For example, five hundred μl of tetramethyl orthosilicate (TMOS) can be hydrolyzed in the presence of 100 μl of 1 mM HCl by sonication on ice for about 15 min, until a single phase forms. The hydrolyzed TMOS (100 μl) can then be added to 900 μl of 20 μM of siRNA (mouse FL2 (Sigma-Aldrich, SASI_Mm02_00354635) or a negative control) solution containing 10 mM phosphate, pH 7.4. A gel is formed within 10 minutes. The gel may be frozen at −80° C. for 15 minutes and lyophilized.

The fidgetin, fidgetin-like 1 or FL2 inhibitor agent may be used in a composition with additives. Examples of suitable additives are sodium alginate, as a gelatinizing agent for preparing a suitable base, or cellulose derivatives, such as guar or xanthan gum, inorganic gelatinizing agents, such as aluminum hydroxide or bentonites (termed thixotropic gel-formers), polyacrylic acid derivatives, such as CarbopolÂŽ, polyvinylpyrrolidone, microcrystalline cellulose and carboxymethylcellulose. Amphiphilic low molecular weight and higher molecular weight compounds, and also phospholipids, are also suitable. The gels can be present either as water-based hydrogels or as hydrophobic organogels, for example based on mixtures of low and high molecular weight paraffin hydrocarbons and vaseline. The hydrophilic organogels can be prepared, for example, on the basis of high molecular weight polyethylene glycols. These gelatinous forms are washable. Hydrophobic organogels are also suitable. Hydrophobic additives, such as petroleum jelly, wax, oleyl alcohol, propylene glycol monostearate and/or propylene glycol monopalmitostearate, in particular isopropyl myristate can be included. In an embodiment the inhibitor is in a composition comprising one or more dyes, for example yellow and/or red iron oxide and/or titanium dioxide for the purpose of matching as regards color. Compositions may be in any suitable form including gels, lotions, balms, pastes, sprays, powders, bandages, wound dressing, emulsions, creams and ointments of the mixed-phase or amphiphilic emulsion systems (oil/water-water/oil mixed phase), liposomes and transfersomes or plasters/band aid-type coverings. Emulsifiers which can be employed in compositions comprising the inhibitor of fidgetin-like 2 include anionic, cationic or neutral surfactants, for example alkali metal soaps, metal soaps, amine soaps, sulphonated and sulphonated compounds, invert soaps, higher fatty alcohols, partial fatty acid esters of sorbitan and polyoxyethylene sorbitan, e.g. lanette types, wool wax, lanolin or other synthetic products for preparing the oil/water and/or water/oil emulsions.

Compositions comprising the agent that inhibits fidgetin, fidgetin-like 1 or fidgetin-like 2 can also comprise vaseline, natural or synthetic waxes, fatty acids, fatty alcohols, fatty acid esters, for example as monoglycerides, diglycerides or triglycerides, paraffin oil or vegetable oils, hydrogenated castor oil or coconut oil, hog fat, synthetic fats (for example based on caprylic acid, capric acid, lauric acid or stearic acid, such as SoftisanÂŽ), or triglyceride mixtures, such as MiglyolÂŽ, can be used as lipids, in the form of fatty and/or oleaginous and/or waxy components for preparing the ointments, creams or emulsions of the compositions comprising the inhibitor of fidgetin-like 2 used in the methods described herein.

Osmotically active acids and alkaline solutions, for example hydrochloric acid, citric acid, sodium hydroxide solution, potassium hydroxide solution, sodium hydrogen carbonate, may also be ingredients of the compositions and, in addition, buffer systems, such as citrate, phosphate, tris buffer or triethanolamine, for adjusting the pH. It is possible to add preservatives as well, such as methyl benzoate or propyl benzoate (parabens) or sorbic acid, for increasing the stability.

Pastes, powders and solutions are additional forms of compositions comprising the agent that inhibits of fidgetin, fidgetin-like 1 or fidgetin-like 2. As consistency-imparting bases, the pastes frequently contain hydrophobic and hydrophilic auxiliary substances, preferably, however, hydrophobic auxiliary substances containing a very high proportion of solids. In order to increase dispersity, and also flowability and slipperiness, and also to prevent agglomerates, the powders or topically applicable powders can, for example, contain starch species, such as wheat or rice starch, flame-dispersed silicon dioxide or siliceous earth, which also serve as diluent.

In an embodiment, the compositions comprise further active ingredients, for example one or more antibiotics, antiseptics, vitamins, anesthetics, antihistamines, anti-inflammatory agents, moisturizers, penetration-enhancing agents and/or anti-irritants.

In an embodiment of the methods and compositions described herein the subject is a mammal. In an embodiment the subject is human.

In one embodiment, nanoparticles comprising the RNA interference agent are used for delivery for either the in vitro, ex vivo or in vivo applications of the methods described herein.

Tumors

In one embodiment, the methods described herein are used to increase or enhance the homing of T cells to, or increase the penetration of T cells into tumor sites or tumors including solid tumors. In one embodiment, the methods described herein are used to a liquid tumor. In one embodiment, the methods described herein are used to liquid tumors hiding in solid tissues (see, for example, “Leukaemia cells hide in fat tissue,” Nature (2016) 535:11). Any tumor or cancer is a potential site for the methods of the invention. Any organ or solid organ of the body that is a potential site for a tumor or cancer is a site for the methods described herein. Non-limiting examples of tumors include tumors that comprise esophageal cancer, pancreatic cancer, metastatic pancreatic cancer, metastatic adenocarcinoma of the pancreas, bladder cancer, stomach cancer, fibrotic cancer, glioma, malignant glioma, diffuse intrinsic pontine glioma, recurrent childhood brain neoplasm renal cell carcinoma, clear-cell metastatic renal cell carcinoma, kidney cancer, prostate cancer, metastatic castration resistant prostate cancer, stage IV prostate cancer, metastatic melanoma, melanoma, malignant melanoma, recurrent melanoma of the skin, melanoma brain metastases, stage IIIA skin melanoma; stage IIIB skin melanoma, stage IIIC skin melanoma; stage IV skin melanoma, malignant melanoma of head and neck, lung cancer, non-small cell lung cancer (NSCLC), squamous cell non-small cell lung cancer, breast cancer, recurrent metastatic breast cancer, hepatocellular carcinoma, Hodgkin's lymphoma, follicular lymphoma, non-Hodgkin's lymphoma, advanced B-cell NHL, HL including diffuse large B-cell lymphoma (DLBCL), multiple myeloma, chronic myeloid leukemia, adult acute myeloid leukemia in remission; adult acute myeloid leukemia with Inv(16)(p13.1q22); CBFB-MYH11; adult acute myeloid leukemia with t(16;16)(p13.1;q22); CBFB-MYH11; adult acute myeloid leukemia with t(8;21)(q22;q22); RUNX1-RUNX1T1; adult acute myeloid leukemia with t(9;11)(p22;q23); MLLT3-MLL; adult acute promyelocytic leukemia with t(15;17)(q22;q12); PML-RARA; alkylating agent-related acute myeloid leukemia, chronic lymphocytic leukemia, Richter's syndrome; Waldenstrom's macroglobulinemia, adult glioblastoma; adult gliosarcoma, recurrent glioblastoma, recurrent childhood rhabdomyosarcoma, recurrent Ewing sarcoma/peripheral primitive neuroectodermal tumor, recurrent neuroblastoma; recurrent osteosarcoma, colorectal cancer, MSI positive colorectal cancer; MSI negative colorectal cancer, nasopharyngeal nonkeratinizing carcinoma; recurrent nasopharyngeal undifferentiated carcinoma, cervical adenocarcinoma; cervical adenosquamous carcinoma; cervical squamous cell carcinoma; recurrent cervical carcinoma; stage IVA cervical cancer; stage IVB cervical cancer, anal canal squamous cell carcinoma; metastatic anal canal carcinoma; recurrent anal canal carcinoma, recurrent head and neck cancer; carcinoma, squamous cell of head and neck, head and neck squamous cell carcinoma (HNSCC), ovarian carcinoma, colon cancer, gastric cancer, advanced GI cancer, gastric adenocarcinoma; gastroesophageal junction adenocarcinoma, bone neoplasms, soft tissue sarcoma; bone sarcoma, thymic carcinoma, urothelial carcinoma, recurrent Merkel cell carcinoma; stage III Merkel cell carcinoma; stage IV Merkel cell carcinoma, myelodysplastic syndrome and recurrent mycosis fungoides and Sezary syndrome.

Diagnostic Methods

The methods of enhancing T cell homing and penetration into tumors described herein may in some embodiments be combined with diagnostic methods prior to, during, or following T cell therapy for the purposes, by non-limiting example, including determining need for enhanced T cell homing or penetration activity; and determining effectiveness of enhancing T cell homing or penetration activity. In one embodiment, the diagnostic test can indicate whether the dosing level or frequency of administration of FL2 inhibition therapy is effective or should be increased, or can be decreased.

In one embodiment, the extent of tumor homing and/or penetration of T cells of any source described herein is first determined, wherein those T cells needing enhancement of homing or penetration activity are subsequently exposed to an agent as described herein. In one embodiment, T cell migration activity towards tumor cells, tumor antigen, or cells expressing tumor antigen is evaluated in vitro, using methods similar to those described in the examples herein, where a sample of T cells obtained during the ex vivo or in vitro preparation for infusion are evaluated for homing or tumor (spheroid) penetration activity and such information used to direct, for example, the decision to and extent of FL2 inhibition of the T cell population before infusion into the patient. Other non-limiting examples of methods for assessing homing or penetration activity may be found in Sherman et al., 2018, Front Immunol April 2018, 9:article 857; https://www.corning.com/media/worldwide/cls/documents/applications/CLS-AN-447%20DL.pdf; and https://www.corning.com/media/worldwide/cls/documents/CLS-PST-055_CAR-T_Cell_Screening_Tumor_Spheroids.pdf.

For example, during tumor biopsy to obtain T cells and identify the patient's tumor antigen for preparation of CAR-T cells, tumor cells if available, or other cells transfected to express the tumor antigen, are used to set up a 3D gel migration assay, in which T cells undergoing CAR modification and expansion are evaluated in vitro for attraction to and penetration into cells expressing the patient's tumor antigen. The extent of attraction and/or penetration is used to determine whether the CAR-T cells should be treated with the FL2 inhibitor before infusion into the patient.

The following examples are presented in order to more fully illustrate the preferred embodiments of the invention. It should in no way be construed, however, as limiting the broad scope of the invention.

EXAMPLES

Experimental Approach

The Jurkat cell line was used as a model for T-cells. The prostate cancer cell lines DU145 and LnCAP were used as models for cancer cells. The T-cells and cancer cells were first co-cultured and observed in a 3D gel migration assay. Subsequently, prostate cancer spheroids were used to model a chemoattractant that has a hypoxic tumor microenvironment for the T-cells in a 3D gel-based co-culture.

The levels of FL2 were then downregulated in T-cells by an siRNA-mediated approach. The Jurkat cells were nucleofected with FL2 siRNA or control siRNA using the standard protocol provided by Lonza (https://bioscience.lonza.com/lonza_bs/US/en/download/product/asset/21051) . The concentration of siRNA was 100 nM. Alternative methods may be carried out with other steps as suggested by Freely M, Long A, Advances in siRNA delivery to T-cells: potential clinical applications for inflammatory disease, cancer and infection, Biochem J (2013) 455(2):133-147. The number of T-cells migrating towards the spheroids was quantified.

The FL2 siRNA and control siRNA were nucleofected into Jurkat cells (cells were grown to a density of 3×10{circumflex over ( )}5 cells/ml before Nucleofection). In the procedure, the required number of cells (1×10{circumflex over ( )}6) are centrifuged at 90×g for 10 minutes at room temperature. The supernatant was removed completely and the cell pellet resuspended carefully in room temperature in 4DNucleofector™ Solution. The siRNA and GFP reporter plasmids were added and subjected to the nucleofection process. The resulting suspension was mixed with pre-warmed DMEM medium. The cells were incubated in humidified 37° C./5% CO2 incubator until analysis. Gene expression or down regulation, respectively, is often detectable after only 4-8 hours. Protein level knockdown was confirmed after 48-72 hours using western blotting.

Example 1. Assessing Migration of T Cells Toward Cancer Cells

As shown in FIG. 1, time-lapse images demonstrate migration of T-cells (red) towards a cancer cell (green) in a 3D co-culture of Jurkat cells (T-cell line) with DU145 cells (prostate cancer cell line). The T-cells (red) show a directional movement (arrows) towards small clusters of cancer cells (green) (hour 0 to hour 5) and with time show phagocytosis of the cancer cells (hour 6 to hour 13). Both the cell lines were pre-stained with membrane specific lipophilic Vybrant dyes and then co-cultured in a 3D Matrigel plug.

Example 2. Assessing Migration of T Cells Toward Cancer Spheroids

Subsequently, using prostate cancer spheroids, limited penetration of T-cells was observed (FIG. 2A). The Jurkat cells (T-cell line) were co-cultured in a Matrigel plug along with a prostate cancer spheroid derived from DU145 cell line. FIG. 2B. Low magnification image of pre-stained Spheroid (green) and the surrounding pre-stained T-cells (red). FIG. 2C to FIG. 2H: Time lapse series tracking the motility and penetration of T-cells (red). Note the migration of T-cells directed towards the edge of spheroid (arrows) (FIG. 2C-FIG. 2F) and then migration away from the spheroid possibly owing to immunosuppressive hypoxic tumor microenvironment.

Example 3. FL2 Knockdown Enhances T Cell Migration Towards Cancer Spheroids

To evaluate the effect of FL2 knockdown, Jurkat cells were exposed to siRNA to FL2. GFP was included to identify the knocked-down cells. FIG. 3A shows by Western blot the knockdown of FL2 in Jurkat cells (T-cell line). A trans-well assay was established (FIG. 3B) for quantifying T-cell migration towards cancer spheroids. The T-cells modified with siRNA+GFP are placed in the upper chamber and the spheroids are in the lower chamber. The trans-well semipermeable membrane is coated with Matrigel to trap the T-cells migrating towards the spheroids. FIG. 3C shows by imaging the GFP-positive cells on the transwell membrane 72 hours after co-culture with cancer spheroids (Scale bar=400 um), and in FIG. 3D, quantification of GFP-positive T-cells from images show significantly (*; p=0.0159) higher number of T-cells treated with FL2 siRNA migrating towards the cancer spheroids.

Example 4. FL2 Knockdown Enhances T Cell Migration Towards Cancer Spheroids

To demonstrate the effect of FL2 knockdown of T-cells enhances migration to different cancer spheroids, FIG. 4A shows imaging the GFP-positive cells on the transwell membrane 72 hours after co-culture with cancer spheroids from prostate cancer cell lines (DU145 and LnCAP) and lung cancer cell line (DMS53) (Scale bar=400 um). In FIG. 4B, quantification of GFP-positive T-cells from images show significantly (***; p<0.001; **; p<0.01) higher number of T-cells treated with FL2 siRNA migrating towards the cancer spheroids.

Example 5. Studies in Preclinical Models

The experimental procedure to identify the role of FL2 downregulation in directing T-cells to infiltrate tumors in higher numbers in vivo as compared to control is shown in FIG. 5. The experimental design will utilize primary CD8+cytotoxic T cells (e.g., ATCC® PCS-800-017™) and T cell lines SUP-T1 [VB] (ATCC® CRL-1942™), MOLT-4 (ATCC® CRL-1582™) and TALL-104 (ATCC® CRL-11386™). Briefly, in study Phase 1, the cancer cells e.g., Du145, DM553) are injected in the flank region of immunocompromised mice through intra-peritoneal injection and allowed to generate solid tumors. In a parallel experiment (Phase 2), T-cells from a human T cell line (for example, as described above) are genetically engineered for FL2 knockdown/knockout, for example by nucleofection as described herein) and then grown for 48-72 hours in vitro. These T-cells will be injected in through tail vein in the tumor bearing mice of Phase 1. The tumors are resected and probed for markers of T-cells in the tumor tissues. It is anticipated that FL2 knockdown of FL2 in infused T cells will improve anti-cancer therapy in the model.

Example 6. Treatment of Cancer Using FL2 Knockdown of T Cells

In human patients, CAR-T cells (shown in FIG. 6) are generated with FL2-modification using multiple strategies which include co-delivery of CAR and FL2 siRNA genetic elements through nanoparticles, viruses, electroporation and gene-editing methods (such as but not limited to CRISPR, TALENs, ZFNs) as described herein. Subsequent to this, the cell therapies are formulated and delivered to the respective patients. Improved killing of tumor cells by T cells that have FL2 inhibition is demonstrated.

In other studies, FL2 knockdown of T cells isolated and expanded from a patient's tumor is also shown to increase T cell killing of tumor cells in solid tumors and blood cancers.

In the experiments described here, the T cells engineered for CAR to target solid tumors/blood cancers will have increased motility due to FL2 knockdown. Increased T cell motility will result in a larger numbers of T-cell interacting with cancer cells in solid tumors or blood cancer cells penetrated in solid tissues such as lymph nodes. The consequence of higher T cell numbers will lead to faster reduction of tumor mass (i.e., tumor shrinkage).

In practice, autologous T cells will be isolated from patient blood and engineered for CAR and FL2 ex vivo. The modified T cells will be injected back into the patient. In some studies modified T cells will be exposed to checkpoint inhibitors and/or other factors ex vivo. The patient may also be treated with checkpoint inhibition therapy. The patients will then be monitored for T-cell infiltration into the tumor (using biopsy) and size of tumor using MRI.

Example 7. FL2 Knockdown Increases T Cell Attachment to Tumor Spheroids

FIG. 8 shows the effect of FL2 knockdown on T cell attachment to a Du145 monolayer. The experiment is designed to quantify T cell attachment to the solid tumor surface. The surface of a solid tumor is demonstrated as a monolayer of Du145 (a prostate cancer cell line). The T cell line, Jurkat, is used as a model for suspension cell culture where FL2 knockdown is carried out. The objective is to study the role of FL2 in enhancing the transition of T-cells from suspension to adherent mode in a co-culture condition. The T cells treated with control or FL2 siRNA were incubated with a monolayer of Du145 cells for 24 hours. The T cells have a GFP marker for identification through imaging. After co-culture, the unadhered T-cells were removed and the monolayer of Du145 was washed with PBS. The attached T-cells were imaged and counted per 20× field of view under a microscope. (FIG. 8) The comparison of control siRNA vs FL2 siRNA treated T-cells shows a significant increase (p<0.00001) in the number of T-cells attached to a monolayer of Du145 cells for those with FL2 knockdown.

The results described in FIG. 8 were verified by a 3D co-culture system. FIG. 9 depicts a study of the attachment of T cells to a tumor spheroid. 3D tumor spheroids were grown in low-attachment 96-well plates using a prostate cancer cell line (Du145) and a small-cell lung cancer cell line (DMS53). After 48-72 h, the T cells treated with control or FL2 siRNA were incubated with individual spheroids of Du145 or DMS53 cells for 24 hours. After co-culture, the unadhered T-cells were removed and the spheroids of Du145 or DMS53 were washed with PBS and imaged under a microscope.

FIG. 9 A-B show the effect of FL2 knockdown on attachment of T cells to tumor spheroids. The comparison of number of T-cells (green) attached to spheroids (red) is significantly higher when FL2siRNA is used for T-cells on DMS53 (FIG. 9A) or Du145 (FIG. 9B). The results indicate that both kind of solid tumors, T-cell penetration can be increased significantly by knockdown of FL2.

While certain features of the invention have been illustrated and described herein, many modifications, substitutions, changes, and equivalents will now occur to those of ordinary skill in the art. It is, therefore, to be understood that the appended claims are intended to cover all such modifications and changes as fall within the true spirit of the invention.

Claims

What is claimed is:

1. A method for enhancing the tumoricidal activity of T cells comprising the step of reducing fidgetin-like 2 expression or activity in the T cells.

2. The method of claim 1 wherein the tumoricidal activity is against a solid tumor, a liquid tumor, a bone marrow tumor or a blood cancer.

3. The method of claim 1 wherein the tumoricidal activity is against a carcinoma, a sarcoma, a lymphoma, a leukemia, a myeloma or a mixed type tumor.

4. The method of claim 1 wherein enhancing the tumoricidal activity comprises enhancing the migration of T cells toward a tumor site or tumor cells, enhancing the penetration or infiltration of T cells into a tumor, enhancing the penetration or infiltration of T cells into a bodily site comprising tumor cells, or any combination thereof.

5. The method of claim 1 wherein the T cells are endogenous T cells or adoptive T cell therapy.

6. The method of claim 4 wherein the T cells are autologous T cells, CAR-T cells, tumor infiltrating lymphocytes, engineered T cell receptor lymphocytes, macrophages, microglia or natural killer cells, or are derived from lymphoid progenitor cells or pluripotent stem cells.

7. The method of claim 1 wherein reducing fidgetin-like 2 expression or activity in the T cells is carried out in vivo, ex vivo or in vitro.

8. The method of claim 7 wherein the in vivo reducing fidgetin-like 2 expression or activity comprises administering an inhibitor of fidgetin-like 2 to a subject parenterally, into a tissue, into an organ, lymph node, intratumorally or adjacent to a tumor.

9. The method of claim 7 wherein the ex vivo reducing fidgetin-like 2 expression or activity comprises exposing T cells ex vivo to an inhibitor of fidgetin-like 2.

10. The method of claim 9 wherein the T cells are subsequently infused into a subject or a site within the subject.

11. The method of claim 7 wherein the in vitro reducing fidgetin-like 2 expression or activity comprises exposing T cells in vitro to an inhibitor of fidgetin-like 2.

12. The method of claim 1 wherein the T cells are autologous, allogeneic, lymphoid progenitors or pluripotent stem cells.

13. The method of claim 1 wherein the T cells are obtained from a cell line or from a donor.

14. The method of any one of claims 8-13 wherein the inhibitor of fidgetin-like 2 is a RNA interference agent.

15. The method of claim 14 wherein the RNA interference agent is shRNA or siRNA

16. The method of claim 15 wherein the siRNA has a sequence selected from

(SEQ ID NO: 1)
UUACACAGUAUUAAAGCGAUU;
(SEQ ID NO: 2)
UCGCUUUAAUACUGUGUAAUU;
(SEQ ID NO: 3
CAUCUGAAACCUAGGGUCUUU;
(SEQ ID NO: 4)
AGACCCUAGGUUUCAGAUGUU;
(SEQ ID NO: 5)
GUGACUUAUGCUAGGAGGAUU;
(SEQ ID NO: 6)
UCCUCCUAGCAUAAGUCACUU;
(SEQ ID NO: 7)
GGUCAGAAGCAGAAUGUAUUU;
(SEQ ID NO: 8)
AUACAUUCUGCUUCUGACCUU;
(SEQ ID NO: 9)
CGCCGGCCCACAAGUUGGAdTdT;
(SEQ ID NO: 10)
UCCAACUUGUGGGCCGGCGdTdT;
(SEQ ID NO: 11)
CAGCUCGAGCCCUUUGACAdTdT;
(SEQ ID NO: 12)
UGUCAAAGGGCUCGAGCUGdTdT;
(SEQ ID NO: 13)
CCUCCAACCUCCUCAAGAGdTdT;
(SEQ ID NO: 14)
CUCUUGAGGAGGUUGGAGGdTdT;
(SEQ ID NO: 15)
CGUUGCUGCUCAUCAGCGAdTdT;
(SEQ ID NO: 16)
UCGCUGAUGAGCAGCAACGdTdT;
(SEQ ID NO: 17)
fUfUmA fCmAfC AGU AUU AAA GCG ATT;
(SEQ ID NO: 18)
(Phos) U CGC UUU AAU ACU G UG UAA TT;
(SEQ ID NO: 34)
5′-UUACACAGUAUUAAAGCGATT-3′;
(SEQ ID NO: 35)
(Phos) 5′-mUmCGCUUUAAUACUGUGUAATT-3′;
(SEQ ID NO: 36)
(Phos) 5′-mU(s)mC(s)GCUUUAAUACUGUGUAATT-3′;
(SEQ ID NO: 37)
(Phos) 5′-fUfCGCUUUAAUACUGUGUAATT-3′;
(SEQ ID NO: 38)
(Phos) 5′-fU(s)fC(s)GCUUUAAUACUGUGUAATT-3′;
(SEQ ID NO: 39)
(Phos) 5′-mU(s)mC(s)GCUUUAAUAmCf
UmGfUmGfUmAmATT-3′;
(SEQ ID NO: 40)
(Phos) 5′-U(s)CGCUUUAAUACUGUGUAATT-3′;
(SEQ ID NO: 41)
(Phos) 5′-mUfCmGfCmUfUmUAAfUmA
fCmUGmUmGfUmAmATT;
(SEQ ID NO: 42)
5′mUmUmAmCmAmCmAmGmUmAmUmUmAm
AmAmGmCmGmAmUmU-3′;
(SEQ ID NO: 43)
(Phos) 5′-mUmCmGmCmUmUmUmAmAmUm
AmCmUmGmUmGmUmAmAmUmU-3′;
(SEQ ID NO: 44)
5′mUmUmAmCmAmCmAmGmUmAmUmUmAmAm
AmGdCdGdATT-3′;
(SEQ ID NO: 45)
5′mUmUmAmCmAmCmAmGmUmAmUmUmAmAm
+0AmGdCmGmATT-3′;
(SEQ ID NO: 46)
5′UUACACAGUAUUAAAGCGA-3′;
(SEQ ID NO: 47)
(Phos) 5′-U(s)CGCUUUAAUACUGUGUAATT-3′;
(SEQ ID NO: 48)
(Phos) 5′-UCGCUUUAAUACUGUGUAATT-3′;
(SEQ ID NO: 49)
(Phos) 5′-U(s)C(s)GCUUUAAUACUGUGUAATT-3′;
(SEQ ID NO: 50)
5′-mUmUACACAGUAUUAAAGCGA-3′;
(SEQ ID NO: 51)
(Phos) 5′-U(s)CGCUUUAAUACUGUGUmAmATT-3′;
(SEQ ID NO: 52)
(Phos) 5′-UCGCUUUAAUACUGUGUAATT-3′;
(SEQ ID NO: 53)
(Phos) 5′-U(s)C(s)GCUUUAAUACUGUGUAA T(s)T-3′;
(SEQ ID NO: 54)
5′lUlUlAlClACAGUAUUAAAGCGATT-3′;
SEQ ID NO: 55)
(Phos) 5′-UCGCUUUAAUACUGlUlGlUlAlA TT-3′;
(SEQ ID NO: 56)
5′fUfUlAfClACAGUAUUAAAGCGA-3′;
or
(SEQ ID NO: 57)
(Phos) 5′-mU(s)mCmGCUUUAAUACUGUGUAATT-3′,

wherein d(nucleotide)=deoxy-(nucleotide), m(nucleotide)=2′-O-methyl nucleotide, T=thymidine, f(nucleotide)=2′-fluorodeoxy nucleotide, (Phos)=phosphodiester cap; capital letter nucleotide=RNA nucleotide, l(nucleotide)=a locked nucleotide, and (s)=phosphorothioate.

17. The method of claim 15 wherein the siRNA has at least one modification selected from a 3′ overhang, a 5′ overhang, a 5′ phosphorylation, a 2′ sugar modification, a nucleic acid base modification, a phosphate backbone modification, and any combination of any of the foregoing.

18. The method of claim 1 wherein the fidgetin-like 2 is human fidgetin-like 2.

19. The method of claim 15 wherein the siRNA is encapsulated in a nanoparticle.

20. The method of claim 15 wherein the siRNA is delivered by nanoparticles, electroporation/nucleofection, Accel siRNA, a viral vector, peptide, protein or aptamer.

21. The method of any one of claim 6, 8 or 11 wherein an immune checkpoint inhibitor is administered to the subject, or the T cells are exposed to an immune checkpoint inhibitor, ex vivo or in vitro.

22. The method of claim 2 wherein the tumor or cancer is colorectal cancer, pancreatic cancer, liver cancer, intrahepatic bile ductal cancer, esophageal cancer, bladder cancer, non-Hodgkin's lymphoma or kidney cancer.

23. A method for treating cancer in a subject in need thereof comprising administering to the subject a population of T cells wherein the expression or activity of fidgetin-like 2 therein has been reduced.

24. The method of claim 23 the cancer comprises a solid tumor, a liquid tumor, a bone marrow tumor or a blood cancer.

25. The method of claim 23 wherein the cancer is a carcinoma, a sarcoma, a lymphoma, a leukemia, a myeloma or a mixed type tumor.

26. The method of claim 23 wherein the T cells are adoptive T cell therapy.

27. The method of claim 26 wherein the population of T cells are autologous T cells, CAR-T cells, tumor infiltrating lymphocytes, engineered T cell receptor lymphocytes, macrophages, microglia or natural killer cells, or are derived from lymphoid progenitor cells or pluripotent stem cells.

28. The method of claim 23 wherein reducing fidgetin-like 2 expression or activity in the T cells is carried out ex vivo or in vitro.

29. The method of claim 28 wherein the ex vivo reducing fidgetin-like 2 expression or activity comprises exposing T cells ex vivo to an inhibitor of fidgetin-like 2 prior to administration to the subject.

30. The method of claim 28 wherein the in vitro reducing fidgetin-like 2 expression or activity comprises exposing T cells in vitro to an inhibitor of fidgetin-like 2 prior to administration to the subject.

31. The method of claim 28 wherein the T cells are obtained from a cell line or a donor.

32. The method of claim 29 wherein the inhibitor of fidgetin-like 2 is a RNA interference agent.

33. The method of claim 32 wherein the RNA interference agent is shRNA or siRNA.

34. The method of claim 33 wherein the siRNA has a sequence selected from

(SEQ ID NO: 1)
UUACACAGUAUUAAAGCGAUU;
(SEQ ID NO: 2)
UCGCUUUAAUACUGUGUAAUU;
(SEQ ID NO: 3
CAUCUGAAACCUAGGGUCUUU;
(SEQ ID NO: 4)
AGACCCUAGGUUUCAGAUGUU;
(SEQ ID NO: 5)
GUGACUUAUGCUAGGAGGAUU;
(SEQ ID NO: 6)
UCCUCCUAGCAUAAGUCACUU;
(SEQ ID NO: 7)
GGUCAGAAGCAGAAUGUAUUU;
(SEQ ID NO: 8)
AUACAUUCUGCUUCUGACCUU;
(SEQ ID NO: 9)
CGCCGGCCCACAAGUUGGAdTdT;
(SEQ ID NO: 10)
UCCAACUUGUGGGCCGGCGdTdT;
(SEQ ID NO: 11)
CAGCUCGAGCCCUUUGACAdTdT;
(SEQ ID NO: 12)
UGUCAAAGGGCUCGAGCUGdTdT;
(SEQ ID NO: 13)
CCUCCAACCUCCUCAAGAGdTdT;
(SEQ ID NO: 14)
CUCUUGAGGAGGUUGGAGGdTdT;
(SEQ ID NO: 15)
CGUUGCUGCUCAUCAGCGAdTdT;
(SEQ ID NO: 16)
UCGCUGAUGAGCAGCAACGdTdT;
(SEQ ID NO: 17)
fUfUmA fCmAfC AGU AUU AAA GCG ATT;
(SEQ ID NO: 18)
(Phos) U CGC UUU AAU ACU G UG UAA TT;
(SEQ ID NO: 34)
5′-UUACACAGUAUUAAAGCGATT-3′;
(SEQ ID NO: 35)
(Phos) 5′-mUmCGCUUUAAUACUGUGUAATT-3′;
(SEQ ID NO: 36)
(Phos) 5′-mU(s)mC(s)GCUUUAAUACUGUGUAATT-3′;
(SEQ ID NO: 37)
(Phos) 5′-fUfCGCUUUAAUACUGUGUAATT-3′;
(SEQ ID NO: 38)
(Phos) 5′-fU(s)fC(s)GCUUUAAUACUGUGUAATT-3′;
(SEQ ID NO: 39)
(Phos) 5′-mU(s)mC(s)GCUUUAAUAm
CfUmGfUmGfUmAmATT-3′;
(SEQ ID NO: 40)
(Phos) 5′-U(s)CGCUUUAAUACUGUGUAATT-3′;
(SEQ ID NO: 41)
(Phos) 5′-mUfCmGfCmUfUmUAAfUmAfCmUGmUmGfUmAmATT;
(SEQ ID NO: 42)
5′mUmUmAmCmAmCmAmGmUmAmUmUmAm
AmAmGmCmGmAmUmU-3′;
(SEQ ID NO: 43)
(Phos) 5′-mUmCmGmCmUmUmUmAmAmUmAmCm
UmGmUmGmUmAmAmUmU-3′;
(SEQ ID NO: 44)
5′mUmUmAmCmAmCmAmGmUmAmUmUmAmAmAmGdCdGdATT-3′;
(SEQ ID NO: 45)
5′mUmUmAmCmAmCmAmGmUmAmUmUmAmAmAmGdCmGmATT-3′;
(SEQ ID NO: 46)
5′UUACACAGUAUUAAAGCGA-3′;
(SEQ ID NO: 47)
(Phos) 5′-U(s)CGCUUUAAUACUGUGUAATT-3′;
(SEQ ID NO: 48)
(Phos) 5′-UCGCUUUAAUACUGUGUAATT-3′;
(SEQ ID NO: 49)
(Phos) 5′-U(s)C(s)GCUUUAAUACUGUGUAATT-3′;
(SEQ ID NO: 50)
5′-mUmUACACAGUAUUAAAGCGA-3;
(SEQ ID NO: 51)
(Phos) 5′-U(s)CGCUUUAAUACUGUGUmAmATT-3′;
(SEQ ID NO: 52)
(Phos) 5′-UCGCUUUAAUACUGUGUAATT-3′;
(SEQ ID NO: 53)
(Phos) 5′-U(s)C(s)GCUUUAAUACUGUGUAA T(s)T-3′;
(SEQ ID NO: 54)
5′lUlUlAlClACAGUAUUAAAGCGATT-3′;
SEQ ID NO: 55)
(Phos) 5′-UCGCUUUAAUACUGlUlGlUlAlA TT-3′;
(SEQ ID NO: 56)
5′fUfUlAfClACAGUAUUAAAGCGA-3′;
or
(SEQ ID NO: 57)
(Phos) 5′-mU(s)mCmGCUUUAAUACUGUGUAATT-3′,

wherein d(nucleotide)=deoxy-(nucleotide), m(nucleotide)=2′-O-methyl nucleotide, T=thymidine, f(nucleotide)=2′-fluorodeoxy nucleotide, (Phos)=phosphodiester cap; capital letter nucleotide=RNA nucleotide, l(nucleotide)=a locked nucleotide, and (s)=phosphorothioate.

35. The method of claim 32 wherein the siRNA has at least one modification selected from a 3′ overhang, a 5′ overhang, a 5′ phosphorylation, a 2′ sugar modification, a nucleic acid base modification, a phosphate backbone modification, [others], and any combination of any of the foregoing.

36. The method of claim 23 wherein the fidgetin-like 2 is human fidgetin-like 2.

37. The method of claim 28 wherein the siRNA is in a wafer or encapsulated in a nanoparticle.

38. The method of claim 28 wherein the siRNA is delivered by nanoparticle, electroporation/nucleofection, Accel siRNA, a viral vector, peptide, protein or aptamer.

39. The method claim 23 wherein an immune checkpoint inhibitor is administered to the subject.

40. The method of claim 23 wherein the cancer is colorectal cancer, pancreatic cancer, liver cancer, intrahepatic bile ductal cancer, esophageal cancer, bladder cancer, non-Hodgkin's lymphoma or kidney cancer.

41. A method for treating cancer in a subject in need thereof comprising administering to or near a lymph node or tumor or tumor site within the subject an inhibitor of the expression or activity of fidgetin-like 2.

42. The method of claim 41 the cancer comprises a solid tumor, a liquid tumor, a bone marrow tumor or a blood cancer.

43. The method of claim 41 wherein the inhibitor of fidgetin-like 2 is a RNA interference agent.

44. The method of claim 43 wherein the RNA interference agent is shRNA or siRNA.

45. The method of claim 44 wherein the siRNA has a sequence selected from

(SEQ ID NO: 1)
UUACACAGUAUUAAAGCGAUU;
(SEQ ID NO: 2)
UCGCUUUAAUACUGUGUAAUU;
(SEQ ID NO: 3
CAUCUGAAACCUAGGGUCUUU;
(SEQ ID NO: 4)
AGACCCUAGGUUUCAGAUGUU;
(SEQ ID NO: 5)
GUGACUUAUGCUAGGAGGAUU;
(SEQ ID NO: 6)
UCCUCCUAGCAUAAGUCACUU;
(SEQ ID NO: 7)
GGUCAGAAGCAGAAUGUAUUU;
(SEQ ID NO: 8)
AUACAUUCUGCUUCUGACCUU;
(SEQ ID NO: 9)
CGCCGGCCCACAAGUUGGAdTdT;
(SEQ ID NO: 10)
UCCAACUUGUGGGCCGGCGdTdT;
(SEQ ID NO: 11)
CAGCUCGAGCCCUUUGACAdTdT;
(SEQ ID NO: 12)
UGUCAAAGGGCUCGAGCUGdTdT;
(SEQ ID NO: 13)
CCUCCAACCUCCUCAAGAGdTdT;
(SEQ ID NO: 14)
CUCUUGAGGAGGUUGGAGGdTdT;
(SEQ ID NO: 15)
CGUUGCUGCUCAUCAGCGAdTdT;
(SEQ ID NO: 16)
UCGCUGAUGAGCAGCAACGdTdT;
(SEQ ID NO: 17)
fUfUmA fCmAfC AGU AUU AAA GCG ATT;
(SEQ ID NO: 18)
(Phos) U CGC UUU AAU ACU G UG UAA TT;
(SEQ ID NO: 34)
5′-UUACACAGUAUUAAAGCGATT-3′;
(SEQ ID NO: 35)
(Phos) 5′-mUmCGCUUUAAUACUGUGUAATT-3′;
(SEQ ID NO: 36)
(Phos) 5′-mU(s)mC(s)GCUUUAAUACUGUGUAATT-3′;
(SEQ ID NO: 37)
(Phos) 5′-fUfCGCUUUAAUACUGUGUAATT-3′;
(SEQ ID NO: 38)
(Phos) 5′-fU(s)fC(s)GCUUUAAUACUGUGUAATT-3′;
(SEQ ID NO: 39)
(Phos) 5′-mU(s)mC(s)GCUUUAAUAmCfUm
GfUmGfUmAmATT-3′;
(SEQ ID NO: 40)
(Phos) 5′-U(s)CGCUUUAAUACUGUGUAATT-3′;
(SEQ ID NO: 41)
(Phos) 5′-mUfCmGfCmUfUmUAAfUmAfCmU
GmUmGfUmAmATT;
(SEQ ID NO: 42)
5′mUmUmAmCmAmCmAmGmUmAmUmUmAmA
mAmGmCmGmAmUmU-3′;
(SEQ ID NO: 43)
(Phos) 5′-mUmCmGmCmUmUmUmAmAmUmAmCm
UmGmUmGmUmAmAmUmU-3′;
(SEQ ID NO: 44)
5′mUmUmAmCmAmCmAmGmUmAmUmUmAm
AmAmGdCdGdATT-3′;
(SEQ ID NO: 45)
5′mUmUmAmCmAmCmAmGmUmAmUmUmAmAmAmGdCmGmATT-3′;
(SEQ ID NO: 46)
5′UUACACAGUAUUAAAGCGA-3′;
(SEQ ID NO: 47)
(Phos) 5′-U(s)CGCUUUAAUACUGUGUAATT-3′;
(SEQ ID NO: 48)
(Phos) 5′-UCGCUUUAAUACUGUGUAATT-3′;
(SEQ ID NO: 49)
(Phos) 5′-U(s)C(s)GCUUUAAUACUGUGUAATT-3′;
(SEQ ID NO: 50)
5′-mUmUACACAGUAUUAAAGCGA-3′;
(SEQ ID NO: 51)
(Phos) 5′-U(s)CGCUUUAAUACUGUGUmAmATT-3′;
(SEQ ID NO: 52)
(Phos) 5′-UCGCUUUAAUACUGUGUAATT-3′;
(SEQ ID NO: 53)
(Phos) 5′-U(s)C(s)GCUUUAAUACUGUGUAA T(s)T-3′;
(SEQ ID NO: 54)
5′lUlUlAlClACAGUAUUAAAGCGATT-3′;
SEQ ID NO: 55)
(Phos) 5′-UCGCUUUAAUACUGlUlGlUlAlA TT-3′;
(SEQ ID NO: 56)
5′fUfUlAfClACAGUAUUAAAGCGA-3′;
or
(SEQ ID NO: 57)
(Phos) 5′-mU(s)mCmGCUUUAAUACUGUGUAATT-3′,

wherein d(nucleotide)=deoxy-(nucleotide), m(nucleotide)=2′-O-methyl nucleotide, T=thymidine, f(nucleotide)=2′-fluorodeoxy nucleotide, (Phos)=phosphodiester cap; capital letter nucleotide=RNA nucleotide, l(nucleotide)=a locked nucleotide, and (s)=phosphorothioate.

46. The method of claim 44 wherein the siRNA has at least one modification selected from a 3′ overhang, a 5′ overhang, a 5′ phosphorylation, a 2′ sugar modification, a nucleic acid base modification, a phosphate backbone modification, [others], and any combination of any of the foregoing.

47. The method of claim 41 wherein the fidgetin-like 2 is human fidgetin-like 2.

48. The method of claim 44 wherein the siRNA is in a wafer or encapsulated in a nanoparticle.

49. The method of claim 41 wherein an immune checkpoint inhibitor is administered to the subject.

50. The method of claim 41 wherein the cancer is colorectal cancer, pancreatic cancer, liver cancer, intrahepatic bile ductal cancer, esophageal cancer, bladder cancer, non-Hodgkin's lymphoma or kidney cancer.

51. The method of claim 41 wherein the inhibitor is infused paratumorally or intratumorally.

52. The method of claim 41 wherein the subject concurrently receives or previously received T cell therapy.

53. A method for treating cancer in a subject in need thereof comprising the steps of (1) determining whether the activity of T cells to migrate to or penetrate into a solid tumor is reduced, and if such activity is reduced, (2) exposing T cells in vitro or ex vivo to an inhibitor that reduces the expression or activity of fidgetin-like 2, and administering the T cells to the subject, or administering to or near a lymph node, tumor or tumor site within the subject, an inhibitor that reduces the expression or activity of fidgetin-like 2, or any combination thereof.

54. The method of claim 53 wherein the T cells are endogenous T cells or the T cells administered for adoptive T cell therapy.

55. The method of claim 53 wherein the determining whether the activity of endogenous T cells or T cells for administration for adoptive T cell therapy to migrate or penetrate into a solid tumor is carried out by a T cell migration or penetration assay.

56. The method of claim 53 wherein the cancer is a solid tumor, a liquid tumor, a bone marrow tumor or a blood cancer.

57. The method of claim 53 wherein the cancer is a carcinoma, a sarcoma, a lymphoma, a leukemia, a myeloma or a mixed type tumor.

58. The method of claim 53 wherein exposing enhances the migration of T cells toward a tumor site or tumor cells, enhances the penetration or infiltration of T cells into a tumor, enhances the penetration or infiltration of T cells into a bodily site comprising tumor cells, or any combination thereof.

59. The method of claim 53 wherein the T cells are administered for adoptive T cell therapy.

60. The method of claim 59 wherein the T cells are autologous T cells, CAR-T cells, tumor infiltrating lymphocytes, engineered T cell receptor lymphocytes, macrophages, microglia or natural killer cells, or are derived from lymphoid progenitor cells or pluripotent stem cells.

61. The method of claim 53 wherein reducing fidgetin-like 2 expression or activity in the T cells is carried out in vivo, ex vivo or in vitro.

62. The method of claim 61 wherein the in vivo reducing fidgetin-like 2 expression or activity comprises administering an inhibitor of fidgetin-like 2 to a subject parenterally, into a tissue, into an organ, lymph node, intratumorally or adjacent to a tumor.

63. The method of claim 61 wherein the ex vivo reducing fidgetin-like 2 expression or activity comprises exposing T cells ex vivo to an inhibitor of fidgetin-like 2.

64. The method of claim 63 wherein the T cells are subsequently infused into a subject or a site within the subject.

65. The method of claim 61 wherein the in vitro reducing fidgetin-like 2 expression or activity comprises exposing T cells in vitro to an inhibitor of fidgetin-like 2.

66. The method of claim 65 wherein the T cells are subsequently infused into a subject or a site within the subject.

67. The method of claim 53 wherein the T cells are autologous, allogeneic, lymphoid progenitors or pluripotent stem cells.

68. The method of claim 53 wherein the T cells are obtained from a cell line or from a donor.

69. The method of any one of claims 62-68 wherein the inhibitor of fidgetin-like 2 is a RNA interference agent.

70. The method of claim 69 wherein the RNA interference agent is shRNA or siRNA.

71. The method of claim 70 wherein the siRNA has a sequence selected from among SEQ ID NOs:1-18 or 34-57.

72. The method of claim 70 wherein the siRNA has at least one modification selected from a 3′ overhang, a 5′ overhang, a 5′ phosphorylation, a 2′ sugar modification, a nucleic acid base modification, a phosphate backbone modification, and any combination of any of the foregoing.

73. The method of claim 53 wherein the fidgetin-like 2 is human fidgetin-like 2.

74. The method of claim 70 wherein the siRNA is encapsulated in a nanoparticle.

75. The method of claim 70 wherein the siRNA is delivered by nanoparticles, electroporation/nucleofection, Accel siRNA, a viral vector, peptide, protein or aptamer.

76. The method of any one of claim 60, 62 or 65 wherein an immune checkpoint inhibitor is administered to the subject.

77. The method of claim 53 wherein the tumor or cancer is colorectal cancer, pancreatic cancer, liver cancer, intrahepatic bile ductal cancer, esophageal cancer, bladder cancer, non-Hodgkin's lymphoma or kidney cancer.

78. The method of claim 53 wherein an immune checkpoint inhibitor is administered to the subject or exposed to T cells ex vivo or in vitro before administration to the subject.

79. A method for enhancing the tumoricidal activity of T cells comprising the step of reducing fidgetin expression or activity in the T cells.

80. A method for treating cancer in a subject in need thereof comprising administering to a subject a population of T cells wherein the expression or activity of fidgetin therein has been reduced.

81. A method for treating cancer in a subject in need thereof comprising administering to or near a lymph node or tumor or tumor site within the subject an inhibitor of the expression or activity of fidgetin.

82. A method for treating cancer in a subject in need thereof comprising the steps of (1) determining whether the activity of T cells to migrate to or penetrate into a solid tumor is reduced, and if such activity is reduced, (2) exposing T cells in vitro or ex vivo to an inhibitor that reduces the expression or activity of fidgetin, and administering the T cells to the subject, or administering to or near a lymph node, tumor or tumor site within the subject, an inhibitor that reduces the expression or activity of fidgetin, or any combination thereof.

83. A method for enhancing the tumoricidal activity of T cells comprising the step of reducing fidgetin-like 1 expression or activity in the T cells.

84. A method for treating cancer in a subject in need thereof comprising administering to a subject a population of T cells wherein the expression or activity of fidgetin-like 1 therein has been reduced.

85. A method for treating cancer in a subject in need thereof comprising administering to or near a lymph node or tumor or tumor site within the subject an inhibitor of the expression or activity of fidgetin-like 1.

86. A method for treating cancer in a subject in need thereof comprising the steps of (1) determining whether the activity of T cells to migrate to or penetrate into a solid tumor is reduced, and if such activity is reduced, (2) exposing T cells in vitro or ex vivo to an inhibitor that reduces the expression or activity of fidgetin-like 1, and administering the T cells to the subject, or administering to or near a lymph node, tumor or tumor site within the subject, an inhibitor that reduces the expression or activity of fidgetin-like 1, or any combination thereof.

Resources

Images & Drawings included:

Sources:

Recent applications in this class:

Recent applications for this Assignee: