US20180216098A1
2018-08-02
15/506,050
2015-08-27
This disclosure provides, among other things, a composition comprising: a 5′ exonuclease; a strand-displacing polymerase; and optionally a single strand DNA binding protein and/or a ligase. A method for polynucleotide assembly to form a synthon, as well as a kit for performing the same, are also described.
Get notified when new applications in this technology area are published.
C12N15/1031 » CPC main
Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor; Recombinant DNA-technology; Processes for the isolation, preparation or purification of DNA or RNA; Mutagenizing nucleic acids mutagenesis by gene assembly, e.g. assembly by oligonucleotide extension PCR
C12N15/1027 » CPC further
Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor; Recombinant DNA-technology; Processes for the isolation, preparation or purification of DNA or RNA; Mutagenizing nucleic acids by DNA shuffling, e.g. RSR, STEP, RPR
C12Y207/07007 » CPC further
Transferases transferring phosphorus-containing groups (2.7); Nucleotidyltransferases (2.7.7) DNA-directed DNA polymerase (2.7.7.7), i.e. DNA replicase
C12N9/1252 » CPC further
Enzymes; Proenzymes; Compositions thereof ; Processes for preparing, activating, inhibiting, separating or purifying enzymes; Transferases (2.) transferring phosphorus containing groups, e.g. kinases (2.7); Nucleotidyltransferases (2.7.7) DNA-directed DNA polymerase (2.7.7.7), i.e. DNA replicase
C12N2310/20 » CPC further
Structure or type of the nucleic acid; Type of nucleic acid involving clustered regularly interspaced short palindromic repeats [CRISPRs]
C12N15/10 IPC
Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor; Recombinant DNA-technology Processes for the isolation, preparation or purification of DNA or RNA
C12N15/64 » CPC further
Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor; Recombinant DNA-technology; Introduction of foreign genetic material using vectors; Vectors; Use of hosts therefor; Regulation of expression General methods for preparing the vector, for introducing it into the cell or for selecting the vector-containing host
C12N15/66 » CPC further
Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor; Recombinant DNA-technology; Introduction of foreign genetic material using vectors; Vectors; Use of hosts therefor; Regulation of expression General methods for inserting a gene into a vector to form a recombinant vector using cleavage and ligation; Use of non-functional linkers or adaptors, e.g. linkers containing the sequence for a restriction endonuclease
C12N9/12 IPC
Enzymes; Proenzymes; Compositions thereof ; Processes for preparing, activating, inhibiting, separating or purifying enzymes; Transferases (2.) transferring phosphorus containing groups, e.g. kinases (2.7)
C12N9/96 » CPC further
Enzymes; Proenzymes; Compositions thereof ; Processes for preparing, activating, inhibiting, separating or purifying enzymes Stabilising an enzyme by forming an adduct or a composition; Forming enzyme conjugates
Synthetic Biology relies on the ability to build novel DNAs from component parts. Double strand (ds) DNA molecules have been assembled by creating staggered ends at the both ends of a first DNA duplex. This has been achieved using restriction endonucleases or by using exonuclease digestion or by T4 DNA polymerase followed by hybridization and optional ligation of a second DNA duplex to the first duplex. Techniques that utilize exonucleases and ligases in a reaction mixture also specify the use of non-strand displacing polymerases.
This disclosure provides, among other things, a composition comprising: i. a 5′ exonuclease; ii. a strand-displacing polymerase; iii. a single strand (ss) DNA binding protein; and, iv. a non-naturally occurring buffering agent, wherein the composition does not comprise a crowding agent and/or a non-strand-displacing polymerase. The composition can be employed to assemble polynucleotides into a synthon. Embodiments of the composition optionally contain a ligase depending on whether assembly is performed for purposes of cloning in a bacterial cell that would contain its own ligase or whether assembly is performed for purposes which do not include a cloning step in bacteria.
Previously described assembly methods required a non-strand displacing polymerases and evolved to additionally require a crowding agent (see for example U.S. Pat. No. 8,968,999). Contrary to the prior teachings, present embodiments demonstrate that a strand displacing polymerase has advantages over a non-strand displacing polymerase when used with a 5′-3′ exonuclease. This combination has a preference for including a ss binding protein over a crowding agent which is the reverse over prior art teachings which assert that use of crowding agents are four fold more effective than alternatives including the use of a single stand binding protein. Present embodiments provide compositions, methods and kits that provide increased efficiency of assembly and cloning of functional genes and synthons from oligonucleotides and polynucleotides including ds and/or ss nucleic acid molecules in a single step method and/or in a single reaction vessel. These embodiments do not rely on crowding agents nor do they require non-strand displacing polymerases for filling in gaps that are present after two molecules anneal. For example, when a 5′-3′ exonuclease that acts upon ds DNA generates a 3′ ss DNA overhang that can anneal effectively with a 3′ ss DNA overhang from another molecule, the strand-displacing polymerase can fill-in gaps left after the molecules anneal. A combination of activities of the strand-displacing DNA polymerase and the 5′-3′ exonuclease results in a duplex synthon containing a nick at or near the site of joining. This nick can be sealed in vitro by a ligase or in vivo by an endogenous cellular ligase. Additionally, the inclusion of a ss DNA binding protein in the reaction mixture enables efficient assembly of relatively low concentrations of nucleic acid fragments, thereby providing a cost saving without loss of efficiency or loss of accuracy of joining.
In some embodiments of the compositions, the strand-displacing polymerase is a Family B polymerase. A strand displacing polymerase should preferably have strand-displacing activity that is greater than that observed with Phusion® polymerase (Thermo Fisher, Waltham, Mass.) (which is generally described as non-strand displacing) under the same reaction conditions (for example, using an assay such as described in FIG. 1A-1E. In the present compositions, methods and kits the strand displacing polymerase is utilized primarily for its strand displacing activity. In some embodiments, the strand-displacing polymerase may be non-naturally occurring, for example, the strand-displacing polymerase may be a mutant. Examples of mutants include polymerases having one or more amino acid substitutions, non-naturally occurring polymerases may alternatively or in addition be fusion proteins with a moiety having an unrelated amino acid sequence where the fusion polymerase is not encountered in nature. Preferably the strand displacing polymerase is stable at 50° C. or above and may thus be referred to as a thermostable strand displacing polymerase. In some cases, the strand-displacing polymerase is a fusion polymerase having an unrelated or heterologous DNA binding domain. In some embodiments, the polymerase moiety may have an amino acid sequence that is at least 90% or 95%, or 98% or 99% identical to SEQ ID NO:102. In another embodiment, the polymerase may have an amino acid sequence that is at least 90% or 95% or 98% or 99% or 100% identical to SEQ ID NO:1 preferably at least 90%. In another embodiment, the polymerase may have an amino acid sequence that is at least 90% or 95% or 98% or 99% or 100% identical to any of SEQ ID NO:33-55 preferably at least 90%. In some embodiments, the DNA binding domain moiety may have an amino acid sequence that is at least 90% or 95%, or 98% or 99% identical to SEQ ID NO:2. In another embodiment, the polymerase may have an amino acid sequence that is at least 90% or 95% or 98% or 99% or 100% identical to any of SEQ ID NOs:1, 3, 56-96 or 102, preferably at least 90%. In other embodiments, any of the polymerase domain moieties described herein may be combined with any of the DNA binding domains described herein provided that that the Polymerase moiety and the DNA binding domain are heterologous. For example, in other embodiments, the fusion protein may have an amino acid sequence that has at least 90% or 95% or 99% or 100% identity with SEQ ID NO:1 and SEQ ID NO:2, preferably at least 90%. In other embodiments, the fusion protein may have at least 90% or 95% or 98% or 99% or 100% sequence identity to SEQ ID NO:3 preferably at least 90%. The strand-displacing polymerase may or may not have a 3′-5′ exonuclease activity. Where strand displacing polymerases have 3′-5′ exonuclease activity, polynucleotide joining may be optimized by balancing 3′-5′ exonuclease activity, 5′-3′ polymerization activity and strand displacement activity using the conditions that include those exemplified herein. The efficacy and accuracy of the assembly can be confirmed using the assay described herein (see for example, FIGS. 3A and 3B). In some embodiments, the polymerase is not Phusion, 9° N, Pfu or Vent, or a polymerase that has an amino acid sequence that is at least 90% identical to Phusion or wild type 9° N, Pfu or Vent. In some embodiments, the polymerase is thermostable, i.e., active at a temperature of at least 40° C. or at least 50° C. degrees. In contrast to strand-displacing polymerases, some polymerases such as Taq DNA polymerase, degrade an encountered downstream strand via a 5′→3′ exonuclease activity. This activity is utilized for nick translation protocols. Hence Taq DNA polymerase is not included in the definition of strand displacing polymerases.
An assay to determine efficiency and accuracy of synthon formation is described in the examples and shown in FIG. 3A-B. The designed assembled fragments encode the lacI and lacZ proteins, which yield a blue colony if DNA fragments are assembled correctly. Thus, the number of “blue” colonies from an overnight plate denotes both efficiency and accuracy of assembly. In the absence of a blue color, efficient assembly may occur but errors at the joining/extension region prevents expression. When synthons are assembled and then cloned into a host cell, efficiency and accuracy of synthon formation translates into a confidence that each clone will contain the accurately assembled synthon. With this confidence, only one or a few duplicate clones need to be sequenced to confirm the presence of a synthon. This reduces the cost and inconvenience of sequencing clones that might contain errors. In one embodiment, at least 80% or alternatively at least 90% of clones will contain accurately assembled synthons.
In some embodiments, methods utilizing the compositions described herein are capable of yields that are substantially in excess of minimum requirements. For example, as many as 5,000 or 10,000 colonies can be produced in a single transformation event. If the purpose of assembly is to create a single example of a synthon rather than a library of synthons, then lower starting amounts of nucleic acid fragments and reagents can be used even below the ranges provided herein. Examples of concentration ranges suitable for use in an assembly mixture include the following: 0.02 nM-100 nM for DNA fragment or for example 0.2 nM-10 nM DNA may be added to the reagent mixture in a reaction vessel. In one embodiment, vector DNA is included at a ratio of 1:1 with the DNA fragments although higher or lower ratios can be used. A higher concentration of ss DNA may be preferred when compared with the concentration selected for ds DNA. The reagent mixture in the reaction vessel may further include 0.0004 U/μl-0.064 U/μl of the 5′-3′ exonuclease (for example 0.0004 U/μl-0.01 U/μl); 0.5 U/μl-32 U/μl of an optional ligase (for example 1 U/μl-10 U/μl); 0.0025 U/μl-0.25 U/μl of the strand displacing polymerase (for example 0.005 U/μl-0.1 U/μl); and 0.001 μg/μl-0.1 μg/μl for the ss binding protein (for example 0.01 μg/μl-0.5 μg/μl) (units correspond with those specified by the manufacturer (New England Biolabs, Ipswich, Mass.)).
The amount of 5′-3′ exonuclease can be further optimized according to the length of overlap of nucleic acid fragments and size of each fragment. For example, amounts of 5′-3′ exonuclease may be increased within the range for nucleic acid fragments greater than 80 nucleotides in length. The absolute concentration of the strand displacing polymerase within the specified range is not critical.
A ss DNA binding protein for use in the composition may be E. coli recA, T7 gene 2.5 product, RedB (from phage lambda) or RecT (from Rac prophage), ET SSB (extreme thermostable single-stranded DNA binding protein) or a ss binding protein with 90% sequence identity to SEQ ID NO:100 although many other ss DNA binding proteins are known and could be used in the composition. The inclusion of a ss binding protein improves the efficiency of assembly particularly for nucleic acid fragments with longer overlap sequences (e.g. at least 20 nucleotides) than would be otherwise occur in the absence of ss binding protein as measured by colony number.
The optional ligase may be an NAD+ dependent ligase such as Taq ligase or an ATP dependent ligase such as T4 ligase. However, for PCR, it is convenient to use an NAD+ dependent ligase since ATP can inhibit Taq polymerase used in subsequent amplification of the synthon. Examples of a suitable ligase include a protein with at least 90% sequence identity to SEQ ID. No. 101.
The 5′-3′ exonuclease used here may be an enzyme that has a 5′-3′ exonuclease activity as well as a ss endonuclease activity (see, for example, Garforth, et al., PNAS, 96, 38-43 (1999)). Examples of a 5′-3′ exonuclease with exonuclease and ss endonuclease activity include T5 exonuclease, as well as homologs and variants thereof. In one example, the 5′-3′ exonuclease has at least 90% amino acid sequence identity SEQ ID NO: 98. There is no requirement to denature the 5′-3′ exonuclease prior to joining the polynucleotides with the strand displacing polymerase. Hence the use of a thermostable 5′-3′ exonuclease is described in the examples.
In some embodiments, the composition may further comprise dNTPs (i.e., a mixture of dGTP, dATP, dGTP and dTTP) and, in some embodiments, where T5 5′-3′ exonuclease is used, the composition may further comprise potassium salt such as KCl (e.g., at a concentration in the range of 7 mM-150 mM).
In general, a method for producing a synthon is provided. In some embodiments, the method may include incubating an embodiment of the composition described herein that comprises a strand displacing polymerase as described herein and a 5′-3′exonuclease and optionally a ligase (if the reaction is in vitro or in vivo in a cell or organism that does not contain a ligase) and may also contain a ss binding protein, with a set of polynucleotides and/or oligonucleotides in which at least one or some of the members of the set have a sequence that overlaps with one or some other members of the set, under suitable reaction conditions. In some embodiments, the polynucleotides or oligonucleotides may be ds DNA, e.g., overlapping PCR products or overlapping restriction fragments. In other embodiments, the polynucleotides may be ss DNA or RNA. In some embodiments, the set of polynucleotides may comprise ss DNA or RNA. In some embodiments, the set of polynucleotides may comprise ds polynucleotides. In some embodiments, the set of polynucleotides may comprise at least one ds polynucleotide and at least one ss polynucleotide. In some embodiments, the set of polynucleotides may comprise a sub-population of polynucleotides that have identical sequences apart from a sub-sequence that varies between members of the sub-population. In other embodiments, the set of polynucleotides may comprise ss or ds polynucleotides or polynucleotides that have overlapping regions at their ends for purposes of joining but different internal sequences that form the synthon. Thus, in one embodiment of the method of the invention, the polynucleotides in the set of polynucleotides are ds; such as wherein the ds polynucleotides are overlapping PCR products or overlapping restriction fragments or assembled from ss polynucleotides In an alternative embodiment of the method of the invention, the synthon is assembled from polynucleotides in the set of polynucleotides that are ss. In a further alternative embodiment of the method of the invention, the synthon is assembled from a set of polynucleotides that comprises a mixture of at least one ds polynucleotide and at least one ss oligonucleotide. In embodiments of the method of the invention, the synthon is assembled from a set of polynucleotides that comprise a sub-population of polynucleotides that are identical to one another except for a sub-sequence that varies between the members of the sub-population.
Embodiments of the method may be used to produce a variety of synthons, including coding sequences, vectors, guide molecules for gene engineering and expression cassettes.
Prior to assembly, the initial ds polynucleotides may be in the range of 100 bases-30 kb in length, although polynucleotides outside of this range may be used in certain cases. For example, in some embodiments, individual fragment sizes can be as much as 20 kb-30 kb or longer or as short as 30 bases-500 bases. Moreover, in some embodiments, fragments of different sizes can be joined in the assembly reaction. In one example, long polynucleotides (e.g., fragments of 5 kb-20 kb in length) are joined to short polynucleotides (e.g., fragments of 100 bases-500 bases in length). Newly assembled synthons may be sequenced, either directly using single molecule sequencing methods or after cloning or amplification.
In one embodiment, the members of the set may contain overlapping sequences having a length less than 2 kb for example, in the range of 15-200 nucleotides for example, 20-100 nucleotides.
In one embodiment, a composition is provided where the composition has a 5′-3′ exonuclease; a strand-displacing polymerase; and a buffer containing a potassium salt such as KCl in a concentration range of 7 mM-150 mM, for example, 20 mM-50 mM. A sodium salt (e.g., sodium chloride) in the range of 10 mM-100 mM such as 20 mM may also be used in addition to potassium salt. A ss binding protein may be included in the composition. In some embodiments, the composition does not contain a crowding agent such as polyethylene glycol (PEG), Ficoll, or dextran. In some embodiments, the composition does not contain a non-strand displacing polymerase. In another embodiment, polynucleotide and/or oligonucleotide fragments are included in the composition for forming a synthon.
In another embodiment of the method, a set of oligonucleotides may be joined using a composition that comprises a crowding agent such as polyethylene glycol (PEG), Ficoll, or dextran in addition to or instead of the ss binding protein and at least 7 mM potassium salt such as KCl together with a strand displacing polymerase and a 5′-3′ exonuclease in the absence of a non-strand displacing polymerase. In one embodiment the potassium salt is at a concentration of less than 150 mM for example, 20 mM-50 mM.
Also provided is a kit for polynucleotide assembly, comprising: i. a 5′-3′ exonuclease; ii. an optional ligase; iii a strand-displacing polymerase; and iv. a ss DNA binding protein. In certain embodiments, the kit may further comprise dNTPs and/or a buffering agent, for example. The components of the kit may be in separate containers (e.g. one or more different reaction tubes), or, the components of the kit may be in a single container. The components may be lyophilized or in solution or in part lyophilized and in part in solution. The components may be immobilized in part or in whole on a solid surface such as a bead or surface of a reaction chamber or may be in solution. The components may be added to target polynucleotides that may be in part or in whole, immobilized or in solution. In some embodiments, the kit may contain one or more mixtures of the components of the kit. In some embodiments, the kit does not contain a non-strand-displacing polymerase, or a crowding agent.
In one embodiment, a polymerase having at least 80%, 85%, 90% or 95% sequence identity with SEQ ID NO:1 is provided for the assembly mixture. In another embodiment, a polymerase having a binding domain having at least 80%, 85%, 90%, or 95% sequence identity with SEQ ID NO:2 is provided for the assembly mixture. In another embodiment, a polymerase having at least 80%, 85%, 90% or 95% sequence identity with SEQ ID NO:3 is provided for the assembly mixture. These compositions may be used in reaction conditions in which the polymerase is strand displacing. The compositions may be used in reaction conditions in which any 3′ exonuclease activity associated with the polymerase activity is active.
The assembly reaction may occur using ss or ds nucleic acids. Any number of fragments e.g., 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19 or 20 or more fragments can be assembled. Chemically synthesized ss polynucleotides can be assembled into ds overlapping fragments and hybridized and ligated to the ends of linearized vectors to form synthons suitable for cloning. Alternatively, duplex fragments can be assembled into synthons and inserted into vectors for cloning or PCR or isothermal amplification (see for example, FIG. 2A-2C). ss nucleic acid fragments can also be directly inserted into vectors (see for example, FIG. 7) by hybridizing the nucleic acid fragment to the 3′ ss end of a linearized ds vector. The ss nucleic acids may be assembled through overlapping complementary ends at the same time, before, or after the a ss nucleic acid fragment has hybridized to the 3′ ss end of the linearized vector. Assembled fragments may be amplified by PCR or isothermal methods before insertion into vectors for cloning. The nucleic acid fragments may contain randomized nucleotide sequences or degenerate code enabling libraries to be formed that contain representative variants at each nucleotide position of the variable region. The random sequence may be positioned between a defined sequence at each end. In one embodiment, the random sequence positioned between defined sequences may be for hybridizing to a second nucleic acid fragment (such as a second ss genomic polynucleotide) or to a linearized vector end. In one example, the random sequence hybridizes to a target genomic sequence for guiding a Cas9 protein to a target nucleic acid for gene editing (see for example, FIG. 9A-9C). Thus, in accordance with this aspect of the invention, the method may be used to hybridize at least one member of a set of polynucleotides to a second nucleic acid fragment (such as a second ss genomic polynucleotide) or to a linearized vector end. For example, the method may be for hybridization of the at least one member of the set of polynucleotides to a target genomic sequence in order to guide a Cas endonuclease such as Cas9 to a target genomic nucleic acid in a method of gene editing.
In some embodiments, a method is provided for assembling a plurality of polynucleotides into a synthon, that includes: combining the plurality of polynucleotides with a composition comprising a 5′-3′ exonuclease, a strand displacing polymerase, optionally a ligase, a ss binding protein and a buffer wherein each polynucleotide has a 3′ ss terminal polynucleotide sequence on one strand that can be hybridized to a complementary ss complementary sequence on a second polynucleotide and can be joined to form a continuous duplex polynucleotide optionally under isothermal conditions in a single container. The synthon can further be joined at its ends to the ends of a linearized plasmid for amplification and/or cloning
In some embodiments, the entire assembly method may be carried out as a “one-step” reaction (in a single tube, which does not have to be opened during after the reaction is started). In one example, the components are mixed together in a reaction vessel and incubated at a temperature of between 40° C. to 60° C. for a period of time, e.g., 5 minutes to 12 hours, thereby producing the synthon.
In one aspect, the method includes a step of strand displacement in the polynucleotides to be joined by a polymerase having at least 90% amino acid sequence identity with SEQ ID NO:1 or SEQ ID NO:102 and/or SEQ ID NO:2 or SEQ ID NO:3. In embodiments of the method, no additional steps of 3′-5′ exonuclease chew back are required. Another aspect further comprises enhancing the efficiency of the assembly reaction by including a potassium salt at a minimum concentration of 7 mM in the reaction mixture where the potassium salt is exemplified by KCl.
In one aspect, a method is provided, wherein the polynucleotides contain a random sequence between defined sequence ends. In another aspect, the method further comprises screening the random sequences for hybridizing activity with a genomic DNA and identifying the random sequence with the hybridizing activity. In another aspect, the method comprises performing gene editing by transcribing the random sequences with hybridizing activity to form RNA and using the RNA for gene editing in the presence of a Cas endonuclease.
In one embodiment of the composition, kit, or method of the invention, the strand-displacing polymerase used in the composition, kit, or method of the invention may be non-naturally occurring, such as a mutant or fusion protein. In the composition, kit, or method of the invention, the non-natural strand-displacing fusion polymerase may be characterized by an amino acid composition of the polymerase moiety that is at least 90% or 95% or 99% or 100% identical to any of SEQ ID NOs: 33-55 or SEQ ID NO:1 or of the DNA binding moiety that is at least 90% or 95% or 99% or 100% identical to any of SEQ ID NOs: 56-98 or SEQ ID NO:2. In one embodiment, the polymerase moiety may have an amino acid sequence that has 90% or 95% or 98% or 99% amino acid sequence identity with SEQ ID NO:102 fused to a heterologous DNA binding moiety selected from a polypeptide that has at least 90% or 95% or 99% or 100% amino acid sequence identity to any of SEQ ID NOs: 56-98.
In general in one aspect, a preparation is provided that includes a composition having an amino acid sequence that has at least 90% sequence identity to SEQ ID NO:3. The preparation may further comprise a 5′-3′ exonuclease, for example a T5 exonuclease. The preparation may further comprise a ss DNA binding protein, for example, an ET SSB, E. coli recA, T7 gene 2.5 product, phage lambda RedB or Rac prophage RecT, more particularly a thermostable ss binding protein such as ET SSB. The preparation may further comprise a ligase. In one aspect, a preparation including the composition may further comprise a ss binding domain and a 5-3′ exonuclease, wherein the preparation does not comprise a crowding agent and/or a non-strand-displacing polymerase. The preparation may further include a potassium salt.
In one aspect, the preparation including the composition may further comprise a plurality of polynucleotides in a set wherein at least a polynucleotide in the set has a sequence that overlaps with another polynucleotide in the set; and wherein the polynucleotides are selected from: (i) ds polynucleotides; (ii) ss oligonucleotides; (iii) at least one ds polynucleotide and at least one ss oligonucleotide; and (iv) a subpopulation of polynucleotides that are otherwise identical to one another except for a sequence that varies between the members of the sub-population. In one aspect the set of polynucleotides has at least 3 members or at least 4 members or at least 5 members.
In general, a method for producing a synthon, that includes: incubating a composition of claim 1 further comprising a 5′-3′ exonuclease and, optionally, a ligase and a ss DNA binding protein, with a plurality of polynucleotides that form a set, wherein members of the set have sequences that overlap under suitable reaction conditions; and joining at least two the polynucleotides to produce a synthon. In one aspect, the set of polynucleotides contains at least 3 members or at least 4 members or at least 5 members. In one aspect, the preparation further includes a ligase. In one aspect, the preparation, further includes a ss DNA binding protein. In one aspect, the polynucleotides are ds and the ds polynucleotides are overlapping PCR products, overlapping restriction fragments or assembled from ss oligonucleotides. In one aspect, the polynucleotides are ss oligonucleotides. In one aspect, the set of polynucleotides comprises at least one ds polynucleotide and at least one ss oligonucleotide.
In general, a kit is provided that includes a preparation according to claim 1 and a 5′-3′ exonuclease such as for example T5 exonuclease. In one aspect, the kit may further include a ss binding protein. In another aspect, the kit may include a ligase. In another aspect, the kit may include a buffering agent. In one aspect, the kit does not include a crowding agent. In one aspect, the composition and the 5′-3′ exonuclease are in the same vessel. In another aspect, the composition and the 5′-3′ exonuclease are in different vessels optionally in buffers suitable for combining into a single vessel.
In general, a composition is provided for assembling a synthon, that includes: a 5′-3′ exonuclease, which in one aspect has ss endonuclease activity, for example having 90% sequence identity with SEQ ID NO:98; a strand-displacing polymerase, including a Family B strand displacing polymerase that is preferably non-naturally occurring such as a mutant or a fusion protein derived from a naturally occurring polymerase that may additionally be thermostable; optionally a ss DNA binding protein, such as for example the ss DNA binding protein is ET SSB, E. coli recA, T7 gene 2.5 product, phage lambda RedB or Rac prophage RecT; and a non-naturally occurring buffering agent, wherein the composition does not comprise a crowding agent and/or a non strand-displacing polymerase. In one aspect, the composition further includes a ligase and/or a ss binding domain. In one aspect, the composition includes a set of at least two polynucleotides (a plurality of polynucleotides). In one aspect, the composition does not include a non-strand displacing polymerase. In another aspect, the composition does not include 9° N, Phusion, Vent or Pfu DNA polymerases.
In one aspect, the strand-displacing polymerase in the composition is a fusion protein wherein the polymerase moiety has an amino acid sequence that is at least 90% identical to SEQ ID NO:1 or SEQ ID NO:102, or any of SEQ ID NOs:33-55. For example, the fusion protein may have an amino acid sequence that is at least 90% identical to SEQ ID NO:1 or 102 and SEQ ID NO:2. For example, the strand-displacing polymerase may have at least 90% sequence identity to SEQ ID NO:3. In one aspect, the composition may include a potassium salt having a concentration of at least 7 mM. In one aspect, the composition may include a set of polynucleotides in which at least one polynucleotide in the set has a sequence that overlaps with another polynucleotide in the set; and wherein the polynucleotides are selected from: (i) ds polynucleotides; (ii) ss oligonucleotides; (iii) at least one ds polynucleotide and at least one ss oligonucleotide; and (iv) a subpopulation of polynucleotides that are otherwise identical to one another except for a sequence that varies between the members of the sub-population. In one aspect, at least one member of the set of polynucleotides contains a random sequence positioned between a defined sequence at each end for hybridizing to a second ss genomic polynucleotide where for example, the random sequence is ss and is capable of hybridizing to a target genomic sequence for guiding a Cas protein to a target genomic nucleic acid for gene editing.
In general, a method for forming a synthon, is provided that includes incubating any of the compositions described above that contain a set of polynucleotides having sequences that overlap under suitable reaction conditions; and joining at least some of the polynucleotides to other polynucleotides to produce a synthon. In one aspect of the method, all or a portion of the polynucleotides in the set are ds. In another aspect, the ds polynucleotides are overlapping PCR products; overlapping restriction fragments, or synthetic ds molecules assembled from complementary ss oligonucleotides where these oligonucleotides may have been made in a synthesizer. In one aspect, all or a portion of the polynucleotides in the set are ss oligonucleotides. In one aspect, the set of polynucleotides comprises at least one ds polynucleotide and at least one ss oligonucleotide. In one aspect, the set of polynucleotides comprises a subpopulation of polynucleotides that are otherwise identical to one another except for a sequence that varies between the members of the sub-population. In one aspect, the overlapping sequences of the polynucleotides are less than 2 kilobases in length. In one aspect of the method, the strand-displacing polymerase comprises an amino acid sequence that is at least 90% identical to any of SEQ ID NOs:1, 2, 3, 33-96, or 102. In one aspect of the method, at least one member of the set of polynucleotides contains a random sequence between defined sequence ends. Another aspect of the method includes screening the random sequences for hybridizing activity with a genomic DNA and identifying the random sequence with the hybridizing activity. Another aspect of the method includes performing gene editing by transcribing the random sequences with hybridizing activity to form RNA and using the RNA for gene editing in the presence of a Cas protein.
In general, a kit for polynucleotide assembly is provided that includes: a 5′-3′ exonuclease; a strand-displacing polymerase; and optionally a ss DNA binding protein wherein the kit optionally does not comprise a crowding agent and/or a non-strand-displacing polymerase. In one aspect, the kit includes a ligase. In another aspect, the kit includes dNTPs. In another aspect, the kit includes a buffering agent. In another aspect, the individual components of the kit may be in the same or separate containers such as one or more different storage or reaction containers.
In general, a composition is provided that includes a polymerase fusion protein, wherein the polymerase fusion protein includes an amino acid sequence that is at least 90% identical to any of SEQ ID NOs:2, 56-96 and a heterologous polymerase domain. In one aspect, the polymerase fusion protein includes an amino acid sequence that is at least 90% identical to any of SEQ ID NO:2; and a heterologous polymerase domain.
In general, a composition is provided that includes a polymerase fusion protein is provided wherein the polymerase fusion protein includes a polymerase domain that has an amino acid sequence that is at least 90% identical to any of SEQ ID NOs:1, 33-55, or 102; and a heterologous DNA binding domain. In one aspect, the polymerase fusion protein, the polymerase domain that has an amino acid sequence that is at least 90% identical to SEQ ID NO:1; and a heterologous DNA binding domain. In one aspect, the polymerase fusion protein has a polymerase domain that has an amino acid sequence that is at least 90% identical to SEQ ID NO:102; and a heterologous DNA binding domain. In one aspect, the polymerase fusion protein has an amino acid sequence that is at least 90% identical to SEQ ID NO:3.
In one aspect, the compositions above further include a 5′-3′ exonuclease such as T5 exonuclease. In one aspect, the composition further includes a single-strand DNA binding protein for example a single-strand binding protein selected from an ET SSB, E. coli recA, T7 gene 2.5 product, phage lambda RedB or Rac prophage RecT. In one aspect, the composition may include a ligase. In one aspect, the ligase is thermostable. In one aspect, the composition does not include a crowding agent and/or a non-strand-displacing polymerase. In another aspect, the composition further includes dNTPs. In another aspect, the composition further includes a potassium salt having a concentration of at least 7 mM. One aspect of the composition includes a set of polynucleotides wherein at least a polynucleotide in the set has a sequence that overlaps with another polynucleotide in the set; and wherein the polynucleotides are selected from: (i) ds polynucleotides; (ii) ss oligonucleotides; (iii) at least one ds polynucleotide and at least one ss oligonucleotide; and (iv) a subpopulation of polynucleotides that are otherwise identical to one another except for a sequence that varies between the members of the sub-population.
In general, a method is provided for producing a synthon, that includes incubating a set of polynucleotides where individual polynucleotides contain sequences that overlap with sequences in other polynucleotides, where the overlapping sequences of different polynucleotides are capable of cross-hybridizing under suitable reaction conditions, and where for example the overlapping region is less than 2 kilobases, with a composition comprising a polymerase characterized above, wherein the composition further includes a 5′-3′ exonuclease and, optionally, a ligase and a ss DNA binding protein; and joining the polynucleotides to produce a synthon.
In different aspects, the composition includes a ligase; and/or a ss DNA binding protein. In another aspect, one or more polynucleotides in the set are ds, where the ds polynucleotides are PCR products, overlapping restriction fragments or assembled from ss oligonucleotides and/or one or more polynucleotides are ss oligonucleotides; and/or the set of polynucleotides includes at least one ds polynucleotide and at least one ss oligonucleotide.
In general, a kit for polynucleotide assembly is provided that includes a polymerase fusion protein, as described above and a 5′-3′ exonuclease; and a ss DNA binding protein. In one aspect, the kit may include any or all of a ligase, dNTPs, and buffering agent where the components of the kit may be in the same vessel or in different vessels.
The skilled artisan will understand that the drawings, described below, are for illustration purposes only. The drawings are not intended to limit the scope of the present teachings in any way.
FIG. 1A-1E shows how the assay described in Example 1 differentiates between a strand displacing and non-strand displacing polymerase. This assay confirms that T4 DNA polymerase is non-strand displacing and terminates synthesis of a template DNA at 44 nucleotides in length at a blocking oligonucleotide (2) (FIG. 1C) whereas Bst polymerase (FIG. 1D) and a non-natural polymerase (FIG. 1E) are strand displacing and can continue DNA synthesis of a FAM primer (1) by displacing the blocking oligonucleotide (27 nucleotides in length).
FIG. 1A shows the sequence and position of the primer (1) and a blocking oligonucleotide (2) on a DNA template used in the assay for the enzymes below.
FIG. 1B shows fluorescence observed in samples obtained after capillary electrophoresis where no enzyme was added and the starting material formed a peak at a position corresponding to 24 nucleotides of the FAM primer.
FIG. 1C shows the result of adding T4 DNA polymerase. The primer was extended to a final length of 44 nucleotides (24 nucleotides plus 20 nucleotides) but was terminated by the blocking oligonucleotide.
FIG. 1D shows that Bst DNA polymerase (large fragment) strand-displaces the blocking oligonucleotide and copies template by extending the primer to a total length of 72 nucleotides (24+20+27+dA).
FIG. 1E shows a family B strand displacing DNA polymerase which is a proof reading polymerase that strand displaces blocking oligonucleotides and copies template by extending the primer by 71 nucleotides (24+20+27).
FIG. 2A-2C show the steps in a DNA assembly method.
FIG. 2A shows the incorporation of the amplicons of each of 5 fragments into 5 plasmids with ampicillin resistance markers. The 5 fragments were initially amplified with primers that generated amplicons which had overlapping regions as well as flanked by NotI restriction sites. The NotI cleavage produces sticky ends. NotI restriction (3) permitted release of each amplicon from the vectors. The restriction enzyme cleaved fragments have an 80 base pair overlap region (4) with the adjacent fragment. In FIG. 2C, the overlap between the first fragment and an adjacent reagent vector end and a last fragment and adjacent reagent vector end is 15-25 nucleotides, for example, 20 nucleotides, for convenience and cost reduction but this is not intended to be limiting.
FIG. 2B shows NotI cleaved optionally sequenced fragments (5) (amplicon retrieved from a vector) which were then treated with an enzyme mixture that included T5/5′-3′ exonuclease, DNA polymerase with 3′-5′ exonuclease activity, a ss binding protein ET SSB (New England Biolabs, Ipswich, Mass.) and DNA ligase in a single reaction vessel (6)-(8). Although NotI is used here, other restriction endonucleases may be used for cleavage depending on convenience. Double digestion with two or more restriction endonucleases may be used. For example, double digestion of vector DNA with two restriction endonucleases has been found to reduce background from uncut vector. The overlapping ss DNA sequences hybridized to adjacent fragments. The T5 exonuclease chewed back a DNA strand from 5′ to 3′ on each fragment to expose a 3′ ss region (6) which allowed the fragments to anneal together in the presence of ss binding protein (7). Removal of the 2 base flap was achieved by means of the 3′-5′ exonuclease activity associated with a strand displacing polymerase followed by extension by the strand displacing polymerase to fill the gap in the assembled product (8). Any residual nick or 5′ flap may be repaired by a ligase and/or T5 exonuclease.
FIG. 2C shows the 5 fragments (Frag 1-Frag 5) now joined in sequence and inserted into a second plasmid carrying chloramphenicol resistance gene (Cam) for transformation into a bacterial host.
FIGS. 3A and 3B show chloramphenicol plates were used to select colonies for growth on plates and those colonies that contained the lacIZ gene generated blue colonies in the presence of IPTG and X-Gal. The assay provides a quantitative assessment of clones in which genes are assembled efficiently and in a functional form.
FIG. 3A shows chloramphenicol only.
FIG. 3B shows chloramphenicol+IPTG+Xgal.
FIG. 4 shows that the plasmids did in fact contain the entire gene. Amplification by PCR of assembly product shown in FIG. 2B was performed to confirm all fragments were joined and ligated prior transformation. Lane 1 and 2 are duplicate PCR results. Lane M is 2-log DNA ladder from New England Biolabs, Ipswich, Mass.
FIG. 5 shows the effect of KCl in the assembly mix as determined by the number of colonies. The increase in accuracy/efficiency of assembly using a strand displacing polymerase in an assembly mix is demonstrated using an increased concentration of KCl in the buffer. The histogram on the left (T26) does not contain KCl whereas the histogram on the right (T26K) contains 25 mM KCl showing a 1.5 fold enhancement of efficiency. This improvement occurs regardless of the assembly condition. A similar relative enhancement of efficiency is expected if PEG or other crowding agent were used in the absence of ss binding protein.
FIG. 6 shows a comparison between the mixture described in Example 2 (Strand displacing polymerase/ss binding protein/5′-3′ exonuclease/ligase)(Mix1) and the commercial Gibson Assembly® Mix (GAMM) (non-strand displacing polymerase and polyethylene glycol) (Synthetic Genomics, La Jolla, Calif./New England Biolabs, Ipswich, Mass.) following the protocol provided by the manufacturer. Mix 1 results in significantly higher efficiencies of DNA assembly and transformation.
FIG. 7 shows a general diagram of DNA assembly between ss DNA oligonucleotides and ds DNA fragments. ss target DNA oligonucleotide is inserted into a DNA vector. The ss target DNA oligonucleotide has been synthesized so as to have an overlapping region of 20-30 nucleotides on each end with the 3′ vector ends. However, the size of the oligonucleotide may have an overlapping region of less than 20 nucleotides for example less than 15 nucleotides or less than 10 nucleotides or alternatively more than 30 nucleotides, for example, at least 40 or 50 or 60 nucleotides or more. Beyond the overlapping regions, the oligonucleotide preferably has 1 or more nucleotides that are not overlapping positioned between the ends. The assembly master mix which contains a 5′-3′ exonuclease, strand displacing polymerase, ligase and ss binding protein is added to the mixture of ss oligonucleotide and the vectors so as to permit the 5′end of the ds DNA vector to be chewed back so as to produce ss overhangs (9). The 3′ end of the ss DNA is then able to anneal to a 5′ end of the vector and the DNA polymerase then replicates the ss template to fill the gap and produce a blunt ended ds DNA. The nick is sealed by ligase (10). Again, the exonuclease (here T5 exonuclease) chews back the 5′ end this time on the blunt end of the target DNA producing 3′ ss regions so as to permit annealing of the complementary sequences and completion of the ds integration of target DNA into the DNA vector (11). Fragments can anneal with DNA polymerase filling the gap and ligase sealing the nick. (12) to produce a synthon.
FIG. 8A-8C shows the workflow for bridging ds DNA by a short ss oligonucleotide. (The protocol is described in FIG. 7).
FIG. 8A provides an example of a sequence of a short ss oligonucleotide for integration into a ds DNA vector shown here as a CRISPR Nuclease Vector with OFP Reporter
FIG. 8B shows the workflow starting with a ss oligonucleotide and a ds CRISPR Nuclease Vector (9424 bp) treated with 5′-3′ exonuclease, strand displacing polymerase, a ligase and a ss binding protein (13) to produce a complete ds circular DNA. This DNA was transformed into competent cells (14). After an overnight incubation, the colonies were analyzed by a mini-prep and then the plasmids sequenced (15). FIG. 8C shows the sequence of the insert and adjacent sequences U6 promoter sequence (vector) sequence of designed ss oligonucleotide (71mer) and scaffold template-specific sequence (vector). The ss oligonucleotide (71mer) including an overlap region of 25 nucleotides at each end (21 nucleotides of the target DNA in bold)) was properly integrated into the vector in host cells.
FIG. 9A-9C show that a similar workflow to that in FIG. 8 can be used for an ss oligonucleotide having degenerate bases between the overlapping ends. Again the starting sequence in FIG. 9A is shown above the workflow (FIG. 9B) and the Sanger-sequencing results from colonies from assembly pool is shown below (FIG. 9C) with the solid line referring to a pool of sgRNA targeting sequences. The sgRNA targeting sequence contained 21 variable nucleotide positions providing 421 variants. The pool contained every possible variant and each variant was amenable to cloning reflecting the degeneracy of the sequence between the overlapping ends and the vector. FIG. 9A shows the sequence of a ss oligonucleotide containing degenerate bases. The sgRNA targeting sequence of FIG. 9A was inserted between a U6 promoter sequence and a scaffold template specific sequence of the vector (16), transformed into host cells (17) and analyzed for synthons by miniprep and sequencing (18) as described above and herein. Sanger sequencing was performed on clones from the assembly pool. An example of a sequence is provided in FIG. 9C
FIG. 10 presents the results of 187 colonies selected from a plate after the assembly reaction products were transformed into E. coli. Each colony was PCR amplified and sequenced to confirm the insertion of the ss DNA and the distribution of degenerate bases were analyzed. The results shown here confirmed that indeed different colonies contained different degenerate sequences. No bias was detected. Analysis was carried out by first converting the sequences into a fastq file and then using the fastx_quality_stats tool from the fastx toolkit on github. The sequence logo was created using weblogo from Berkeley.
Unless defined otherwise, all technical and scientific terms used herein have the same meaning as commonly understood by one of ordinary skill in the art to which this invention belongs. Singleton, et al., DICTIONARY OF MICROBIOLOGY AND MOLECULAR BIOLOGY, 2D ED., John Wiley and Sons, New York (1994), and Hale & Markham, THE HARPER COLLINS DICTIONARY OF BIOLOGY, Harper Perennial, N.Y. (1991) provide one of skill with the general meaning of many of the terms used herein. Still, certain terms are defined below for the sake of clarity and ease of reference.
As used herein, the term “synthon” as used in the field of gene synthesis refers to a polynucleotide assembly. Polynucleotide assembly may include assembling overlapping fragments of a size that can be prepared on an oligonucleotide synthesizer which at the present time is generally 2000-3000 bases for each synthetic polynucleic acid. Alternatively, overlapping fragments may be obtained by PCR from naturally occurring nucleic acid to which adaptors have been attached to provide the overlapping sequences. For assembly purposes there is no limitation on the size of each fragment. Many fragments can be assembled end to end relying on overlapping sequences at the ends to enable constructs of any desirable length to be made accurately and efficiently. Preferably a synthon is a continuous longer polynucleotide that does not contain gaps or nicks that are formed from the assembly of shorter polynucleotides. The length of synthons resulting from assembly of nucleic acid fragments is not limited to any particular size however.
As used herein, the term “5′-3′ exonuclease”, refers to an exonuclease that degrades DNA from the 5′ end, i.e., in the 5′ to 3′ direction. 5′-3′ exonucleases of interest can remove nucleotides from the 5′ end of a strand of ds DNA at a blunt end and, in certain embodiments, at a 3′ and or 5′ overhang. T5 exonuclease, lambda exonuclease and T7 exonuclease are examples of 5′-3′ exonucleases. In certain embodiments, T5 exonuclease is preferred. T5 exonuclease additionally has a ss endonuclease activity.
As used herein, the term “ligase”, refers to an enzyme that can covalently join a 3′ end of a DNA molecule to a 5′ end of another DNA molecule, particularly at a nick. Examples of ligases include T7 ligase, T4 DNA ligase, E. coli DNA ligase and Taq ligase, although many others are known and may be used herein.
As used herein, the term “strand-displacing polymerase”, refers to a polymerase that is able to displace one or more nucleotides, such as at least 10 or 100 or more nucleotides that are downstream from the enzyme. Strand displacing polymerases can be differentiated from Phusion where the art recognized definition of Phusion is a non-strand displacing polymerase. In some embodiments, the strand displacing polymerase is stable and active at a temperature of at least 50° C. or at least 55° C. (including the strand displacing activity). Taq polymerase is a nick translating polymerase and, as such, is not a strand displacing polymerase.
As used herein, the term “single strand (ss) DNA binding protein”, refers to proteins that bind to ss DNA and prevent premature annealing, protect the ss DNA from being digested by nucleases, and polymerases and/or remove secondary structure from the DNA to allow other enzymes to function effectively upon it. Inclusion of a ss binding protein in the compositions described herein is preferable to optimize the efficiency of synthon formation. Examples of ss DNA binding proteins are T4 gene 32 protein, E. coli SSB, T7 gp2.5 SSB, and phage phi29 SSB, and ET SSB although many others, e.g., RedB of lambda phage, RecT of Rac prophage and the sequences listed below, are known and may be used herein. A thermostable ss DNA binding protein that is stable at 50° C. may be used in some cases. Thus, in one embodiment of the composition, kit, or method of the invention, the ss DNA binding protein is T4 gene 32 protein, E. coli SSB, T7 gp2.5 SSB, phage phi29 SSB, ET SSB, RedB of lambda phage, or RecT of Rac prophage. In one embodiment, the ss DNA binding protein is ET SSB. In one embodiment of the composition, kit, or method of the invention, the ss DNA binding protein is thermostable (i.e. stable at 40° C.-60° C.).
As used herein, the term “buffering agent”, refers to an agent that allows a solution to resist changes in pH when acid or alkali is added to the solution. Examples of suitable non-naturally occurring buffering agents that may be used in the compositions, kits, and methods of the invention include, for example, Tris, HEPES, TAPS, MOPS, tricine, or MES.
The term “non-naturally occurring” refers to a composition that does not exist in nature.
Any protein described herein may be non-naturally occurring, where the term “non-naturally occurring” refers to a protein that has an amino acid sequence and/or a post-translational modification pattern that is different to the protein in its natural state. For example, a non-naturally occurring protein may have one or more amino acid substitutions, deletions or insertions at the N-terminus, the C-terminus and/or between the N- and C-termini of the protein. A “non-naturally occurring” protein may have an amino acid sequence that is different to a naturally occurring amino acid sequence (i.e., having less than 100% sequence identity to the amino acid sequence of a naturally occurring protein) but that that is at least 80%, at least 85%, at least 90%, at least 95%, at least 97%, at least 98% or at least 99% identical to the naturally occurring amino acid sequence. In certain cases, a non-naturally occurring protein may contain an N-terminal methionine or may lack one or more post-translational modifications (e.g., glycosylation, phosphorylation, etc.) if it is produced by a different (e.g., bacterial) cell. A “mutant” protein may have one or more amino acid substitutions relative to a wild-type protein and may include a “fusion” protein. The term “fusion protein” refers to a protein composed of a plurality of polypeptide components that are unjoined in their native state. Fusion proteins may be a combination of two, three or even four or more different proteins. The term polypeptide includes fusion proteins, including, but not limited to, a fusion of two or more heterologous amino acid sequences, a fusion of a polypeptide with: a heterologous targeting sequence, a linker, an immunologically tag, a detectable fusion partner, such as a fluorescent protein, β-galactosidase, luciferase, etc., and the like. A fusion protein may have one or more heterologous domains added to the N-terminus, C-terminus, and or the middle portion of the protein. If two parts of a fusion protein are “heterologous”, they are not part of the same protein in its natural state.
In the context of a nucleic acid, the term “non-naturally occurring” refers to a nucleic acid that contains: a) a sequence of nucleotides that is different to a nucleic acid in its natural state (i.e. having less than 100% sequence identity to a naturally occurring nucleic acid sequence), b) one or more non-naturally occurring nucleotide monomers (which may result in a non-natural backbone or sugar that is not G, A, T or C) and/or c) may contain one or more other modifications (e.g., an added label or other moiety) to the 5′-end, the 3′ end, and/or between the 5′- and 3′-ends of the nucleic acid.
In the context of a preparation, the term “non-naturally occurring” refers to: a) a combination of components that are not combined by nature, e.g., because they are at different locations, in different cells or different cell compartments; b) a combination of components that have relative concentrations that are not found in nature; c) a combination that lacks something that is usually associated with one of the components in nature; d) a combination that is in a form that is not found in nature, e.g., dried, freeze dried, crystalline, aqueous; and/or e) a combination that contains a component that is not found in nature. For example, a preparation may contain a “non-naturally occurring” buffering agent (e.g., Tris, HEPES, TAPS, MOPS, tricine or MES), a detergent, a dye, a reaction enhancer or inhibitor, an oxidizing agent, a reducing agent, a solvent or a preservative that is not found in nature.
It may be desirable to use a strand displacing polymerase that has 3′ exonuclease activity. While not wishing to be limited by theory, the 3′ exonuclease activity is desirable to remove a flap sequence on the 3′ end of a duplex where the flap sequence may be the result of enzyme cleavage to extract the target polynucleotide from the plasmid in which it is placed. This is the case when NotI is used as described in the examples. However, if a restriction endonuclease is used that creates a blunt end on the excised fragment, 3′exonuclease activity may not be required.
The 3′ exonuclease activity can be routinely determined by using a standard DNA template and primers where the primers either have or do not have non-hybridized 3′ nucleotides. If the polymerase has 3′ exonuclease activity, an amplicon will be detected using either primer pair. If the polymerase lacks the 3′ exonuclease activity, no amplicon will be detected using those primers having a non-hybridized 3′ nucleotide.
As used herein, the term “potassium salt”, refers to a salt of potassium including, but not limited to, KCl. The term “sodium salt”, refers to a salt of sodium including, but not limited to, NaCl.
As used herein, the term “polynucleotide” encompasses oligonucleotides and refers to a nucleic acid of any length. Polynucleotides may be DNA or RNA. Polynucleotides may be ss or ds unless specified. Polynucleotides may be synthetic, for example, synthesized in a DNA synthesizer, or naturally occurring, for example, extracted from a natural source, or derived from cloned or amplified material. Polynucleotides referred to herein may contain modified bases.
As used herein, the term “set of polynucleotides”, refers to a collection of at least 2 polynucleotides. In some embodiments, a set of polynucleotides may comprise at least 5, at least 10, at least 12 or at least 15 or more polynucleotides.
As used herein, the term “overlapping sequence”, refers to a sequence that is complementary in two polynucleotides and where the overlapping sequence is ss, on one polynucleotide it can be hybridized to another overlapping complementary ss region on another polynucleotide. By way of example, the overlapping sequence may be complementary in at least 5, 10, 15, or more polynucleotides in a set of polynucleotides. An overlapping sequence may be at or close to (e.g., within about 5, 10, 20 nucleotides of) the 3′ ends of two distinct molecules (e.g., the 3′ ends of two ss oligonucleotides, or the 3′ end of the top strand of first ds polynucleotide and the 3′ end of the bottom strand of a second ds molecule), where, if the non-overlapping sequence is at the 3′ ends then the non-overlapping sequence may be removed using a 3′-5′ exonuclease activity of a polymerase. An overlapping sequence may vary in length and, in some cases, may be at least 12 nucleotides in length (e.g. at least 15, 20 or more nucleotides in length) and/or may be up 100 nucleotides in length (e.g., up to 50, up to 30, up to 20 or up to 15 nucleotides in length). Alternatively, overlapping sequences in the set of polynucleotides may be 2 kb or less, or 1 kb or less or less than 900 bases, 800 bases, 700 bases, 600 bases, 500 bases, 400 bases, 300 bases, 200 bases or 100 bases. Preferably the overlapping sequence length is in the range of 15 nucleotides-80 nucleotides for example up to 20, up to 25, up to 30, up to 35, up to 40, up to 45, up to 50, up to 55, up to 60, up to 65, up to 70, up to 75, or up to 80 nucleotides. The minimum length of the overlap may be defined by a Tm that is preferably equal to or greater than 48° C.
As used herein, the term “polynucleotide assembly”, refers to a reaction in which two or more, four or more, six or more, eight or more, ten or more, 12 or more 15 or more polynucleotides, e.g., four or more polynucleotides are joined to another to make a longer polynucleotide. The product of a polynucleotide assembly reaction, i.e., the “assembled polynucleotide” or “synthon” in many embodiments should contain one copy of each of the overlapping sequences.
As used herein, the term “incubating under suitable reaction conditions”, refers to maintaining a reaction a suitable temperature and time to achieve the desired results, i.e., polynucleotide assembly. Reaction conditions suitable for the enzymes and reagents used in the present method are known (e.g. as described in the Examples herein) and, as such, suitable reaction conditions for the present method can be readily determined. These reactions conditions may change depending on the enzymes used (e.g., depending on their optimum temperatures, etc.).
As used herein, the term “isothermal” refers to temperature conditions that do not require active modulation of temperature for assembly to occur. Insignificant variations in the temperature of a water bath or heating block are within the scope of the meaning of the term isothermal. By way of example, the term “isothermal”, may refer to reaction conditions that do not require a heat denaturation step after the reaction has started. More specifically, isothermal methods do not involve thermocycling, i.e., cycling between a denaturation temperature of above 90° C. and an annealing/extension temperature. Isothermal conditions usually involve incubation at a temperature that is below 90° C. for a period of time (e.g., 5 minutes to 12 hours or more). In one embodiment, isothermal amplification reactions were performed at a temperature in the range of 30° C.-75° C., for example, 40° C.-60° C.
As used herein, the term “joining”, refers to the production of covalent linkage between two sequences.
As used herein, the term “composition” refers to a combination of reagents that may contain other reagents, e.g., glycerol, salt, dNTPs, etc., in addition to those listed. A composition may be in any form, e.g., aqueous or lyophilized, and may be at any state (e.g., frozen or in liquid form).
As used herein a “vector” is a suitable DNA into which a fragment or a synthon may be integrated such that the engineered vector can be replicated in a host cell. A linearized vector may be created restriction endonuclease digestion of a circular vector or by PCR. The concentration of fragments and/or linearized vectors can be determined by gel electrophoresis or other means.
Any one or more of the proteins (e.g., the ligase, SSBP, 5′-3′ exonuclease or polymerase, etc.) used herein may be temperature sensitive or thermostable where, as used herein, the term “temperature sensitive” refers to an enzyme that loses at least 95% of its activity after 10 minutes at a temperature of 65° C., and the term “thermostable” refers to an enzyme that retains at least 95% of its activity after 10 minutes at a temperature of 65° C.
Before various embodiments are described in greater detail, it is to be understood that the teachings of this disclosure are not limited to the particular embodiments described, and as such can, of course, vary. It is also to be understood that the terminology used herein is for the purpose of describing particular embodiments only, and is not intended to be limiting, since the scope of the present teachings will be limited only by the appended claims.
While the present teachings are described in conjunction with various embodiments, it is not intended that the present teachings be limited to such embodiments. On the contrary, the present teachings encompass various alternatives, modifications, and equivalents, as will be appreciated by those of skill in the art.
Where a range of values is provided, it is understood that each intervening value, to the tenth of the unit of the lower limit unless the context clearly dictates otherwise, between the upper and lower limit of that range and any other stated or intervening value in that stated range is encompassed within the present disclosure.
Although any methods and materials similar or equivalent to those described herein can also be used in the practice or testing of the present teachings, the some exemplary methods and materials are now described.
The citation of any publication is for its disclosure prior to the filing date and should not be construed as an admission that the present claims are not entitled to antedate such publication by virtue of prior invention. Further, the dates of publication provided can be different from the actual publication dates which can need to be independently confirmed.
It must be noted that as used herein and in the appended claims, the singular forms “a”, “an”, and “the” include plural referents unless the context clearly dictates otherwise. It is further noted that the claims can be drafted to exclude any optional element. As such, this statement is intended to serve as antecedent basis for use of such exclusive terminology as “solely,” “only” and the like in connection with the recitation of claim elements, or use of a “negative” limitation.
As will be apparent to those of skill in the art upon reading this disclosure, each of the individual embodiments described and illustrated herein has discrete components and features which can be readily separated from or combined with the features of any of the other several embodiments without departing from the scope or spirit of the present teachings. Any recited method can be carried out in the order of events recited or in any other order which is logically possible.
The sequences that overlap in the set of polynucleotides may be of any suitable length such as 2 kb or less, or 1 kb or less or less than 900 bases, 800 bases, 700 bases, 600 bases, 500 bases, 400 bases, 300 bases, 200 bases or 100 bases. The overlapping region may be as few as 8 nucleotides. Preferably the overlapping sequence length is in the range of 15 nucleotides-80 nucleotides for example up to 20, up to 25, up to 30, up to 35, up to 40, up to 45, up to 50, up to 55, up to 60, up to 65, up to 70, up to 75, or up to 80 nucleotides. For example, the minimum length of the overlap may be defined by a Tm that is preferably equal to or greater than 48° C.
Synthetic oligonucleotides and polynucleotides may contain errors created during their synthesis prior to their use in synthon assembly. To correct these errors prior to assembly, it is desirable to perform a mismatch repair step. To this end, various methods have been described to achieve mismatch repair of the synthetic nucleic acids prior to assembly. A population of synthetic nucleic acids may have random errors so that denaturation and renaturation of the preparation may reveal mismatches. Proteins that have been isolated from nature such as mutHLS, cel-1 nuclease, T7 endo 1, uvrD, T4 EndoVII, E. coli EndoV, (see U.S. Pat. No. 7,851,192 and U.S. Pat. No. 8,048,664) that can bind selectively to DNA duplexes containing mismatches; cleave nucleic acids at the mismatched bases and optionally replace with correct bases based on the nucleotide sequences of the templates.
Despite teaching in the art that a non-strand displacing polymerase must be utilized with a ss binding protein, 5′-3′-exonuclease and ligase to assemble fragments of DNA, it has been surprisingly shown herein that a strand displacing polymerase may be used under conditions where strand displacement occurs and that this is efficient at surprising low concentrations of starting polynucleotide fragments to effectively generate a single nucleic acid from a plurality of fragments.
Examples of strand displacing polymerases that may be used in embodiments of an assembly mixture, composition, kit, or method of the invention include members of family B polymerases, such as (but not limited to) any of those identified in Table 1 (SEQ ID NOs:33-55). In addition, fusions of such polymerases may be used, for example fusions between a plurality of polymerases and/or ss binding domains (such as shown in Table 2) (SEQ ID NOs: 56-97). In embodiments any of the polymerase moieties in Table 1 or proteins having at least 80%, 85%, 90%, 95% 98%, 99% or 100% amino acid sequence identity to any of these protein moieties in Table 1 may be fused at the N-terminal end or the C-terminal end to any of the DNA binding domains described in Table 2 or a protein moiety have at least 80%, 85%, 90%, 95% 98%, 99% or 100% amino acid sequence identity to any of the DNA binding moieties in Table 2 to form a strand displacing fusion polymerase for use herein. The DNA binding domain may optionally be fused to the N-terminal end or the C-terminal end of the polymerase.
Variants of other polymerases or novel isolates that are revealed to be strand displacing as determined by the assay provided herein (see for example, FIG. 1A-1E and Example 1) may also be used. Sequences of the polymerases found from these sources are readily accessible through GenBank. Because of the high degree of conservation of strand displacing sequences, any variant having 80%, 85%, 90%, or 95% amino acid sequence identity with such wild type polymerases might be expected to have strand displacing properties that can be quickly and easily verified in the assay provided in Example 1 in a preselected buffer without undue experimentation.
In one embodiment, the reaction mixture, composition, kit, or method of the invention comprises or uses a strand displacing polymerase having at least 80%, 85%, 90%, 95%, 98%, 99% or 100% sequence identity with SEQ ID NO:1 or SEQ ID NO:102 (e.g. 100% sequence identity with SEQ ID NO:1 or SEQ ID NO:102). In another embodiment, the reaction mixture, composition, kit, or method of the invention comprises or uses a polymerase having a binding domain having at least 80%, 85%, 90%, 95%, 98%, 99% or 100% sequence identity with SEQ ID NO:2 (e.g. 100% sequence identity with SEQ ID NO:2). In another embodiment, the reaction mixture, composition, kit, or method of the invention comprises or uses a polymerase having at least 80%, 85%, 90%, 95%, 98%, 99% or 100% sequence identity with SEQ ID NO:1, or SEQ ID NO:102 and SEQ ID NO:2, or SEQ ID NO:3 or any of SEQ ID NOs:33-97 (e.g. 100% sequence identity with SEQ ID NO:1 or SEQ ID NO: 102, and SEQ ID NO:2 or SEQ ID NO:3 or any of SEQ ID NOs:33-97). These compositions may be used in reaction conditions in which the polymerase is strand displacing. The compositions may be used in reaction conditions in which any 3′-5′ exonuclease activity associated with the polymerase activity is active. This may be helpful when a restriction enzyme is used in the reaction such as NotI. In this case, the 3′-5′ exonuclease may remove a flap sequence on the 3′ end of the duplex. However, if a restriction endonuclease is used that creates a blunt end on the excised fragment, 3′-5′ exonuclease activity may not be required. The assembly reaction may be performed under isothermal conditions. In one embodiment the isothermal conditions are 50° C.
| TABLE 1 |
| Table of polymerases |
| Methanocaldococcus vulcanius M7 | SP-13 | gi|502573182 | SEQ ID NO: 33 |
| Archaeoglobus fulgidus DSM 4304 | SP-16 | gi|499180464 | SEQ ID NO: 34 |
| Archaeoglobus profundus DSM 5631 | SP-17 | gi|502704426 | SEQ ID NO: 35 |
| Caldicellulosiruptor hydrothermalis 108 | SP-19 | gi|503168530 | SEQ ID NO: 36 |
| Desulfurococcus mucosus DSM 2162 | SP-27 | gi|503328138 | SEQ ID NO: 37 |
| Pyrolobus fumarii | SP-29 | gi|503791850 | SEQ ID NO: 38 |
| Pyrobaculum oguniense CH | SP-30 | gi|379003208 | SEQ ID NO: 39 |
| Staphylothermus marinus F1 | SP-33 | gi|500164563 | SEQ ID NO: 40 |
| Pyrococcus yayaosii CH1 | SP-42 | gi|503672202 | SEQ ID NO: 41 |
| Thermococcus sp. AM4-del | SP-43 | gi|503888003 | SEQ ID NO: 42 |
| Thermococcus hydrothermalis | SP-44 | gi|17375628 | SEQ ID NO: 43 |
| Thermococcus thioreducens | SP-45 | gi|117958105 | SEQ ID NO: 44 |
| Thermococcus waiotapuensis | SP-46 | gi|378813034 | SEQ ID NO: 45 |
| Thermococcus sibiricus MM 739 | SP-47 | gi|506329477 | SEQ ID NO: 46 |
| Pyrococcus glycovorans | SP-48 | gi|7288074 | SEQ ID NO: 47 |
| Pyrococcus sp. NA2 | SP-49 | gi|503513858 | SEQ ID NO: 48 |
| Ferroglobus placidus DSM 10642 | SP-61 | gi|502730992 | SEQ ID NO: 49 |
| Palaeococcus ferrophilus DSM 13482 | SP-5 | gi|851288004 | SEQ ID NO: 50 |
| Thermococcus gammatolerans EJ3 | SP-50 | gi|506339349 | SEQ ID NO: 51 |
| Thermococcus celericrescens | SP-51 | gi|332308985 | SEQ ID NO: 52 |
| Vulcanisaeta distributa DSM 14429 | SP-60 | gi|503101260 | SEQ ID NO: 53 |
| Methanopyrus kandleri AV19 | SP-7 | gi|20094475 | SEQ ID NO: 54 |
| Thermoproteus neutrophilus V24Sta | SP-9 | gi|171185774 | SEQ ID NO: 55 |
| TABLE 2 |
| DNA binding proteins |
| DNA-binding protein Tfx | BD-51 | gi|499321160 | SEQ ID NO: 56 |
| AbrB/MazE/MraZ-like | BD-52 | gi|499321199 | SEQ ID NO: 57 |
| “Winged helix” DNA-binding domain | BD-54 | gi|499322061 | SEQ ID NO: 58 |
| Ribbon-helix-helix protein, copG family | BD-62 | gi|499321149 | SEQ ID NO: 59 |
| lambda repressor-like DNA-binding domains | BD-63 | gi|499322443 | SEQ ID NO: 60 |
| Resolvase-like | BD-67 | gi|499322676 | SEQ ID NO: 61 |
| “Winged helix” DNA-binding domain | BD-71 | gi|499322676 | SEQ ID NO: 62 |
| “Winged helix” DNA-binding domain | BD-74 | gi|499322255 | SEQ ID NO: 63 |
| “Winged helix” DNA-binding domain | BD-75 | gi|499322388 | SEQ ID NO: 64 |
| “Winged helix” DNA-binding domain | BD-81 | gi|499322131 | SEQ ID NO: 65 |
| “Winged helix” DNA-binding domain | BD-82 | gi|499321342 | SEQ ID NO: 66 |
| “Winged helix” DNA-binding domain | BD-85 | gi|499321130 | SEQ ID NO: 67 |
| “Winged helix” DNA-binding domain | BD-86 | gi|499322705 | SEQ ID NO: 68 |
| “Winged helix” DNA-binding domain | BD-88 | gi|499320855 | SEQ ID NO: 69 |
| “Winged helix” DNA-binding domain | BD-89 | gi|499322250 | SEQ ID NO: 70 |
| “Winged helix” DNA-binding domain | BD-91 | gi|499321633 | SEQ ID NO: 71 |
| “Winged helix” DNA-binding domain | BD-92 | gi|490170077 | SEQ ID NO: 72 |
| “Winged helix” DNA-binding domain | BD-93 | gi|499321272 | SEQ ID NO: 73 |
| “Winged helix” DNA-binding domain | BD-94 | gi|499320919 | SEQ ID NO: 74 |
| “Winged helix” DNA-binding domain | BD-97 | gi|499320853 | SEQ ID NO: 75 |
| “Winged helix” DNA-binding domain | BD-98 | gi|499321734 | SEQ ID NO: 76 |
| “Winged helix” DNA-binding domain | BD-100 | gi|499322439 | SEQ ID NO: 77 |
| “Winged helix” DNA-binding domain | BD-102 | gi|499322707 | SEQ ID NO: 78 |
| “Winged helix” DNA-binding domain | BD-109 | gi|499321112 | SEQ ID NO: 79 |
| HCP-like | BD-02 | gi|351675391 | SEQ ID NO: 80 |
| Helix-turn-helix domain, rpiR family | BD-03 | gi|500479591 | SEQ ID NO: 81 |
| Helix-turn-helix domain, rpiR family | BD-04 | gi|15643984 | SEQ ID NO: 82 |
| Bacterial regulatory proteins, lacI family | BD-07 | gi|15643711 | SEQ ID NO: 83 |
| Bacterial regulatory proteins, lacI family | BD-08 | gi|15643974 | SEQ ID NO: 84 |
| Bacterial regulatory proteins, lacI family | BD-09 | gi|15643956 | SEQ ID NO: 85 |
| Bacterial regulatory proteins, lacI family | BD-11 | gi|500480095 | SEQ ID NO: 86 |
| lambda repressor-like DNA-binding domains | BD-12 | gi|15643421 | SEQ ID NO: 87 |
| “Winged helix” DNA-binding domain | BD-14 | gi|15644350 | SEQ ID NO: 88 |
| “Winged helix” DNA-binding domain | BD-16 | gi|24159093 | SEQ ID NO: 89 |
| “Winged helix” DNA-binding domain | BD-18 | gi|15643139 | SEQ ID NO: 90 |
| “Winged helix” DNA-binding domain | BD-23 | gi|15642807 | SEQ ID NO: 91 |
| “Winged helix” DNA-binding domain | BD-24 | gi|15643159 | SEQ ID NO: 92 |
| “Winged helix” DNA-binding domain | BD-30 | gi|15643333 | SEQ ID NO: 93 |
| “Winged helix” DNA-binding domain | BD-32 | gi|15643055 | SEQ ID NO: 94 |
| “Winged helix” DNA-binding domain | BD-37 | gi|15643827 | SEQ ID NO: 95 |
| “Winged helix” DNA-binding domain | BD-43 | gi|15643699 | SEQ ID NO: 96 |
| Homeodomain-like | BD-45 | gi|15643788 | SEQ ID NO: 97 |
In an embodiment of the invention, the reaction mixture, composition, kit or method may include or use a 5′-3′ exonuclease such as T5/5′-3′-exonuclease that is temperature sensitive and can be inactivated by raising the temperature above 50° C. In one embodiment, the 5′-3′ exonuclease has exonuclease activity and ss endonuclease activity. In some embodiments, a reaction mixture may further include a ligase for example, an NAD+ requiring ligase and/or a thermostable ligase, for example Taq ligase. In preferred embodiments, the reaction mixture may include a ss binding protein. The ss binding protein may be thermostable for example, ET SSB. The assembly reaction may be performed under isothermal conditions.
In certain embodiments, the use of a ligase is optional. For example, where an assembled fragment is introduced directly into a vector for transformation of a host cell, a ligase is not required as the host cell such as E. coli may be capable of repairing nicks in vivo. However, if the assembled fragment is amplified for purposes of confirming correct assembly prior to transformation, it is desirable to use a ligase to close nicks and enable a polymerase to amplify the entire target DNA.
Cloning of individual fragments may use chemically synthesized polynucleotide fragments with sequences obtained from any database or publication where the polynucleotide fragments have overlapping sequences. These can be cloned in a plasmid by inserting the polynucleotide into a site in the plasmid adjacent to restriction enzyme sites suitable for excision of the inserted polynucleotide.
Any plasmid may be used. The present examples utilize the commercially available pACYC184 that contains the chloramphenicol gene as a selectable marker. Any selectable marker may be used in place of chloramphenicol resistance gene. Similarly a specific recognition site for any cleavage enzyme capable of specifically cleaving at the ends of the oligonucleotide to generate either staggered ends or blunt ends may be selected where the specific cleavage site does not occur in the fragments of interest in addition to the engineered position adjacent to the ends of the fragment of interest. In the present examples, the recognition site for the eight base cutter NotI (CGCCGGCG) that produces staggered ends has been introduced adjacent to the polynucleotide of interest by means of DNA synthesis. However, this site may be present in a plasmid of choice or added to the synthetic oligonucleotide of interest by a primer for amplification. Examples of specific cleavage enzymes include restriction endonucleases and homing endonucleases.
Once the oligonucleotide or DNA fragment of interest has been chemically synthesized cloned or amplified from an existing DNA and cloned into a vector with a selectable marker, it is excised preferably by enzyme cleavage. The fragments or oligonucleotides that have been synthesized or amplified so as to incorporate overlapping sequence with an adjacent fragment or oligonucleotide to which it is intended to be joined are then assembled in an assembly reaction.
Under the hybridization conditions selected, the 5′-3′ exonuclease in the reaction mixture (for example, at a concentration in the range of 0.004-0.016 U/μl) chews back any ss region at the 5′ end of the fragment or oligonucleotide and continues to chew back through the region of overlapping sequences and may continue further continues for a limited distance (for example, at least 100 bases) to provide a 3′ ss region (see for example, FIGS. 2A-2C and 7). At the same time, the strand-displacing polymerase as defined by the assay in FIG. 1A-1E and Example 1 (for example, at a concentration in the range of 0.005 U/μl-0.5 U/μl) repairs the gap remaining between the hybridized ds region and any residual ss region. Since the polymerase is strand-displacing, it may displace additional downstream sequences to form an ss flap. However, T5 exonuclease ss endonuclease activity will remove this flap and any associated nick may be repaired by a ligase (for example, at a concentration in the range of 0.001 U/μl-20 U/μl).
Once fragments are assembled into a larger piece of DNA which are cloned in colonies of host cells under selective pressure, the DNA from these colonies can be rescued from the vectors and again assembled with other fragments and transformed into host cells thus expanding the size of the DNA many times. The host cell may be a competent bacterial cell or may be a yeast cell or other eukaryotic cell.
The assembly process as described herein has been found to be very efficient. For example, 0.02 nM-100 nM of oligonucleotide (ss) or DNA fragment (ds) may be utilized to assemble a larger fragment where the concentration of ss oligonucleotides used in a reaction can be up to approximately 50 times more than the amount of ds DNA fragments used in a similar assembly reaction. Similarly, equal molarity of plasmid containing a single fragment and a selectable marker and a similar amount of the vector containing the assembled fragments with a different selectable marker may be used. These amounts are intended as guides but can be reduced whether the efficiency of the assembly is enhanced. For example, addition of the potassium salt, KCl can increase efficiency of productive assembly by 1.5 fold as determined by the number of colonies using the assembly of lac1Z as an indicator (see for example FIG. 5).
The assembly process for ss target oligonucleotides between two ds DNA molecules or into a linearized vector is also very efficient. An example is provided herein which is not intended to be limiting that uses specific/random sequences to identify guide RNAs for CRISPR-Cas gene editing protocols that can be introduced into cells to determine an altered phenotype. At the outset, it may not be known what sequence might be suitable for achieving this goal. The generation of a library containing degenerate sequences makes this type of analysis possible. CRISPR/Cas9-based gene editing is quickly growing in popularity in the field of genome editing. Due to the size of most commonly used Cas9-containing plasmids, construction of a sgRNA or sgRNA library into a Cas9/sgRNA expression vector can be cumbersome. This approach solves this problem, using ss DNA oligonucleotides.
In a separate embodiment, any DNA binding domain from Table 2 may be fused to a Bst polymerase, Bst large fragment or mutant thereof (see for example, U.S. Pat. No. 8,993,298 and US 2015/0152396 including all the Bst variants described and claimed therein).
Kits
Also provided by the present disclosure are kits for practicing the subject method as described above. In certain embodiments, a subject kit may contain: i. a 5′-3′ exonuclease, ii. an optional a ligase, iii. a strand-displacing polymerase; and iv. a ss DNA binding protein. The components of the kit may be combined in one container, or each component may be in its own container. For example, the components of the kit may be combined in a single reaction tube or in one or more different reaction tubes. Further details of the components of this kit are described above. The kit may also contain other reagents described above and below that may be employed in the method, e.g., a mismatch repair enzyme such as mutHLS, cel-1 nuclease, T7 endo 1, uvrD, T4 EndoVII, E. coli EndoV, a buffer, dNTPs, plasmids into which to insert the synthon and/or competent cells to receive the plasmids, controls etc., depending on how the method is going to be implemented. In some embodiments, the kit does not contain a non-strand displacing polymerase and/or a crowding agent.
In addition to above-mentioned components, the subject kit further includes instructions for using the components of the kit to practice the subject method. The instructions for practicing the subject method are generally recorded on a suitable recording medium. For example, the instructions may be printed on a substrate, such as paper or plastic, etc. As such, the instructions may be present in the kits as a package insert, in the labeling of the container of the kit or components thereof (i.e., associated with the packaging or subpackaging) etc. In other embodiments, the instructions are present as an electronic storage data file present on a suitable computer readable storage medium, e.g. CD-ROM, diskette, etc. In yet other embodiments, the actual instructions are not present in the kit, but means for obtaining the instructions from a remote source, e.g. via the internet, are provided. An example of this embodiment is a kit that includes a web address where the instructions can be viewed and/or from which the instructions can be downloaded. As with the instructions, this means for obtaining the instructions is recorded on a suitable substrate.
Compositions, kits and methods for assembling fragments and forming synthons as described herein result in a product that is a ds fully sealed DNA that can serve as a template for PCR, RCA or a variety of other molecular biology applications including direct transformation or transfection of a competent bacterial or eukaryotic host cell.
In order to further illustrate the present invention, the following specific examples are given with the understanding that they are being offered to illustrate the present invention and should not be construed in any way as limiting its scope.
All references cited herein including U.S. Provisional Ser. Nos.: 62/042,527, filed Aug. 27, 2014, 62/189,599, filed Jul. 7, 2015 plus 62/193,168, filed on Jul. 16, 2015, are incorporated by reference.
An assay was developed to differentiate between strand-displacing and non-strand displacing polymerases-A 10 μl reaction containing 10 nM FAM-primer/Template/blocking oligonucleotide, 1× THERMOPOL® buffer (New England Biolabs, Ipswich, Mass.) (FIG. 1A) and 0.1 mM dNTP was prepared. FIG. 1B is the control which is the FAM labeled primer absent any polymerase. When a strand displacing DNA polymerase was added to the reaction, and incubated at 50° C. for 30 minutes with 1 μl of sample diluted 10 fold and analyzed by capillary electrophoresis, the FAM primer was extended through the blocking oligonucleotide which was displaced. The results are shown in FIG. 1D-1E. The position of the peak in FIG. 2D for Bst polymerase, an established strand displacing polymerase corresponds to the peak observed for a non-natural polymerase, SPB49F. The small size shift results from a blunt end generated by SPB49F resulting from 3′-5′ exonuclease activity which is absent in Bst polymerase such that the product of Bst polymerase replication has a 3′dA. FIG. 1C shows the product of a non-strand displacing polymerase-T4DNA polymerase where synthesis is terminated at the blocking primer.
Plasmid A, B, C, D and E were constructed separately from PCR products (fragments (Frags) 1, 2, 3, 4, 5 that together cover the region of LacI- and LacZ gene) using NEB® PCR Cloning Kit (New England Biolabs, Ipswich, Mass.).
In this experiment, the 5 different fragments integrated into separate plasmids were used in the following concentrations—50 ng of each PCR (source of “fragments) and 25 ng of pMiniT™ vector (NEB # E1202) was the ampicillin containing plasmid. The 5 fragments for assembly were first amplified using PCR. Primers used in the preparation of LacI-lacZ DNA fragments assembly system as follows:
| 5PLacIZ- | ttggtctggtgtcaaaaatgaATCGTCACGGC |
| pACYC184VF1 | GATTTATG (SEQ ID NO: 4) |
| 5PLacIZ- | gggtcattttcggcgaggacTGCATCAACGCA |
| pACYC184VR1 | TATAGCG (SEQ ID NO: 5) |
| Not-IZ F1 | GCGGCCGCgtcctcgccgaaaatgacccagag |
| (SEQ ID NO: 6) | |
| Not-IZ R1 | GCGGCCGCtggtgtcgatggtagaacgaagcg |
| (SEQ ID NO: 7) | |
| Not-IZ F2 | GCGGCCGCcccactgacgcgttgcgcgagaag |
| (SEQ ID NO: 8) | |
| Not-IZ R2 | GCGGCCGCggctgcgcaactgttgggaagggc |
| (SEQ ID NO: 9) | |
| Not-IZ F3 | GCGGCCGCtgcagcacatccccctttcgccag |
| (SEQ ID NO: 10) | |
| Not-IZ R3 | GCGGCCGCatgatgctcgtgacggttaacgcc |
| (SEQ ID NO: 11) | |
| Not-IZ F4 | GCGGCCGCaggtgcggattgaaaatggtctgc |
| (SEQ ID NO: 12) | |
| Not-IZ R4 | GCGGCCGCtcaccgcttgccagcggcttacca |
| (SEQ ID NO: 13) | |
| Not-IZ F5 | GCGGCCGCgaatacctgttccgtcatagcgat |
| (SEQ ID NO: 14) | |
| Not-IZ R5 | GCGGCCGCtcatttttgacaccagaccaactg |
| g (SEQ ID NO: 15) | |
The amplified fragments were cloned and sequenced to confirm that no errors during amplification had been introduced.
| Sequence of PCR amplified fragment 1 |
| (SEQ ID NO: 16): |
| GCGGCCGCgtcctcgccgaaaatgacccagagcgctgccggcacctgtcc |
| tacgagttgcatgataaagaagacagtcataagtgcggcgacgatagtca |
| tgccccgcgcccaccggaaggagctgactgggttgaaggctctcaagggc |
| atcggtcgagatcccggtgcctaatgagtgagctaacttacattaattgc |
| gttgcgctcactgcccgctttccagtcgggaaacctgtcgtgccagctgc |
| attaatgaatcggccaacgcgcggggagaggcggtttgcgtattgggcgc |
| cagggtggtttttcttttcaccagtgagacgggcaacagctgattgccct |
| tcaccgcctggccctgagagagttgcagcaagcggtccacgctggtttgc |
| cccagcaggcgaaaatcctgtttgatggtggttaacggcgggatataacc |
| aacgcgcagcccggactcggtaatatcccactaccgagatatccgcacca |
| acgcgcagcccggactcggtaatggcgcgcattgcgcccagcgccatctg |
| atcgttggcaaccagcatcgcagtgggaacgatgccctcattcagcattt |
| gcatggtttgttgaaaaccggacatggcactccagtcgccttcccgttcc |
| gctatcggctgaatttgattgcgagtgagatatttatgccagccagccag |
| acgcagacgcgccgagacagaacttaatgggcccgctaacagcgcgattt |
| gctggtgacccaatgcgaccagatgctccacgcccagtcgcgtaccgtct |
| tcatgggagaaaataatactgttgatgggtgtctggtcagagacatcaag |
| aaataacgccggaacattagtgcaggcagcttccacagcaatggcatcct |
| ggtcatccagcggatagttaatgatcagcccactgacgcgttgcgcgaga |
| agattgtgcaccgccgctttacaggcttcgacgccgcttcgttctaccat |
| cgacaccaGCGGCCGC |
| Sequence of PCR amplified fragment 2 |
| (SEQ ID NO: 17): |
| GCGGCCGCcccactgacgcgttgcgcgagaagattgtgcaccgccgcttt |
| acaggcttcgacgccgcttcgttctaccatcgacaccaccacgctggcac |
| ccagttgatcggcgcgagatttaatcgccgcgacaatttgcgacggcgcg |
| tgcagggccagactggaggtggcaacgccaatcagcaacgactgtttgcc |
| cgccagttgttgtgccacgcggttgggaatgtaattcagctccgccatcg |
| ccgcttccactttttcccgcgttttcgcagaaacgtggctggcctggttc |
| accacgcgggaaacggtctgataagagacaccggcatactctgcgacatc |
| gtataacgttactggtttcacattcaccaccctgaattgactctcttccg |
| ggcgctatcatgccataccgcgaaaggttttgcgccattcgatggtgtcc |
| gggatctcgacgctctcccttatgcgactcctgcattaggaagcagccca |
| gtagtaggttgaggccgttgagcaccgccgccgcaaggaatggtgcatgc |
| aaggagatggcgcccaacagtcccccggccacggggcctgccaccatacc |
| cacgccgaaacaagcgctcatgagcccgaagtggcgagcccgatcttccc |
| catcggtgatgtcggcgatataggcgccagcaaccgcacctgtggcgccg |
| gtgatgccggccacgatgcgtccggcgtagaggatcgagatctcgatccc |
| gcgaaattaatacgactcactataggggaattgtgagcggataacaattc |
| ccctctagaaataattttgtttaactttaagaaggagatatacatatgac |
| catgattacggattcactggccgtcgttttacaacgtcgtgactgggaaa |
| accctggcgttacccaacttaatcgccttgcagcacatccccctttcgcc |
| agctggcgtaatagcgaagaggcccgcaccgatcgcccttcccaacagtt |
| gcgcagccGCGGCCGC |
| Sequence of PCR fragment 3 (SEQ ID NO: 18): |
| GCGGCCGCtgcagcacatccccctttcgccagctggcgtaatagcgaaga |
| ggcccgcaccgatcgcccttcccaacagttgcgcagcctgaatggcgaat |
| ggcgctttgcctggtttccggcaccagaagcggtgccggaaagctggctg |
| gagtgcgatcttcctgaggccgatactgtcgtcgtcccctcaaactggca |
| gatgcacggttacgatgcgcccatctacaccaacgtgacctatcccatta |
| cggtcaatccgccgtttgttcccacggagaatccgacgggttgttactcg |
| ctcacatttaatgttgatgaaagctggctacaggaaggccagacgcgaat |
| tatttttgatggcgttaactcggcgtttcatctgtggtgcaacgggcgct |
| gggtcggttacggccaggacagtcgtttgccgtctgaatttgacctgagc |
| gcatttttacgcgccggagaaaaccgcctcgcggtgatggtgctgcgctg |
| gagtgacggcagttatctggaagatcaggatatgtggcggatgagcggca |
| ttttccgtgacgtctcgttgctgcataaaccgactacacaaatcagcgat |
| ttccatgttgccactcgctttaatgatgatttcagccgcgctgtactgga |
| ggctgaagttcagatgtgcggcgagttgcgtgactacctacgggtaacag |
| tttctttatggcagggtgaaacgcaggtcgccagcggcaccgcgcctttc |
| ggcggtgaaattatcgatgagcgtggtggttatgccgatcgcgtcacact |
| acgtctgaacgtcgaaaacccgaaactgtggagcgccgaaatcccgaatc |
| tctatcgtgcggtggttgaactgcacaccgccgacggcacgctgattgaa |
| gcagaagcctgcgatgtcggtttccgcgaggtgcggattgaaaatggtct |
| gctgctgctgaacggcaagccgttgctgattcgaggcgttaaccgtcacg |
| agcatcatGCGGCCGC |
| Sequence of PCR fragment 4 (SEQ ID NO: 19): |
| GCGGCCGCaggtgcggattgaaaatggtctgctgctgctgaacggcaagc |
| cgttgctgattcgaggcgttaaccgtcacgagcatcatcctctgcatggt |
| caggtcatggatgagcagacgatggtgcaggatatcctgctgatgaagca |
| gaacaactttaacgccgtgcgctgttcgcattatccgaaccatccgctgt |
| ggtacacgctgtgcgaccgctacggcctgtatgtggtggatgaagccaat |
| attgaaacccacggcatggtgccaatgaatcgtctgaccgatgatccgcg |
| ctggctaccggcgatgagcgaacgcgtaacgcgaatggtgcagcgcgatc |
| gtaatcacccgagtgtgatcatctggtcgctggggaatgaatcaggccac |
| ggcgctaatcacgacgcgctgtatcgctggatcaaatctgtcgatccttc |
| ccgcccggtgcagtatgaaggcggcggagccgacaccacggccaccgata |
| ttatttgcccgatgtacgcgcgcgtggatgaagaccagcccttcccggct |
| gtgccgaaatggtccatcaaaaaatggctttcgctacctggagagacgcg |
| cccgctgatcctttgcgaatacgcccacgcgatgggtaacagtcttggcg |
| gtttcgctaaatactggcaggcgtttcgtcagtatccccgtttacagggc |
| ggcttcgtctgggactgggtggatcagtcgctgattaaatatgatgaaaa |
| cggcaacccgtggtcggcttacggcggtgattttggcgatacgccgaacg |
| atcgccagttctgtatgaacggtctggtctttgccgaccgcacgccgcat |
| ccagcgctgacggaagcaaaacaccagcagcagtttttccagttccgttt |
| atccgggcaaaccatcgaagtgaccagcgaatacctgttccgtcatagcg |
| ataacgagctcctgcactggatggtggcgctggatggtaagccgctggca |
| agcggtgaGCGGCCGC |
| Sequence of PCR fragment 5 (SEQ ID NO: 20): |
| GCGGCCGCgaatacctgttccgtcatagcgataacgagctcctgcactgg |
| atggtggcgctggatggtaagccgctggcaagcggtgaagtgcctctgga |
| tgtcgctccacaaggtaaacagttgattgaactgcctgaactaccgcagc |
| cggagagcgccgggcaactctggctcacagtacgcgtagtgcaaccgaac |
| gcgaccgcatggtcagaagccgggcacatcagcgcctggcagcagtggcg |
| tctggcggaaaacctcagtgtgacgctccccgccgcgtcccacgccatcc |
| cgcatctgaccaccagcgaaatggatttttgcatcgagctgggtaataag |
| cgttggcaatttaaccgccagtcaggctttctttcacagatgtggattgg |
| cgataaaaaacaactgctgacgccgctgcgcgatcagttcacccgtgcac |
| cgctggataacgacattggcgtaagtgaagcgacccgcattgaccctaac |
| gcctgggtcgaacgctggaaggcggcgggccattaccaggccgaagcagc |
| gttgttgcagtgcacggcagatacacttgctgatgcggtgctgattacga |
| ccgctcacgcgtggcagcatcaggggaaaaccttatttatcagccggaaa |
| acctaccggattgatggtagtggtcaaatggcgattaccgttgatgttga |
| agtggcgagcgatacaccgcatccggcgcggattggcctgaactgccagc |
| tggcgcaggtagcagagcgggtaaactggctcggattagggccgcaagaa |
| aactatcccgaccgccttactgccgcctgttttgaccgctgggatctgcc |
| attgtcagacatgtataccccgtacgtcttcccgagcgaaaacggtctgc |
| gctgcgggacgcgcgaattgaattatggcccacaccagtggcgcggcgac |
| ttccagttcaacatcagccgctacagtcaacagcaactgatggaaaccag |
| ccatcgccatctgctgcacgcggaagaaggcacatggctgaatatcgacg |
| gtttccatatggggattggtggcgacgactcctggagcccgtcagtatcg |
| gcggaattccagctgagcgccggtcgctaccattaccagttggtctggtg |
| tcaaaaatgaGCGGCCGC |
The 5 fragments each had an overlapping region of 80 bp with an adjacent fragment in order of the final assembly by design (between fragment 1 and 2, 2 and 3, 3 and 4, 4 and 5). Fragment 1 and 5 also shared 20 bp overlap with the ends of vector. Any available vector may be used such as for example pACYC184 (New England Biolabs, Ipswich, Mass.). pACYC184 vector was prepared by the method of inverse PCR, which permitted assembly of fragments 1-5 in the presence of the assembly mix described above after treatment with NotI-HF® (New England Biolabs, Ipswich, Mass.) and heat-inactivation (see FIG. 2A-2C).
During assembly, the nucleotides extending from the shaded region were degraded by T5 exonuclease while nucleotides in grey were removed by the polymerase. After the fragments are assembled and transformed into E. coli, productive assembly determined by blue/white selection were recorded on a plate with IPTG and X-Gal.
T5 exonuclease, Taq ligase, a strand displacing DNA polymerase, and a ss binding domain (ET SSB) were combined in a reaction mixture in a buffer to form Mix 1. These enzymes were all obtained from New England Biolabs, Ipswich, Mass. Five of 150 ng of NotI-HF-digested plasmids (plasmid A, B, C, D and E) were mixed with 105 ng of vector and either with Mix 1 or GAMM in a total volume of 20 μl. The reactions were incubated at 50° C. for 60 minutes. 2 μl of the assembled products were used to transform into NEB 5-alpha (New England Biolabs, Ipswich, Mass.) competent cells. Cells were then spread on plates containing chloramphenicol. Positive assembly can be identified as a blue colony on a plate with chloramphenicol+IPTG+X-Gal and incubated at 37° C. overnight.
PCR of assembly product to confirm all fragments are joined and ligated prior transformation involved the following steps: 1 μl of assembled products were used in a PCR to ensured 5 fragments and vector are ligated together. Pairs of PCR primers that anneal on the vector were used to amplify the whole assembled LacIZ gene (5.3 kb). Lane 1 and 2 are duplicate PCR results. Lane M is 2-log DNA ladder from New England Biolabs, Ipswich, Mass. (see FIG. 4).
Sequencing results were obtained from 8 colonies that were picked and the plasmid DNA purified for the purpose of Sanger sequencing. 6 primers were used to sequence the 4.8 kb. The junction sequence between fragments as well as extension regions from the overlap region showed less than 2% sequence errors.
Primers Used for Sequencing the Assembled DNA:
| Seq Not-IZ-M0 | |
| (SEQ ID NO: 21) | |
| aaaaccaccctggcgcccaatacg | |
| Seq Not-IZ-M1 | |
| (SEQ ID NO: 22) | |
| cccggactcggtaatggcgcgcat | |
| Seq Not-IZ-M2 | |
| (SEQ ID NO: 23) | |
| ggaagcagcccagtagtaggttga | |
| Seq Not-IZ-M3 | |
| (SEQ ID NO: 24) | |
| ggtgctgcgctggagtgacggcag | |
| Seq Not-IZ-M4 | |
| (SEQ ID NO: 25) | |
| cggccaccgatattatttgcccga | |
| Seq Not-IZ-M5 | |
| (SEQ ID NO: 26) | |
| gattagggccgcaagaaaactatc |
An oligonucleotide corresponding to sgRNA for targeting a gene from H. sapiens was designed as follows:
| (SEQ ID NO: 27) | |
| 5′GCGAAGAACCTCTTCCCAAGANGG3′ |
See for example FIG. 8A-C in which the ss oligonucleotide is defined as
| (SEQ ID NO: 28) |
| 5′ATCTTGTGGAAAGGACGAAACACCGGCGAAGAACCTCTTCCCAAGAGT |
| TTTAGAGCTAGAAATAGCAAGTT3′ |
or FIG. 9A-C where the ss oligonucleotide is designed to create a random library:
| (SEQ ID NO: 29 |
| 5′ATCTTGTGGAAAGGACGAAACACCGN21GTTTTAGAGCTAGAAATAGC |
| AAGTT3′ |
Unlike traditional cloning methods, in which two oligonucleotides must be synthesized and re-annealed, this example offers a simple way to design an oligonucleotide and assemble it with the desired vector and represents a substantial improvement over traditional methods, specifically in time savings, ease-of-use and cost.
| SEQ ID NO: 1 |
| MILDADYITEDGKPIIRLFKKENGRFKVEYDRNFRPYIYALLKDDSAIDD |
| VRKITSERHGKVVRVIDVEKVKKKFLGRPIEVWKLYFEHPQDVPAMRDKI |
| REHPAVIDIFEYDIPFAKRYLIDKGLIPMEGNEELTFLAVDIETLYHEGE |
| EFGKGPIIMISYADEEGAKVITWKKIDLPYVEVVANEREMIKRLIKVIRE |
| KDPDVIITYNGDNFDFPYLLKRAEKLGMKLPLGRDNSEPKMQRLGDSLAV |
| EIKGRIHFDLFPVIRRTINLPTYTLEAVYEAIFGKQKEKVYPHEIAEAWE |
| TGKGLERVAKYSMEDAKVTYELGKEFFPMEAQLARLVGQPLWDVSRSSTG |
| NLVEWYLLRKAYERNELAPNKPDEREYERRLRESYEGGYVKEPERGLWEG |
| IVSLDFRSLYPSIIITHNVSPDTLNKEGCGEYDEAPEVGHRFCKDFPGFI |
| PSLLGSLLEERQKIKKRMKESKDPVERKLLDYRQRAIKILANSFYGYYGY |
| AKARWYCKECAESVTAWGRQYIELVRRELEERGFKVLYIDTDGLYATIPG |
| EKNWEEIKRRALEFVNYINSKLPGILELEYEGFYTRGFFVTKKKYALIDE |
| EGKIVTRGLEIVRRDWSEIAKETQAKVLEAILKHGNVEEAVKIVKEVTEK |
| LSNYEIPVEKLVIYEQITRPLNEYKAIGPHVAVAKRLAAKGIKIKPGMVI |
| GYVVLRGDGPISKRAIAIEEFDGKKHKYDAEYYIENQVLPAVERILKAFG |
| YKREDLRWQKTKQVGLGAWLKVKKS |
| SEQ ID NO: 2 |
| IINPQARLTPLELEILEIIKQKKSITITEIKEILSERRKSEYPLSLVSEY |
| ISRLERKGYVKKIAKGRKKFVEALI |
| SEQ ID NO: 3 |
| MILDADYITEDGKPIIRLFKKENGRFKVEYDRNFRPYIYALLKDDSAIDD |
| VRKITSERHGKVVRVIDVEKVKKKFLGRPIEVWKLYFEHPQDVPAMRDKI |
| REHPAVIDIFEYDIPFAKRYLIDKGLIPMEGNEELTFLAVDIETLYHEGE |
| EFGKGPIIMISYADEEGAKVITWKKIDLPYVEVVANEREMIKRLIKVIRE |
| KDPDVIITYNGDNFDFPYLLKRAEKLGMKLPLGRDNSEPKMQRLGDSLAV |
| EIKGRIHFDLFPVIRRTINLPTYTLEAVYEAIFGKQKEKVYPHEIAEAWE |
| TGKGLERVAKYSMEDAKVTYELGKEFFPMEAQLARLVGQPLWDVSRSSTG |
| NLVEWYLLRKAYERNELAPNKPDEREYERRLRESYEGGYVKEPERGLWEG |
| IVSLDFRSLYPSIIITHNVSPDTLNKEGCGEYDEAPEVGHRFCKDFPGFI |
| PSLLGSLLEERQKIKKRMKESKDPVERKLLDYRQRAIKILANSFYGYYGY |
| AKARWYCKECAESVTAWGRQYIELVRRELEERGFKVLYIDTDGLYATIPG |
| EKNWEEIKRRALEFVNYINSKLPGILELEYEGFYTRGFFVTKKKYALIDE |
| EGKIVTRGLEIVRRDWSEIAKETQAKVLEAILKHGNVEEAVKIVKEVTEK |
| LSNYEIPVEKLVIYEQITRPLNEYKAIGPHVAVAKRLAAKGIKIKPGMVI |
| GYVVLRGDGPISKRAIAIEEFDGKKHKYDAEYYIENQVLPAVERILKAFG |
| YKREDLRWQKTKQVGLGAWLKVKKSGTGGGGIINPQARLTPLELEILEII |
| KQKKSITITEIKEILSERRKSEYPLSLVSEYISRLERKGYVKKIAKGRKK |
| FVEALI |
| SEQ ID NO: 33 |
| MKEKAPKIDALIDCTYKTEDNRAVIYLYLLENILKDREFSPYFYVEMLKD |
| RIEKEDIDKIKEFLLKEDLLKFVENLEVVNKTILKKEKEIVKIIATHPQR |
| VPKLRKIKECDIVKEIYEHDIPFAKRYLIDSDIVPMTYWDFENRKQVSIE |
| IPKLKTVSFDMEVYNRDTEPDPEKDPILMASFWDDNGGKVITYKHFDHSN |
| IEVVNSEKDLIKKIVEMLRQYDVIFTYNGDNFDFPYLKARAKIYGIDIKL |
| GRDGEELKIKRGGMEFRSYIPGRVHIDLYPISRRLLKLTKYTLEDVVYNL |
| FGIEKLKIPHTKIVDYWANNDKILIEYSLQDAKYTHKIGKYFFPLEVMFS |
| RIVNQTPFEITRMSSGQMVEYLLMKNAFKENMIVPNKPDEKEYRKRLLTS |
| YEGGYVKEPEKGMFEDIISMDFRCHPRGTKVIVKNNGLTDIENVKVGDYV |
| LGIDGWQKVKRVWKYPYNGFLVNVNGLKSTPNHKIPVIKKENGKDRVIDV |
| SSIYLLNLKGCKILKIKNFESIGMFGKIFKKDTKIKKVKGLLEKIAYIDP |
| REGLVIKVKNEKEDIFKTVIPILKELNILYKQVDEKTIIIDSIDGLLKYI |
| VTIGFNDKNEEKIKEIIKEKSFLEFKELEDIKISIEEYEGYVYDLTLEGR |
| PYYFANGILTHNSLYPSIIIAYNISPETLDCECCKDISEKILGHWFCKKR |
| EGLIPKTLRGLIERRINIKNKMKKMESEKEINEEYNLLDYEQRSLKILAN |
| SVYGYLAFPRARFYSRECAEVITYLGRKYILETIEEAEKFGFKVIYADSV |
| VKDAKVIIKEDGKIKEIKIEDLFKKVDYTIGDKEYCILNNVETLTIEDTK |
| LVWRKVPYIMRHRTNKKIYRVKVKDRYVDITEDHSIIGVKNNKLVELKPT |
| EIKDDETKLIILNKDLKSYNFASVEEINCIKYSDYVYDIEVENTHRFFAN |
| GILVHNTDGFYAVWKEKISKDDLIKKALEFVKYINSKLPGTMELEFEGYF |
| KRGIFITKKRYALIDENGRVIVKGLEFVRRDWSNLARITQRRVLEALLLE |
| GDINKAKKAIQDVIKDLREKKIKKEDLIIYTQLTKNPNEYKTTAPHVEIA |
| KKMMREGKKIKIGDVIGYIIVKGSKSISERAKLPEEVSIEEIDVNYYIDN |
| QILPPVLRIMEAVGVSKNELKKEGTQLTLDRFLK |
| SEQ ID NO: 34 |
| MERVEGWLIDADYETIGGKAVVRLWCKDDQGIFVAYDYNFDPYFYVIGVD |
| EDILKNAATSTRREVIKLKSFEKAQLKTLGREVEGYIVYAHHPQHVPKLR |
| DYLSQFGDVREADIPFAYRYLIDKDLACMDGIAIEGEKQGGVIRSYKIEK |
| VERIPRMEFPELKMLVFDCEMLSSFGMPEPEKDPIIVISVKTNDDDEIIL |
| TGDERKIISDFVKLIKSYDPDIIVGYNQDAFDWPYLRKRAERWNIPLDVG |
| RDGSNVVFRGGRPKITGRLNVDLYDIAMRISDIKIKKLENVAEFLGTKIE |
| IADIEAKDIYRYWSRGEKEKVLNYARQDAINTYLIAKELLPMHYELSKMI |
| RLPVDDVTRMGRGKQVDWLLLSEAKKIGEIAPNPPEHAESYEGAFVLEPE |
| RGLHENVACLDFASMYPSIMIAFNISPDTYGCRDDCYEAPEVGHKFRKSP |
| DGFFKRILRMLIEKRRELKVELKNLSPESSEYKLLDIKQQTLKVLTNSFY |
| GYMGWNLARWYCHPCAEATTAWGRHFIRTSAKIAESMGFKVLYGDTDSIF |
| VTKAGMTKEDVDRLIDKLHEELPIQIEVDEYYSAIFFVEKKRYAGLTEDG |
| RLVVKGLEVRRGDWCELAKKVQREVIEVILKEKNPEKALSLVKDVILRIK |
| EGKVSLEEVVIYKGLTKKPSKYESMQAHVKAALKAREMGIIYPVSSKIGY |
| VIVKGSGNIGDRAYPIDLIEDFDGENLRIKTKSGIEIKKLDKDYYIDNQI |
| IPSVLRILERFGYTEASLKGSSQMSLDSFFS |
| SEQ ID NO: 35 |
| MIKAWLLDVDYVTENDRAVIRLWCKDDKGVFVAYDRNFLPYFYVIGCKAE |
| DVMKVKVRTNEGIITPLKVEEIEAKSLGKPIKALKVYTRHPQHVPKLREE |
| IKKFAEVREADIPFAYRYLIDKDLACMDGIEIEPIAVKEGVLRAYEVRSV |
| RRVEKKGFPDLKILAFDCEMLAQFMPDPEKDPIIAIAVKCGDFEEVLHGD |
| ERDILRRFVSIIKEQDPDIIVGYNQDNFDWPYVKKRAEKFGIRLDIGRDR |
| SEISFRGGRPKIAGRLNVDLYDIALKIPDVKIKTLKKVAEFLGAKVEEED |
| IEGRDIYKCWMRGEKEKVFKHVLNDVLTTYRLALELLPMHYELSRMIRLP |
| LDDVARLGRGKQVDYFLLSEAKKINEIAPNPPEIEESYEGAFVLEPARGL |
| HENVACLDFASMYPSIMINFNISPDTLVKGECEDCYVAPEVGHKFRKSPD |
| GFFKRILKMLIEKRREMKRQMKELDPDSEDYKLLDIKQQTLKVLTNSFYG |
| YTGWNLARWYCRECAEATTAWGRYFIKRAVKIAESMGFEVLYGDTDSLFI |
| KKNKLNLKDLEKECLKLIDVISKELPIQLEIDEFYKAIFFVEKKRYAGLT |
| DDDRIVVKGLEVRRGDWCELAKRVQREVIEIILRERNPDKALKFVKNVIE |
| EIKEGKFKLEDYVIYKGLTKKPDKYESKQAHVKAALRAMEMGIYYPIGTK |
| VGFVIVKGGGSISDRAYPIELIEEFDGENLKIRTPSGIMVKKIDKDYYID |
| HQIIPAVMRILERFGYTEASLKTTIQKTLFDFT |
| SEQ ID NO: 36 |
| MKLVIFDGNSILYRAFFALPELTTSSNIPTNAIYGFINVILKYLEQEKPD |
| YIAVAFDKRGREARKSEYQEYKANRKPMPDNLQVQIPYVREILYALNIPI |
| VEFEGYEADDVIGSLVNKFKNTGLDIVIITGDRDTLQLLDKNVVVKIVST |
| KFDRTMEDLYTIENIKEKYGVWANQVPDYKALVGDQSDNIPGVKGIGEKS |
| AQKLLEEYSSLEEIYQNLDKIKGSIREKLEAGKDMAFLSKRLATIVCDLP |
| LNVNLEDLRTKEWNKERLYEILVQLEFKSIIKRLGLSENIQFEFVQQRTD |
| IPDVEQRELESISRIRSKEIPLMFVQDEKCFYLYDQESNTVFVTRDRHLV |
| EEILKSDTVKIVYDLKNIFHQLNLEDTDNIKNCEDVMIASYVLDSTRSSY |
| ELETLFVSYLNTDIEAVKKDKKMVSVVLLKRLWDDLLRLIDLNSCQFLYE |
| NIERPLIPVLYEMEKTGFKVDRDALLQYTKEIENKILKLETQIYQIAGEW |
| FNINSPKQLSYILFEKLKLPVIKKTKTGYSTDAEVLEEFDKHEIVPLILD |
| YRMYTKILTTYCQGLLQAINPSSGRVHTTFIQTGTATGRLASSDPNLQNI |
| PVKYDEGKLIRKVFVPEEGHVLIDADYSQIELRILAHISEDERLINAFKN |
| NIDIHSQTAAEVFGVDIADVTPEMRSQAKAVNFGIVYGISDYGLARDIKI |
| SRKEAAEFINKYFERYPKVKEYLDNIVRFARENGYVLTLFNRKRYVKDIK |
| SANRNARSYAERIAMNSPIQGSAADIMKLAMIKVYQKLKENNLKSKIILQ |
| VHDELLIEAPYEEKDIVKRIVKREMENAVALKVPLVVEVKEGLNWYETK |
| SEQ ID NO: 37 |
| MEKRVYLVDITYGLVGNSPEIRMFGVDENGEKVVILDRGFRPYFYVIPEE |
| GFEDQVARVIGKMQNVIKADVTERRLFGKPIKVVKVTVTVPDKVRELRDR |
| VKSIQHVKEVLEADIRFYIRYMIDNDIRPGWLMFSNLKPVDNKIGGVSNV |
| YLTETPPTSLDLGIMPRLNYMALDIEVYNPRGTPDPKRDPIIIIALANSN |
| GDVKLLTLDNYKHEREMLNDMMSVIKEWDPDVLFGYNSNKFDMPYLVNRA |
| DALNVKLQLSKYGTPPEQSVYGHWSIIGRAHIDLYNFIEDMTDVKRKSLD |
| YVAEYFGVMKRSERVNIPGHRIYQYWDDEGKRSQLIKYARDDVLSTLGLG |
| KILLPYAMQLASVSGLPLDQVGPASVGSRVEMMIMHEAYKMGELAPNRVE |
| RPYETYKGAIVLEPKPGIHYNIAVLDFSSMYPNIMLKYNISPDTLVLDSS |
| EGDYYTAPEVGYRFRKSPRGLYASLLQKLIEARREARDEMRNYPEGSFEW |
| VLLNERQRALKIMANAMYGYCGWLGARWYIREVAESVTAWGRYLLKTAMS |
| MAKERGLTVIYGDTDSLFVTYDKDKVADIISRINEMGFEVKIDKVYSKLI |
| FTESKKRYIGLTADGEVDIVGFEAVRGDWSELARNVQERVAELVLRESVD |
| EAVKYVKSVIDDLRNYRFTIDDVIIWKTLDKDINEYKAIQPHVVAARRLM |
| EKGYVVNKGDTVGFVIVKDSGDKLTQRAYPYVFINDVKEIDVDYYVEKQV |
| IPAALRILEVFGVNEAALLGKTGKSILDYFH |
| SEQ ID NO: 38 |
| MTEVVFTVLDSSYEVVGKEPQVIIWGIAENGERVVLIDRSFRPYFYALLA |
| PGADPKQVAQRIRALSRPKSPIIGVEDDKRKYFGRPRRVLRIRTVLPEAV |
| REYRELVKNVDGVEDVLEADIRFAMRYLIDHDLFPFTWYRVEAEPLENKM |
| GFRVDKVYLVKSRPEPLYGEALAPTKLPDLRILAFDIEVYSKQGSPRPER |
| DPVIVIAVKTDDGDEVLFIAEGKDDRKPIREFVEYVKRYDPDIIVGYNNN |
| HFDWPYLLRRARILGIKLDVTRRVGAEPTTSVHGHVSVPGRLNVDLYDYA |
| EEMPEIKIKSLEEVAEYLGVMKKSERVIINWWEIPDYWDDPKKRPLLLQY |
| ARDDVRATYGLAEKILPFAIQLSYVTGLPLDQVGAMSVGFRLEWYLIRAA |
| FKMKELVPNRVERPEETYRGAIVLEPLRGVHENIAVLDFSSMYPNIMIKY |
| NVGPDTLVRPGEECGECGCWEAPEVKHRFRRCPPGFFKTVLERLLELRKR |
| VRAEMKKYPPDSPEYRLLDERQKALKVLANASYGYMGWSGARWYCRECAE |
| AVTAWGRHLIRTAINIARKLGLKVIYGDTDSLFVTYDPEKVEKFIKIIEE |
| ELGFEIKLEKVYKRVFFTEAKKRYAGLLEDGRIDIVGFEAVRGDWCELAK |
| EVQTKVVEIVLKTSDVNKAVEYVRKIVKELEEGKVPIEKLVIWKTLSKRL |
| EEYTTEAPHVVAAKRMLSAGYRVSPGDKIGYVIVKGGGRISQRAWPYFMV |
| KDPSQIDVTYYVDHQIIPAALRILGYFGITEKKLKASATGQKTLFDFLAK |
| KSK |
| SEQ ID NO: 39 |
| MEIRVWPLDVTYIVVGGVPEVRVFGIAEGGERVVLADRSFRPYFYVDCAG |
| CDPHAVKTHLGRTAPVEGVELVERRFLGRPRQFLKVVAKIPEDVRRLREA |
| ASTIPGVRGVYEADIRFYMRYVIDMGVVPCSWNVAEVEVADEKLGSLPVY |
| RVVKWGGAVEGFPPPLRVLAFDIEVYNERGTPDPARDPIVMIAVQSSDGR |
| LEVFEASGRDDRGVLRSFVEYVRSFDPDVVVGYNSNNFDWPYLAERAKAV |
| GVPLRVDRLGGAPQQSVYGHWSVLGRANVDLYNIVDEFPEIKLKTLDRVA |
| EYFGVMRRDERVLIPGHKIYEYWRDPSKRPLLRQYVIDDVRSTYGLAERL |
| LPFLIQLSSVSGLPLDQVAAASVGNRVEWMLLRYAYGLGEVAPNREEREY |
| EPYKGAIVLEPKPGLYSDVLVLDFSSMYPNVMMRYNLSPDTYLEPGEPDP |
| PEGVYVAPEVGHRFRKEPPGFIPQVLRRLVALRRAVREEMKKYQPDTPEY |
| RVLDERQKALKIMANAMYGYTGWVGARWYKKEVAESVTAFARAILKDVID |
| YARRLGIVVIYGDTDSLFVKKGGDLEKLARYVDEKYGIEIKVDKDYEKVL |
| FTEAKKRYAGLLRDGRIDIVGFEVVRGDWSELAKEVQLKVIELILKARDL |
| SEARQRVIKYVKDVIERLKSGKFDLDDLIIWKTLDKDLGEYKAYPPHVRA |
| ALILKKKGYKVGRGTTIGYVVVKGGEKVSERSLPYILVDDLAKIDVDYYI |
| EKQVIPAALRIAEVIGVKEGDLRAGRSEKSLLDFFE |
| SEQ ID NO: 40 |
| MSEKINLEFYFLDNSYEVIGNEPHIIIWGITRDGRRVLLRDRRFRPYFYA |
| ILKDKVNIEDLARKIRTYSDPKSPIIGVEPVEKKYFGRKVSALKIITMIP |
| EYVRKYREKIKSLPEVLEVVEADIRFSIRYIIDHDLRPCGWHVAEVVEVP |
| KKPIYRVDAEYEIIGDIKPLEQTLQPDLRIIAFDIEVYNKSGTPRPQTDP |
| IIIIGIMNNNGDIKQFLANKYDDKISVEEFVNYVKTFDPDIIVGYNTDGF |
| DWPYLIERSKYIGVKLDVTRRVGATPRTSTYGHISVPGRLNTDLYHFAEE |
| IPEVKVKSLENVAEYLGVMKKSERVIIEYIDIPKYWDDEKLRPKLLQYNI |
| DDVKSTYGLAEKFLPFAMQLSNITGLPLDQVGAASVGFRLEWYLMREAFR |
| YGELVPNRVERAAESYRGAVVLKPVKGVHENIAVLDFSSMYPNIMIKYNV |
| GPDTIVRNEKCNPDKHNIAPEVGHCFRKEPPGFFKRVLETLLRLRKQIKS |
| EMKKYPPTSYEYRLLDERQKAVKVLANATYGYMGWIHARWYCRECAEAVT |
| AWGRQTIKSAIELARKLGLKVIYGDTDSLFVTYDKDKVEKLIELIQTKLG |
| FEIKIDKIYKRVFFTEAKKRYAGLLEDGRIDIVGFEAVRGDWAEIAKEVQ |
| EKVTEILLKENSIDKAIEYVRQVIADLKAGKIPLDKLIIWKTLSKRIEEY |
| SVDAPHVVAAKKLIKAGIKVSTNDKIGYVILKGGGKISSRAEPYIFVKDP |
| KLIDTEYYVDHQIVPAALRILNYFGVTETQLKRAAASAGQKSLFDFFGGK |
| K |
| SEQ ID NO: 41 |
| MILDADYITENGKPVVRIFKKENGEFKVEYDRSFRPYIYALLRDDSAIED |
| IKKITAERHGKVVRVVEAEKVRKKFLGRPIEVWKLYFEHPQDVPAIREKI |
| REHPAVIDIFEYDIPFAKRYLIDKGLIPMEGNEELKLLAFDIETLYHEGD |
| EFGSGPIIMISYADEKGAKVITWKGVDLPYVEVVSSEREMIKRFLRVIRE |
| KDPDVIITYNGDNFDFPYLLKRAEKLGMKLPIGRDGSEPKMQRMGDGFAV |
| EVKGRIHFDIYPVIRRTINLPTYTLEAVYEAVFGRPKEKVYPNEIARAWE |
| NCKGLERVAKYSMEDAKVTYELGREFFPMEAQLARLVGQPVWDVSRSSTG |
| NLVEWFLLRKAYERNELAPNRPDEREYERRLRESYEGGYVKEPEKGLWEG |
| IIYLDFRSLYPSIIITHNISPDTLNKEGCNSYDVAPKVGHRFCKDFPGFI |
| PSLLGQLLDERQKIKRKMKATIDPIERKLLDYRQRAIKILANSYYGYYGY |
| AKARWYCKECAESVTAWGREYIELVSRELEKRGFKVLYIDTDGLYATIPG |
| SREWDKIKERALEFVKYINARLPGLLELEYEGFYKRGFFVTKKKYALIDE |
| EGKIITRGLEIVRRDWSEIAKETQARVLEAILKEGNLEKAVKIVKEVTEK |
| LSKYEVPPEKLVIYEQITRDLKDYKAVGPHVAVAKRLAARGIKVRPGMVI |
| GYLVLRGDGPISRRAIPAEEFDPSRHKYDAEYYIENQVLPAVLRILEAFG |
| YRKEDLRYQKTRQAGLDAWLKRKASL |
| SEQ ID NO: 42 |
| MILDTDYITENGKPVIRVFKKENGEFKIEYDRTFEPYFYALLKDDSAIED |
| VKKVTAKRHGTVVRVKRAEKVQRKFLGRPIEVWKLYFTHPQDVPAIRDKI |
| RAHPAVIDIYEYDIPFAKRYLIDKGLIPMEGDEELTMLAFDIETLYHEGE |
| EFGTGPILMISYADGSEARVITWKKIDLPYVDVVSTEKEMIKRFLRIVKE |
| KDPDVLITYNGDNFDFAYLKKRCEKLGIKFTLGRDGSEPKIQRMGDRFAV |
| EVKGRIHFDLYPVIRRTINLPTYTLEAVYEAVFGKPKEKVYAEEIAQAWE |
| SGEGLERVARYSMEDAKVTYELGREFFPMEAQLSRLIGQSLWDVSRSSTG |
| NLVEWFLLRKAYERNELAPNKPDEKELARRRGGYAGGYVKEPERGLWDNI |
| VYLDFRSLYPSIIITHNVSPDTLNREGCKEYDVAPEVGHKFCKDFPGFIP |
| SLLGDLLEERQKIKRKMKATVDPLEKKLLDYRQRAIKILANSYYGYYGYA |
| KARWYCRECAESVTAWGREYIETTIREIEEKFGFKVLYADTDGFFATIPG |
| ADAETVKKKAKEFLKYINAKLPGLLELEYEGFYVRGFFVTKKKYAVIDEE |
| GKITTRGLEIVRRDWSEIAKETQARVLEAILKHGDVEEAVRIVKEVTEKL |
| SKYEVPPEKLVIHEQITRDLRDYKATGPHVAVAKRLAARGVKIRPGTVIS |
| YIVLKGSGRIGDRAIPFDEFDPTKHRYDAEYYIENQVLPAVERILKAFGY |
| RKEDLRYQKTKQVGLGAWLKVKK |
| SEQ ID NO: 43 |
| MILDTDYITEDGKPVIRIFKKENGEFKIEYDREFEPYIYALLKDDSAIEE |
| VKKITAGRHGRVVKVKRAEKVKKKFLGRPIEVWKLYFTHPQDVPAIRDEI |
| RRHSAVVDIYEYDIPFAKRYLIDKGLIPMEGDEELKMMSFDIETLYHEGE |
| EFGTGPILMISYADEGEARVITWKKIDLPYVEVVSTEKEMIKRFLKVVKE |
| KDPDVLITYNGDNFDFAYLKKRCEKIGIKFTLRRDGSEPKIQRMGDRFAV |
| EVKGRIHFDLYPVIRRTINLPTYTLEAVYEAVFGTPKEKVYPEEITTAWE |
| TGEGLERVARYSMEDAKVTYELGREFFPMEAQLSRLIGQSLWDVSRSSTG |
| NLVEWFLLRKAYERNEIAPNKPDERELARRRGGYAGGYVKEPERGLWDNI |
| VYLDFMSLYPSIIITHNVSPDTFNREGCKEYDTAPQVGHKFCKDVQGFIP |
| SLLGALLDERQKIKKRMKASIDPLEKKLLDYRQKAIKILANSYYGYYGYA |
| RARWYCKECAESVTAWGRDYIETTIHEIEERFGFKVLYADTDGFFATIPG |
| ADAETVKKKAKEFLKYINAKLPGLLELEYEGFYVRGFFVTKKKYAVIDEE |
| GKITTRGLEIVRRDWSEIAKETQARVLEAILRHGDVEEAVRIVKDVTEKL |
| SKYEVPPEKLVIHEQITRELKDYKATGPHVAIAKRLAARGIKIRPGTVIS |
| YIVLKGSGRIGDRAIPFDEFDPTKHRYDAEYYIENQVLPAVERILKAFGY |
| KKEELRYQKTRQVGLGAWLKLKGKK |
| SEQ ID NO: 44 |
| MILDADYITEDGKPVVRIFKKENGEFKIEYDREFEPYIYALLRDDSAIEE |
| IKKITADRHGKVVKVKRAEKVQKKFLGRPIEVWKLYFTHPQDVPAIRDEI |
| RKHPAVVDIYEYDIPFAKRYLIDKGLIPMEGDEELKMLAFDIETLYHEGE |
| EFGTGPILMISYADEDGARVITWKKIDLPYVDVVSTEKEMIKRFLKVVKE |
| KDPDVLITYNGDNFDFAYLKKRCEKLGIKFTLGRDGSEPKIQRMGDRFAV |
| EVKGRIHFDLYPLIRRTINLPTYTLEAVYEAVFGKPKEKVYAEEIALAWE |
| SGEGLERVARYSMEDAKVTFELGREFFPMEAQLSRLIGQSLWDVSRSSTG |
| NLVEWFLLRKAYERNELAPNKPNERELARRRGGYAGGYVKEPERGLWDNI |
| VYLDFRSLYPSIIITHNVSPDTLNREGCKEYDRAPQVGHKFCKDVPGFIP |
| SLLGSLLDERQKIKRKMKATIDPIEKKLLDYRQRAIKILANSYYGYYGYA |
| RARWYCRECAESVTAWGREYIEMAIRELEEKFGFKVLYADTDGLHATIPG |
| ADAETVKKKAMEFLKYINPKLPGLLELEYEGFYARGFFVTKKKYAVIDEE |
| GKITTRGLEIVRRDWSEIAKETQARVLEAILRHGDVEEAVRIVKEVTEKL |
| SKYEVPPEKLVIHEQITRELKDYRATGPHVAIAKRLAKRGIKIRPGTVIS |
| YIVLKGSGRIGDRAIPFDEFDPTKHKYDAEYYIENQVLPAVERVLKAFGY |
| RKDDLRYQKTRQVGLGAWLKVKKR |
| SEQ ID NO: 45 |
| MILDADYITEDGKPVIRVFKKEKGEFKINYDRDFEPYIYALLKDDSAIED |
| IKKITAERHGTTVRVTRAERVKKKFLGRPVEVWKLYFTHPQDVPAIRDKI |
| REHPAVVDIYEYDIPFAKRYLIDKGLIPMEGNEELRMLAFDIETLYHEGE |
| EFGEGPILMISYADEEGARVITWKNIDLPYVESVSTEKEMIKRFLKVIQE |
| KDPDVLITYNGDNFDFAYLKKRSETLGVKFILGRDGSEPKIQRMGDRFAV |
| EVKGRIHFDLYPVIRRTINLPTYTLETVYEAIFGQPKEKVYAEEIAQAWE |
| SGEGLERVARYSMEDAKATYELGKEFFPMEAQLSRLVGQSLWDVSRSSTG |
| NLVEWFLLRKAYERNELAPNKPDERELARRAESYAGGYVKEPEKGLWENI |
| VYLDYKSLYPSIIITHNVSPDTLNREGCREYDVAPQVGHRFCKDFPGFIP |
| SLLGDLLEERQKVKKKMKATVDPIERKLLDYRQRAIKILANSYYGYYGYA |
| NARWYCRECAESVTAWGRQYIETTMREIEEKFGFKVLYADTDGFFATIPG |
| ADAETVKKKTKEFLNYINPRLPGLLELEYEGFYRRGFFVTKKKYAVIDEE |
| DKITTRGLEIVRRDWSEIAKETQARVLEAILKHGDVEEAVRIVKEVTEKL |
| SRYEVPPEKLVIYEQITRNLRDYRATGPHVAVAKRLAARGIKIRPGTVIS |
| YIVLKGPGRVGDRAIPFDEFDPAKHRYDAEYYIENQVLPAVERILRAFGY |
| RKEDLRYQKTKQAGLGAWLKPKT |
| SEQ ID NO: 46 |
| MILGADYITKDGKPIVRIFKKENGEFKIELDPHFQPYIYALLSEDSAIDE |
| IKQIKGERHGKTVRIVDAVKVEKKFLKKPVKVWKLILEHPQDVPAIRNKI |
| REHPAVQDIYEYDIPFAKRYLIDNGLIPMEGDEELKMLAFDIETFYHEGD |
| EFGKGEIIMISYADEEGARVITWKNIDLPYVDVVSNEREMIKRFIQIIKE |
| KDPDVIITYNGDNFDLPYLIKRAEKLGLRLILSRDNENPVPKIQRMGNSF |
| AVEIKGRIHFDLFPVVKRAVNLPTYTLEAVYETVLGKHKSKLGAEEIAAI |
| WETEEGLKKLAQYSMEDAKATYELGREFFPMEVELAKLIGQSVWDVSRSS |
| TGNLVEWYMLRVAYERNELAPNRPSDEEYKRRLRTTYLGGYVKEPERGLW |
| ENIIYLDFRSLYPSIIVTHNVSPDTLERKGCQNYDVAPIVGYKFCKDFSG |
| FIPSILEDLIETRQKIKKEMKSTIDPIKKKMLDYRQRAVKLLANSYYGYM |
| GYPKARWYSKECAESVTAWGRHYIEMTIREIEEKFGFKVLYADTDGFYAT |
| IPGADPETIKKKAKEFLNYINSKLPGLLELEYEGFYLRGFFVTKKRYAVI |
| DEEEKITTRGLEVVRRDWSEIAKETQARVLEAILREGSVEKAVEIVKEVV |
| EAITKYKVPLEKLIIHEQITRELRDYKAVGPHVAIAKRLAAKGIKIKPGT |
| IISYIVLRGSGKISDRVVLLTEYDPRKHKYDPDYYIENQVLPAVLRILEA |
| FGYRKEDLKYQSSKQTGLESWLKK |
| SEQ ID NO: 47 |
| MILDADYITEDGKPIIRIFKKENGEFKVEYDRNFRPYIYALLKDDSQIDE |
| VKKITAERHGKIVRIVDVEKVKKKFLGRPIEVWKLYFEHPQDVPAIRDKI |
| REHPAVVDIFEYDIPFAKRYLIDKGLIPMEGDEELKLLAFDIETLYHEGE |
| EFAKGPIIMISYADEEGAKVITWKKVDLPYVEVVSSEREMIKRFLKVIRE |
| KDPDVIITYNGDSFDLPYLVKRAEKLGIKLPLGRDGSEPKMQRLGDMTAV |
| EIKGRIHFDLYHVIRRTINLPTYTLEAVYEAIFGKPKEKVYAHEIAEAWE |
| TGKGLERVAKYSMEDAKVTYELGREFFPMEAQLSRLVGQPLWDVSRSSTG |
| NLVEWYLLRKAYERNELAPNKPDEREYERRLRESYAGGYVKEPEKGLWEG |
| LVSLDFRSLYPSIIITHNVSPDTLNREGCMEYDVAPEVKHKFCKDFPGFI |
| PSLLKRLLDERQEIKRRMKASKDPIEKKMLDYRQRAIKILANSYYGYYGY |
| AKARWYCKECAESVTAWGREYIEFVRKELEEKFGFKVLYIDTDGLYATIP |
| GAKPEEIKRKALEFVEYINAKLPGLLELEYEGFYVRGFFVTKKKYALIDE |
| EGKIITRGLEIVRRDWSEIAKETQAKVLEAILKHGNVEEAVKIVKEVTEK |
| LSKYEIPPEKLVIYEQITRPLHEYKAIGPHVAVAKRLAARGVKVRPGMVI |
| GYIVLRGDGPISKRAILAEEFDPRKHKYDAEYYIENQVLPAVLRILEAFG |
| YRKEDLRWQKTKQTGLTAWLNVKKK |
| SEQ ID NO: 48 |
| MILDADYITEDGKPIIRLFKKENGRFKVEYDRNFRPYIYALLKDDSAIDD |
| VRKITSERHGKVVRVIDVEKVKKKFLGRPIEVWKLYFEHPQDVPAMRDKI |
| REHPAVIDIFEYDIPFAKRYLIDKGLIPMEGNEELTFLAVDIETLYHEGE |
| EFGKGPIIMISYADEEGAKVITWKKIDLPYVEVVANEREMIKRLIKVIRE |
| KDPDVIITYNGDNFDFPYLLKRAEKLGMKLPLGRDNSEPKMQRLGDSLAV |
| EIKGRIHFDLFPVIRRTINLPTYTLEAVYEAIFGKQKEKVYPHEIAEAWE |
| TGKGLERVAKYSMEDAKVTYELGKEFFPMEAQLARLVGQPLWDVSRSSTG |
| NLVEWYLLRKAYERNELAPNKPDEREYERRLRESYEGGYVKEPERGLWEG |
| IVSLDFRSLYPSIIITHNVSPDTLNKEGCGEYDEAPEVGHRFCKDFPGFI |
| PSLLGSLLEERQKIKKRMKESKDPVERKLLDYRQRAIKILANSFYGYYGY |
| AKARWYCKECAESVTAWGRQYIELVRRELEERGFKVLYIDTDGLYATIPG |
| EKNWEEIKRRALEFVNYINSKLPGILELEYEGFYTRGFFVTKKKYALIDE |
| EGKIVTRGLEIVRRDWSEIAKETQAKVLEAILKHGNVEEAVKIVKEVTEK |
| LSNYEIPVEKLVIYEQITRPLNEYKAIGPHVAVAKRLAAKGIKIKPGMVI |
| GYVVLRGDGPISKRAIAIEEFDGKKHKYDAEYYIENQVLPAVERILKAFG |
| YKREDLRWQKTKQVGLGAWLKVKKS |
| SEQ ID NO: 49 |
| MEGWLLDADYITAEDGRAVVRLWCKDFDGNTFVVYDRNFQPYFYAFKNGL |
| SKEDIEKIVVKSREGVIKPFKVEEVRRKVFGKEVEVFKIYAYHPQHVPKL |
| REELKKITEVREADIPFAYRYLIDKDLACMDGIRVEGKVREERGLKVIDA |
| EHVERFEIPLPEPKVLAFDCEMLTELGMPDPEKDKIIIIGVKCGDFEEII |
| TGNEREILLRFVEIIKEQDPDVIVGYNQDNFDWPYIRKRAEKLSVKLNIG |
| RDGSEISFRGGRPKIAGRLNVDLYDIAMKLDVKVKTLENVAEFLGRKVEL |
| ADIEAKDIYKRWTSGDKESVLKYSKQDVLNTYFIAEELLPMHYELSRMIR |
| IPTDDVARIGRGKQVDWFLLSEAYKIGEIAPNPAEVEESYEGAFVLEPSR |
| GLHKNVVCLDFASMYPSIMIAYNISPDTYVFGKCDDCYVAPEVGHKFRKH |
| PDGFFKRILKMLIEKRREIKNQMKSLDRNSREYLLLNIKQQTLKILTNSF |
| YGYTGWSGARWYCRQCAEATTAWGRHLIKSAVEIAKKLGFEVLYGDTDSI |
| FVKKGNLSLEKIRGEVEKLIEEISEKFPVQIEVDEYYKTIFFVEKKRYAG |
| LTEDGILVVKGLEVRRGDWCELAKEVQKKVIEIILKEENPEKAAEYVRKV |
| INDIKSGKVKLEDVVIYKGLTKRPDKYESKQAHVKAALRAMELGIVYNVG |
| SKVGFVVVEGAGNVGDRAYPIDLIEEFDGENLVIRTRSGSIVKKLDKDYY |
| INHQIIPSVLRILERFGYNEASLKGATQKTLDAFW |
| SEQ ID NO: 50 |
| MILDADYITENGKPVVRIFKKENGEFKVEYDRNFEPYIYALLKDDSAIEE |
| IKKITAERHGTVVRITKAEKVERKFLGRPVEVWKLYFTHPQDVPAIRDKI |
| RSHPAVVDIYEYDIPFAKRYLIDKGLVPMEGDEELKMLAFDIETLYHEGE |
| EFAEGPILMISYADESEARVITWKKVDLPYVDAVSTEKDMIKAFLRVVKE |
| KDPDVLITYNGDNFDFAYLKKRCEKLGVKFILGRDGSEPKIQRMGDRFAV |
| DVKGRIHFDLYPVIRRTINLPTYTLEAVYEAIFGRPKEKVYAEEIAQAWE |
| TNEGLERVARYSMEDAKVTYELGKEFFPMEAQLSRLIGQPLWDVSRSSTG |
| NLVEWFLLRKAYERNELAPNKPSGREYDERRGGYAGGYVKEPEKGLWENI |
| VYLDYKSLYPSIIITHNVSPDTLNREGCKEYDVAPQVGHRFCKDFPGFIP |
| SLLGDLLEERQKIKRKMKATIDPIERRLLDYRQRAIKILANSYYGYYGYA |
| RARWYCKECAESVTAWGREYIEMSIREIEEKYGFKVLYADTDGFHATIPG |
| EDAETIKKKAMEFLKYINSKLPGALELEYEGFYRRGFFVTKKKYAVIDEE |
| GKITTRGLEIVRRDWSEIAKETQARVLEALLKDGNVEEAVSIVKEVTEKL |
| SKYEVPPEKLVIHEQITRELKDYKATGPHVAIAKRLAARGVKIRPGTVIS |
| YIVLKGSGRIGDRAIPFDEFDPAKHRYDAEYYIENQVLPAVERILKAFGY |
| RKEDLRYQKTRQVGLGAWLKPKGKK |
| SEQ ID NO: 51 |
| MILDTDYITENGKPVIRVFKKENGEFKIEYDRTFEPYFYALLKDDSAIED |
| VKKVTAKRHGAVVKVKRAEKVQRKFLGRPIEVWKLYFTHPQDVPAIRDKI |
| RAHPAVVDIYEYDIPFAKRYLIDKGLIPMEGDEELRMLAFDIETLYHEGE |
| EFGTGPILMISYADENEARVITWKKIDLPYVDVVSTEKEMIKRFLRVVKE |
| KDPDVLITYNGDNFDFAYLKKRCEKLGIKFTLGRDGSEPKIQRMGDRFAV |
| EVKGRIHFDLYPVIRRTINLPTYTLEAVYEAVFGKPKEKVYAEEITEAWE |
| SGEGLERVARYSMEDAKVTYELGREFFPMEAQLSRLIGQSLWDVSRSSTG |
| NLVEWFLLRKAYERNELAPNKPDERELARRRESYAGGYVKEPERGLWDNI |
| VYLDFRSLYPSIIITHNVSPDTLNREGCKEYDVAPEVGHKFCKDFPGFIP |
| SLLGDLLEERQKIKRKMKATIDPLEKKLLDYRQRAIKILANSFYGYYGYA |
| KARWYCKECAESVTAWGREYIETTIREIEEKFGFKVLYADTDGFFATIPG |
| ADAETVKKKAKEFLKYINAKLPGLLELEYEGFYVRGFFVTKKKYAVIDEE |
| GKITTRGLEIVRRDWSEIAKETQARVLEAILKHGDVEEAVRIVKEVTEKL |
| SKYEVPPEKLVIHEQITRDLRDYKATGPHVAVAKRLAAKGVKIRPGTVIS |
| YIVLKGSGRIGDRAIPADEFDPTKHRYDAEYYIENQVLPAVERILKAFGY |
| RKEDLRYQKTKQVGLGAWLKVKGKK |
| SEQ ID NO: 52 |
| MILDTDYITEDGKPVIRIFKKDNGEFKIEYDRNFEPYIYALLRDDSAIED |
| VKKITAERHGRVVKVKRAEKVKKKFLGRPVEVWKLYFTRPQDVPAIRDRI |
| RAHPAVVDIYEYDIPFAKRYLIDKGIIPMEGDEELKMLAFDIETLYHEGE |
| EFAEGPILMISYADENEARVITWKKIDLPFVDVVSTEKEMIKRFLKVIKE |
| KDPDVLITYNGDNFDFAYLKKRCEKFGIKFTLGRDGSDPKIQRMGDRFAV |
| EVKGRIHFDLYPVILRTVNLPTYTLEAVYEAIFGTPKEKVYPEEITTAWE |
| TGEGLERVARYSMEDAKVTFELGREFFPMEAQLSRLVGQSFWDVSRSSTG |
| NLVEWFLLRKAYERNELAPNKPDERELVRRRNSYTGGYVKEPERGLWDNI |
| VYLDFRSLYPSIIITHNVSPDTLNREGCKEYDEAPQVGHKFCKDFPGFIP |
| SLLGNLLDERQKIKKRMKATIDPLEKKLLDYRQRAIKILANSYYGYYAYA |
| RARWYCKECAESVTAWGREYIEMSIREIEEKYGFKVLYADTDGFHATIPG |
| ADAETVKKKAMEFLKYINAKLPGALELEYEGFYKRGFFVTKKKYAVIDEE |
| GKITTRGLEIVRRDWSEIAKETQARVLEALLKDGNVEEAVSIVKEVTEKL |
| GKYEVPPEKLVIHEQITRELKDYKATGPHVAIAKRLAARGVKIRPGTVIS |
| YIVLKGSGRIGDRAIPFDEFDPTKHRYDAEYYIENQVLPAVERILKAFGY |
| RAEDLRYQKTRQVGLGVWLQPKGKK |
| SEQ ID NO: 53 |
| MELAFWLLDITYGVIGNTPELRLFGITDDGKRVLVLDRSFRPYFYVIPSG |
| DVNAVFNNVKRKLEGKVLNVEVIKRKMFGNEVDAIRVTATIPEKVRELRE |
| LAAEVPGVEDVLEADIRFSQRYLLDMGVKPSNWIVVDQCEEVKGNYQVDL |
| VCLAKSRPRMIEEHKLPSFRVLAFDIEVYNPRGMPNPDRDPVIIISTMTK |
| EDGVKMFVVDDNKNDAKIIREFLDYFRKYDPDIVVGYNNNGFDWPYLVNR |
| SSRVGVRLALSRMGNPPEPSVYGHWSIIGRANVDLYNFIEEISEIKVKSL |
| DRAAEFFGIMKRSERVLIPGHRIHEYWDDKNKRDLLLKYARDDVVSTYGL |
| AEKLLPFAIQLSSISGLPLDQVGAASVGARVEWMIFYEAVKRGELAPNRE |
| ERPYETYKGAVVLEPRPGLHENIAVIDFSSMYPSIMMKYNVSPDTLVLGD |
| CGDCYVAPEVNYKFRRSPEGLYPGLLRILVESRRRVRDLMKKYPENSPEW |
| VLLNERQRALKVMANAMYGYCGWLGARWYRREVAEAVTAWGRNLLRTVIE |
| KARSLGLPIIYGDTDSLFVRNISDKVDALINYVNNELGFEVKVDKVYRRV |
| LFTEAKKRYVGLTVEGEVDIVGFEAVRGDWAEIAKDVQENVAEIVLTTGD |
| VGKAISYVKSVIDKVKAYQFDIDDVIIWKTLDKSLNEYKVLTPHVAAAKQ |
| LVEAGYKVGKGDMIGYVVVKGGGAKLAYKVKPYILIKDIREVDVDYYVEK |
| QIVPAAMRILEVLGVKESQLMEGKAGKSILDYFS |
| SEQ ID NO: 54 |
| MLRTVWVDYARKGEPDVILVGRREDGNPAALVVKGFRPYFYAEVEDGFDP |
| SEVERLSGVVEVEEVLLEHPYGGDRVELLRIVATYPKVVPKLREQVKKLD |
| GVKEVYEADIPFVRRAAVDLNLPPASEVDVSDLDTGSWSGLPAYFADVED |
| ARELDHRPYPIEDLVVASFDLEVLAEPGTTIKGASGPIIAISFAYSTPDG |
| ERRNYVITWKGEDESFEVDGVETEVIVCRSEAAALRRFFDEFRRVDPDVV |
| FTYNGDEFDLPYLQHRAGKLGIDVSPLARPAGKRGIILKHGGGRYASDIF |
| GRAHVDLYHTARKNLKLERFTLEEAVKDVLGVEKEEMELADINEAWKRGN |
| LDELMRYSAEDAHYTLELGLELAQVELELSYLTRLPLPDATRFSFGQLAE |
| WRAIYKARQEDILVPNKPTRDEYKRRRRKAYKGAIVFEPEIGLHENVVCV |
| DFASLYPNVMVAHNISPDTFDCDCCPRVTVEEVDDPTDATVAPDVGHKFC |
| KRRKGFFPRLVEGLIERRRELKRRLRKLDTESHPHEAKILDVRQQAYKVL |
| ANSYYGYMGWANARWFCRECAESVTAWGRYYISEVRRIAEEKYGLKVVYG |
| DTDSLFVKLPDADLEETIERVKEFLKEVNGRLPVELELEDAYKRILFVTK |
| KKYAGYTEDGKIVTKGLEVVRRDWAPIARETQRRVLKRILADNDPEAALK |
| EIHEVLERLKSGDVDIDELAVTSQLTKKPSEYVQKGPHVRAALRLARHLG |
| VEPEPGTIVRYVIVRGPGSVSDKAYPVELVREEGKEPDVDYYIEHQILPA |
| VERIMRAIGYSRGQIVGETASQKTLDQFFG |
| SEQ ID NO: 55 |
| MELKIWPLDVTYAVVGGYPEVRVFGLTEGGGRVVLVDRSFKPYFYVDCPT |
| CEVGVVKSSLSRVAPVDEVSAAERRFLGRPRRFLMVVARVPEDVRRLREA |
| AAQIPGVAGVYEADIRFYMRYMIDVGLLPCSWNRAEVEGGGKVGGLPQYT |
| VVQWLGPAGGFPPPLRVLAFDIEVYNERGTPDPARDPVVMIAVKTDDGRE |
| EVFEAEGRDDRGVLRSFVEFVKSYDPDVVVGYNSNGFDWPYLAGRARAIG |
| VPLRVDRLGGLPQQSVYGHWSIVGRANVDLYGIVEEFPEIKLKTLDRVAE |
| YFGVMRREERVLIPGHKIYEYWRDPGKRPLLRQYVLDDVRSTLGLADKLL |
| PFLIQLSSVSGLPLDQVAAASVGNRVEWMLLRYAYRLGEVAPNREEREYE |
| PYKGAIVLEPKPGMYEDVLVLDFSSMYPNIMMKYNLSPDTYLEPGEPDPP |
| EGVNAAPEVGHRFRRSPLGFVPQVLKSLVELRKAVREEAKRYPPDSPEFR |
| ILDERQRALKVMANAMYGYLGWVGARWYKREVAESVTAFARAILKDVIEQ |
| ARRLGIVVVYGDTDSLFVKKHVNVDKLIQYVEEKYGIEIKVDKDYAKVLF |
| TEAKKRYAGLLRDGRIDIVGFEVVRGDWSELAKEVQLKVVEIILNSRDVA |
| EARRRVTQYVREIIERLREYKFNVDDLIIWKTLDKELGEYKAYPPHVHAA |
| LILKRHGYKVGKGNMVGYVVVKGGGKISEKALPYILLDDVKKIDVEYYIE |
| RQIIPAALRIAEVIGVKEADLKTGKSERSLLDFF |
| SEQ ID NO: 56 |
| MKTFLTEQQIKVLMLRAKGYKQSEIAKILGTSRANVSILEKRAMEKIEKA |
| RNTLLLWEQINSKVIVEIKAGEDIFSIPEKFFKKADKVGVKVPYSTAEII |
| TFLVEHAPVEDRLAKRDFVLFLDSKNKLRIGDCLVIEEIKED |
| SEQ ID NO: 57 |
| MPITKVTRNYQITIPAEIRKALGIKEGELLEVRLENGKIIIERLKKERKT |
| LKLGKKLTLEEIEKAIEEGMKQCMQ |
| SEQ ID NO: 58 |
| TKIEILRLLKEREMYAYEIWSLLGKPLKYQAVHQHIKELLELGLVEQAYR |
| KGKRVYYKITEKGLRILQNFEDLENI |
| SEQ ID NO: 59 |
| MNTGAQGVSEMSRMKIISVQLPQSLIHGLDALVKRGIYPNRSEAIRVAIR |
| ELLKKELYKEEIQEEIPEYVVK |
| SEQ ID NO: 60 |
| VIIPRPIDPRDIRRIRKELGITQEELARKAGVTQAYIAKLEAGKVDPRLS |
| TFNKILRALIECQKAKI |
| SEQ ID NO: 61 |
| NNCECMVVKEKLYTVKQASEILGVHPKTIQKWDREGKIKTVRTPGGRRRI |
| PESEIKRLLGISEEK |
| SEQ ID NO: 62 |
| MLKDSAPKRKILEELRKGETVSGDYLASKLGVSRVAIWKHIRELKELGYG |
| IIADKKGYKLVYEPKKPYPWE |
| SEQ ID NO: 63 |
| MIDERDKIILEILEKDARTPFTEIAKKLGISETAVRKRVKALEEKGIIEG |
| YTIKINPKKLGYSLVTITGVDTKPEKLFEVAEKLKE |
| SEQ ID NO: 64 |
| MEIDDLDRKILSLLIEDSRLSYREIAKKLNVAVGTIYNRIKKLEDMGVIQ |
| GFTVKLNYEKLGYELTAIIGIKAQGKK |
| SEQ ID NO: 65 |
| EMLWMYILKLLKDRPMYAYEIRNELKKRFGFEPATVSSYVVLYRLEEGGY |
| VSSEWHESEAGRPSRKYYRLTEKGEKLLEKGIETIEDVLNMLKS |
| SEQ ID NO: 66 |
| MKVSKATASKVLRSLENKGIVERERRGKTYLVRLTNKGLELLEEISKAGK |
| ELDEKIFAEMSVDERIVL |
| SEQ ID NO: 67 |
| SEDYMLQNRRKVLAKVLELLNYNPKALNISELARMFGVSRDTIYNDIQQI |
| IKNVEV |
| SEQ ID NO: 68 |
| SKEISRFLKVISNPIRYGILKMLNDRWMCVCLISEALEIDQTLVSHHIRI |
| LKELDLLEERKEGKLRFYRTNKEKLREYLEKVLEDFNHGTSKGS |
| SEQ ID NO: 69 |
| MCRKDVMIISDPKQIKALSDPTRVKILELLRYHPMTVSEISRVIGKDKST |
| IYRHIKALEEAGLVEEVEKIGNETVYGR |
| SEQ ID NO: 70 |
| MEPVEFKLNQKGIKSILPTMEAEIMEYMWEIKEATAGEVYEYMKTKYPEI |
| RRSTVSILMNRLCERGLLKRRMEKGKGGIRYVYSITTTREEFERKVVEKI |
| IESLMMNFREATFAYLSKINKK |
| SEQ ID NO: 71 |
| MKKSNLDLLILLAKAGGIEKEILTTSRELSKMLNVSPQTIVRWLEDLEKD |
| GLIKKSESRKGTLVTITEEGVKFLEKLHEELSDALYR |
| SEQ ID NO: 72 |
| MEIPPEISHALSEIGFTKYEILTYWTLLVYGPSTAKEISTKSGIPYNRVY |
| DTISSLKLRGFVTEIEGTPKVYAAYSPRIAFFRFKKELEDIMKKLEIELN |
| NVKK |
| SEQ ID NO: 73 |
| IINPQARLTPLELEILEIIKQKKSITITEIKEILSERRKSEYPLSLVSEY |
| ISRLERKGYVKKIAKGRKKFVEALI |
| SEQ ID NO: 74 |
| GIDVVIPEIKHDPIARDIVKILFDLRRANVSQIARELKGRRGKASRNTVR |
| KKLKELEKLGVVKEVPGERGSVYTLSREVVKKWLDLIGIPINLL |
| SEQ ID NO: 75 |
| MTKRVKVITDPEVIKVMLEDTRRKILQLLRNREMTISQLSEILGKMPQTI |
| YHHIEKLKEAGLVEVKR |
| SEQ ID NO: 76 |
| MEEIKEIMKSHTLGNPVRLGIMIYLFPRRRAPFSHIQKALDLTPGNLDSH |
| IKVLEKHGFVRTYKVIADRPRTMVEITDYGMEETRKFLSHLKTVIDAIHF |
| SEQ ID NO: 77 |
| MGEELNRLLDVLGNETRRRILFLLTKRPYFVSELSRELGVGQKAVLEHLR |
| ILEEAGLIESRVEKIPRGRPRKYYMIKKGLRLEILLTPTLFGSEMYEAK |
| SEQ ID NO: 78 |
| MRRMDKVDLQLIKILSQNSRLTYRELAEMLGTTRQRVARKVDKLKKLGII |
| RKFTIIPNLEK |
| SEQ ID NO: 79 |
| GRKVRTQQNEILNLLNEKEKAVLRAILEHGGEIKQEDLPELVGYSRPTIS |
| KVIQELENKGLIKREKSGKTFVVKIERKIKLD |
| SEQ ID NO: 80 |
| KSLQRFLRRNTTSIKHLSEITGVARNRLSDILNGKTQKIRGETLRKIAKA |
| FEKSNILSF |
| SEQ ID NO: 81 |
| DVIQRIKEKYDEFTNAEKKIADTILSDPKGIIESSISDLSEKAGVKSEAS |
| VVKFYKKLGLNSFQQFKVLLAQSISRAPLEIVYEDVSSEDDTKTITEKIF |
| KATVRAI |
| SEQ ID NO: 82 |
| KIRDKILNVYTQFSPAERKVADYVLERPDDVIHYSITEFAKIVGVSETTI |
| HRMIKKLDFEGYQAFKIALARELSGLEETIERRDFIDEEIDILRRLKDTL |
| D |
| SEQ ID NO: 83 |
| KRRPTINDVAKLAGVSISTVSRYLKDPSQVSEKLGERIREAIKKLGYKPN |
| KIAQGLRTGD |
| SEQ ID NO: 84 |
| MASIKDVAKLAGVSIATVSRVINGYNNVSEETRKKVIDAIRKLNYHPVYA |
| VKGAVLKR |
| SEQ ID NO: 85 |
| MKKKYVTIRDIAEKAGVSINTVSRALNNKPDISEETRRKILKIAQELGYV |
| KNATASSLRSK |
| SEQ ID NO: 86 |
| MPTIEDVAKLAGVSIATVSRVINGSGYVSEKTRYKVWKAIEELGYKPEIS |
| AKLLASKG |
| SEQ ID NO: 87 |
| MRIGEKLRKLRLSRGLTQEELAERTDLSRSFISQLESDKTSPSIDTLERI |
| LEALGTDLKHF |
| SEQ ID NO: 88 |
| MHMKTVRQERLKSIVRILERSKEPVSGAQLAEELSVSRQVIVQDIAYLRS |
| LGYNIVATPRGYVLAGG |
| SEQ ID NO: 89 |
| MNTLKKAFEILDFIVKNPGDVSVSEIAEKFNMSVSNAYKYMVVLEEKGFV |
| LRKKDKRYVPGYKLIEYGSFVLRRF |
| SEQ ID NO: 90 |
| MKISKKRRQELIRKIIHEKKISNQFQIVEELKKYGIKAVQPTVARDLKEI |
| GAVKIMDESGNYVYKLLDETPVIDPWKELKR |
| SEQ ID NO: 91 |
| MHKKLNPKSMKRENKKMVLRYLIESGPHSRVEIARKTGLAQSAIWRIIEE |
| LVNEGLVEEKGTATGRRRKAVTYGPTRSFITS |
| SEQ ID NO: 92 |
| MPSPLLRRENKIKILRYILKNGKTTRNQLASNLNLAHSTLSYIIDELLDE |
| GFLVFEEIKKKRGRPYQILSVNPEKFTAI |
| SEQ ID NO: 93 |
| MKEERLKEILDIVDRNGFISMKDLQEQLGVSMITVRRDVAELVKRNLVKK |
| VHGGIRKVNYFEKETDFMKRLSINREAKE |
| SEQ ID NO: 94 |
| MFTMRSEYALRLMIVMAKEYGNYLSMTEILEKAKQSVPREFAEKILYTLK |
| KAGLVKTRRGKSGGYMLSRPPKEIKVSEIVFLLDRKSKVFFDMPGCPDEL |
| DCVIRALWKRVENEIEKILSGVTLEDLVREQEEKMKQ |
| SEQ ID NO: 95 |
| MRDTKGHLKFLVLHIISQQPSHGYVIMKKISQIIGAEPPSPGALYPILSS |
| LRKQKYIETYNEGKRKVYRLTDKGRKYLEEHKEEIKKALDFAERF |
| SEQ ID NO: 96 |
| MRHRGGRGFRGWWLASTILLLVAEKPSHGYELAERLAEFGIEIPGIGHMG |
| NIYRVLADLEESGFLSTEWDTTVSPPRKIYRITPQGKLYLREILRSLEDM |
| KRRIETLEERIKRVLQEE |
| SEQ ID NO: 97 |
| MLSKRDAILKAAVEVFGKKGYDRATTDEIAEKAGVAKGLIFHYFKNKEEL |
| YYQAYMSVTEKLQKEFENFL |
| SEQ ID NO: 98 |
| MSKSWGKFIEEEEAEMASRRNLMIVDGTNLGFRFKHNNSKKPFASSYVST |
| IQSLAKSYSARTTIVLGDKGKSVFRLEHLPEYKGNRDEKYAQRTEEEKAL |
| DEQFFEYLKDAFELCKTTFPTFTIRGVEADDMAAYIVKLIGHLYDHVWLI |
| STDGDWDTLLTDKVSRFSFTTRREYHLRDMYEHHNVDDVEQFISLKAIMG |
| DLGDNIRGVEGIGAKRGYNIIREFGNVLDIIDQLPLPGKQKYIQNLNASE |
| ELLFRNLILVDLPTYCVDAIAAVGQDVLDKFTKDILEIAEQ |
| SEQ ID NO: 100 |
| MEEKVGNLKPNMESVNVTVRVLEASEARQIQTKNGVRTISEAIVGDETGR |
| VKLTLWGKHAGSIKEGQVVKIENAWTTAFKGQVQLNAGSKTKIAEASEDG |
| FPESSQIPENTPTAPQQMRGGGRGFRGGGRRYGRRGGRRQENEEGEEE |
| SEQ ID NO: 101 |
| MTLEEARKRVNELRDLIRYHNYRYYVLADPISDAEYDRLLRELKELEERF |
| PELKSPDSPTLQVGARPLEATFRPVRHPTRMYSLDNAFNLDELKAFEERI |
| ERALGRKGPFAYTVEHKVDGLSVNLYYEEGVLVYGATRGDGEVGEEVTQN |
| LLTIPTIPRRLKGVPERLEVRGEMPIEAFLRLNEELEERGERIFKNPRNA |
| AAGSLRQKDPRITAKRGLRATFYALGLGLEEVEREGVATQFALLHWLKEK |
| GFPVEHGYARAVGAEGVEAVYQDWLKKRRALPFEADGVVVKLDELALWRE |
| LGYTARAPRFAIAYKFPAEEKETRLLDVVFQVGRTGRVTPVGILEPVFLE |
| GSEVSRVTLHNESYIEELDIRIGDWVLVHKAGGVIPEVLRVLKERRTGEE |
| RPIRWPETCPECGHRLLKEGKVHRCPNPLCPAKRFEAIRHFASRKAMDIQ |
| GLGEKLIERLLEKGLVKDVADLYRLRKEDLVGLERMGEKSAQNLLRQIEE |
| SKKRGLERLLYALGLPGVGEVLARNLAARFGNMDRLLEASLEELLEVEEV |
| GELTARAILETLKDPAFRDLVRRLKEAGVEMEAKEKGGEALKGLTFVITG |
| ELSRPREEVKALLRRLGAKVTDSVSRKTSYLVVGENPGSKLEKARALGVP |
| TLTEEELYRLLEARTGKKAEELV |
| SEQ ID NO: 102 |
| MILDADYITEDGKPIIRIFKKENGEFKVEYDRNFRPYIYALLKDDSAIDD |
| VKKITAERHGKVVRVVDVEKVKKKFLGRPIEVWKLYFEHPQDVPAIRDKI |
| REHPAVIDIFEYDIPFAKRYLIDKGLIPMEGNEELKLLAFDIETLYHEGE |
| EFGKGPIIMISYADEEGAKVITWKKVDLPYVEVVSSEREMIKRFLKVIRE |
| KDPDVIITYNGDNFDFPYLLKRAEKLGMKLPLGRDGSEPKMQRLGDSLAV |
| EIKGRIHFDLYPVIRRTINLPTYTLEAVYEAIFGKPKEKVYPHEIAEAWE |
| TGKGLERVAKYSMEDAKVTYELGREFFPMEAQLARLVGQPLWDVSRSSTG |
| NLVEWYLLRKAYERNELAPNKPDEREYERRLRESYEGGYVKEPEKGLWEG |
| IVSLDFRSLYPSIIITHNVSPDTLNKEGCGEYDVAPEVGHRFCKDFPGFI |
| PSLLGSLLDERQKIKRRMKASKDPIERKLLDYRQRAIKILANSYYGYYGY |
| AKARWYCKECAESVTAWGREYIELVRRELEERGFKVLYIDTDGLYATIPG |
| EKNWEEIKRRALEFVNYINAKLPGLLELEYEGFYTRGFFVTKKKYALIDE |
| EGKIITRGLEIVRRDWSEIAKETQAKVLEAILKHGNVEEAVKIVKEVTEK |
| LSKYEIPPEKLVIYEQITRPLNEYKAIGPHVAVAKRLAARGIKVRPGMVI |
| GYVVLRGDGPISKRAIAAEEFDPKKHKYDAEYYIENQVLPAVLRILEAFG |
| YRKEDLRWQKTKQVGLGAWLKVKKS |
1. A composition for assembling a synthon, comprising:
(a) a 5′-3′ exonuclease;
(b) a strand-displacing polymerase;
(c) optionally a single strand DNA binding protein; and
(d) a non-naturally occurring buffering agent
wherein the composition does not comprise a crowding agent and/or a non strand-displacing polymerase.
2. The composition according to claim 1, further comprising a ligase and/or a single strand binding domain.
3. The composition according to claim 1, further comprising a set of at least two polynucleotides.
4. The composition according to claim 1, wherein the strand-displacing polymerase is non-naturally occurring.
5. The composition of claim 4, wherein the strand-displacing polymerase is a mutant or a fusion protein.
6. The composition according to claim 1, wherein the strand-displacing polymerase is thermostable.
7. The composition according to claim 1, wherein the strand-displacing polymerase is a Family B polymerase and the composition excludes a non strand-displacing polymerase.
8. The composition according to claim 1, wherein 9° N, Phusion, Vent or Pfu DNA polymerases are not included.
9. The composition according to claim 1, wherein the strand-displacing polymerase is a fusion protein wherein the polymerase moiety has an amino acid sequence that is at least 90% identical to SEQ ID NO:1 or SEQ ID NO:102, or any of SEQ ID NOs:33-55.
10. The composition according to claim 9, wherein the fusion protein has an amino acid sequence that is at least 90% identical to SEQ ID NO:1 and SEQ ID NO:2.
11. The composition according to claim 1, wherein the strand-displacing polymerase has at least 90% sequence identity to SEQ ID NO:3.
12. The composition according to claim 1, wherein (c) is the single strand DNA binding protein, the single strand DNA binding protein being an extreme thermostable single-stranded DNA binding protein (ET SSB), E. coli recA, T7 gene 2.5 product, phage lambda RedB or Rac prophage RecT.
13. The composition according to claim 1, wherein the 5′-3′ exonuclease has single strand endonuclease activity.
14. The composition according to claim 1, wherein the 5′-3′ exonuclease has at least 90% sequence identity with SEQ ID NO:98.
15. The composition according to claim 1, further comprising a potassium salt having a concentration of at least 7 mM.
16. The composition according to claim 1, further comprising a set of polynucleotides wherein at least one polynucleotide in the set has a sequence that overlaps with another polynucleotide in the set; and wherein the polynucleotides are selected from: (i) double stranded polynucleotides; (ii) single stranded oligonucleotides; (iii) at least one double stranded polynucleotide and at least one single strand oligonucleotide; and (iv) a subpopulation of polynucleotides that are otherwise identical to one another except for a sequence that varies between the members of the sub-population.
17. The composition according to claim 16, wherein at least one member of the set of polynucleotides contains a random sequence positioned between a defined sequence at each end for hybridizing to a second single strand genomic polynucleotide.
18. The composition according to claim 17, wherein the random sequence is single stranded and is capable of hybridizing to a target genomic sequence for guiding a Cas protein to a target genomic nucleic acid for gene editing.
19.-64. (canceled)