US20220389460A1
2022-12-08
17/840,152
2022-06-14
Disclosed herein are methods and compositions useful in targeting a payload to, or editing a target nucleic acid, where a governing gRNA molecule is used to target, optionally inactivate, a Cas9 molecule or a Cas9 molecule/gRNA complex.
Get notified when new applications in this technology area are published.
C12N15/902 » CPC main
Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor; Recombinant DNA-technology; Introduction of foreign genetic material using processes not otherwise provided for, e.g. co-transformation; Stable introduction of foreign DNA into chromosome using homologous recombination
C12N15/111 » CPC further
Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor; Recombinant DNA-technology; DNA or RNA fragments; Modified forms thereof General methods applicable to biologically active non-coding nucleic acids
C12N15/1137 » CPC further
Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor; Recombinant DNA-technology; DNA or RNA fragments; Modified forms thereof; Non-coding nucleic acids modulating the expression of genes, e.g. antisense oligonucleotides against enzymes
C12N2310/10 » CPC further
Structure or type of the nucleic acid Type of nucleic acid
C12N2310/20 » CPC further
Structure or type of the nucleic acid; Type of nucleic acid involving clustered regularly interspaced short palindromic repeats [CRISPRs]
C12N2800/80 » CPC further
Nucleic acids vectors Vectors containing sites for inducing double-stranded breaks, e.g. meganuclease restriction sites
C12N15/90 IPC
Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor; Recombinant DNA-technology; Introduction of foreign genetic material using processes not otherwise provided for, e.g. co-transformation Stable introduction of foreign DNA into chromosome
C12N15/63 » CPC further
Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor; Recombinant DNA-technology Introduction of foreign genetic material using vectors; Vectors; Use of hosts therefor; Regulation of expression
C12N15/11 » CPC further
Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor; Recombinant DNA-technology DNA or RNA fragments; Modified forms thereof
C12N15/113 IPC
Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor; Recombinant DNA-technology; DNA or RNA fragments; Modified forms thereof Non-coding nucleic acids modulating the expression of genes, e.g. antisense oligonucleotides
C12N9/22 » CPC further
Enzymes; Proenzymes; Compositions thereof ; Processes for preparing, activating, inhibiting, separating or purifying enzymes; Hydrolases (3) acting on ester bonds (3.1) Ribonucleases RNAses, DNAses
The present application is a divisional of U.S. Ser. No. 16/835,386, filed Mar. 31, 2020, which is a continuation of U.S. Ser. No. 16/256,615, filed Jan. 24, 2019, now U.S. Pat. No. 10,640,788 issued May 5, 2020, which is a continuation of Ser. No. 15/825,616, filed Nov. 29, 2017, now U.S. Pat. No. 10,190,137 issued Jan. 29, 2019, which is a divisional of U.S. Ser. No. 14/536,319, filed Nov. 7, 2014, now U.S. Pat. No. 9,834,791, issued Dec. 5, 2017, which claims the benefit of U.S. Provisional Application No. 61/901,215, filed Nov. 7, 2013, the contents of which are incorporated by reference herein in their entireties.
The instant application contains a Sequence Listing which has been submitted electronically in ASCII format and is hereby incorporated by reference in its entirety. Said ASCII copy, created on Dec. 18, 2014, is named C2159-704110_SL.txt and is 501,350 bytes in size.
The invention relates to CRISPR-related methods and components for editing of, or delivery of a payload to, a target nucleic acid sequence.
CRISPRs (Clustered Regularly Interspaced Short Palindromic Repeats) evolved in bacteria as an adaptive immune system to defend against viral attack. Upon exposure to a virus, short segments of viral DNA are integrated into the CRISPR locus. RNA is transcribed from a portion of the CRISPR locus that includes the viral sequence. That RNA, which contains sequence complimentary to the viral genome, mediates targeting of a Cas9 protein to to a target sequence in the viral genome. The Cas9 protein cleaves and thereby silences the viral target.
Recently, the CRISPR/Cas system has been adapted for genome editing in eukaryotic cells. The introduction of site-specific double strand breaks (DSBs) allows for target sequence alteration through one of two endogenous DNA repair mechanisms—either non-homologous end-joining (NHEJ) or homology-directed repair (HDR). The CRISPR/Cas system has also been used for gene regulation including transcription repression and activation without altering the target sequence. Targeted gene regulation based on the CRISPR/Cas system uses an enzymatically inactive Cas9 (also known as a catalytically dead Cas9).
Despite the recent advances adapting the CRISPR/Cas system for genome editing in eukaryotic cells, there remains a need for improved regulation and control of these systems for use in eukaryotic cells.
Disclosed herein are methods and compositions, e.g., a Cas9 molecule complexed with a gRNA molecule, that can be used to target a specific location in a target DNA. Depending on the Cas9 molecule/gRNA molecule complex used in the disclosed methods and compositions, specific editing of a target nucleic acid, or the delivery of a payload, can be effected.
Methods and compositions that use, or include, a nucleic acid, e.g., a DNA, that encodes a Cas9 molecule or a gRNA molecule, can, in addition, use or include a “governing gRNA molecule.” The governing gRNA molecule can complex with the Cas9 molecule to inactivate or silence a component of a Cas9 system. In one aspect, the disclosure features a gRNA molecule, referred to herein as a governing gRNA molecule, comprises a targeting domain which targets a component of the Cas9 system. In an embodiment, the governing gRNA molecule targets and silences (1) a nucleic acid that encodes a Cas9 molecule (i.e., a Cas9-targeting gRNA molecule), (2) a nucleic acid that encodes a gRNA molecule (i.e., a gRNA-targeting gRNA molecule), or (3) a nucleic acid sequence engineered into the Cas9 components that is designed with minimal homology to other nucleic acid sequences in the cell to minimize off-target cleavage (i.e., an engineered control sequence-targeting gRNA molecule).
The targeting sequence for the governing gRNA can be selected to increase regulation or control of the Cas9 system and/or to reduce or minimize off-target effects of the system. For example, a governing gRNA can minimize undesirable cleavage, e.g., “recleavage” after Cas9 mediated alteration of a target nucleic acid or off-target cutting of Cas9, by inactivating (e.g., cleaving) a nucleic acid that encodes a Cas9 molecule. In an embodiment, a governing gRNA places temporal or other limit(s) on the level of expression or activity of the Cas9 molecule/gRNA molecule complex. In an embodiment, the governing gRNA reduces off-target or other unwanted activity.
A target sequence for the governing gRNA can be disposed in the control or coding region of the Cas9 encoding sequence. This can be a Cas9 sequence or a non-Cas9 sequence, e.g., a sequence which is selected for, or which results in, reduced or minimized off target effect. The silencing, or inactivation, can be effected by cleaving the targeted nucleic acid sequence or by binding a Cas9 molecule/governing gRNA molecule complex to the targeted nucleic acid sequence.
In an aspect, the disclosure features a gRNA molecule that targets, optionally inactivates, a Cas9 molecule. In an embodiment, the gRNA molecule targets a nucleic acid sequence that encodes the Cas9 molecule. For example, a sequence that encodes the Cas9 molecule can comprise one or more of: a sequence encoding the amino acid sequence of the Cas9 molecule, a sequence encoding the amino acid sequence of the Cas9 molecule comprising non-translated sequence, or a sequence encoding the amino acid sequence of the Cas9 molecule comprising non-transcribed sequence.
In an embodiment, the Cas9 molecule is an eaCas9 molecule. In another embodiment, the Cas9 molecule is an eiCas9 molecule.
In an embodiment, the gRNA is configured to provide a Cas9 molecule-mediated cleavage event in the nucleic acid sequence that encodes the Cas9 molecule. In an embodiment, the gRNA molecule comprises a targeting domain configured to provide a Cas9 molecule-mediated cleavage event in the nucleic acid sequence that encodes the Cas9 molecule.
In an embodiment, the gRNA molecule:
targets the Cas9 molecule-amino acid coding sequence of the nucleic acid sequence;
is configured to provide a Cas9 molecule-mediated cleavage event in the Cas9 molecule-amino acid coding sequence of the nucleic acid sequence; or comprises a targeting domain configured to provide a Cas9 molecule-mediated cleavage event in the Cas9 molecule-amino acid coding sequence of the nucleic acid sequence.
In an embodiment, the gRNA molecule:
targets a non-coding sequence of the nucleic acid sequence;
is configured to provide a Cas9 molecule-mediated cleavage event in a non-coding sequence of the nucleic acid sequence; or
comprises a targeting domain configured to provide a Cas9 molecule-mediated cleavage event in a non-coding sequence of the nucleic acid sequence.
In an embodiment, the gRNA molecule:
targets an untranslated sequence of the nucleic acid sequence;
is configured to provide a Cas9 molecule-mediated cleavage event in an untranslated sequence of the nucleic acid sequence; or
comprises a targeting domain configured to provide a Cas9 molecule-mediated cleavage event in an untranslated sequence of the nucleic acid sequence.
In an embodiment, the gRNA molecule:
targets the nucleic acid sequence 5′ of the Cas9 molecule-amino acid coding region;
is configured to provide a Cas9 molecule-mediated cleavage event in the nucleic acid sequence 5′ of the Cas9 molecule-coding region; or comprises a targeting domain configured to provide a Cas9 molecule-mediated cleavage event 5′ of the Cas9 molecule-coding region of the nucleic acid sequence.
In an embodiment, the gRNA molecule:
targets the nucleic acid sequence that encodes the Cas9 molecule 3′ of the Cas9 molecule-coding region;
is configured to provide a Cas9 molecule-mediated cleavage event in the nucleic acid sequence 3′ of the Cas9 molecule-coding region; or
comprises a targeting domain configured to provide a Cas9 molecule-mediated cleavage event 3′ of the Cas9 molecule-coding region of the nucleic acid sequence.
In an embodiment, the gRNA molecule:
targets the promoter region of the nucleic acid sequence,
is configured to provide a Cas9 molecule-mediated cleavage event in the promoter region of nucleic acid sequence; or
comprises a targeting domain configured to provide a Cas9 molecule-mediated cleavage event in the promoter region of the nucleic acid sequence, wherein the promoter region is functionally linked to the Cas9 molecule amino acid coding region.
In an embodiment, the gRNA molecule:
targets Cas9 molecule intronic sequence of the nucleic acid sequence;
is configured to provide a Cas9 molecule-mediated cleavage event in Cas9 molecule intronic sequence of the nucleic acid sequence; or
comprises a targeting domain configured to provide a Cas9 molecule-mediated cleavage event in Cas9 molecule intronic sequence of the nucleic acid sequence.
In an embodiment, the Cas9 molecule is a S. pyogenes Cas9 molecule. In another embodiment, the Cas9 molecule is a S. aureus Cas9 molecule.
In an embodiment, the gRNA molecule is selected from Tables E1-E6. In another embodiment, the gRNA molecule is selected from Tables E7-E12.
In an embodiment, the gRNA is a chimeric gRNA. In another embodiment, the gRNA is a modular gRNA.
In an embodiment, the governing gRNA molecule targets the coding sequence, or a control region, e.g., a promoter, for the Cas9 system component to be negatively regulated. For example, the gRNA can target the coding sequence for Cas9, or a control region, e.g., a promoter, that regulates the expression of the Cas9 coding sequence. In an embodiment, the governing gRNA, e.g., a Cas9-targeting gRNA molecule, or a nucleic acid that encodes it, is introduced separately, e.g., later than the Cas9 molecule or a nucleic acid that encodes it. For example, a first vector, e.g., a viral vector, e.g., an AAV vecvtor, can introduce nucleic acid encoding a Cas9 and one or more gRNAs and a second vector, e.g., a viral vector, e.g., an AAV vecvtor, can introduce a nucleic acid encoding a governing gRNA molecule, e.g., a Cas9-targeting gRNA molecule. The second vector can be introduced after the first. In an embodiment, the governing gRNA, e.g., a Cas9-targeting gRNA molecule, or a nucleic acid that encodes it, can be introduced together, e.g., at the same time or in the same vector, with the Cas9 molecule or a nucleic acid that encodes it, but, e.g., under transcriptional control elements, e.g., a promoter or an enhancer, that are activated at a later time, e.g., such that after a period of time the transcription of Cas9 is silenced. In an embodiment, the transcriptional control element is activated intrinsically. In an embodiment, the transcriptional element is activated via the introduction of an external trigger.
In an aspect, the disclosure features a nucleic acid comprising a sequence that encodes a governing gRNA molecule. In an embodiment, the governing gRNA molecule comprises a Cas9 molecule-targeting gRNA molecule. In an embodiment, the nucleic acid comprises a sequence that encodes a gRNA molecule described herein. In an embodiment, the nucleic acid is purified.
In another aspect, the disclosure features a nucleic acid, e.g., one or more vectors, e.g., one or more viral vectors, e.g., one or more AAV vectors, comprising:
a) a first nucleic acid sequence that encodes a governing gRNA molecule, e.g., a Cas9 molecule-targeting gRNA molecule or a gRNA molecule-targeting gRNA molecule; and
b) a second nucleic acid sequence that encodes a Cas9 molecule, e.g., an eaCas9 or an eiCas9 molecule.
In an embodiment, the governing gRNA molecule comprises a Cas9 molecule-targeting gRNA molecule. In another embodiment, the governing gRNA molecule comprises a gRNA molecule-targeting gRNA molecule.
In an embodiment, the governing gRNA molecule comprises a Cas9 molecule-targeting gRNA molecule and the Cas9 molecule-targeting gRNA molecule targets the second nucleic acid sequence that encodes the Cas9 molecule.
In an embodiment, the Cas9 molecule is an eaCas9 molecule. In another embodiment, the Cas9 molecule is an eiCas9 molecule.
In an embodiment, the gRNA molecule is configured to provide a Cas9 molecule-mediated cleavage event in the second nucleic acid sequence. In an embodiment, the gRNA molecule comprises a targeting domain configured to provide a Cas9 molecule-mediated cleavage event in the second nucleic acid sequence. In an embodiment, the gRNA molecule is a gRNA molecule described herein and targets the second nucleic acid sequence.
In an embodiment, the nucleic acid is purified.
In an embodiment, component a) and component b) are provided on the same nucleic acid, e.g., the same vector, e.g., the same viral vector, e.g., the same AAV vector. In another embodiment, component a) and component b) are provided on different nucleic acids, e.g., different vectors, e.g., different viral vectors, e.g., different AAV vectors.
In an embodiment, the nucleic acid is configured such that a Cas9 molecule-targeting gRNA transcribed from said nucleic acid forms a complex with a Cas9 molecule produced from said nucleic acid.
In an embodiment, said complex is capable of inactivating or silencing, e.g., by cleaving, the nucleic acid sequence that comprises or encodes said Cas9 molecule sequence. In an embodiment, the inactivating comprises cleaving.
In an embodiment, said first nucleic acid sequence is under the control of a first control region, e.g., promoter, and said second nucleic acid sequence is under the control of a second control region, e.g., promoter, and said first and second control regions, e.g., promoters, are different, e.g., one is a constitutive promoter and one is an inducible promoter. In an embodiment, one of the first and second control regions is a constitutive promoter and one is an inducible promoter.
In an embodiment, said first nucleic acid sequence and said second nucleic acid sequence are differentially expressed, e.g., differentially expressed in terms of level of expression or temporally, e.g., the first sequence is expressed later than said second sequence, or the first sequence is expressed at a lower level than said second sequence.
In an embodiment, the nucleic acid further comprises:
c) a third nucleic acid sequence that encodes a gRNA molecule, e.g., a second gRNA molecule, comprising a targeting domain which is complementary with a target nucleic acid, e.g., wherein the second gRNA does not target b).
In an embodiment, the target nucleic acid is disclosed herein, e.g., a sequence from: a gene or pathway described herein, e.g., in Section VIIB, e.g., in Table VII-13, VII-14, VII-15, VII-16, VII-17, VII-18, VII-19, VII-20, VII, 21, VII-22, VII-23, VII-24, IX-1, IX-1A, IX-3, or XII-1, or in Section VIII.
In an embodiment, said first nucleic acid sequence is under the control of a first control region, e.g., promoter,
said second nucleic acid sequence is under the control of said second control region, e.g., promoter, or a third control region, e.g., promoter,
said third nucleic acid sequence is under the control of said second control region, e.g., promoter, or said third control region, e.g., promoter, and
said first control region, e.g., promoter, is different from said second and/or said third control region, e.g., promoter.
In an embodiment, said first nucleic acid sequence and said third nucleic acid sequence are differentially expressed, e.g., differentially expressed in terms of level of expression or temporally, e.g., the first sequence is expressed later than said third sequence, or the first sequence is expressed at a lower level than said third sequence.
In an embodiment, the nucleic acid further comprises a template nucleic acid (referred to interchangeably herein as a swap nucleic acid sequence), e.g., having 5′ and 3′ flanking region sequences recognized by one or more governing gRNAs.
In an embodiment, the nucleic acid sequence that comprises or encodes the Cas9 molecule sequence or the gRNA molecule sequence (e.g., targeted by the governing gRNA as described herein) further comprises a nucleic acid sequence that is capable of being used as a template nucleic acid, e.g., after being cleaved or excised (e.g., by the method described herein) from the nucleic acid sequence that comprises or encodes the Cas9 molecule sequence or the gRNA molecule sequence, e.g., as a donor DNA for homologous recombination. In an embodiment, a first governing gRNA molecule targets a region 5′ of a nucleic acid sequence comprising the template nucleic acid sequence and a second governing gRNA molecule targets a region 3′ of the nucleic acid sequence comprising the template nucleic acid sequence. For example, at least two (e.g., two, three, four, five or more) governing gRNAs can be used to produce one or more (e.g., two, three, four or more) template nucleic acids. In another embodiment, a single governing gRNA molecule targets both the regions 5′ and 3′ of the nucleic acid sequence comprising the template nucleic acid sequence. For example, the region (e.g., targeted by the governing gRNA molecule) 5′ of the nucleic acid sequence comprising the template nucleic acid sequence can be the same or substantially the same as the region (e.g., targeted by the governing gRNA molecule) 3′ of the nucleic acid sequence comprising the template nucleic acid sequence. In an embodiment, the nucleic acid sequence comprising the template nucleic acid sequence is in a vector, e.g., a vector described herein. In an embodiment, the vector is a viral vector, e.g., an AAV vector.
In an aspect, the disclosure features a vector comprising a nucleic acid described herein. In an embodiment, the vector is a viral vector. In an embodiment, the viral vector, is an AAV rector.
In an aspect, the disclosure features a composition, e.g., a pharmaceutical composition, comprising:
a) a governing gRNA molecule, e.g., a governing gRNA molecule described herein, or a nucleic acid that encodes a governing gRNA molecule, e.g., a nucleic acid described herein.
In an embodiment, the composition comprises one or more (e.g., 2 or all) of;
b) a Cas9 molecule, e.g., a Cas9 molecule described herein, or a nucleic acid sequence that encodes the Cas9 molecule, e.g., a nucleic acid sequence described herein;
c) a second gRNA molecule or a nucleic acid encoding the second gRNA molecule; or
d) a template nucleic acid.
In an embodiment, the governing gRNA molecule comprises a Cas9 molecule-targeting gRNA molecule. In an embodiment, the Cas 9 molecule-targeting gRNA comprises a gRNA molecule described herein.
In an embodiment, the gRNA molecule is configured to provide a Cas 9 molecule-mediated cleavage event in the nucleic acid sequence that encodes the Cas 9 molecule.
In an embodiment, the composition comprises a Cas9 molecule-targeting gRNA molecule and a nucleic acid encoding the Cas9 molecule. In another embodiment, the composition comprises a Cas9 molecule-targeting gRNA molecule and the Cas9 molecule.
In an embodiment, the composition further comprises:
c) a second gRNA molecule or a nucleic acid encoding the second gRNA molecule.
In an embodiment, the second gRNA targets a Cas 9 molecule to a target nucleic acid.
In an embodiment, the composition further comprises:
d) a template nucleic acid.
In an embodiment, the composition comprises a second gRNA or a nucleic acid encoding the second gRNA.
In an embodiment, the template nucleic acid is configured to mediate repair of a break positioned by the second gRNA.
In an embodiment, each of a), b), c) and d) is present as a nucleic acid and are encoded on the same nucleic acid molecule. In an embodiment, a first sequence selected from a), b), c) and d) is encoded on a first nucleic acid molecule and a second sequence selected from a), b), c), and d) is encoded on a second nucleic acid molecule.
In another aspect, the disclosure features a composition, e.g., a pharmaceutical composition, comprising the nucleic acid described herein. For example, the nucleic acid, e.g., one or more vectors, e.g., one or more viral vectors, e.g., one or more AAV vectors, can comprise:
a) a first nucleic acid sequence that encodes a governing gRNA molecule, e.g., a Cas9-targeting gRNA molecule or a gRNA-targeting gRNA molecule; and
b) a second nucleic acid sequence that encodes a Cas9 molecule, e.g., an eaCas9 or an eiCas9 molecule.
In an embodiment, said nucleic acid comprises an AAV vector.
In an aspect, the disclosure features a composition, e.g., a pharmaceutical composition, comprising nucleic acid sequence, e.g., a DNA, that encodes a governing gRNA molecule, e.g., a Cas9-targeting gRNA molecule or a gRNA-targeting gRNA molecule, and one or more of
a) a Cas9 molecule,
b) a second Cas9 molecule,
c) a gRNA molecule, and
d) a second gRNA molecule.
In an embodiment, each of a), b), c) and d) present are encoded on the same nucleic acid molecule. In an embodiment, a first sequence selected from a, b, c and d is encoded on a first nucleic acid molecule and a second sequence selected from a, b, c, and d is encoded on a second nucleic acid molecule. In an embodiment, said nucleic acid encodes: a and c; a, c, and d; or a, b, c, and d.
In an aspect, the disclosure features a pharmaceutical preparation comprising:
a gRNA molecule described herein;
a nucleic acid described herein;
a vector described herein; or
a composition described herein.
In an aspect, the disclosure features a cell comprising:
a gRNA molecule described herein;
a nucleic acid described herein;
a vector described herein; or
a composition described herein.
In an embodiment, the cell comprises:
a nucleic acid sequence encoding a Cas 9 molecule, wherein a sequence that encodes the Cas9 molecule can comprise one or more of: a sequence encoding the amino acid sequence of the Cas9 molecule, a sequence encoding the amino acid sequence of the Cas9 molecule comprising non-translated sequence, and a sequence encoding the amino acid sequence of the Cas9 molecule comprising non-transcribed sequence; and
a governing gRNA molecule.
In an embodiment, the governing gRNA molecule comprises a gRNA molecule that targets the nucleic acid sequence that encodes the Cas 9 molecule. In an embodiment, the gRNA molecule is a gRNA molecule described herein.
In an embodiment, the cell further comprises a Cas 9 molecule.
In an embodiment, the cell further comprises a second gRNA molecule or a nucleic acid encoding the second gRNA molecule. In an embodiment, the second gRNA targets a Cas9 molecule to a target nucleic acid.
In an embodiment, the cell further comprises a template nucleic acid. In an embodiment, the template nucleic acid is configured to mediate repair of a break in the target nucleic acid positioned by the second gRNA molecule.
In an embodiment, the cell comprises target nucleic acid cleaved by second gRNA molecule mediated targeting of the Cas9 molecule.
In an embodiment, the cell comprises the target nucleic acid that has been cleaved and repaired. In an embodiment, the repair comprises template nucleic acid mediated repair.
In an embodiment, the nucleic acid sequence encoding the Cas9 molecule has not been cleaved. In an embodiment, the nucleic acid sequence encoding the Cas9 molecule can express Cas 9 molecule.
In an embodiment, the nucleic acid sequence encoding the Cas9 molecule has been cleaved by gRNA mediated targeting of Cas 9 molecule. In an embodiment, the cleaved nucleic acid sequence encoding the Cas9 molecule has reduced ability to express Cas9 molecule, as compared to the same molecule not having been cleaved. In an embodiment, the cleaved nucleic acid sequence encoding the Cas9 molecule is substantially incapable of expressing Cas 9 molecule.
In an embodiment, the cell comprises one or both of:
a cleaved nucleic acid sequence encoding the Cas9 molecule; or
a target nucleic acid having a repaired Cas9 molecule-mediated cleavage event.
In an embodiment, the cell is a vertebrate, mammalian, rodent, goat, pig, bird, chicken, turkey, cow, horse, sheep, fish, primate, or human cell.
In another embodiment, the cell is a plant cell. In an embodiment, the plant cell is a monocot or a dicot.
In an embodiment, the cell is a human cell. In an embodiment, the cell is a somatic cell, germ cell, or prenatal cell. In an embodiment, the cell is a zygotic, blastocyst or embryonic cell, a stem cell, a mitotically competent cell, a meiotically competent cell.
In an aspect, the disclosure features a method of altering a cell, e.g., altering the structure, e.g., sequence, of a target nucleic acid of a cell, comprising contacting said cell with the nucleic acid described herein. For example, the nucleic acid, e.g., one or more vectors, e.g., one or more viral vectors, e.g., one or more AAV vectors, can comprise:
a) a first nucleic acid sequence that encodes a governing gRNA molecule, e.g., a Cas9-targeting gRNA molecule or a gRNA-targeting gRNA molecule; and
b) a second nucleic acid sequence that encodes a Cas9 molecule, e.g., an eaCas9 or an eiCas9 molecule.
In an embodiment, the cell is a mammalian, primate, or human cell. In an embodiment, the cell is a human cell, e.g., a cell described herein, e.g., in Section VIIA. In an embodiment, the cell is: a somatic cell, germ cell, prenatal cell, e.g., zygotic, blastocyst or embryonic cell, a stem cell, a mitotically competent cell, or a meiotically competent cell. In an embodiment, the target nucleic acid is a chromosomal nucleic acid.
In another aspect, the disclosure features a method of altering a cell, e.g., altering the structure, e.g., sequence, of a target nucleic acid of a cell, comprising contacting the cell with an effective amount of:
a gRNA molecule described herein;
a nucleic acid described herein;
a vector described herein; or a composition described herein.
In an embodiment, the cell is a vertebrate, mammalian, rodent, goat, pig, bird, chicken, turkey, cow, horse, sheep, fish, primate, or human cell.
In another embodiment, the cell is a plant cell. In an embodiment, the plant cell is a monocot or a dicot.
In an embodiment, the cell is a human cell. In an embodiment, the cell is a somatic cell, germ cell, or prenatal cell. In an embodiment, the cell is a zygotic, blastocyst or embryonic cell, a stem cell, a mitotically competent cell, a meiotically competent cell.
In an embodiment, the subject is a mammal, primate, or human.
In an embodiment, the target nucleic acid is a chromosomal nucleic acid.
In another aspect, the disclosure features a method of treating a subject, e.g., by altering the structure, e.g., altering the sequence, of a target nucleic acid, comprising administering to the subject, an effective amount of the nucleic acid described herein. For example, the nucleic acid, e.g., one or more vectors, e.g., one or more viral vectors, e.g., one or more AAV vectors, can comprise:
a) a first nucleic acid sequence that encodes a governing gRNA molecule, e.g., a Cas9-targeting gRNA molecule or a gRNA-targeting gRNA molecule; and
b) a second nucleic acid sequence that encodes a Cas9 molecule, e.g., an eaCas9 or an eiCas9 molecule.
In an embodiment, the subject is a mammalian, primate, or human. In an embodiment, the target nucleic acid is the nucleic acid of a human cell, e.g., a cell described herein, e.g., in Section VIIA. In an embodiment, the target nucleic acid is the nucleic acid of: a somatic cell, germ cell, prenatal cell, e.g., zygotic, blastocyst or embryonic cell, a stem cell, a mitotically competent cell, or a meiotically competent cell. In an embodiment, the target nucleic acid is a chromosomal nucleic acid.
In another aspect, the disclosure features a method of treating a subject, e.g., by altering the structure, e.g., altering the sequence, of a target nucleic acid, in a cell of the subject, comprising contacting the cell or the subject, with an effective amount of the nucleic acid of: a gRNA molecule described herein;
a nucleic acid described herein;
a vector described herein; or
a composition described herein.
In an embodiment, the cell is a vertebrate, mammalian, rodent, goat, pig, bird, chicken, turkey, cow, horse, sheep, fish, primate, or human cell.
In another embodiment, the cell is a plant cell. In an embodiment, the plant cell is a monocot or a dicot.
In an embodiment, the cell is a human cell. In an embodiment, the cell is a somatic cell, germ cell, or prenatal cell. In an embodiment, the cell is a zygotic, blastocyst or embryonic cell, a stem cell, a mitotically competent cell, a meiotically competent cell.
In an embodiment, the subject is a mammal, primate, or human.
In an embodiment, the target nucleic acid is a chromosomal nucleic acid.
In an aspect, the disclosure features a reaction mixture comprising a cell and:
a gRNA molecule described herein;
a nucleic acid described herein;
a vector described herein; or
a composition described herein.
In another aspect, the disclosure features a reaction mixture comprising a composition described herein and a cell, e.g., a cell described herein.
In an aspect, the disclosure features a kit comprising:
a gRNA molecule described herein;
a nucleic acid described herein;
a vector described herein; or
a composition described herein.
In an embodiment, the kit comprises an instruction for using the gRNA molecule, the nucleic acid, the vector, or the composition, in a method described herein.
In another aspect, the disclosure features a composition, e.g., pharmaceutical composition, comprising a governing gRNA molecule described herein.
In an embodiment, the composition further comprises a Cas9 molecule, e.g., an eaCas9 or an eiCas9 molecule. In an embodiment, said Cas9 molecule is an eaCas9 molecule. In an embodiment, said Cas9 molecule is an eiCas9 molecule.
In an embodiment, the composition further comprises a gRNA molecule comprising a targeting domain which is complementary with a target sequence from a target nucleic acid disclosed herein, e.g., a sequence from: a gene or pathway described herein, e.g., in Section VIIB, e.g., in Table VII-13, VII-14, VII-15, VII-16, VII-17, VII-18, VII-19, VII-20, VII-21, VII-22, VII-23, VII-24, IX-1, IX-1A, IX-3, or XII-1, or in Section VIII.
In another aspect, the disclosure features a composition, e.g., pharmaceutical composition, comprising a gRNA molecule described herein.
In an embodiment, the composition further comprises a Cas9 molecule, e.g., an eaCas9 or an eiCas9 molecule. In an embodiment, said Cas9 molecule is an eaCas9 molecule. In another embodiment, said Cas9 molecule is an eiCas9 molecule.
In an embodiment, said composition comprises a payload, e.g., a payload described herein, e.g., in Section VI, e.g., in Table VI-1, VI-2, VI-3, VI-4, VI-5, or VI-6.
In an embodiment, the payload comprises: an epigenetic modifier, e.g., a molecule that modifies DNA or chromatin; component, e.g., a molecule that modifies a histone, e.g., an epigenetic modifier described herein, e.g., in Section VI; a transcription factor, e.g., a transcription factor described herein, e.g., in Section VI; a transcriptional activator domain; an inhibitor of a transcription factor, e.g., an anti-transcription factor antibody, or other inhibitors; a small molecule; an antibody; an enzyme; an enzyme that interacts with DNA, e.g., a helicase, restriction enzyme, ligase, or polymerase; and/or a nucleic acid, e.g., an enzymatically active nucleic acid, e.g., a ribozyme, or an mRNA, siRNA, of antisense oligonucleotide. In an embodiment, the composition further comprises a Cas9 molecule, e.g., an eiCas9, molecule.
In an embodiment, said payload is coupled, e.g., covalently or noncovalently, to a Cas9 molecule, e.g., an eiCas9 molecule. In an embodiment, said payload is coupled to said Cas9 molecule by a linker. In an embodiment, said linker is or comprises a bond that is cleavable under physiological, e.g., nuclear, conditions. In an embodiment, said linker is, or comprises, a bond described herein, e.g., in Section XI. In an embodiment, said linker is, or comprises, an ester bond. In an embodiment, said payload comprises a fusion partner fused to a Cas9 molecule, e.g., an eaCas9 molecule or an eiCas9 molecule.
In an embodiment, said payload is coupled, e.g., covalently or noncovalently, to the gRNA molecule. In an embodiment, said payload is coupled to said gRNA molecule by a linker. In an embodiment, said linker is or comprises a bond that is cleavable under physiological, e.g., nuclear, conditions. In an embodiment, said linker is, or comprises, a bond described herein, e.g., in Section XI. In an embodiment, said linker is, or comprises, an ester bond.
In an embodiment, the composition comprises an eaCas9 molecule. In an embodiment, the composition comprises an eaCas9 molecule which forms a double stranded break in the target nucleic acid.
In an embodiment, the composition comprises an eaCas9 molecule which forms a single stranded break in the target nucleic acid. In an embodiment, said single stranded break is formed in the complementary strand of the target nucleic acid. In an embodiment, said single stranded break is formed in the strand which is not the complementary strand of the target nucleic acid.
In an embodiment, the composition comprises HNH-like domain cleavage activity but having no, or no significant, N-terminal RuvC-like domain cleavage activity. In an embodiment, the composition comprises N-terminal RuvC-like domain cleavage activity but having no, or no significant, HNH-like domain cleavage activity.
In an embodiment, said double stranded break is within 10, 20, 30, 40, 50, 100, 150 or 200 nucleotides of a nucleotide of the target position. In an embodiment, said single stranded break is within 10, 20, 30, 40, 50, 100, 150 or 200 nucleotides of a nucleotide of the target position.
In an embodiment, the composition further comprises a template nucleic acid, e.g., a template nucleic acid described herein, e.g., in Section IV. In an embodiment, the template nucleic acid comprises a nucleotide that corresponds to a nucleotide of the target position.
In an embodiment, said template nucleic acid comprises a nucleotide that corresponds to a nucleotide of the target position from a sequence of: a gene, or a gene from a pathway, described herein, e.g., in Section VIIB, e.g., in Table VII-13, VII-14, VII-15, VII-16, VII-17, VII-18, VII-19, VII-20, VII-21, VII-22, VII-23, VII-24, IX-1, IX-1A, IX-3, or XII-1, or in Section VIII.
In an embodiment, the template nucleic acid is or comprises a fragment of 10 to 500, 10 to 400, 10 to 300, 10 to 200 nucleotides in length from a sequence in: a gene, or a gene from a pathway, described herein, e.g., in Section VIIB, e.g., in Table VII-13, VII-14, VII-15, VII-16, VII-17, VII-18, VII-19, VII-20, VII-21, VII-22, VII-23, VII-24, IX-1, IX-1A, IX-3, or XII-1, or in Section VIII.
In an embodiment, the template nucleic acid is or comprises a fragment of 10 to 500, 10 to 400, 10 to 300, 10 to 200 nucleotides in length, which differs at at least 1 nucleotide, but not more than 5, 10, 20 or 30% of its nucleotides, from a corresponding sequence in: a gene, or a gene from a pathway, described herein, e.g., in Section VIIB, e.g., in Table VII-13, VII-14, VII-15, VII-16, VII-17, VII-18, VII-19, VII-20, VII-21, VII-22, VII-23, VII-24, IX-1, IX-1A, IX-3, or XII-1, or in Section VIII.
In an embodiment, the composition further comprises a second gRNA molecule, e.g., a second gRNA molecule described herein.
In an embodiment, said gRNA molecule and said second gRNA molecule mediate breaks at different sites in the target nucleic acid, e.g., flanking a target position. In an embodiment, said gRNA molecule and said second gRNA molecule are complementary to the same strand of the target. In an embodiment, said gRNA molecule and said second gRNA molecule are complementary to the different strands of the target.
In an embodiment, said Cas9 molecule mediates a double stranded break.
In an embodiment, said gRNA molecule and said second gRNA molecule are configured such that first and second break made by the Cas9 molecule flank a target position. In an embodiment, said double stranded break is within 10, 20, 30, 40, 50, 100, 150 or 200 nucleotides of a nucleotide of the target position.
In an embodiment, the composition further comprises a template nucleic acid. In an embodiment, the template nucleic acid comprises a nucleotide that corresponds to a nucleotide of the target position.
In an embodiment, said template nucleic acid comprises a nucleotide that corresponds to a nucleotide of a target position from a sequence of: a gene, or a gene from a pathway, described herein, e.g., in Section VIIB, e.g., in Table VII-13, VII-14, VII-15, VII-16, VII-17, VII-18, VII-19, VII-20, VII-21, VII-22, VII-23, VII-24, IX-1, IX-1A, IX-3, or XII-1, or in Section VIII.
In an embodiment, the template nucleic acid is a fragment of 10 to 500, 10 to 400, 10 to 300, 10 to 200 nucleotides in length from a sequence in: a gene, or a gene from a pathway, described herein, e.g., in Section VIIB, e.g., in Table VII-13, VII-14, VII-15, VII-16, VII-17, VII-18, VII-19, VII-20, VII-21, VII-22, VII-23, VII-24, IX-1, IX-1A, IX-3, or XII-1, or in Section VIII.
In an embodiment, the template nucleic acid is a fragment of 10 to 500, 10 to 400, 10 to 300, 10 to 200 nucleotides in length, which differs at at least 1 nucleotide, but not more than 5, 10, 20 or 30% of its nucleotides, from a corresponding sequence in: a gene, or a gene from a pathway, described herein, e.g., in Section VIIB, e.g., in Table VII-13, VII-14, VII-15, VII-16, VII-17, VII-18, VII-19, VII-20, VII-21, VII-22, VII-23, VII-24, IX-1, IX-1A, IX-3, or XII-1, or in Section VIII.
In an embodiment, said Cas9 molecule mediates a single stranded break.
In an embodiment, said gRNA molecule and said second gRNA molecule are configured such that a first and second break are formed in the same strand of the nucleic acid target, e.g., in the case of transcribed sequence, the template strand or the non-template strand.
In an embodiment, said first and second break flank a target position.
In an embodiment, one of said first and second single stranded breaks, or both are independently, within 10, 20, 30, 40, 50, 100, 150 or 200 nucleotides of a nucleotide of the target position.
In an embodiment, the composition further comprises a template nucleic acid. In an embodiment, the template nucleic acid comprises a nucleotide that corresponds to a nucleotide of the target position. In an embodiment, said template nucleic acid comprises a nucleotide that corresponds to a nucleotide of the target position from a sequence of: a gene, or a gene from a pathway, described herein, e.g., in Section VIIB, e.g., in Table VII-13, VII-14, VII-15, VII-16, VII-17, VII-18, VII-19, VII-20, VII-21, VII-22, VII-23, VII-24, IX-1, IX-1A, IX-3, or XII-1, or in Section VIII.
In an embodiment, the template nucleic acid is or comprises a fragment of 10 to 500, 10 to 400, 10 to 300, 10 to 200 nucleotides in length from a sequence in: a gene, or a gene from a pathway, described herein, e.g., in Table VII-13, VII-14, VII-15, VII-16, VII-17, VII-18, VII-19, VII-20, VII-21, VII-22, VII-23, VII-24, IX-1, IX-1A, IX-3, or XII-1, or in Section VIII.
In an embodiment, the template nucleic acid is or comprises a fragment of 10 to 500, 10 to 400, 10 to 300, 10 to 200 nucleotides in length, which differs at at least 1 nucleotide, but not more than 5, 10, 20 or 30% of its nucleotides, from a corresponding sequence in: a gene, or a gene from a pathway, described herein, e.g., in Section VIIB, e.g., in Table VII-13, VII-14, VII-15, VII-16, VII-17, VII-18, VII-19, VII-20, VII-21, VII-22, VII-23, VII-24, IX-1, IX-1A, IX-3, or XII-1, or in Section VIII.
In an embodiment, said gRNA molecule and said second gRNA molecule are configured such that a first and a second breaks are formed in different strands of the target. In an embodiment, said first and second break flank a target position. In an embodiment, one of said first and second single stranded breaks, or both are independently, within 10, 20, 30, 40, 50, 100, 150 or 200 nucleotides of a nucleotide of the target position.
In an embodiment, the composition further comprises a template nucleic acid. In an embodiment, the template nucleic acid comprises a nucleotide that corresponds to a nucleotide of the target position.
In an embodiment, said template nucleic acid comprises a nucleotide that corresponds to a nucleotide of the target position from a sequence of: a gene, or a gene from a pathway, described herein, e.g., in Section VIIB, e.g., in Table VII-13, VII-14, VII-15, VII-16, VII-17, VII-18, VII-19, VII-20, VII-21, VII-22, VII-23, VII-24, IX-1, IX-1A, IX-3, or XII-1, or in Section VIII.
In an embodiment, the template nucleic acid is or comprises a fragment of 10 to 500, 10 to 400, 10 to 300, 10 to 200 nucleotides in length from a sequence in: a gene, or a gene from a pathway, described herein, e.g., in Section VIIB, e.g., in Table VII-13, VII-14, VII-15, VII-16, VII-17, VII-18, VII-19, VII-20, VII-21, VII-22, VII-23, VII-24, IX-1, IX-1A, IX-3, or XII-1, or in Section VIII.
In an embodiment, the template nucleic acid is or comprises a fragment of 10 to 500, 10 to 400, 10 to 300, 10 to 200 nucleotides in length, which differs at at least 1 nucleotide, but not more than 5, 10, 20 or 30% of its nucleotides, from a corresponding sequence in: a gene, or a gene from a pathway, described herein, e.g., in Section VIIB, e.g., in Table VII-13, VII-14, VII-15, VII-16, VII-17, VII-18, VII-19, VII-20, VII-21, VII-22, VII-23, VII-24, IX-1, IX-1A, IX-3, or XII-1, or in Section VIII.
In an embodiment, the composition comprises a second Cas9 molecule.
In an embodiment, one or both of said Cas9 molecule and said second Cas9 molecule are eiCas9 molecules. In an embodiment, said eiCas9 molecule is coupled to a payload by a linker and said second eiCas9 molecules is coupled to a second payload by a second linker.
In an embodiment, said payload and said second payload are the same. In an embodiment, said payload and said second payload are different. In an embodiment, said linker and said second linker are the same. In an embodiment, said linker and said second linker are different, e.g., have different release properties, e.g., different release rates.
In an embodiment, said payload and said second payload are each described herein, e.g., in Section VI, e.g., in Table VI-1, VI-2, VI-3, VI-4, VI-5, or VI-6. In an embodiment, said payload and said second payload can interact, e.g., they are subunits of a protein.
In an embodiment, one of both of said Cas9 molecule and said second Cas9 molecule are eaCas9 molecules.
In an embodiment, said eaCas9 molecule comprises a first cleavage activity and said second eaCas9 molecule comprises a second cleavage activity. In an embodiment, said cleavage activity and said second cleavage activity are the same, e.g., both are N-terminal RuvC-like domain activity or are both HNH-like domain activity. In an embodiment, said cleavage activity and said second cleavage activity are different, e.g., one is N-terminal RuvC-like domain activity and one is HNH-like domain activity.
In an embodiment, said Cas9 molecule and said second Cas9 molecule are specific for different PAMs, e.g., one is specific for NGG and the other is specific for, e.g., NGGNG, NNAGAAW (W=A or T), or NAAR (R=A or G). In an embodiment, said Cas9 molecule of S. aureus recognizes the sequence motif NNGRR (R=A or G) and directs cleavage of a target nucleic acid sequence 1 to 10, e.g., 3 to 5, base pairs upstream from that sequence. In an embodiment, one of said Cas 9 molecule and said second Cas 9 molecule recognizes an S. aureus PAM. In an embodiment, said Cas9 molecule of N. meningitidis recognizes the sequence motif NNNNGATT and directs cleavage of a target nucleic acid sequence 1 to 10, e.g., 3 to 5, base pairs upstream from that sequence. In an embodiment, one of said Cas 9 molecule and said second Cas 9 molecule recognizes an N. meningitidis PAM.
In an embodiment, said Cas9 molecule and said second Cas9 molecule both mediate double stranded breaks.
In an embodiment, said Cas9 molecule and said second Cas9 molecule are specific for different PAMs, e.g., one is specific for NGG and the other is specific for another PAM, e.g., another PAM described herein. In an embodiment, said gRNA molecule and said second gRNA molecule are configured such that first and second break flank a target position. In an embodiment, one of said first and second double stranded breaks, or both are independently, within 10, 20, 30, 40, 50, 100, 150 or 200 nucleotides of a nucleotide of the target position.
In an embodiment, the composition further comprises a template nucleic acid. In an embodiment, the template nucleic acid comprises a nucleotide that corresponds to a nucleotide of the target position.
In an embodiment, said template nucleic acid comprises a nucleotide that corresponds to a nucleotide of the target position from a sequence of: a gene, or a gene from a pathway, described herein, e.g., in Section VIIB, e.g., in Table VII-13, VII-14, VII-15, VII-16, VII-17, VII-18, VII-19, VII-20, VII-21, VII-22, VII-23, VII-24, IX-1, IX-1A, IX-3, XII-1, or Section VIII.
In an embodiment, the template nucleic acid is or comprises a fragment of 10 to 500, 10 to 400, 10 to 300, 10 to 200 nucleotides in length from a sequence in: a gene, or a gene from a pathway, described herein, e.g., in Section VIIB, e.g., in Table VII-13, VII-14, VII-15, VII-16, VII-17, VII-18, VII-19, VII-20, VII-21, VII-22, VII-23, VII-24, IX-1, IX-1A, IX-3, or XII-1, or in Section VIII.
In an embodiment, the template nucleic acid is or comprises a fragment of 10 to 500, 10 to 400, 10 to 300, 10 to 200 nucleotides in length, which differs at at least 1 nucleotide, but not more than 5, 10, 20 or 30% of its nucleotides, from a corresponding sequence in: a gene, or a gene from a pathway, described herein, e.g., in Section VIIB, e.g., in Table VII-13, VII-14, VII-15, VII-16, VII-17, VII-18, VII-19, VII-20, VII-21, VII-22, VII-23, VII-24, IX-1, IX-1A, IX-3, or XII-1, or in Section VIII.
In an embodiment, one of said Cas9 molecule and said second Cas9 molecule mediates a double stranded break and the other mediates a single stranded break.
In an embodiment, said Cas9 molecule and said second Cas9 molecule are specific for different PAMs, e.g., one is specific for NGG and the other is specific for another PAM, e.g., another PAM described herein. In an embodiment, said gRNA molecule and said second gRNA molecule are configured such that a first and second break flank a target position. In an embodiment, said first and second break flank a target position. In an embodiment, one of said first and second breaks, or both are independently, within 10, 20, 30, 40, 50, 100, 150 or 200 nucleotides of a nucleotide of the target position.
In an embodiment, the composition further comprises a template nucleic acid. In an embodiment, the template nucleic acid comprises a nucleotide that corresponds to a nucleotide of the target position.
In an embodiment, said template nucleic acid comprises a nucleotide that corresponds to a nucleotide of the target position from a sequence of: a gene, or a gene from a pathway, described herein, e.g., in Section VIIB, e.g., in Table VII-13, VII-14, VII-15, VII-16, VII-17, VII-18, VII-19, VII-20, VII-21, VII-22, VII-23, VII-24, IX-1, IX-1A, IX-3, or XII-1, or in Section VIII.
In an embodiment, the template nucleic acid is or comprises a fragment of 10 to 500, 10 to 400, 10 to 300, 10 to 200 nucleotides in length from a sequence in: a gene, or a gene from a pathway, described herein, e.g., in Section VIIB, e.g., in Table VII-13, VII-14, VII-15, VII-16, VII-17, VII-18, VII-19, VII-20, VII-21, VII-22, VII-23, VII-24, IX-1, IX-1A, IX-3, or XII-1, or in Section VIII.
In an embodiment, the template nucleic acid is or comprises a fragment of 10 to 500, 10 to 400, 10 to 300, 10 to 200 nucleotides in length, which differs at at least 1 nucleotide, but not more than 5, 10, 20 or 30% of its nucleotides, from a corresponding sequence in: a gene, or a gene from a pathway, described herein, e.g., in Section VIIB, e.g., in Table VII-13, VII-14, VII-15, VII-16, VII-17, VII-18, VII-19, VII-20, VII-21, VII-22, VII-23, VII-24, IX-1, IX-1A, IX-3, or XII-1, or in Section VIII.
In an embodiment, said Cas9 molecule and said second Cas9 molecule both mediate single stranded breaks.
In an embodiment, said Cas9 molecule and said second Cas9 molecule are specific for different PAMs, e.g., one is specific for NGG and the other is specific for another PAM, e.g., another PAM described herein. In an embodiment, said first and second break flank a target position.
In an embodiment, one of said first and second single stranded breaks, or both are independently, within 10, 20, 30, 40, 50, 100, 150 or 200 nucleotides of a nucleotide of the target position.
In an embodiment, the composition further comprises a template nucleic acid. In an embodiment, the template nucleic acid comprises a nucleotide that corresponds to a nucleotide of the target position.
In an embodiment, said template nucleic acid comprises a nucleotide that corresponds to a nucleotide of the target position from a sequence of: a gene, or a gene from a pathway, described herein, e.g., in Section VIIB, e.g., in Table VII-13, VII-14, V11-15, VII-16, VII-17, VII-18, VII-19, VII-20, VII-21, VII-22, VII-23, VII-24, IX-1, IX-1A, IX-3, or XII-1, or in Section VIII.
In an embodiment, the template nucleic acid is or comprises a fragment of 10 to 500, 10 to 400, 10 to 300, 10 to 200 nucleotides in length from a sequence in: a gene, or a gene from a pathway, described herein, e.g., in Section VIIB, e.g., in Table VII-13, VII-14, V11-15, VII-16, VII-17, VII-18, VII-19, VII-20, VII-21, VII-22, VII-23, VII-24, IX-1, IX-1A, IX-3, or XII-1, or in Section VIII.
In an embodiment, the template nucleic acid is or comprises a fragment of 10 to 500, 10 to 400, 10 to 300, 10 to 200 nucleotides in length, which differs at at least 1 nucleotide, but not more than 5, 10, 20 or 30% of its nucleotides, from a corresponding sequence in: a gene, or a gene from a pathway, described herein, e.g., in Section VIIB, e.g., in Table VII-13, VII-14, VII-15, VII-16, VII-17, VII-18, VII-19, VII-20, VII-21, VII-22, VII-23, VII-24, IX-1, IX-1A, IX-3, or XII-1, or in Section VIII.
In an embodiment, said gRNA molecule, said second gRNA molecule are configured such that a first and second break are in the same strand.
In an embodiment, said Cas9 molecule and said second Cas9 molecule are specific for different PAMs, e.g., one is specific for NGG and the other is specific for another PAM, e.g., another PAM described herein. In an embodiment, said gRNA molecule, said second gRNA molecule are configured such that a first and second break flank a target position. In an embodiment, one of said first and second single stranded breaks, or both are independently, within 10, 20, 30, 40, 50, 100, 150 or 200 nucleotides of a nucleotide of the target position.
In an embodiment, the composition further comprises a template nucleic acid. In an embodiment, the template nucleic acid comprises a nucleotide that corresponds to a nucleotide of the target position.
In an embodiment, said template nucleic acid comprises a nucleotide that corresponds to a nucleotide of the target position from a sequence of: a gene, or a gene from a pathway, described herein, e.g., in Section VIIB, e.g., in Table VII-13, VII-14, V11-15, VII-16, VII-17, VII-18, VII-19, VII-20, VII-21, VII-22, VII-23, VII-24, IX-1, IX-1A, IX-3, or XII-1, or in Section VIII.
In an embodiment, the template nucleic acid is or comprises a fragment of 10 to 500, 10 to 400, 10 to 300, 10 to 200 nucleotides in length from a sequence in: a gene, or a gene from a pathway, described herein, e.g., in Section VIIB, e.g., in Table VII-13, VII-14, V11-15, VII-16, VII-17, VII-18, VII-19, VII-20, VII-21, VII-22, VII-23, VII-24, IX-1, IX-1A, IX-3, or XII-1, or in Section VIII.
In an embodiment, the template nucleic acid is or comprises a fragment of 10 to 500, 10 to 400, 10 to 300, 10 to 200 nucleotides in length, which differs at at least 1 nucleotide, but not more than 5, 10, 20 or 30% of its nucleotides, from a corresponding sequence in: a gene, or a gene from a pathway, described herein, e.g., in Section VIIB, e.g., in Table VII-13, VII-14, VII-15, VII-16, VII-17, VII-18, VII-19, VII-20, VII-21, VII-22, VII-23, VII-24, IX-1, IX-1A, IX-3, or XII-1, or in Section VIII.
In an embodiment, said first and second break are on the different strands.
In an embodiment, said Cas9 molecule and said second Cas9 molecule are specific for different PAMs, e.g., one is specific for NGG and the other is specific for another PAM, e.g., another PAM described herein. In an embodiment, said gRNA molecule, said second gRNA molecule are configured such that a first and second break are on different strands.
In an embodiment, said gRNA molecule, said second gRNA molecule are configured such that a first and second break flank a target position. In an embodiment, said first and second break flank a target position.
In an embodiment, one of said first and second single stranded breaks, or both are independently, within 10, 20, 30, 40, 50, 100, 150 or 200 nucleotides of a nucleotide of the target position.
In an embodiment, the composition further comprises a template nucleic acid. In an embodiment, the template nucleic acid comprises a nucleotide that corresponds to a nucleotide of the target position.
In an embodiment, said template nucleic acid comprises a nucleotide that corresponds to a nucleotide of the target position from a sequence of: a gene, or a gene from a pathway, described herein, e.g., in Section VIIB, e.g., in Table VII-13, VII-14, VII-15, VII-16, VII-17, VII-18, VII-19, VII-20, VII-21, VII-22, VII-23, VII-24, IX-1, IX-1A, IX-3, or XII-1, or in Section VIII.
In an embodiment, the template nucleic acid is or comprises a fragment of 10 to 500, 10 to 400, 10 to 300, 10 to 200 nucleotides in length from a sequence in: a gene, or a gene from a pathway, described herein, e.g., in Section VIIB, e.g., in Table VII-13, VII-14, VII-15, VII-16, VII-17, VII-18, VII-19, VII-20, VII-21, VII-22, VII-23, VII-24, IX-1, IX-1A, IX-3, or XII-1, or in Section VIII.
In an embodiment, the template nucleic acid is or comprises a fragment of 10 to 500, 10 to 400, 10 to 300, 10 to 200 nucleotides in length, which differs at at least 1 nucleotide, but not more than 5, 10, 20 or 30% of its nucleotides, from a corresponding sequence in: a gene, or a gene from a pathway, described herein, e.g., in Section VIIB, e.g., in Table VII-13, VII-14, VII-15, VII-16, VII-17, VII-18, VII-19, VII-20, VII-21, VII-22, VII-23, VII-24, IX-1, IX-1A, IX-3, or XII-1, or Section VIII.
In yet another aspect, the disclosure features a composition, e.g., a pharmaceutical composition, comprising governing gRNA molecule, e.g., a Cas9-targeting gRNA molecule or a gRNA-targeting gRNA molecule, a gRNA molecule and a second gRNA molecule described herein.
In an embodiment, the composition further comprises a nucleic acid, e.g., a DNA or mRNA, that encodes a Cas9 molecule described herein. In an embodiment, the composition further comprises a nucleic acid, e.g., a DNA or RNA, that encodes a second Cas9 molecule described herein. In an embodiment, the composition further comprises a template nucleic acid described herein.
In one aspect, the disclosure features a composition, e.g., a pharmaceutical composition, comprising, nucleic acid sequence, e.g., a DNA, that encodes a governing gRNA molecule, e.g., a Cas9-targeting gRNA molecule or a gRNA-targeting gRNA molecule, and one or more gRNA molecules described herein.
In an embodiment, said nucleic acid comprises a promoter operably linked to the sequence that encodes a gRNA molecule, e.g., a promoter described herein.
In an embodiment, said nucleic acid comprises a second promoter operably linked to the sequence that encodes a second gRNA molecule, e.g., a promoter described herein. In an embodiment, the promoter and second promoter are different promoters. In an embodiment, the promoter and second promoter are the same.
In an embodiment, the nucleic acid further encodes a Cas9 molecule described herein. In an embodiment, the nucleic acid further encodes a second Cas9 molecule described herein. In an embodiment, said nucleic acid comprises a promoter operably linked to the sequence that encodes a Cas9 molecule, e.g., a promoter described herein.
In an embodiment, said nucleic acid comprises a second promoter operably linked to the sequence that encodes a second Cas9 molecule, e.g., a promoter described herein. In an embodiment, the promoter and second promoter are different promoters. In an embodiment, the promoter and second promoter are the same.
In an embodiment, the composition further comprises a template nucleic acid e.g., a template nucleic acid described herein, e.g., in Section IV.
In another aspect, the disclosure features a composition, e.g., a pharmaceutical composition, comprising nucleic acid sequence that encodes one or more of: a) a Cas9 molecule, b) a second Cas9 molecule, c) a gRNA molecule, d) a second gRNA molecule, and e) a governing gRNA molecule, e.g., a Cas9-targeting gRNA molecule or a gRNA-targeting gRNA molecule.
In an embodiment, each of a), b), c) d) and e) present are encoded on the same nucleic acid molecule.
In an embodiment, a first sequence selected from of a), b), c), d) and e) is encoded on a first nucleic acid molecule and a second sequence selected from a), b), c), d) and e) is encoded on a second nucleic acid molecule.
In an embodiment, said nucleic acid encodes: a), c) and e); a), c), d) and e); or a), b), c), d) and e).
In an embodiment, the composition further comprises a Cas9 molecule, e.g., comprising one or more of the Cas9 molecules wherein said nucleic acid does not encode a Cas9 molecule.
In an embodiment, the composition further comprises an mRNA encoding Cas9 molecule, e.g., comprising one or more mRNAs encoding one or more of the Cas9 molecules wherein said nucleic acid does not encode a Cas9 molecule.
In an embodiment, the composition further comprises a template nucleic acid e.g., a template nucleic acid described herein, e.g., in Section IV.
In yet another aspect, the disclosure features a nucleic acid described herein.
In one aspect, the disclosure features a composition comprising: a) a gRNA molecule (or combination of gRNA molecules, e.g., a gRNA molecule and a second gRNA molecule); b) an eaCas9 molecule (or combination of eaCas9 molecules, e.g., an eaCas9 molecule; and a second eaCas9 molecule); and c) optionally, a template nucleic acid e.g., a template nucleic acid described herein, e.g., in Section IV.
In another aspect, the disclosure features a composition comprising: a) a gRNA molecule (or combination of gRNA molecules, e.g., a gRNA molecule and a second gRNA molecule); b) a nucleic acid, e.g. a DNA or mRNA encoding an eaCas9 molecule (or combination of eaCas9 molecules, e.g., an eaCas9 molecule and a second eaCas9 molecule); c) optionally, a template nucleic acid, e.g., a template nucleic acid described herein, e.g., in Section IV; and d) a governing gRNA molecule, e.g., a Cas9-targeting gRNA molecule.
In yet another aspect, the disclosure features a composition comprising: a) a nucleic acid, e.g., a DNA, which encodes a gRNA molecule (or combination of gRNA molecules, e.g., a gRNA molecule and a second gRNA molecule); b) an eaCas9 molecule (or combination of eaCas9 molecules, e.g., an eaCas9 molecule and a second eaCas9 molecule); c) optionally, a template nucleic acid, e.g., a template nucleic acid described herein, e.g., in Section IV; and d) a governing gRNA molecule, e.g., a gRNA-targeting gRNA molecule.
In still another aspect, the disclosure features a composition comprising: a) nucleic acid, e.g., a DNA, which encodes a gRNA molecule or (or combination of gRNA molecules, e.g., a gRNA molecule and a second gRNA molecule); b) nucleic acid, e.g. a DNA or mRNA encoding eaCas9 molecule or (or combination of eaCas9 molecules, e.g., an eaCas9 molecule and a second eaCas9 molecule) (wherein the gRNA molecule encoding nucleic acid and the eaCas9 molecule encoding nucleic acid can be on the same or different molecules); c) optionally, a template nucleic acid, e.g., a template nucleic acid described herein, e.g., in Section IV; and d) a governing gRNA molecule, e.g., a Cas9-targeting gRNA molecule or a gRNA-targeting gRNA molecule.
In one aspect, the disclosure features a method of altering a cell, e.g., altering the structure, e.g., sequence, of a target nucleic acid of a cell, comprising contacting said cell with:
1) a composition comprising:
2) a composition comprising:
3) a composition comprising:
4) a composition comprising:
In an embodiment, a gRNA molecule or nucleic acid encoding a gRNA molecule, and an eaCas9 molecule, or nucleic acid encoding an eaCas9 molecule, are delivered in or by, one dosage form, mode of delivery, or formulation.
In an embodiment, a) a gRNA molecule or nucleic acid encoding a gRNA molecule is delivered in or by, a first dosage form, a first mode of delivery, or a first formulation; and b) an eaCas9 molecule, or nucleic acid encoding an eaCas9 molecule, is delivered in or by a second dosage form, second mode of delivery, or second formulation. In an embodiment, a governing gRNA molecule (or a nucleic acide that encodes it), e.g., a Cas9-targeting gRNA molecule or a gRNA-targeting gRNA molecule, is provided in the dosage form that contains the component it inactivates, or in another dosage form, mode of delivery, or formulation.
In an embodiment, the cell is an animal or plant cell. In an embodiment, the cell is a mammalian, primate, or human cell. In an embodiment, the cell is a human cell, e.g., a cell from described herein, e.g., in Section VIIA. In an embodiment, the cell is: a somatic cell, germ cell, prenatal cell, e.g., zygotic, blastocyst or embryonic, blastocyst cell, a stem cell, a mitotically competent cell, a meiotically competent cell. In an embodiment, the cell is a human cell, e.g., a cancer cell or other cell characterized by a disease or disorder.
In an embodiment, the target nucleic acid is a chromosomal nucleic acid. In an embodiment, the target nucleic acid is an organellar nucleic acid. In an embodiment, the target nucleic acid is a mitochondrial nucleic acid. In an embodiment, the target nucleic acid is a chloroplast nucleic acid.
In an embodiment, the cell is a cell of a disease causing organism, e.g., a virus, bacterium, fungus, protozoan, or parasite.
In an embodiment, the target nucleic acid is the nucleic acid of a disease causing organism, e.g., of a disease causing organism, e.g., a virus, bacterium, fungus, protozoan, or parasite.
In an embodiment, said method comprises: modulating the expression of a gene or inactivating a disease organism.
In an embodiment, said cell is a cell characterized by unwanted proliferation, e.g., a cancer cell. In an embodiment, said cell is a cell characterized by an unwanted genomic component, e.g., a viral genomic component. In an embodiment, the cell is a cell described herein, e.g., in Section IIA. In an embodiment, a control or structural sequence of at least, 2 3, 4, 5 or 6 or more genes is altered.
In an embodiment, the target nucleic acid is a rearrangement, a rearrangement that comprises a kinase gene, or a rearrangement that comprises a tumor suppressor gene. In an embodiment, the targent nucleic acid comprises a kinase gene or a tumor suppressor gene.
In an embodiment, the method comprises cleaving a target nucleic acid within 10, 20, 30, 40, 50, 100, 150 or 200 nucleotides of a nucleotide of the target position. In an embodiment, said composition comprises a template nucleic acid.
In an embodiment, the template nucleic acid comprises a nucleotide that corresponds to a nucleotide of the target position.
In an embodiment, said template nucleic acid comprises a nucleotide that corresponds to a nucleotide of the target position from a sequence of: a gene, or a gene from a pathway, described herein, e.g., in Section VIIB, e.g., in Table VII-13, VII-14, VII-15, VII-16, VII-17, VII-18, VII-19, VII-20, VII-21, VII-22, VII-23, VII-24, IX-1, IX-1A, IX-3, or XII-1, or in Section VIII.
In an embodiment, the template nucleic acid is or comprises a fragment of 10 to 500, 10 to 400, 10 to 300, 10 to 200 nucleotides in length from a sequence in: a gene, or a gene from a pathway, described herein, e.g., in Section VIIB, e.g., in Table VII-13, VII-14, VII-15, VII-16, VII-17, VII-18, VII-19, VII-20, VII-21, VII-22, VII-23, VII-24, IX-1, IX-1A, IX-3, or XII-1, or in Section VIII.
In an embodiment, the template nucleic acid is or comprises a fragment of 10 to 500, 10 to 400, 10 to 300, 10 to 200 nucleotides in length, which differs at at least 1 nucleotide, but not more than 5, 10, 20 or 30% of its nucleotides, from a corresponding sequence in: a gene, or a gene from a pathway, described herein, e.g., in Section VIIB, e.g., in Table VII-13, VII-14, VII-15, VII-16, VII-17, VII-18, VII-19, VII-20, VII-21, VII-22, VII-23, VII-24, IX-1, IX-1A, IX-3, or XII-1, or in Section VIII.
In an embodiment,
a) a control region, e.g., a cis-acting or tans-acting control region, of a gene is cleaved;
b) the sequence of a control region, e.g., a cis-acting or trans-acting control region, of a gene is altered, e.g., by an alteration that modulates, e.g., increases or decreases, expression a gene under control of the control region, e.g., a control sequence is disrupted or a new control sequence is inserted;
c) the coding sequence of a gene is cleaved;
d) the sequence of a transcribed region, e.g., a coding sequence of a gene is altered, e.g., a mutation is corrected or introduced, an alteration that increases expression of or activity of the gene product is effected, e.g., a mutation is corrected; and/or
e) the sequence of a transcribed region, e.g., the coding sequence of a gene is altered, e.g., a mutation is corrected or introduced, an alteration that decreases expression of or activity of the gene product is effected, e.g., a mutation is inserted, e.g., the sequence of one or more nucleotides is altered so as to insert a stop codon.
In an embodiment, a control region or transcribed region, e.g., a coding sequence, of at least 2, 3, 4, 5, or 6 or more genes are altered.
In another aspect, the disclosure features a method of treating a subject, e.g., by altering the structure, e.g., altering the sequence, of a target nucleic acid, comprising administering to the subject, an effective amount of:
1) a composition comprising:
2) a composition comprising:
3) a composition comprising:
4) a composition comprising:
In an embodiment, a gRNA molecule or nucleic acid encoding a gRNA molecule, and an eaCas9 molecule, or nucleic acid encoding an eaCas9 molecule, are delivered in or by one dosage form, mode of delivery, or formulation. In an embodiment, a governing gRNA molecule (or a nucleic acide that encodes it), e.g., a Cas9-targeting gRNA molecule or a gRNA-targeting gRNA molecule, is provided in the dosage form that contains the component it inactivates, or in another dosage form, mode of delivery, or formulation.
In an embodiment, a gRNA molecule or nucleic acid encoding a gRNA molecule is delivered in or by a first dosage form, in a first mode of delivery, or first formulation; and an eaCas9 molecule, or nucleic acid encoding an eaCas9 molecule, is delivered in or by a second dosage form, second mode of delivery, or second formulation. In an embodiment a governing gRNA molecule (or a nucleic acide that encodes it), e.g., a Cas9-targeting gRNA molecule or a gRNA-targeting gRNA molecule, can provided in the dosage form that contains the component it inactivates, or in another dosage form, mode of delivery, or formulation.
In an embodiment, the subject is an animal or plant. In an embodiment, the subject is a mammalian, primate, or human.
In an embodiment, the target nucleic acid is the nucleic acid of a human cell, e.g., a cell described herein, e.g., in Section VIIA. In an embodiment, the target nucleic acid is the nucleic acid of: a somatic cell, germ cell, prenatal cell, e.g., zygotic, blastocyst or embryonic, blasotcyst cell, a stem cell, a mitotically competent cell, a meiotically competent cell.
In an embodiment, the target nucleic acid is a chromosomal nucleic acid. In an embodiment, the target nucleic acid is an organellar nucleic acid. In an embodiment, the nucleic acid is a mitochondrial nucleic acid. In an embodiment, the nucleic acid is a chloroplast nucleic acid.
In an embodiment, the target nucleic acid is the nucleic acid of a disease causing organism, e.g., of a disease causing organism, e.g., a virus, bacterium, fungus, protozoan, or parasite. In an embodiment, said method comprises modulating expression of a gene or inactivating a disease organism.
In an embodiment, the target nucleic acid is the nucleic acid of a cell characterized by unwanted proliferation, e.g., a cancer cell. In an embodiment, said target nucleic acid comprises an unwanted genomic component, e.g., a viral genomic component. In an embodiment, a control or structural sequence of at least, 2 3, 4, 5 or 6 or more genes is altered. In an embodiment, the target nucleic acid is a rearrangement, a rearrangement that comprises a kinase gene, or a rearrangement that comprises a tumor suppressor gene. In an embodiment, the targent nucleic acid comprises a kinase gene or a tumor suppressor gene.
In an embodiment, the method comprises cleaving a target nucleic acid within 10, 20, 30, 40, 50, 100, 150 or 200 nucleotides of a nucleotide of the target position.
In an embodiment, said composition comprises a template nucleic acid. In an embodiment, the template nucleic acid comprises a nucleotide that corresponds to a nucleotide of the target position.
In an embodiment, said template nucleic acid comprises a nucleotide that corresponds to a nucleotide of the target position from a sequence of: a gene, or a gene from a pathway, described herein, e.g., in Section VIIB, e.g., in Table VII-13, VII-14, VII-15, VII-16, VII-17, VII-18, VII-19, VII-20, VII-21, VII-22, VII-23, VII-24, IX-1, IX-1A, IX-3, or XII-1, or in Section VIII.
In an embodiment, the template nucleic acid is or comprises a fragment of 10 to 500, 10 to 400, 10 to 300, 10 to 200 nucleotides in length from a sequence in: a gene, or a gene from a pathway, described herein, e.g., in Section VIIB, e.g., in Table VII-13, VII-14, VII-15, VII-16, VII-17, VII-18, VII-19, VII-20, VII-21, VII-22, VII-23, VII-24, IX-1, IX-1A, IX-3, or XII-1, or in Section VIII.
In an embodiment, the template nucleic acid is or comprises a fragment of 10 to 500, 10 to 400, 10 to 300, 10 to 200 nucleotides in length, which differs at at least 1 nucleotide, but not more than 5, 10, 20 or 30% of its nucleotides, from a corresponding sequence in: In an embodiment,
b) the sequence of a control region, e.g., a cis-acting or trans-acting control region, of a gene is altered, e.g., by an alteration that modulates, e.g., increases or decreases, expression a gene under control of the control region, e.g., a control sequence is disrupted or a new control sequence is inserted;
c) the coding sequence of a gene is cleaved;
d) the sequence of a transcribed region, e.g., a coding sequence of a gene is altered, e.g., a mutation is corrected or introduced, an alteration that increases expression of or activity of the gene product is effected, e.g., a mutation is corrected;
e) the non-coding sequence of a gene or an intergenic region between genes is cleaved; and/or
f) the sequence of a transcribed region, e.g., the coding sequence of a gene is altered, e.g., a mutation is corrected or introduced, an alteration that decreases expression of or activity of the gene product is effected, e.g., a mutation is inserted, e.g., the sequence of one or more nucleotides is altered so as to insert a stop codon.
In an embodiment, a control region or transcribed region, e.g., a coding sequence, of at least 2, 3, 4, 5, or 6 or more genes are altered.
In one aspect, the disclosure features a composition comprising: a) a gRNA molecule (or combination of gRNA molecules, e.g., a gRNA molecule and a second gRNA molecule); b) a Cas9 molecule, e.g., an eiCas9 molecule (or combination of Cas9 molecules, e.g., an eiCas9 molecule and a second eiCas9 molecule); and c) a payload coupled, covalently or non-covalently, to a complex of the gRNA molecule and the Cas9 molecule, e.g., coupled to the Cas9 molecule or the gRNA molecule.
In another aspect, the disclosure features a composition comprising: a) a gRNA molecule (or combination of gRNA molecules, e.g., a gRNA molecule and a second gRNA molecule); b) a nucleic acid, e.g. a DNA or mRNA encoding a Cas9 molecule, e.g., an eiCas9 molecule (or combination of Cas9 molecules, e.g., an eiCas9 molecule and a second eiCas9 molecule); and c) a payload which is: coupled, covalently or non-covalently, the gRNA molecule; or a fusion partner with the Cas9 molecule.
In yet another aspect, the disclosure features a composition comprising: a) a nucleic acid, e.g., a DNA, which encodes a gRNA molecule (or combination of gRNA molecules, e.g., a gRNA molecule and a second gRNA molecule); b) a Cas9 molecule, e.g., an eiCas9 molecule (or combination of Cas9 molecules, e.g., an eiCas9 molecule and a second eiCas9 molecule); c) a payload which is coupled, covalently or non-covalently, to the Cas9 molecule; and d) a governing gRNA molecule, e.g., a gRNA-targeting gRNA molecule.
In still another aspect, the disclosure features a composition comprising: a) nucleic acid, e.g., a DNA, which encodes a gRNA molecule or (or combination of gRNA molecules, e.g., a gRNA molecule and a second gRNA molecule); b) nucleic acid, e.g. a DNA or mRNA, encoding a Cas9 molecule, e.g., an eiCas9 molecule (or combination of Cas9 molecules, e.g., an eiCas9 molecule and a second eiCas9 molecule), wherein the gRNA molecule encoding nucleic acid and the eaCas9 molecule encoding nucleic acid can be on the same or different molecules; c) a payload which is a fusion partner with the Cas9 molecule; and d) a governing gRNA molecule, e.g., a Cas9-targeting gRNA molecule or a gRNA-targeting gRNA molecule.
In one aspect, the disclosure features a method of delivering a payload to a cell, e.g., by targeting a payload to target nucleic acid, comprising contacting said cell with:
1) a composition comprising:
2) a composition comprising:
3) a composition comprising:
4) a composition comprising:
In an embodiment, a gRNA molecule or nucleic acid encoding a gRNA molecule, and an eaCas9 molecule, or nucleic acid encoding an eaCas9 molecule, are delivered in or by one dosage form, mode of delivery, or formulation. In an embodiment, a governing gRNA molecule (or a nucleic acide that encodes it), e.g., a Cas9-targeting gRNA molecule or a gRNA-targeting gRNA molecule, is provided in the dosage form that contains the component it inactivates, or in another dosage form, mode of delivery, or formulation.
In an embodiment, a gRNA molecule or nucleic acid encoding a gRNA molecule is delivered in or by a first dosage form, first mode of delivery, or first formulation; and a Cas9 molecule, or nucleic acid encoding a Cas9 molecule, is delivered in or by a second dosage form, second mode of delivery, or second formulation. In an embodiment, a governing gRNA molecule (or a nucleic acide that encodes it), e.g., a Cas9-targeting gRNA molecule or a gRNA-targeting gRNA molecule, is provided in the dosage form that contains the component it inactivates, or in another dosage form, mode of delivery, or formulation.
In an embodiment, the cell is an animal or plant cell. In an embodiment, the cell is a mammalian, primate, or human cell. In an embodiment, the cell is a human cell, e.g., a human cell described herein, e.g., in Section VIIA. In an embodiment, the cell is: a somatic cell, germ cell, prenatal cell, e.g., zygotic, blastocyst or embryonic, blasotcyst cell, a stem cell, a mitotically competent cell, a meiotically competent cell. In an embodiment, the cell is a human cell, e.g., a cancer cell, a cell comprising an unwanted genetic element, e.g., all or part of a viral genome.
In an embodiment, the gRNA mediates targeting of a chromosomal nucleic acid. In an embodiment, the gRNA mediates targeting of a selected genomic signature. In an embodiment, the gRNA mediates targeting of an organellar nucleic acid. In an embodiment, the gRNA mediates targeting of a mitochondrial nucleic acid. In an embodiment, the gRNA mediates targeting of a chloroplast nucleic acid.
In an embodiment, the cell is a cell of a disease causing organism, e.g., a virus, bacterium, fungus, protozoan, or parasite.
In an embodiment, the gRNA mediates targeting of the nucleic acid of a disease causing organism, e.g., of a disease causing organism, e.g., a virus, bacterium, fungus, protozoan, or parasite.
In an embodiment, the payload comprises a payload described herein, e.g., in Section VI.
In an embodiment, said cell is a cell characterized by unwanted proliferation, e.g., a cancer cell. In an embodiment, said cell is characterized by an unwanted genomic component, e.g., a viral genomic component.
In an embodiment, a control or structural sequence of at least 2 3, 4, 5, or 6 or more genes is altered.
In an embodiment, the gRNA targets a selected genomic signature, e.g., a mutation, e.g., a germline or acquired somatic mutation. In an embodiment, the target nucleic acid is a rearrangement, a rearrangement that comprises a kinase gene, or a rearrangement that comprises a tumor suppressor gene. In an embodiment, the targent nucleic acid comprises a kinase gene or a tumor suppressor gene. In an embodiment, the gRNA targets a cancer cell, e.g., a cancer cell disclosed herein, e.g., in Section VIIA. In an embodiment, the gRNA targets a cell which has been infected with a virus.
In another aspect, the disclosure features a method of treating a subject, e.g., by targeting a payload to target nucleic acid, comprising administering to the subject, an effective amount of:
1) a composition comprising:
2) a composition comprising:
3) a composition comprising:
4) a composition comprising:
In an embodiment, a gRNA molecule or nucleic acid encoding a gRNA molecule, and an eaCas9 molecule, or nucleic acid encoding an eaCas9 molecule, are delivered in or by one dosage form, mode of delivery, or formulation. In an embodiment a governing gRNA molecule (or a nucleic acide that encodes it), e.g., a Cas9-targeting gRNA molecule or a gRNA-targeting gRNA molecule, can provided in the dosage form that contains the component it inactivates, or in another dosage form, mode of delivery, or formulation.
In an embodiment, a gRNA molecule or nucleic acid encoding a gRNA molecule is delivered in or by a first dosage, mode of delivery form or formulation; and a Cas9 molecule, or nucleic acid encoding a Cas9 molecule, is delivered in or by a second dosage form, mode of delivery, or formulation. In an embodiment a governing gRNA molecule (or a nucleic acide that encodes it), e.g., a Cas9-targeting gRNA molecule or a gRNA-targeting gRNA molecule, can provided in the dosage form that contains the component it inactivates, or in another dosage form, mode of delivery, or formulation.
In an embodiment, the subject is an animal or plant cell. In an embodiment, the subject is a mammalian, primate, or human cell.
In an embodiment, the gRNA mediates targeting of a human cell, e.g., a human cell described herein, e.g., in Section VIIA. In an embodiment, the gRNA mediates targeting of: a somatic cell, germ cell, prenatal cell, e.g., zygotic, blastocyst or embryonic, blasotcyst cell, a stem cell, a mitotically competent cell, a meiotically competent cell. In an embodiment, the gRNA mediates targeting of a cancer cell or a cell comprising an unwanted genomic element, e.g., all or part of a viral genome. In an embodiment, the gRNA mediates targeting of a chromosomal nucleic acid. In an embodiment, the gRNA mediates targeting of a selected genomic signature. In an embodiment, the gRNA mediates targeting of an organellar nucleic acid. In an embodiment, the gRNA mediates targeting of a mitochondrial nucleic acid. In an embodiment, the gRNA mediates targeting of a chloroplast nucleic acid. In an embodiment, the gRNA mediates targeting of the nucleic acid of a disease causing organism, e.g., of a disease causing organism, e.g., a virus, bacterium, fungus, protozoan, or parasite. In an embodiment, the gRNA targets a cell characterized by unwanted proliferation, e.g., a cancer cell, e.g., a cancer cell from Section VIIA, e.g., from Table VII-11. In an embodiment, the gRNA targets a cell characterized by an unwanted genomic component, e.g., a viral genomic component.
In an embodiment, a control element, e.g., a promoter or enhancer, is targeted. In an embodiment, the target nucleic acid is a rearrangement, a rearrangement that comprises a kinase gene, or a rearrangement that comprises a tumor suppressor gene. In an embodiment, the targent nucleic acid comprises a kinase gene or a tumor suppressor gene. In an embodiment, the gRNA targets a selected genomic signature, e.g., a mutation, e.g., a germline or acquired somatic mutation.
In an embodiment, the gRNA targets a cancer cell. In an embodiment, the gRNA targets a cell which has been infected with a virus.
In an embodiment, at least one eaCas9 molecule and a payload are administered. In an embodiment, the payload comprises a payload described herein, e.g., in Section VI.
Unless otherwise defined, all technical and scientific terms used herein have the same meaning as commonly understood by one of ordinary skill in the art to which this invention belongs. Although methods and materials similar or equivalent to those described herein can be used in the practice or testing of the present invention, suitable methods and materials are described below. All publications, patent applications, patents, and other references mentioned herein are incorporated by reference in their entirety. In addition, the materials, methods, and examples are illustrative only and not intended to be limiting.
Headings, including numeric and alphabetical headings and subheadings, are for organization and presentation and are not intended to be limiting.
Other features and advantages of the invention will be apparent from the detailed description, drawings, and from the claims.
The Figures described below, that together make up the Drawing, are for illustration purposes only, not for limitation.
FIG. 1A-G are representations of several exemplary gRNAs.
FIG. 1A depicts a modular gRNA molecule derived in part (or modeled on a sequence in part) from Streptococcus pyogenes (S. pyogenes) as a duplexed structure (SEQ ID NOS 42 and 43, respectively, in order of appearance);
FIG. 1B depicts a unimolecular (or chimeric) gRNA molecule derived in part from S. pyogenes as a duplexed structure (SEQ ID NO: 44);
FIG. 1C depicts a unimolecular gRNA molecule derived in part from S. pyogenes as a duplexed structure (SEQ ID NO: 45);
FIG. 1D depicts a unimolecular gRNA molecule derived in part from S. pyogenes as a duplexed structure (SEQ ID NO: 46);
FIG. 1E depicts a unimolecular gRNA molecule derived in part from S. pyogenes as a duplexed structure (SEQ ID NO: 47);
FIG. 1F depicts a modular gRNA molecule derived in part from Streptococcus thermophilus (S. thermophilus) as a duplexed structure (SEQ ID NOS 48 and 49, respectively, in order of appearance);
FIG. 1G depicts an alignment of modular gRNA molecules of S. pyogenes and S. thermophilus (SEQ ID NOS 50-53, respectively, in order of appearance).
FIG. 2 depicts an alignment of Cas9 sequences from Chylinski et al., RNA BIOL. 2013; 10(5): 726-737. The N-terminal RuvC-like domain is boxed and indicated with a “Y”. The other two RuvC-like domains are boxed and indicated with a “B”. The HNH-like domain is boxed and indicated by a “G”. Sm: S. mutans (SEQ ID NO: 1); Sp: S. pyogenes (SEQ ID NO: 2); St: S. thermophilus (SEQ ID NO: 3); Li: L. innocua (SEQ ID NO: 4). Motif: this is a motif based on the four sequences: residues conserved in all four sequences are indicated by single letter amino acid abbreviation; “*” indicates any amino acid found in the corresponding position of any of the four sequences; and “-” indicates any amino acid, e.g., any of the 20 naturally occurring amino acids.
FIG. 3A shows an alignment of the N-terminal RuvC-like domain from the Cas9 molecules disclosed in Chylinski et al. (SEQ ID NOS 54-103, respectively, in order of appearance). The last line of FIG. 3A identifies 3 highly conserved residues.
FIG. 3B shows an alignment of the N-terminal RuvC-like domain from the Cas9 molecules disclosed in Chylinski et al. with sequence outliers removed (SEQ ID NOS 104-177, respectively, in order of appearance). The last line of FIG. 3B identifies 4 highly conserved residues.
FIG. 4A shows an alignment of the HNH-like domain from the Cas9 molecules disclosed in Chylinski et al. (SEQ ID NOS 178-252, respectively, in order of appearance). The last line of FIG. 4A identifies conserved residues.
FIG. 4B shows an alignment of the HNH-like domain from the Cas9 molecules disclosed in Chylinski et al. with sequence outliers removed (SEQ ID NOS 253-302, respectively, in order of appearance). The last line of FIG. 4B identifies 3 highly conserved residues.
FIG. 5 depicts an alignment of Cas9 sequences from S. pyogenes and Neisseria meningitidis (N. meningitidis). The N-terminal RuvC-like domain is boxed and indicated with a “Y”. The other two RuvC-like domains are boxed and indicated with a “B”. The HNH-like domain is boxed and indicated with a “G”. Sp: S. pyogenes; Nm: N. meningitidis. Motif: this is a motif based on the two sequences: residues conserved in both sequences are indicated by a single amino acid designation; “*” indicates any amino acid found in the corresponding position of any of the two sequences; “-” indicates any amino acid, e.g., any of the 20 naturally occurring amino acids, and “-” indicates any amino acid, e.g., any of the 20 naturally occurring amino acids, or absent.
FIG. 6 shows a nucleic acid sequence encoding Cas9 of N. meningitidis (SEQ ID NO: 303). Sequence indicated by an “R” is an SV40 NLS; sequence indicated as “G” is an HA tag; sequence indicated by an “0” is a synthetic NLS sequence. The remaining (unmarked) sequence is the open reading frame (ORF).
FIG. 7 depicts the levels of Cas9 protein expression in cells transfected with each of the Cas9-targeted governing gRNAs at 1, 2, 3, 6 and 9 days following transfection.
“Governing gRNA molecule”, as used herein, refers to a gRNA molecule that can complex with a Cas9 molecule to inactivate or silence a component of the Cas9 system. In an embodiment, the governing gRNA molecule inactivates or silences a nucleic acid that comprises the sequence encoding the Cas9 molecule. In an embodiment, it inactivates or silences the nucleic acid that comprises the sequence encoding the gRNA molecule. In an embodiment, the governing gRNA, e.g., a Cas9-targeting gRNA molecule, or a gRNA targeting gRNA molecule, limits the effect of the Cas9 molecule/gRNA molecule complex-mediated gene targeting. In an embodiment, it places temporal, level of expression, or other limits, on activity of the Cas9 molecule/gRNA molecule complex. In an embodiment, it reduces off-target or other unwanted activity. Governing gRNA molecules can act as to inhibit, e.g., entirely or substantially inhibit, the production of a component of the Cas9 system, e.g., the Cas9 molecule, and thereby limit, or govern, its activity.
The governing gRNA molecule can target any region of the nucleic acid that comprises the sequence encoding the component to be negatively regulated, within or outside the transcribed or translated region of the component, as long as production of the component is reduced.
In an embodiment, a governing gRNA molecule comprises a targeting sequence that is complementary with a target sequence on the nucleic acid on which the sequence encoding the component to be negatively regulated resides.
In an embodiment, a governing gRNA molecule comprises a targeting sequence that is complementary with a sequence of the component to be negatively regulated.
In an embodiment, a Cas9-targeting gRNA molecule can include a targeting sequence that targets the nucleic acid on which the sequence that encodes the Cas9 molecule resides.
In an embodiment, a Cas9-targeting gRNA molecule can include a targeting sequence that targets the Cas9 molecule sequence.
In an embodiment, a gRNA-targeting gRNA molecule can include a targeting sequence that targets the nucleic acid on which the sequence that encodes the gRNA molecule resides.
In an embodiment, a gRNA-targeting gRNA molecule can include a targeting sequence that targets the gRNA molecule sequence.
“Domain”, as used herein, is used to describe segments of a protein or nucleic acid. Unless otherwise indicated, a domain is not required to have any specific functional property.
Calculations of “homology” or “sequence identity” between two sequences (the terms are used interchangeably herein) are performed as follows. The sequences are aligned for optimal comparison purposes (e.g., gaps can be introduced in one or both of a first and a second amino acid or nucleic acid sequence for optimal alignment and non-homologous sequences can be disregarded for comparison purposes). The optimal alignment is determined as the best score using the GAP program in the GCG software package with a Blossum 62 scoring matrix with a gap penalty of 12, a gap extend penalty of 4, and a frame shift gap penalty of 5. The amino acid residues or nucleotides at corresponding amino acid positions or nucleotide positions are then compared. When a position in the first sequence is occupied by the same amino acid residue or nucleotide as the corresponding position in the second sequence, then the molecules are identical at that position (as used herein, In an embodiment, amino acid or nucleic acid “identity” is equivalent to amino acid or nucleic acid “homology”). The percent identity between the two sequences is a function of the number of identical positions shared by the sequences.
“Modulator”, as used herein, refers to an entity, e.g., a drug, that can alter the activity (e.g., enzymatic activity, transcriptional activity, or translational activity), amount, distribution, or structure of a subject molecule or genetic sequence. In an embodiment, modulation comprises cleavage, e.g., breaking of a covalent or non-covalent bond, or the forming of a covalent or non-covalent bond, e.g., the attachment of a moiety, to the subject molecule. In an embodiment, a modulator alters the, three dimensional, secondary, tertiary, or quaternary structure, of a subject molecule. A modulator can increase, decrease, initiate, or eliminate a subject activity.
“Large molecule”, as used herein, refers to a molecule having a molecular weight of at least 2, 3, 5, 10, 20, 30, 40, 50, 60, 70, 80, 90, or 100 kD. Large molecules include proteins, polypeptides, nucleic acids, biologics, and carbohydrates.
“Polypeptide”, as used herein, refers to a polymer of amino acids having less than 100 amino acid residues. In an embodiment, it has less than 50, 20, or 10 amino acid residues.
“Reference molecule”, e.g., a reference Cas9 molecule or reference gRNA, as used herein, refers to a molecule to which a subject molecule, e.g., a subject Cas9 molecule of subject gRNA molecule, e.g., a modified or candidate Cas9 molecule is compared. For example, a Cas9 molecule can be characterized as having no more than 10% of the nuclease activity of a reference Cas9 molecule. Examples of reference Cas9 molecules include naturally occurring unmodified Cas9 molecules, e.g., a naturally occurring Cas9 molecule such as a Cas9 molecule of S. pyogenes, or S. thermophilus. In an embodiment, the reference Cas9 molecule is the naturally occurring Cas9 molecule having the closest sequence identity or homology with the Cas9 molecule to which it is being compared. In an embodiment, the reference Cas9 molecule is a sequence, e.g., a naturally occurring or known sequence, which is the parental form on which a change, e.g., a mutation has been made.
“Replacement”, or “replaced”, as used herein with reference to a modification of a molecule does not require a process limitation but merely indicates that the replacement entity is present.
“Small molecule”, as used herein, refers to a compound having a molecular weight less than about 2 kD, e.g., less than about 2 kD, less than about 1.5 kD, less than about 1 kD, or less than about 0.75 kD.
“Subject”, as used herein, may mean either a human or non-human animal. The term includes, but is not limited to, mammals (e.g., humans, other primates, pigs, rodents (e.g., mice and rats or hamsters), rabbits, guinea pigs, cows, horses, cats, dogs, sheep, and goats). In an embodiment, the subject is a human. In an embodiment, the subject is poultry.
“Treat”, “treating” and “treatment”, as used herein, mean the treatment of a disease in a mammal, e.g., in a human, including (a) inhibiting the disease, i.e., arresting or preventing its development; (b) relieving the disease, i.e., causing regression of the disease state; or (c) curing the disease.
“X” as used herein in the context of an amino acid sequence, refers to any amino acid (e.g., any of the twenty natural amino acids) unless otherwise specified.
I. gRNA Molecules
A gRNA molecule, as that term is used herein, refers to a nucleic acid that promotes the specific targeting or homing of a gRNA molecule/Cas9 molecule complex to a target nucleic acid. gRNA molecules can be unimolecular (having a single RNA molecule), sometimes referred to herein as “chimeric” gRNAs, or modular (comprising more than one, and typically two, separate RNA molecules). A gRNA molecule comprises a number of domains. The gRNA molecule domains are described in more detail below. Typically, gRNA will incorporate the functions or structure of both crRNA and tracrRNA, e.g., the functions of processed or mature crRNA and of processed or mature tracrRNA. Chimieric or unimolecular gRNA molecules can have a single RNA molecule, e.g., which incorporates both crRNA function or structure and the tracrRNA function or structure. A modular gRNA molecule can comprise a RNA molecule that incorporates the crRNA function or structure another that incorporates the tracrRNA function or structure. Several exemplary gRNA structures, with domains indicated thereon, are provided in FIG. 1. While not wishing to be bound by theory with regard to the three dimensional form, or intra- or inter-strand interactions of an active form of a gRNA, regions of high complementarity are sometimes shown as duplexes in FIG. 1 and other depictions provided herein.
In an embodiment, a unimolecular, or chimeric, gRNA comprises, preferably from 5′ to 3′:
In an embodiment, a modular gRNA comprises:
The domains are discussed briefly below:
1) The Targeting Domain:
FIGS. 1A-1G provide examples of the placement of targeting domains.
The targeting domain comprises a nucleotide sequence that is complementary, e.g., at least 80, 85, 90, or 95% complementary, e.g., fully complementary, to the target sequence on the target nucleic acid. The targeting domain is part of an RNA molecule and will therefore comprise the base uracil (U), while any DNA encoding the gRNA molecule will comprise the base thymine (T). While not wishing to be bound by theory, it is believed that the complementarity of the targeting domain with the target sequence contributes to specificity of the interaction of the gRNA molecule/Cas9 molecule complex with a target nucleic acid. It is understood that in a targeting domain and target sequence pair, the uracil bases in the targeting domain will pair with the adenine bases in the target sequence. In an embodiment, the target domain itself comprises, in the 5′ to 3′ direction, an optional secondary domain, and a core domain. In an embodiment, the core domain is fully complementary with the target sequence. In an embodiment, the targeting domain is 5 to 50, e.g., 10 to 40, e.g., 10 to 30, e.g., 15 to 30, e.g., 15 to 25 nucleotides in length. In an embodiment, the targeting domain is 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, or 26 nucleotides in length. The strand of the target nucleic acid with which the targeting domain is complementary is referred to herein as the complementary strand. Some or all of the nucleotides of the domain can have a modification, e.g., modification found in Section X herein.
In an embodiment, the targeting domain is 15 nucleotides in length.
In an embodiment, the targeting domain is 16 nucleotides in length.
In an embodiment, the targeting domain is 17 nucleotides in length.
In an embodiment, the targeting domain is 18 nucleotides in length.
In an embodiment, the targeting domain is 19 nucleotides in length.
In an embodiment, the targeting domain is 20 nucleotides in length.
In an embodiment, the targeting domain is 21 nucleotides in length.
In an embodiment, the targeting domain is 22 nucleotides in length.
In an embodiment, the targeting domain is 23 nucleotides in length.
In an embodiment, the targeting domain is 24 nucleotides in length.
In an embodiment, the targeting domain is 25 nucleotides in length.
In an embodiment, the targeting domain is 26 nucleotides in length.
In an embodiment, the targeting domain comprises 15 nucleotides.
In an embodiment, the targeting domain comprises 16 nucleotides.
In an embodiment, the targeting domain comprises 17 nucleotides.
In an embodiment, the targeting domain comprises 18 nucleotides.
In an embodiment, the targeting domain comprises 19 nucleotides.
In an embodiment, the targeting domain comprises 20 nucleotides.
In an embodiment, the targeting domain comprises 21 nucleotides.
In an embodiment, the targeting domain comprises 22 nucleotides.
In an embodiment, the targeting domain comprises 23 nucleotides.
In an embodiment, the targeting domain comprises 24 nucleotides.
In an embodiment, the targeting domain comprises 25 nucleotides.
In an embodiment, the targeting domain comprises 26 nucleotides.
Targeting domains are discussed in more detail below.
2) The First Complementarity Domain:
FIGS. 1A-1G provide examples of first complementarity domains.
The first complementarity domain is complementary with the second complementarity domain, and in an embodiment, has sufficient complementarity to the second complementarity domain to form a duplexed region under at least some physiological conditions. In an embodiment, the first complementarity domain is 5 to 30 nucleotides in length. In an embodiment, the first complementarity domain is 5 to 25 nucleotides in length. In an embodiment, the first complementary domain is 7 to 25 nucleotides in length. In an embodiment, the first complementary domain is 7 to 22 nucleotides in length. In an embodiment, the first complementary domain is 7 to 18 nucleotides in length. In an embodiment, the first complementary domain is 7 to 15 nucleotides in length. In an embodiment, the first complementary domain is 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, or 25 nucleotides in length.
In an embodiment, the first complementarity domain comprises 3 subdomains, which, in the 5′ to 3′ direction are: a 5′ subdomain, a central subdomain, and a 3′ subdomain. In an embodiment, the 5′ subdomain is 4-9, e.g., 4, 5, 6, 7, 8 or 9 nucleotides in length. In an embodiment, the central subdomain is 1, 2, or 3, e.g., 1, nucleotide in length. In an embodiment, the 3′ subdomain is 3 to 25, e.g., 4-22, 4-18, or 4 to 10, or 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, or 25, nucleotides in length.
The first complementarity domain can share homology with, or be derived from, a naturally occurring first complementarity domain. In an embodiment, it has at least 50% homology with a first complementarity domain disclosed herein, e.g., an S. pyogenes, or S. thermophilus, first complementarity domain.
Some or all of the nucleotides of the domain can have a modification, e.g., modification found in Section X herein.
First complementarity domains are discussed in more detail below.
3) The Linking Domain
FIGS. 1B-1E provide examples of linking domains.
A linking domain serves to link the first complementarity domain with the second complementarity domain of a unimolecular gRNA. The linking domain can link the first and second complementarity domains covalently or non-covalently. In an embodiment, the linkage is covalent. In an embodiment, the linking domain covalently couples the first and second complementarity domains, see, e.g., FIGS. 1B-1E. In an embodiment, the linking domain is, or comprises, a covalent bond interposed between the first complementarity domain and the second complementarity domain. Typically, the linking domain comprises one or more, e.g., 2, 3, 4, 5, 6, 7, 8, 9, or 10 nucleotides.
In modular gRNA molecules the two molecules can be associated by virtue of the hybridization of the complementarity domains, see e.g., FIG. 1A.
A wide variety of linking domains are suitable for use in unimolecular gRNA molecules. Linking domains can consist of a covalent bond, or be as short as one or a few nucleotides, e.g., 1, 2, 3, 4, or 5 nucleotides in length.
In an embodiment, a linking domain is 2, 3, 4, 5, 6, 7, 8, 9, 10, 15, 20, or 25 or more nucleotides in length. In an embodiment, a linking domain is 2 to 50, 2 to 40, 2 to 30, 2 to 20, 2 to 10, or 2 to 5 nucleotides in length. In an embodiment, a linking domain shares homology with, or is derived from, a naturally occurring sequence, e.g., the sequence of a tracrRNA that is 5′ to the second complementarity domain. In an embodiment, the linking domain has at least 50% homology with a linking domain disclosed herein.
Some or all of the nucleotides of the domain can have a modification, e.g., modification found in Section X herein.
Linking domains are discussed in more detail below.
4) The 5′ Extension Domain
In an embodiment, a modular gRNA can comprise additional sequence, 5′ to the second complementarity domain, referred to herein as the 5′ extension domain, see, e.g., FIG. 1A. In an embodiment, the 5′ extension domain is, 2-10, 2-9, 2-8, 2-7, 2-6, 2-5, 2-4 nucleotides in length. In an embodiment, the 5′ extension domain is 2, 3, 4, 5, 6, 7, 8, 9, or 10 or more nucleotides in length.
5) The Second Complementarity Domain:
FIGS. 1A-1F provide examples of second complementarity domains.
The second complementarity domain is complementary with the first complementarity domain, and in an embodiment, has sufficient complementarity to the second complementarity domain to form a duplexed region under at least some physiological conditions. In an embodiment, e.g., as shown in FIG. 1A or FIG. 1B, the second complementarity domain can include sequence that lacks complementarity with the first complementarity domain, e.g., sequence that loops out from the duplexed region.
In an embodiment, the second complementarity domain is 5 to 27 nucleotides in length. In an embodiment, it is longer than the first complementarity region.
In an embodiment, the second complementary domain is 7 to 27 nucleotides in length. In an embodiment, the second complementary domain is 7 to 25 nucleotides in length. In an embodiment, the second complementary domain is 7 to 20 nucleotides in length. In an embodiment, the second complementary domain is 7 to 17 nucleotides in length. In an embodiment, the complementary domain is 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24 or 25 nucleotides in length.
In an embodiment, the second complementarity domain comprises 3 subdomains, which, in the 5′ to 3′ direction are: a 5′ subdomain, a central subdomain, and a 3′ subdomain. In an embodiment, the 5′ subdomain is 3 to 25, e.g., 4 to 22, 4 to 18, or 4 to 10, or 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, or 25 nucleotides in length. In an embodiment, the central subdomain is 1, 2, 3, 4 or 5, e.g., 3, nucleotides in length. In an embodiment, the 3′ subdomain is 4 to 9, e.g., 4, 5, 6, 7, 8 or 9 nucleotides in length.
In an embodiment, the 5′ subdomain and the 3′ subdomain of the first complementarity domain, are respectively, complementary, e.g., fully complementary, with the 3′ subdomain and the 5′ subdomain of the second complementarity domain.
The second complementarity domain can share homology with or be derived from a naturally occurring second complementarity domain. In an embodiment, it has at least 50% homology with a second complementarity domain disclosed herein, e.g., an S. pyogenes, or S. thermophilus, first complementarity domain.
Some or all of the nucleotides of the domain can have a modification, e.g., modification found in Section X herein.
6) A Proximal Domain:
FIGS. 1A-1F provide examples of proximal domains.
In an embodiment, the proximal domain is 5 to 20 nucleotides in length. In an embodiment, the proximal domain can share homology with or be derived from a naturally occurring proximal domain. In an embodiment, it has at least 50% homology with a proximal domain disclosed herein, e.g., an S. pyogenes, or S. thermophilus, proximal domain.
Some or all of the nucleotides of the domain can have a modification, e.g., modification found in Section X herein.
7) A Tail Domain:
FIG. 1A and FIGS. 1C-1F provide examples of tail domains.
As can be seen by inspection of the tail domains in FIG. 1A and FIGS. 1C-1F, a broad spectrum of tail domains are suitable for use in gRNA molecules. In an embodiment, the tail domain is 0 (absent), 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10 nucleotides in length. In an embodiment, the tail domain nucleotides are from or share homology with sequence from the 5′ end of a naturally occurring tail domain, see e.g., FIG. 1D or FIG. 1E. In an embodiment, the tail domain includes sequences that are complementary to each other and which, under at least some physiological conditions, form a duplexed region.
In an embodiment, the tail domain is absent or is 1 to 50 nucleotides in length. In an embodiment, the tail domain can share homology with or be derived from a naturally occurring proximal tail domain. In an embodiment, it has at least 50% homology with a tail domain disclosed herein, e.g., an S. pyogenes, or S. thermophilus, tail domain.
Some or all of the nucleotides of the domain can have a modification, e.g., modification found in Section X herein.
In an embodiment, the tail domain includes nucleotides at the 3′ end that are related to the method of in vitro or in vivo transcription. When a T7 promoter is used for in vitro transcription of the gRNA, these nucleotides may be any nucleotides present before the 3′ end of the DNA template. When a U6 promoter is used for in vivo transcription, these nucleotides may be the sequence UUUUUU. When alternate pol-III promoters are used, these nucleotides may be various numbers or uracil bases or may include alternate bases.
The domains of gRNA molecules are described in more detail below.
The Targeting Domain
The “targeting domain” of the gRNA is complementary to the “target domain” on the target nucleic acid. The strand of the target nucleic acid comprising the nucleotide sequence complementary to the core domain of the gRNA is referred to herein as the “complementary strand” of the target nucleic acid. Guidance on the selection of targeting domains can be found, e.g., in Fu Y et al., NAT BIOTECHNOL 2014 (doi: 10.1038/nbt.2808) and Sternberg S H et al., NATURE 2014 (doi: 10.1038/nature13011).
In an embodiment, the targeting domain is 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25 or 26 nucleotides in length.
In an embodiment, the targeting domain comprises 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25 or 26 nucleotides in length.
In an embodiment, the targeting domain is 15 nucleotides in length.
In an embodiment, the targeting domain is 16 nucleotides in length.
In an embodiment, the targeting domain is 17 nucleotides in length.
In an embodiment, the targeting domain is 18 nucleotides in length.
In an embodiment, the targeting domain is 19 nucleotides in length.
In an embodiment, the targeting domain is 20 nucleotides in length.
In an embodiment, the targeting domain is 21 nucleotides in length.
In an embodiment, the targeting domain is 22 nucleotides in length.
In an embodiment, the targeting domain is 23 nucleotides in length.
In an embodiment, the targeting domain is 24 nucleotides in length.
In an embodiment, the targeting domain is 25 nucleotides in length.
In an embodiment, the targeting domain is 26 nucleotides in length.
In an embodiment, the targeting domain comprises 15 nucleotides.
In an embodiment, the targeting domain comprises 16 nucleotides.
In an embodiment, the targeting domain comprises 17 nucleotides.
In an embodiment, the targeting domain comprises 18 nucleotides.
In an embodiment, the targeting domain comprises 19 nucleotides.
In an embodiment, the targeting domain comprises 20 nucleotides.
In an embodiment, the targeting domain comprises 21 nucleotides.
In an embodiment, the targeting domain comprises 22 nucleotides.
In an embodiment, the targeting domain comprises 23 nucleotides.
In an embodiment, the targeting domain comprises 24 nucleotides.
In an embodiment, the targeting domain comprises 25 nucleotides.
In an embodiment, the targeting domain comprises 26 nucleotides.
In an embodiment, the targeting domain is 10+/−5, 20+/−5, 30+/−5, 40+/−5, 50+/−5, 60+/−5, 70+/−5, 80+/−5, 90+/−5, or 100+/−5 nucleotides, in length.
In an embodiment, the targeting domain is 20+/−5 nucleotides in length.
In an embodiment, the targeting domain is 20+/−10, 30+/−10, 40+/−10, 50+/−10, 60+/−10, 70+/−10, 80+/−10, 90+/−10, or 100+/−10 nucleotides, in length.
In an embodiment, the targeting domain is 30+/−10 nucleotides in length.
In an embodiment, the targeting domain is 10 to 100, 10 to 90, 10 to 80, 10 to 70, 10 to 60, 10 to 50, 10 to 40, 10 to 30, 10 to 20 or 10 to 15 nucleotides in length. In an embodiment, the targeting domain is 20 to 100, 20 to 90, 20 to 80, 20 to 70, 20 to 60, 20 to 50, 20 to 40, 20 to 30, or 20 to 25 nucleotides in length.
Typically the targeting domain has full complementarity with the target sequence. In an embodiment the targeting domain has or includes 1, 2, 3, 4, 5, 6, 7 or 8 nucleotides that are not complementary with the corresponding nucleotide of the targeting domain.
In an embodiment, the target domain includes 1, 2, 3, 4 or 5 nucleotides that are complementary with the corresponding nucleotide of the targeting domain within 5 nucleotides of its 5′ end. In an embodiment, the target domain includes 1, 2, 3, 4 or 5 nucleotides that are complementary with the corresponding nucleotide of the targeting domain within 5 nucleotides of its 3′ end.
In an embodiment, the target domain includes 1, 2, 3, or 4 nucleotides that are not complementary with the corresponding nucleotide of the targeting domain within 5 nucleotides of its 5′ end. In an embodiment, the target domain includes 1, 2, 3, or 4 nucleotides that are not complementary with the corresponding nucleotide of the targeting domain within 5 nucleotides of its 3′ end.
In an embodiment, the degree of complementarity, together with other properties of the gRNA, is sufficient to allow targeting of a Cas9 molecule to the target nucleic acid.
In an embodiment, the targeting domain comprises two consecutive nucleotides that are not complementary to the target domain (“non-complementary nucleotides”), e.g., two consecutive noncomplementary nucleotides that are within 5 nucleotides of the 5′ end of the targeting domain, within 5 nucleotides of the 3′ end of the targeting domain, or more than 5 nucleotides away from one or both ends of the targeting domain.
In an embodiment, no two consecutive nucleotides within 5 nucleotides of the 5′ end of the targeting domain, within 5 nucleotides of the 3′ end of the targeting domain, or within a region that is more than 5 nucleotides away from one or both ends of the targeting domain, are not complementary to the targeting domain.
In an embodiment, there are no noncomplementary nucleotides within 5 nucleotides of the 5′ end of the targeting domain, within 5 nucleotides of the 3′ end of the targeting domain, or within a region that is more than 5 nucleotides away from one or both ends of the targeting domain.
In an embodiment, the targeting domain nucleotides do not comprise modifications, e.g., modifications of the type provided in Section X. However, in an embodiment, the targeting domain comprises one or more modifications, e.g., modifications that it render it less susceptible to degradation or more bio-compatible, e.g., less immunogenic. By way of example, the backbone of the targeting domain can be modified with a phosphorothioate, or other modification from Section X. In an embodiment, a nucleotide of the targeting domain can comprise a 2′ modification (e.g., a modification at the 2′ position on ribose), e.g., a 2′ acetylation, e.g., a 2′ methylation, or other modification from Section X.
In an embodiment, the targeting domain includes 1, 2, 3, 4, 5, 6, 7 or 8 or more modifications. In an embodiment, the targeting domain includes 1, 2, 3, or 4 modifications within 5 nucleotides of its 5′ end. In an embodiment, the targeting domain comprises as many as 1, 2, 3, or 4 modifications within 5 nucleotides of its 3′ end.
In an embodiment, the targeting domain comprises modifications at two consecutive nucleotides, e.g., two consecutive nucleotides that are within 5 nucleotides of the 5′ end of the targeting domain, within 5 nucleotides of the 3′ end of the targeting domain, or more than 5 nucleotides away from one or both ends of the targeting domain.
In an embodiment, no two consecutive nucleotides are modified within 5 nucleotides of the 5′ end of the targeting domain, within 5 nucleotides of the 3′ end of the targeting domain, or within a region that is more than 5 nucleotides away from one or both ends of the targeting domain. In an embodiment, no nucleotide is modified within 5 nucleotides of the 5′ end of the targeting domain, within 5 nucleotides of the 3′ end of the targeting domain, or within a region that is more than 5 nucleotides away from one or both ends of the targeting domain.
Modifications in the targeting domain can be selected so as to not interfere with targeting efficacy, which can be evaluated by testing a candidate modification in the system described in Section III. gRNA's having a candidate targeting domain having a selected length, sequence, degree of complementarity, or degree of modification, can be evaluated in a system in Section III. The candidate targeting domain can be placed, either alone, or with one or more other candidate changes in a gRNA molecule/Cas9 molecule system known to be functional with a selected target and evaluated.
In an embodiment, all of the modified nucleotides are complementary to and capable of hybridizing to corresponding nucleotides present in the target domain. In an embodiment, 1, 2, 3, 4, 5, 6, 7 or 8 or more modified nucleotides are not complementary to or capable of hybridizing to corresponding nucleotides present in the target domain.
In an embodiment, the targeting domain comprises, preferably in the 5′—>3′ direction: a secondary domain and a core domain. These domains are discussed in more detail below.
The Core Domain and Secondary Domain of the Targeting Domain
The “core domain” of the targeting domain is complementary to the “core domain target” on the target nucleic acid. In an embodiment, the core domain comprises about 8 to about 13 nucleotides from the 3′ end of the targeting domain (e.g., the most 3′ 8 to 13 nucleotides of the targeting domain).
In an embodiment, the core domain is 6+/−2, 7+/−2, 8+/−2, 9+/−2, 10+/−2, 11+/−2, 12+/−2, 13+/−2, 14+/−2, 15+/−2, or 16+/−2 nucleotides in length.
In an embodiment, the core domain is 10+/−2 nucleotides in length.
In an embodiment, the core domain is 10+/−4 nucleotides in length.
In an embodiment, the core domain is 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, or 16 nucleotides in length.
In an embodiment, the core domain is 8 to 13, e.g., 8 to 12, 8 to 11, 8 to 10, 8 to 9, 9 to 13, 9 to 12, 9 to 11, or 9 to 10 nucleotides in length.
In an embodiment, the core domain is 6 to 16, e.g., 6 to 15, 6 to 14, 6 to 13, 7 to 14, 7 to 13, 7 to 12, 7 to 11, 7 to 10, 8 to 14, 8 to 13, 8 to 12, 8 to 11, 8 to 10, or 8 to 9 nucleotides in length.
The core domain is complementary with the core domain target. Typically the core domain has exact complementarity with the core domain target. In an embodiment, the core domain can have 1, 2, 3, 4 or 5 nucleotides that are not complementary with the corresponding nucleotide of the core domain. In an embodiment, the degree of complementarity, together with other properties of the gRNA, is sufficient to allow targeting of a Cas9 molecule to the target nucleic acid.
The “secondary domain” of the targeting domain of the gRNA is complementary to the “secondary domain target” of the target nucleic acid.
In an embodiment, the secondary domain is positioned 5′ to the core domain.
In an embodiment, the secondary domain is absent or optional.
In an embodiment, if the targeting domain is, or is at least, 26 nucleotides in length and the core domain (counted from the 3′ end of the targeting domain) is 8 to 13 nucleotides in length, the secondary domain is 12 to 17 nucleotides in length.
In an embodiment, if the targeting domain is, or is at least, 25 nucleotides in length and the core domain (counted from the 3′ end of the targeting domain) is 8 to 13 nucleotides in length, the secondary domain is 12 to 17 nucleotides in length.
In an embodiment, if the targeting domain is, or is at least, 24 nucleotides in length and the core domain (counted from the 3′ end of the targeting domain) is 8 to 13 nucleotides in length, the secondary domain is 11 to 16 nucleotides in length.
In an embodiment, if the targeting domain is, or is at least, 23 nucleotides in length and the core domain (counted from the 3′ end of the targeting domain) is 8 to 13 nucleotides in length, the secondary domain is 10 to 15 nucleotides in length.
In an embodiment, if the targeting domain is, or is at least, 22 nucleotides in length and the core domain (counted from the 3′ end of the targeting domain) is 8 to 13 nucleotides in length, the secondary domain is 9 to 14 nucleotides in length.
In an embodiment, if the targeting domain is, or is at least, 21 nucleotides in length and the core domain (counted from the 3′ end of the targeting domain) is 8 to 13 nucleotides in length, the secondary domain is 8 to 13 nucleotides in length.
In an embodiment, if the targeting domain is, or is at least, 20 nucleotides in length and the core domain (counted from the 3′ end of the targeting domain) is 8 to 13 nucleotides in length, the secondary domain is 7 to 12 nucleotides in length.
In an embodiment, if the targeting domain is, or is at least, 19 nucleotides in length and the core domain (counted from the 3′ end of the targeting domain) is 8 to 13 nucleotides in length, the secondary domain is 6 to 11 nucleotides in length.
In an embodiment, if the targeting domain is, or is at least, 18 nucleotides in length and the core domain (counted from the 3′ end of the targeting domain) is 8 to 13 nucleotides in length, the secondary domain is 5 to 10 nucleotides in length.
In an embodiment, if the targeting domain is, or is at least, 17 nucleotides in length and the core domain (counted from the 3′ end of the targeting domain) is 8 to 13 nucleotides in length, the secondary domain is 4 to 9 nucleotides in length.
In an embodiment, if the targeting domain is, or is at least, 16 nucleotides in length and the core domain (counted from the 3′ end of the targeting domain) is 8 to 13 nucleotides in length, the secondary domain is 3 to 8 nucleotides in length.
In an embodiment, the secondary domain is 0, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14 or 15 nucleotides in length.
The secondary domain is complementary with the secondary domain target. Typically the secondary domain has exact complementarity with the secondary domain target. In an embodiment the secondary domain can have 1, 2, 3, 4 or 5 nucleotides that are not complementary with the corresponding nucleotide of the secondary domain. In an embodiment, the degree of complementarity, together with other properties of the gRNA, is sufficient to allow targeting of a Cas9 molecule to the target nucleic acid.
In an embodiment, the core domain nucleotides do not comprise modifications, e.g., modifications of the type provided in Section X. However, in an embodiment, the core domain comprises one or more modifications, e.g., modifications that it render it less susceptible to degradation or more bio-compatible, e.g., less immunogenic. By way of example, the backbone of the core domain can be modified with a phosphorothioate, or other modification from Section X. In an embodiment, a nucleotide of the core domain can comprise a 2′ modification (e.g., a modification at the 2′ position on ribose), e.g., a 2′-acetylation, e.g., a 2′ methylation, or other modification from Section X. Typically, a core domain will contain no more than 1, 2, or 3 modifications.
Modifications in the core domain can be selected to not interfere with targeting efficacy, which can be evaluated by testing a candidate modification in the system described in Section III. gRNA's having a candidate core domain having a selected length, sequence, degree of complementarity, or degree of modification, can be evaluated in the system described at Section III. The candidate core domain can be placed, either alone, or with one or more other candidate changes in a gRNA molecule/Cas9 molecule system known to be functional with a selected target and evaluated.
In an embodiment, the secondary domain nucleotides do not comprise modifications, e.g., modifications of the type provided in Section X. However, in an embodiment, the secondary domain comprises one or more modifications, e.g., modifications that render it less susceptible to degradation or more bio-compatible, e.g., less immunogenic. By way of example, the backbone of the secondary domain can be modified with a phosphorothioate, or other modification from Section X. In an embodiment, a nucleotide of the secondary domain can comprise a 2′ modification (e.g., a modification at the 2′ position on ribose), e.g., a 2′-acetylation, e.g., a 2′ methylation, or other modification from Section X. Typically, a secondary domain will contain no more than 1, 2, or 3 modifications.
Modifications in the secondary domain can be selected to not interfere with targeting efficacy, which can be evaluated by testing a candidate modification in the system described in Section III. gRNA's having a candidate secondary domain having a selected length, sequence, degree of complementarity, or degree of modification, can be evaluated in the system described at Section III. The candidate secondary domain can be placed, either alone, or with one or more other candidate changes in a gRNA molecule/Cas9 molecule system known to be functional with a selected target and evaluated.
In an embodiment, (1) the degree of complementarity between the core domain and its target, and (2) the degree of complementarity between the secondary domain and its target, may differ. In an embodiment, (1) may be greater than (2). In an embodiment, (1) may be less than (2). In an embodiment, (1) and (2) may be the same, e.g., each may be completely complementary with its target.
In an embodiment, (1) the number of modifications (e.g., modifications from Section X) of the nucleotides of the core domain and (2) the number of modification (e.g., modifications from Section X) of the nucleotides of the secondary domain, may differ. In an embodiment, (1) may be less than (2). In an embodiment, (1) may be greater than (2). In an embodiment, (1) and (2) may be the same, e.g., each may be free of modifications.
The First and Second Complementarity Domains
The first complementarity domain is complementary with the second complementarity domain.
Typically the first domain does not have exact complementarity with the second complementarity domain target. In an embodiment, the first complementarity domain can have 1, 2, 3, 4 or 5 nucleotides that are not complementary with the corresponding nucleotide of the second complementarity domain. In an embodiment, 1, 2, 3, 4, 5 or 6, e.g., 3 nucleotides, will not pair in the duplex, and, e.g., form a non-duplexed or looped-out region. In an embodiment, an unpaired, or loop-out, region, e.g., a loop-out of 3 nucleotides, is present on the second complementarity domain. In an embodiment, the unpaired region begins 1, 2, 3, 4, 5, or 6, e.g., 4, nucleotides from the 5′ end of the second complementarity domain.
In an embodiment, the degree of complementarity, together with other properties of the gRNA, is sufficient to allow targeting of a Cas9 molecule to the target nucleic acid.
In an embodiment, the first and second complementarity domains are:
independently, 6+/−2, 7+/−2, 8+/−2, 9+/−2, 10+/−2, 11+/−2, 12+/−2, 13+/−2, 14+/−2, 15+/−2, 16+/−2, 17+/−2, 18+/−2, 19+/−2, or 20+/−2, 21+/−2, 22+/−2, 23+/−2, or 24+/−2 nucleotides in length;
independently, 6, 7, 8, 9, 10, 11, 12, 13, 14, 14, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, or 26 nucleotides in length; or
independently, 5 to 24, 5 to 23, 5 to 22, 5 to 21, 5 to 20, 7 to 18, 9 to 16, or 10 to 14 nucleotides in length.
In an embodiment, the second complementarity domain is longer than the first complementarity domain, e.g., 2, 3, 4, 5, or 6, e.g., 6, nucleotides longer.
In an embodiment, the first and second complementary domains, independently, do not comprise modifications, e.g., modifications of the type provided in Section X.
In an embodiment, the first and second complementary domains, independently, comprise one or more modifications, e.g., modifications that the render the domain less susceptible to degradation or more bio-compatible, e.g., less immunogenic. By way of example, the backbone of the domain can be modified with a phosphorothioate, or other modification from Section X. In an embodiment, a nucleotide of the domain can comprise a 2′ modification (e.g., a modification at the 2′ position on ribose), e.g., a 2′-acetylation, e.g., a 2′ methylation, or other modification from Section X.
In an embodiment, the first and second complementary domains, independently, include 1, 2, 3, 4, 5, 6, 7 or 8 or more modifications. In an embodiment, the first and second complementary domains, independently, include 1, 2, 3, or 4 modifications within 5 nucleotides of its 5′ end. In an embodiment, the first and second complementary domains, independently, include as many as 1, 2, 3, or 4 modifications within 5 nucleotides of its 3′ end.
In an embodiment, the first and second complementary domains, independently, include modifications at two consecutive nucleotides, e.g., two consecutive nucleotides that are within 5 nucleotides of the 5′ end of the domain, within 5 nucleotides of the 3′ end of the domain, or more than 5 nucleotides away from one or both ends of the domain. In an embodiment, the first and second complementary domains, independently, include no two consecutive nucleotides that are modified, within 5 nucleotides of the 5′ end of the domain, within 5 nucleotides of the 3′ end of the domain, or within a region that is more than 5 nucleotides away from one or both ends of the domain. In an embodiment, the first and second complementary domains, independently, include no nucleotide that is modified within 5 nucleotides of the 5′ end of the domain, within 5 nucleotides of the 3′ end of the domain, or within a region that is more than 5 nucleotides away from one or both ends of the domain.
Modifications in a complementarity domain can be selected to not interfere with targeting efficacy, which can be evaluated by testing a candidate modification in the system described in Section III. gRNA's having a candidate complementarity domain having a selected length, sequence, degree of complementarity, or degree of modification, can be evaluated in the system described in Section III. The candidate complementarity domain can be placed, either alone, or with one or more other candidate changes in a gRNA molecule/Cas9 molecule system known to be functional with a selected target and evaluated.
In an embodiment, the first complementarity domain has at least 60, 70, 80, 85%, 90%, or 95% homology with, or differs by no more than 1, 2, 3, 4, 5, or 6 nucleotides from, a reference first complementarity domain, e.g., a naturally occurring, e.g., an S. pyogenes, or S. thermophilus, first complementarity domain, or a first complementarity domain described herein, e.g., from FIGS. 1A-1F.
In an embodiment, the second complementarity domain has at least 60, 70, 80, 85%, 90%, or 95% homology with, or differs by no more than 1, 2, 3, 4, 5, or 6 nucleotides from, a reference second complementarity domain, e.g., a naturally occurring, e.g., an S. pyogenes, or S. thermophilus, second complementarity domain, or a second complementarity domain described herein, e.g., from FIGS. 1A-1F.
The duplexed region formed by first and second complementarity domains is typically 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21 or 22 base pairs in length (excluding any looped out or unpaired nucleotides).
In an embodiment, the first and second complementarity domains, when duplexed, comprise 11 paired nucleotides, for example, in the gRNA sequence (one paired strand underlined, one bolded):
| (SEQ ID NO: 5) |
| NNNNNNNNNNNNNNNNNNNNGUUUUAGAGCUAGAAAUAGCAAGUUAAAA |
| UAAGGCUAGUCCGUUAUCAACUUGAAAAAGUGGCACCGAGUCGGUGC. |
In an embodiment, the first and second complementarity domains, when duplexed, comprise 15 paired nucleotides, for example in the gRNA sequence (one paired strand underlined, one bolded):
| (SEQ ID NO: 27) |
| NNNNNNNNNNNNNNNNNNNNGUUUUAGAGCUAUGCUGAAAAGCAUAGCA |
| AGUUAAAAUAAGGCUAGUCCGUUAUCAACUUGAAAAAGUGGCACCGAGU |
| CGGUGC. |
In an embodiment the first and second complementarity domains, when duplexed, comprise 16 paired nucleotides, for example in the gRNA sequence (one paired strand underlined, one bolded):
| (SEQ ID NO: 28) |
| NNNNNNNNNNNNNNNNNNNNGUUUUAGAGCUAUGCUGGAAACAGCAUAG |
| CAAGUUAAAAUAAGGCUAGUCCGUUAUCAACUUGAAAAAGUGGCACCGA |
| GUCGGUGC. |
In an embodiment the first and second complementarity domains, when duplexed, comprise 21 paired nucleotides, for example in the gRNA sequence (one paired strand underlined, one bolded):
| (SEQ ID NO: 29) |
| NNNNNNNNNNNNNNNNNNNNGUUUUAGAGCUAUGCUGUUUUGGAAACAA |
| AACAGCAUAGCAAGUUAAAAUAAGGCUAGUCCGUUAUCAACUUGAAAAA |
| GUGGCACCGAGUCGGUGC. |
In an embodiment, nucleotides are exchanged to remove poly-U tracts, for example in the gRNA sequences (exchanged nucleotides underlined):
| (SEQ ID NO: 30) |
| NNNNNNNNNNNNNNNNNNNNGUAUUAGAGCUAGAAAUAGCAAGUUAAUA |
| UAAGGCUAGUCCGUUAUCAACUUGAAAAAGUGGCACCGAGUCGGUGC; |
| (SEQ ID NO: 31) |
| NNNNNNNNNNNNNNNNNNNNGUUUAAGAGCUAGAAAUAGCAAGUUUAAA |
| UAAGGCUAGUCCGUUAUCAACUUGAAAAAGUGGCACCGAGUCGGUGC; |
| and |
| (SEQ ID NO: 32) |
| NNNNNNNNNNNNNNNNNNNNGUAUUAGAGCUAUGCUGUAUUGGAAACAA |
| UACAGCAUAGCAAGUUAAUAUAAGGCUAGUCCGUUAUCAACUUGAAAAA |
| GUGGCACCGAGUCGGUGC. |
The 5′ Extension Domain
In an embodiment, a modular gRNA can comprise additional sequence, 5′ to the second complementarity domain. In an embodiment, the 5′ extension domain is 2 to 10, 2 to 9, 2 to 8, 2 to 7, 2 to 6, 2 to 5, or 2 to 4 nucleotides in length. In an embodiment, the 5′ extension domain is 2, 3, 4, 5, 6, 7, 8, 9, or 10 or more nucleotides in length.
In an embodiment, the 5′ extension domain nucleotides do not comprise modifications, e.g., modifications of the type provided in Section X. However, in an embodiment, the 5′ extension domain comprises one or more modifications, e.g., modifications that it render it less susceptible to degradation or more bio-compatible, e.g., less immunogenic. By way of example, the backbone of the 5′ extension domain can be modified with a phosphorothioate, or other modification from Section X. In an embodiment, a nucleotide of the 5′ extension domain can comprise a 2′ modification (e.g., a modification at the 2′ position on ribose), e.g., a 2′-acetylation, e.g., a 2′ methylation, or other modification from Section X.
In an embodiment, the 5′ extension domain can comprise as many as 1, 2, 3, 4, 5, 6, 7 or 8 modifications. In an embodiment, the 5′ extension domain comprises as many as 1, 2, 3, or 4 modifications within 5 nucleotides of its 5′ end, e.g., in a modular gRNA molecule. In an embodiment, the 5′ extension domain comprises as many as 1, 2, 3, or 4 modifications within 5 nucleotides of its 3′ end, e.g., in a modular gRNA molecule.
In an embodiment, the 5′ extension domain comprises modifications at two consecutive nucleotides, e.g., two consecutive nucleotides that are within 5 nucleotides of the 5′ end of the 5′ extension domain, within 5 nucleotides of the 3′ end of the 5′ extension domain, or more than 5 nucleotides away from one or both ends of the 5′ extension domain. In an embodiment, no two consecutive nucleotides are modified within 5 nucleotides of the 5′ end of the 5′ extension domain, within 5 nucleotides of the 3′ end of the 5′ extension domain, or within a region that is more than 5 nucleotides away from one or both ends of the 5′ extension domain. In an embodiment, no nucleotide is modified within 5 nucleotides of the 5′ end of the 5′ extension domain, within 5 nucleotides of the 3′ end of the 5′ extension domain, or within a region that is more than 5 nucleotides away from one or both ends of the 5′ extension domain.
Modifications in the 5′ extension domain can be selected to not interfere with gRNA molecule efficacy, which can be evaluated by testing a candidate modification in the system described in Section III. gRNAs having a candidate 5′ extension domain having a selected length, sequence, degree of complementarity, or degree of modification, can be evaluated in the system described at Section III. The candidate 5′ extension domain can be placed, either alone, or with one or more other candidate changes in a gRNA molecule/Cas9 molecule system known to be functional with a selected target and evaluated.
In an embodiment, the 5′ extension domain has at least 60, 70, 80, 85, 90 or 95% homology with, or differs by no more than 1, 2, 3, 4, 5, or 6 nucleotides from, a reference 5′ extension domain, e.g., a naturally occurring, e.g., an S. pyogenes, or S. thermophilus, 5′ extension domain, or a 5′ extension domain described herein, e.g., from FIG. 1A and FIG. 1F.
The Linking Domain
In a unimolecular gRNA molecule the linking domain is disposed between the first and second complementarity domains. In a modular gRNA molecule, the two molecules are associated with one another by the complementarity domains.
In an embodiment, the linking domain is 10+/−5, 20+/−5, 30+/−5, 40+/−5, 50+/−5, 60+/−5, 70+/−5, 80+/−5, 90+/−5, or 100+/−5 nucleotides, in length.
In an embodiment, the linking domain is 20+/−10, 30+/−10, 40+/−10, 50+/−10, 60+/−10, 70+/−10, 80+/−10, 90+/−10, or 100+/−10 nucleotides, in length.
In an embodiment, the linking domain is 10 to 100, 10 to 90, 10 to 80, 10 to 70, 10 to 60, 10 to 50, 10 to 40, 10 to 30, 10 to 20 or 10 to 15 nucleotides in length. In an embodiment, the targeting domain is 20 to 100, 20 to 90, 20 to 80, 20 to 70, 20 to 60, 20 to 50, 20 to 40, 20 to 30, or 20 to 25 nucleotides in length.
In an embodiment, the linking domain is 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16 17, 18, 19, or 20 nucleotides in length.
In an embodiment, the linking domain is a covalent bond.
In an embodiment, the linking domain comprises a duplexed region, typically adjacent to or within 1, 2, or 3 nucleotides of the 3′ end of the first complementarity domain and/or the S-end of the second complementarity domain. In an embodiment, the duplexed region can be 20+/−10, 30+/−10, 40, +/−10 or 50+/−10 base pairs in length. In an embodiment, the duplexed region can be 10+/−5, 15+/−5, 20+/−5, or 30+/−5 base pairs in length. In an embodiment, the duplexed region can be 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, or 15 base pairs in length.
Typically the sequences forming the duplexed region have exact complementarity with one another, though in an embodiment as many as 1, 2, 3, 4, 5, 6, 7 or 8 nucleotides are not complementary with the corresponding nucleotides.
In an embodiment, the linking domain nucleotides do not comprise modifications, e.g., modifications of the type provided in Section X. However, in an embodiment the linking domain comprises one or more modifications, e.g., modifications that it render it less susceptible to degradation or more bio-compatible, e.g., less immunogenic. By way of example, the backbone of the linking domain can be modified with a phosphorothioate, or other modification from Section X. In an embodiment, a nucleotide of the linking domain can comprise a 2′ modification (e.g., a modification at the 2′ position on ribose), e.g., a 2′-acetylation, e.g., a 2′ methylation, or other modification from Section X.
In an embodiment, the linking domain can comprise as many as 1, 2, 3, 4, 5, 6, 7 or 8 modifications.
Modifications in a linking domain can be selected to not interfere with targeting efficacy, which can be evaluated by testing a candidate modification in the system described in Section III. gRNA's having a candidate linking domain having a selected length, sequence, degree of complementarity, or degree of modification, can be evaluated a system described in Section III. A candidate linking domain can be placed, either alone, or with one or more other candidate changes in a gRNA molecule/Cas9 molecule system known to be functional with a selected target and evaluated.
In an embodiment, the linking domain has at least 60, 70, 80, 85, 90 or 95% homology with, or differs by no more than 1, 2, 3, 4, 5, or 6 nucleotides from, a reference linking domain, e.g., a linking domain described herein, e.g., from FIG. 1B-1E.
The Proximal Domain
In an embodiment, the proximal domain is 6+/−2, 7+/−2, 8+/−2, 9+/−2, 10+/−2, 11+/−2, 12+/−2, 13+/−2, 14+/−2, 14+/−2, 16+/−2, 17+/−2, 18+/−2, 19+/−2, or 20+/−2 nucleotides in length.
In an embodiment, the proximal domain is 6, 7, 8, 9, 10, 11, 12, 13, 14, 14, 16, 17, 18, 19, or 20 nucleotides in length.
In an embodiment, the proximal domain is 5 to 20, 7, to 18, 9 to 16, or 10 to 14 nucleotides in length.
In an embodiment, the proximal domain nucleotides do not comprise modifications, e.g., modifications of the type provided in Section X. However, in an embodiment, the proximal domain comprises one or more modifications, e.g., modifications that it render it less susceptible to degradation or more bio-compatible, e.g., less immunogenic. By way of example, the backbone of the proximal domain can be modified with a phosphorothioate, or other modification from Section X. In an embodiment, a nucleotide of the proximal domain can comprise a 2′ modification (e.g., a modification at the 2′ position on ribose), e.g., a 2′-acetylation, e.g., a 2′ methylation, or other modification from Section X.
In an embodiment, the proximal domain can comprise as many as 1, 2, 3, 4, 5, 6, 7 or 8 modifications. In an embodiment, the proximal domain comprises as many as 1, 2, 3, or 4 modifications within 5 nucleotides of its 5′ end, e.g., in a modular gRNA molecule. In an embodiment, the target domain comprises as many as 1, 2, 3, or 4 modifications within 5 nucleotides of its 3′ end, e.g., in a modular gRNA molecule.
In an embodiment, the proximal domain comprises modifications at two consecutive nucleotides, e.g., two consecutive nucleotides that are within 5 nucleotides of the 5′ end of the proximal domain, within 5 nucleotides of the 3′ end of the proximal domain, or more than 5 nucleotides away from one or both ends of the proximal domain. In an embodiment, no two consecutive nucleotides are modified within 5 nucleotides of the 5′ end of the proximal domain, within 5 nucleotides of the 3′ end of the proximal domain, or within a region that is more than 5 nucleotides away from one or both ends of the proximal domain. In an embodiment, no nucleotide is modified within 5 nucleotides of the 5′ end of the proximal domain, within 5 nucleotides of the 3′ end of the proximal domain, or within a region that is more than 5 nucleotides away from one or both ends of the proximal domain.
Modifications in the proximal domain can be selected to not interfere with gRNA molecule efficacy, which can be evaluated by testing a candidate modification in the system described in Section III. gRNA's having a candidate proximal domain having a selected length, sequence, degree of complementarity, or degree of modification, can be evaluated in the system described at Section III. The candidate proximal domain can be placed, either alone, or with one or more other candidate changes in a gRNA molecule/Cas9 molecule system known to be functional with a selected target and evaluated.
In an embodiment, the proximal domain has at least 60%, 70%, 80%, 85%, 90%, or 95% homology with, or differs by no more than 1, 2, 3, 4, 5, or 6 nucleotides from, a reference proximal domain, e.g., a naturally occurring, e.g., an S. pyogenes, or S. therrnophilus, proximal domain, or a proximal domain described herein, e.g., from FIG. 1A-1F.
The Tail Domain
In an embodiment, the tail domain is 10+/−5, 20+/−5, 30+/−5, 40+/−5, 50+/−5, 60+/−5, 70+/−5, 80+/−5, 90+/−5, or 100+/−5 nucleotides, in length.
In an embodiment, the tail domain is 20+/−5 nucleotides in length.
In an embodiment, the tail domain is 20+/−10, 30+/−10, 40+/−10, 50+/−10, 60+/−10, 70+/−10, 80+/−10, 90+/−10, or 100+/−10 nucleotides, in length.
In an embodiment, the tail domain is 25+/−10 nucleotides in length.
In an embodiment, the tail domain is 10 to 100, 10 to 90, 10 to 80, 10 to 70, 10 to 60, 10 to 50, 10 to 40, 10 to 30, 10 to 20 or 10 to 15 nucleotides in length.
In an embodiment, the tail domain is 20 to 100, 20 to 90, 20 to 80, 20 to 70, 20 to 60, 20 to 50, 20 to 40, 20 to 30, or 20 to 25 nucleotides in length.
In an embodiment, the tail domain is 1 to 20, 1 to 1, 1 to 10, or 1 to 5 nucleotides in length.
In an embodiment, the tail domain nucleotides do not comprise modifications, e.g., modifications of the type provided in Section X. However, in an embodiment, the tail domain comprises one or more modifications, e.g., modifications that it render it less susceptible to degradation or more bio-compatible, e.g., less immunogenic. By way of example, the backbone of the tail domain can be modified with a phosphorothioate, or other modification from Section X. In an embodiment, a nucleotide of the tail domain can comprise a 2′ modification (e.g., a modification at the 2′ position on ribose), e.g., a 2′-acetylation, e.g., a 2′ methylation, or other modification from Section X.
In an embodiment, the tail domain can have as many as 1, 2, 3, 4, 5, 6, 7 or 8 modifications. In an embodiment, the target domain comprises as many as 1, 2, 3, or 4 modifications within 5 nucleotides of its 5′ end. In an embodiment, the target domain comprises as many as 1, 2, 3, or 4 modifications within 5 nucleotides of its 3′ end.
In an embodiment, the tail domain comprises a tail duplex domain, which can form a tail duplexed region. In an embodiment, the tail duplexed region can be 3, 4, 5, 6, 7, 8, 9, 10, 11, or 12 base pairs in length. In an embodiment, a further single stranded domain exists 3′ to the tail duplexed domain. In an embodiment, this domain is 3, 4, 5, 6, 7, 8, 9, or 10 nucleotides in length. In an embodiment, it is 4 to 6 nucleotides in length.
In an embodiment, the tail domain has at least 60, 70, 80, or 90% homology with, or differs by no more than 1, 2, 3, 4, 5, or 6 nucleotides from, a reference tail domain, e.g., a naturally occurring, e.g., an S. pyogenes, or S. thermophilus, tail domain, or a tail domain described herein, e.g., from FIG. 1A and FIGS. 1C-1F.
In an embodiment, the proximal and tail domain, taken together comprise the following sequences:
| (SEQ ID NO: 33) |
| AAGGCUAGUCCGUUAUCAACUUGAAAAAGUGGCACCGAGUCGGUGCU; |
| (SEQ ID NO: 34) |
| AAGGCUAGUCCGUUAUCAACUUGAAAAAGUGGCACCGAGUCGGUGGUGC; |
| (SEQ ID NO: 35) |
| AAGGCUAGUCCGUUAUCAACUUGAAAAAGUGGCACCGAGUCGGUGCGGAU |
| C; |
| (SEQ ID NO: 36) |
| AAGGCUAGUCCGUUAUCAACUUGAAAAAGUG; |
| (SEQ ID NO: 37) |
| AAGGCUAGUCCGUUAUCA; |
| or |
| (SEQ ID NO: 38) |
| AAGGCUAGUCCG. |
In an embodiment, the tail domain comprises the 3′ sequence UUUUUU, e.g., if a U6 promoter is used for transcription.
In an embodiment, the tail domain comprises the 3′ sequence UUUU, e.g., if an H1 promoter is used for transcription.
In an embodiment, tail domain comprises variable numbers of 3′ U's depending, e.g., on the termination signal of the pol-III promoter used.
In an embodiment, the tail domain comprises variable 3′ sequence derived from the DNA template if a T7 promoter is used.
In an embodiment, the tail domain comprises variable 3′ sequence derived from the DNA template, e.g., if in vitro transcription is used to generate the RNA molecule.
In an embodiment, the tail domain comprises variable 3′ sequence derived from the DNA template, e.g, if a pol-II promoter is used to drive transcription.
Modifications in the tail domain can be selected to not interfere with targeting efficacy, which can be evaluated by testing a candidate modification in the system described in Section III. gRNA's having a candidate tail domain having a selected length, sequence, degree of complementarity, or degree of modification, can be evaluated in the system described in Section III. The candidate tail domain can be placed, either alone, or with one or more other candidate changes in a gRNA molecule/Cas9 molecule system known to be functional with a selected target and evaluated.
In an embodiment, the tail domain comprises modifications at two consecutive nucleotides, e.g., two consecutive nucleotides that are within 5 nucleotides of the 5′ end of the tail domain, within 5 nucleotides of the 3′ end of the tail domain, or more than 5 nucleotides away from one or both ends of the tail domain. In an embodiment, no two consecutive nucleotides are modified within 5 nucleotides of the 5′ end of the tail domain, within 5 nucleotides of the 3′ end of the tail domain, or within a region that is more than 5 nucleotides away from one or both ends of the tail domain. In an embodiment, no nucleotide is modified within 5 nucleotides of the 5′ end of the tail domain, within 5 nucleotides of the 3′ end of the tail domain, or within a region that is more than 5 nucleotides away from one or both ends of the tail domain.
In an embodiment a gRNA has the following structure:
5′ [targeting domain]-[first complementarity domain]-[linking domain]-[second complementarity domain]-[proximal domain]-[tail domain]-3′
wherein,
and
the tail domain is absent or a nucleotide sequence is 1 to 50 nucleotides in length and, in an embodiment has at least 50, 60, 70, 80, 85, 90 or 95% homology with a reference tail domain disclosed herein.
Exemplary Chimeric gRNAs
In an embodiment, a unimolecular, or chimeric, gRNA comprises, preferably from 5′ to 3′:
In an embodiment, the sequence from (a), (b), or (c), has at least 60, 75, 80, 85, 90, 95, or 99% homology with the corresponding sequence of a naturally occurring gRNA, or with a gRNA described herein.
In an embodiment, the proximal and tail domain, when taken together, comprise at least 15, 18, 20, 25, 30, 31, 35, 40, 45, 49, 50, or 53 nucleotides.
In an embodiment, there are at least 15, 18, 20, 25, 30, 31, 35, 40, 45, 49, 50, or 53 nucleotides 3′ to the last nucleotide of the second complementarity domain.
In an embodiment, there are at least 16, 19, 21, 26, 31, 32, 36, 41, 46, 50, 51, or 54 nucleotides 3′ to the last nucleotide of the second complementarity domain that is complementary to its corresponding nucleotide of the first complementarity domain.
In an embodiment, the targeting domain comprises, has, or consists of 16, 17, 18, 19, 20, 21, 22, 23, 24 or 25 nucleotides (e.g., 16, 17, 18, 19, 20, 21, 22, 23, 24 or 25 consecutive nucleotides) having complementarity with the target domain, e.g., the targeting domain is 16, 17, 18, 19, 20, 21, 22, 23, 24 or 25 nucleotides in length.
In an embodiment, the targeting domain comprises, has, or consists of, 16 nucleotides (e.g., 16 consecutive nucleotides) having complementarity with the target domain, e.g., the targeting domain is 16 nucleotides in length.
In an embodiment, the targeting domain comprises, has, or consists of, 17 nucleotides (e.g., 17 consecutive nucleotides) having complementarity with the target domain, e.g., the targeting domain is 17 nucleotides in length.
In an embodiment, the targeting domain comprises, has, or consists of, 18 nucleotides (e.g., 18 consecutive nucleotides) having complementarity with the target domain, e.g., the targeting domain is 18 nucleotides in length.
In an embodiment, the targeting domain comprises, has, or consists of, 19 nucleotides (e.g., 19 consecutive nucleotides) having complementarity with the target domain, e.g., the targeting domain is 19 nucleotides in length.
In an embodiment, the targeting domain comprises, has, or consists of, 20 nucleotides (e.g., 20 consecutive nucleotides) having complementarity with the target domain, e.g., the targeting domain is 20 nucleotides in length.
In an embodiment, the targeting domain comprises, has, or consists of, 21 nucleotides (e.g., 21 consecutive nucleotides) having complementarity with the target domain, e.g., the targeting domain is 21 nucleotides in length.
In an embodiment, the targeting domain comprises, has, or consists of, 22 nucleotides (e.g., 22 consecutive nucleotides) having complementarity with the target domain, e.g., the targeting domain is 22 nucleotides in length.
In an embodiment, the targeting domain comprises, has, or consists of, 23 nucleotides (e.g., 23 consecutive nucleotides) having complementarity with the target domain, e.g., the targeting domain is 23 nucleotides in length.
In an embodiment, the targeting domain comprises, has, or consists of, 24 nucleotides (e.g., 24 consecutive nucleotides) having complementarity with the target domain, e.g., the targeting domain is 24 nucleotides in length.
In an embodiment, the targeting domain comprises, has, or consists of, 25 nucleotides (e.g., 25 consecutive nucleotides) having complementarity with the target domain, e.g., the targeting domain is 25 nucleotides in length.
In an embodiment, the targeting domain comprises, has, or consists of, 26 nucleotides (e.g., 26 consecutive nucleotides) having complementarity with the target domain, e.g., the targeting domain is 26 nucleotides in length. In an embodiment, the targeting domain comprises, has, or consists of, 16 nucleotides (e.g., 16 consecutive nucleotides) having complementarity with the target domain, e.g., the targeting domain is 16 nucleotides in length; and the proximal and tail domain, when taken together, comprise at least 15, 18, 20, 25, 30, 31, 35, 40, 45, 49, 50, or 53 nucleotides.
In an embodiment, the targeting domain comprises, has, or consists of, 16 nucleotides (e.g., 16 consecutive nucleotides) having complementarity with the target domain, e.g., the targeting domain is 16 nucleotides in length; and there are at least 15, 18, 20, 25, 30, 31, 35, 40, 45, 49, 50, or 53 nucleotides 3′ to the last nucleotide of the second complementarity domain.
In an embodiment, the targeting domain comprises, has, or consists of, 16 nucleotides (e.g., 16 consecutive nucleotides) having complementarity with the target domain, e.g., the targeting domain is 16 nucleotides in length; and there are at least 16, 19, 21, 26, 31, 32, 36, 41, 46, 50, 51, or 54 nucleotides 3′ to the last nucleotide of the second complementarity domain that is complementary to its corresponding nucleotide of the first complementarity domain.
In an embodiment, the targeting domain comprises, has, or consists of, 17 nucleotides (e.g., 17 consecutive nucleotides) having complementarity with the target domain, e.g., the targeting domain is 17 nucleotides in length; and the proximal and tail domain, when taken together, comprise at least 15, 18, 20, 25, 30, 31, 35, 40, 45, 49, 50, or 53 nucleotides.
In an embodiment, the targeting domain comprises, has, or consists of, 17 nucleotides (e.g., 17 consecutive nucleotides) having complementarity with the target domain, e.g., the targeting domain is 17 nucleotides in length; and there are at least 15, 18, 20, 25, 30, 31, 35, 40, 45, 49, 50, or 53 nucleotides 3′ to the last nucleotide of the second complementarity domain.
In an embodiment, the targeting domain comprises, has, or consists of, 17 nucleotides (e.g., 17 consecutive nucleotides) having complementarity with the target domain, e.g., the targeting domain is 17 nucleotides in length; and there are at least 16, 19, 21, 26, 31, 32, 36, 41, 46, 50, 51, or 54 nucleotides 3′ to the last nucleotide of the second complementarity domain that is complementary to its corresponding nucleotide of the first complementarity domain.
In an embodiment, the targeting domain comprises, has, or consists of, 18 nucleotides (e.g., 18 consecutive nucleotides) having complementarity with the target domain, e.g., the targeting domain is 18 nucleotides in length; and the proximal and tail domain, when taken together, comprise at least 15, 18, 20, 25, 30, 31, 35, 40, 45, 49, 50, or 53 nucleotides.
In an embodiment, the targeting domain comprises, has, or consists of, 18 nucleotides (e.g., 18 consecutive nucleotides) having complementarity with the target domain, e.g., the targeting domain is 18 nucleotides in length; and there are at least 15, 18, 20, 25, 30, 31, 35, 40, 45, 49, 50, or 53 nucleotides 3′ to the last nucleotide of the second complementarity domain.
In an embodiment, the targeting domain comprises, has, or consists of, 18 nucleotides (e.g., 18 consecutive nucleotides) having complementarity with the target domain, e.g., the targeting domain is 18 nucleotides in length; and there are at least 16, 19, 21, 26, 31, 32, 36, 41, 46, 50, 51, or 54 nucleotides 3′ to the last nucleotide of the second complementarity domain that is complementary to its corresponding nucleotide of the first complementarity domain.
In an embodiment, the targeting domain comprises, has, or consists of, 19 nucleotides (e.g., 19 consecutive nucleotides) having complementarity with the target domain, e.g., the targeting domain is 19 nucleotides in length; and the proximal and tail domain, when taken together, comprise at least 15, 18, 20, 25, 30, 31, 35, 40, 45, 49, 50, or 53 nucleotides.
In an embodiment, the targeting domain comprises, has, or consists of, 19 nucleotides (e.g., 19 consecutive nucleotides) having complementarity with the target domain, e.g., the targeting domain is 19 nucleotides in length; and there are at least 15, 18, 20, 25, 30, 31, 35, 40, 45, 49, 50, or 53 nucleotides 3′ to the last nucleotide of the second complementarity domain.
In an embodiment, the targeting domain comprises, has, or consists of, 19 nucleotides (e.g., 19 consecutive nucleotides) having complementarity with the target domain, e.g., the targeting domain is 19 nucleotides in length; and there are at least 16, 19, 21, 26, 31, 32, 36, 41, 46, 50, 51, or 54 nucleotides 3′ to the last nucleotide of the second complementarity domain that is complementary to its corresponding nucleotide of the first complementarity domain.
In an embodiment, the targeting domain comprises, has, or consists of, 20 nucleotides (e.g., 20 consecutive nucleotides) having complementarity with the target domain, e.g., the targeting domain is 20 nucleotides in length; and the proximal and tail domain, when taken together, comprise at least 15, 18, 20, 25, 30, 31, 35, 40, 45, 49, 50, or 53 nucleotides.
In an embodiment, the targeting domain comprises, has, or consists of, 20 nucleotides (e.g., 20 consecutive nucleotides) having complementarity with the target domain, e.g., the targeting domain is 20 nucleotides in length; and there are at least 15, 18, 20, 25, 30, 31, 35, 40, 45, 49, 50, or 53 nucleotides 3′ to the last nucleotide of the second complementarity domain.
In an embodiment, the targeting domain comprises, has, or consists of, 20 nucleotides (e.g., 20 consecutive nucleotides) having complementarity with the target domain, e.g., the targeting domain is 20 nucleotides in length; and there are at least 16, 19, 21, 26, 31, 32, 36, 41, 46, 50, 51, or 54 nucleotides 3′ to the last nucleotide of the second complementarity domain that is complementary to its corresponding nucleotide of the first complementarity domain.
In an embodiment, the targeting domain comprises, has, or consists of, 21 nucleotides (e.g., 21 consecutive nucleotides) having complementarity with the target domain, e.g., the targeting domain is 21 nucleotides in length; and the proximal and tail domain, when taken together, comprise at least 15, 18, 20, 25, 30, 31, 35, 40, 45, 49, 50, or 53 nucleotides.
In an embodiment, the targeting domain comprises, has, or consists of, 21 nucleotides (e.g., 21 consecutive nucleotides) having complementarity with the target domain, e.g., the targeting domain is 21 nucleotides in length; and there are at least 15, 18, 20, 25, 30, 31, 35, 40, 45, 49, 50, or 53 nucleotides 3′ to the last nucleotide of the second complementarity domain.
In an embodiment, the targeting domain comprises, has, or consists of, 21 nucleotides (e.g., 21 consecutive nucleotides) having complementarity with the target domain, e.g., the targeting domain is 21 nucleotides in length; and there are at least 16, 19, 21, 26, 31, 32, 36, 41, 46, 50, 51, or 54 nucleotides 3′ to the last nucleotide of the second complementarity domain that is complementary to its corresponding nucleotide of the first complementarity domain.
In an embodiment, the targeting domain comprises, has, or consists of, 22 nucleotides (e.g., 22 consecutive nucleotides) having complementarity with the target domain, e.g., the targeting domain is 22 nucleotides in length; and the proximal and tail domain, when taken together, comprise at least 15, 18, 20, 25, 30, 31, 35, 40, 45, 49, 50, or 53 nucleotides.
In an embodiment, the targeting domain comprises, has, or consists of, 22 nucleotides (e.g., 22 consecutive nucleotides) having complementarity with the target domain, e.g., the targeting domain is 22 nucleotides in length; and there are at least 15, 18, 20, 25, 30, 31, 35, 40, 45, 49, 50, or 53 nucleotides 3′ to the last nucleotide of the second complementarity domain.
In an embodiment, the targeting domain comprises, has, or consists of, 22 nucleotides (e.g., 22 consecutive nucleotides) having complementarity with the target domain, e.g., the targeting domain is 22 nucleotides in length; and there are at least 16, 19, 21, 26, 31, 32, 36, 41, 46, 50, 51, or 54 nucleotides 3′ to the last nucleotide of the second complementarity domain that is complementary to its corresponding nucleotide of the first complementarity domain.
In an embodiment, the targeting domain comprises, has, or consists of, 23 nucleotides (e.g., 23 consecutive nucleotides) having complementarity with the target domain, e.g., the targeting domain is 23 nucleotides in length; and the proximal and tail domain, when taken together, comprise at least 15, 18, 20, 25, 30, 31, 35, 40, 45, 49, 50, or 53 nucleotides.
In an embodiment, the targeting domain comprises, has, or consists of, 23 nucleotides (e.g., 23 consecutive nucleotides) having complementarity with the target domain, e.g., the targeting domain is 23 nucleotides in length; and there are at least 15, 18, 20, 25, 30, 31, 35, 40, 45, 49, 50, or 53 nucleotides 3′ to the last nucleotide of the second complementarity domain.
In an embodiment, the targeting domain comprises, has, or consists of, 23 nucleotides (e.g., 23 consecutive nucleotides) having complementarity with the target domain, e.g., the targeting domain is 23 nucleotides in length; and there are at least 16, 19, 21, 26, 31, 32, 36, 41, 46, 50, 51, or 54 nucleotides 3′ to the last nucleotide of the second complementarity domain that is complementary to its corresponding nucleotide of the first complementarity domain.
In an embodiment, the targeting domain comprises, has, or consists of, 24 nucleotides (e.g., 24 consecutive nucleotides) having complementarity with the target domain, e.g., the targeting domain is 24 nucleotides in length; and the proximal and tail domain, when taken together, comprise at least 15, 18, 20, 25, 30, 31, 35, 40, 45, 49, 50, or 53 nucleotides.
In an embodiment, the targeting domain comprises, has, or consists of, 24 nucleotides (e.g., 24 consecutive nucleotides) having complementarity with the target domain, e.g., the targeting domain is 24 nucleotides in length; and there are at least 15, 18, 20, 25, 30, 31, 35, 40, 45, 49, 50, or 53 nucleotides 3′ to the last nucleotide of the second complementarity domain.
In an embodiment, the targeting domain comprises, has, or consists of, 24 nucleotides (e.g., 24 consecutive nucleotides) having complementarity with the target domain, e.g., the targeting domain is 24 nucleotides in length; and there are at least 16, 19, 21, 26, 31, 32, 36, 41, 46, 50, 51, or 54 nucleotides 3′ to the last nucleotide of the second complementarity domain that is complementary to its corresponding nucleotide of the first complementarity domain.
In an embodiment, the targeting domain comprises, has, or consists of, 25 nucleotides (e.g., 25 consecutive nucleotides) having complementarity with the target domain, e.g., the targeting domain is 25 nucleotides in length; and the proximal and tail domain, when taken together, comprise at least 15, 18, 20, 25, 30, 31, 35, 40, 45, 49, 50, or 53 nucleotides.
In an embodiment, the targeting domain has, or consists of, 25 nucleotides (e.g., 25 consecutive nucleotides) having complementarity with the target domain, e.g., the targeting domain is 25 nucleotides in length; and there are at least 15, 18, 20, 25, 30, 31, 35, 40, 45, 49, 50, or 53 nucleotides 3′ to the last nucleotide of the second complementarity domain.
In an embodiment, the targeting domain comprises, has, or consists of, 25 nucleotides (e.g., 25 consecutive nucleotides) having complementarity with the target domain, e.g., the targeting domain is 25 nucleotides in length; and there are at least 16, 19, 21, 26, 31, 32, 36, 41, 46, 50, 51, or 54 nucleotides 3′ to the last nucleotide of the second complementarity domain that is complementary to its corresponding nucleotide of the first complementarity domain.
In an embodiment, the targeting domain comprises, has, or consists of, 26 nucleotides (e.g., 26 consecutive nucleotides) having complementarity with the target domain, e.g., the targeting domain is 26 nucleotides in length; and the proximal and tail domain, when taken together, comprise at least 15, 18, 20, 25, 30, 31, 35, 40, 45, 49, 50, or 53 nucleotides.
In an embodiment, the targeting domain comprises, has, or consists of, 26 nucleotides (e.g., 26 consecutive nucleotides) having complementarity with the target domain, e.g., the targeting domain is 26 nucleotides in length; and there are at least 15, 18, 20, 25, 30, 31, 35, 40, 45, 49, 50, or 53 nucleotides 3′ to the last nucleotide of the second complementarity domain.
In an embodiment, the targeting domain comprises, has, or consists of, 26 nucleotides (e.g., 26 consecutive nucleotides) having complementarity with the target domain, e.g., the targeting domain is 26 nucleotides in length; and there are at least 16, 19, 21, 26, 31, 32, 36, 41, 46, 50, 51, or 54 nucleotides 3′ to the last nucleotide of the second complementarity domain that is complementary to its corresponding nucleotide of the first complementarity domain.
Exemplary Modular gRNAs
In an embodiment, a modular gRNA comprises:
(a) the proximal and tail domain, when taken together, comprise at least 15, 18, 20, 25, 30, 31, 35, 40, 45, 49, 50, or 53 nucleotides;
(b) there are at least 15, 18, 20, 25, 30, 31, 35, 40, 45, 49, 50, or 53 nucleotides 3′ to the last nucleotide of the second complementarity domain; or
(c) there are at least 16, 19, 21, 26, 31, 32, 36, 41, 46, 50, 51, or 54 nucleotides 3′ to the last nucleotide of the second complementarity domain that is complementary to its corresponding nucleotide of the first complementarity domain.
In an embodiment, the sequence from (a), (b), or (c), has at least 60, 75, 80, 85, 90, 95, or 99% homology with the corresponding sequence of a naturally occurring gRNA, or with a gRNA described herein.
In an embodiment, the proximal and tail domain, when taken together, comprise at least 15, 18, 20, 25, 30, 31, 35, 40, 45, 49, 50, or 53 nucleotides.
In an embodiment, there are at least 15, 18, 20, 25, 30, 31, 35, 40, 45, 49, 50, or 53 nucleotides 3′ to the last nucleotide of the second complementarity domain.
In an embodiment, there are at least 16, 19, 21, 26, 31, 32, 36, 41, 46, 50, 51, or 54 nucleotides 3′ to the last nucleotide of the second complementarity domain that is complementary to its corresponding nucleotide of the first complementarity domain.
In an embodiment, the targeting domain comprises, has, or consists of, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, or 26 nucleotides (e.g., 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, or 26 consecutive nucleotides) having complementarity with the target domain, e.g., the targeting domain is 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, or 26 nucleotides in length.
In an embodiment, the targeting domain comprises, has, or consists of, 16 nucleotides (e.g., 16 consecutive nucleotides) having complementarity with the target domain, e.g., the targeting domain is 16 nucleotides in length.
In an embodiment, the targeting domain comprises, has, or consists of, 17 nucleotides (e.g., 17 consecutive nucleotides) having complementarity with the target domain, e.g., the targeting domain is 17 nucleotides in length.
In an embodiment, the targeting domain comprises, has, or consists of, 18 nucleotides (e.g., 18 consecutive nucleotides) having complementarity with the target domain, e.g., the targeting domain is 18 nucleotides in length.
In an embodiment, the targeting domain comprises, has, or consists of, 19 nucleotides (e.g., 19 consecutive nucleotides) having complementarity with the target domain, e.g., the targeting domain is 19 nucleotides in length.
In an embodiment, the targeting domain comprises, has, or consists of, 20 nucleotides (e.g., 20 consecutive nucleotides) having complementarity with the target domain, e.g., the targeting domain is 20 nucleotides in length.
In an embodiment, the targeting domain comprises, has, or consists of, 21 nucleotides (e.g., 21 consecutive nucleotides) having complementarity with the target domain, e.g., the targeting domain is 21 nucleotides in length.
In an embodiment, the targeting domain comprises, has, or consists of, 22 nucleotides (e.g., 22 consecutive nucleotides) having complementarity with the target domain, e.g., the targeting domain is 22 nucleotides in length.
In an embodiment, the targeting domain comprises, has, or consists of, 23 nucleotides (e.g., 23 consecutive nucleotides) having complementarity with the target domain, e.g., the targeting domain is 23 nucleotides in length.
In an embodiment, the targeting domain has, or consists of, 24 nucleotides (e.g., 24 consecutive nucleotides) having complementarity with the target domain, e.g., the targeting domain is 24 nucleotides in length.
In an embodiment, the targeting domain comprises, has, or consists of, 25 nucleotides (e.g., 25 consecutive nucleotides) having complementarity with the target domain, e.g., the targeting domain is 5 nucleotides in length.
In an embodiment, the targeting domain comprises, has, or consists of, 26 nucleotides (e.g., 26 consecutive nucleotides) having complementarity with the target domain, e.g., the targeting domain is 5 nucleotides in length.
In an embodiment, the targeting domain comprises, has, or consists of, 16 nucleotides (e.g., 16 consecutive nucleotides) having complementarity with the target domain, e.g., the targeting domain is 16 nucleotides in length; and the proximal and tail domain, when taken together, comprise at least 15, 18, 20, 25, 30, 31, 35, 40, 45, 49, 50, or 53 nucleotides.
In an embodiment, the targeting domain comprises, has, or consists of, 16 nucleotides (e.g., 16 consecutive nucleotides) having complementarity with the target domain, e.g., the targeting domain is 16 nucleotides in length; and there are at least 15, 18, 20, 25, 30, 31, 35, 40, 45, 49, 50, or 53 nucleotides 3′ to the last nucleotide of the second complementarity domain.
In an embodiment, the targeting domain comprises, n has, or consists of, 16 nucleotides (e.g., 16 consecutive nucleotides) having complementarity with the target domain, e.g., the targeting domain is 16 nucleotides in length; and there are at least 16, 19, 21, 26, 31, 32, 36, 41, 46, 50, 51, or 54 nucleotides 3′ to the last nucleotide of the second complementarity domain that is complementary to its corresponding nucleotide of the first complementarity domain.
In an embodiment, the targeting domain comprises, has, or consists of, 17 nucleotides (e.g., 17 consecutive nucleotides) having complementarity with the target domain, e.g., the targeting domain is 17 nucleotides in length; and the proximal and tail domain, when taken together, comprise at least 15, 18, 20, 25, 30, 31, 35, 40, 45, 49, 50, or 53 nucleotides.
In an embodiment, the targeting domain comprises, has, or consists of, 17 nucleotides (e.g., 17 consecutive nucleotides) having complementarity with the target domain, e.g., the targeting domain is 17 nucleotides in length; and there are at least 15, 18, 20, 25, 30, 31, 35, 40, 45, 49, 50, or 53 nucleotides 3′ to the last nucleotide of the second complementarity domain.
In an embodiment, the targeting domain comprises, has, or consists of, 17 nucleotides (e.g., 17 consecutive nucleotides) having complementarity with the target domain, e.g., the targeting domain is 17 nucleotides in length; and there are at least 16, 19, 21, 26, 31, 32, 36, 41, 46, 50, 51, or 54 nucleotides 3′ to the last nucleotide of the second complementarity domain that is complementary to its corresponding nucleotide of the first complementarity domain.
In an embodiment, the targeting domain comprises, has, or consists of, 18 nucleotides (e.g., 18 consecutive nucleotides) having complementarity with the target domain, e.g., the targeting domain is 18 nucleotides in length; and the proximal and tail domain, when taken together, comprise at least 15, 18, 20, 25, 30, 31, 35, 40, 45, 49, 50, or 53 nucleotides.
In an embodiment, the targeting domain comprises, has, or consists of, 18 nucleotides (e.g., 18 consecutive nucleotides) having complementarity with the target domain, e.g., the targeting domain is 18 nucleotides in length; and there are at least 15, 18, 20, 25, 30, 31, 35, 40, 45, 49, 50, or 53 nucleotides 3′ to the last nucleotide of the second complementarity domain. In an embodiment, the targeting domain comprises, has, or consists of, 18 nucleotides (e.g., 18 consecutive nucleotides) having complementarity with the target domain, e.g., the targeting domain is 18 nucleotides in length; and there are at least 16, 19, 21, 26, 31, 32, 36, 41, 46, 50, 51, or 54 nucleotides 3′ to the last nucleotide of the second complementarity domain that is complementary to its corresponding nucleotide of the first complementarity domain.
In an embodiment, the targeting domain comprises, has, or consists of, 19 nucleotides (e.g., 19 consecutive nucleotides) having complementarity with the target domain, e.g., the targeting domain is 19 nucleotides in length; and the proximal and tail domain, when taken together, comprise at least 15, 18, 20, 25, 30, 31, 35, 40, 45, 49, 50, or 53 nucleotides.
In an embodiment, the targeting domain comprises, has, or consists of, 19 nucleotides (e.g., 19 consecutive nucleotides) having complementarity with the target domain, e.g., the targeting domain is 19 nucleotides in length; and there are at least 15, 18, 20, 25, 30, 31, 35, 40, 45, 49, 50, or 53 nucleotides 3′ to the last nucleotide of the second complementarity domain.
In an embodiment, the targeting domain comprises, has, or consists of, 19 nucleotides (e.g., 19 consecutive nucleotides) having complementarity with the target domain, e.g., the targeting domain is 19 nucleotides in length; and there are at least 16, 19, 21, 26, 31, 32, 36, 41, 46, 50, 51, or 54 nucleotides 3′ to the last nucleotide of the second complementarity domain that is complementary to its corresponding nucleotide of the first complementarity domain.
In an embodiment, the targeting domain comprises, has, or consists of, 20 nucleotides (e.g., 20 consecutive nucleotides) having complementarity with the target domain, e.g., the targeting domain is 20 nucleotides in length; and the proximal and tail domain, when taken together, comprise at least 15, 18, 20, 25, 30, 31, 35, 40, 45, 49, 50, or 53 nucleotides.
In an embodiment, the targeting domain comprises, has, or consists of, 20 nucleotides (e.g., 20 consecutive nucleotides) having complementarity with the target domain, e.g., the targeting domain is 20 nucleotides in length; and there are at least 15, 18, 20, 25, 30, 31, 35, 40, 45, 49, 50, or 53 nucleotides 3′ to the last nucleotide of the second complementarity domain.
In an embodiment, the targeting domain comprises, has, or consists of, 20 nucleotides (e.g., 20 consecutive nucleotides) having complementarity with the target domain, e.g., the targeting domain is 20 nucleotides in length; and there are at least 16, 19, 21, 26, 31, 32, 36, 41, 46, 50, 51, or 54 nucleotides 3′ to the last nucleotide of the second complementarity domain that is complementary to its corresponding nucleotide of the first complementarity domain.
In an embodiment, the targeting domain comprises, has, or consists of, 21 nucleotides (e.g., 21 consecutive nucleotides) having complementarity with the target domain, e.g., the targeting domain is 21 nucleotides in length; and the proximal and tail domain, when taken together, comprise at least 15, 18, 20, 25, 30, 31, 35, 40, 45, 49, 50, or 53 nucleotides.
In an embodiment, the targeting domain comprises, has, or consists of, 21 nucleotides (e.g., 21 consecutive nucleotides) having complementarity with the target domain, e.g., the targeting domain is 21 nucleotides in length; and there are at least 15, 18, 20, 25, 30, 31, 35, 40, 45, 49, 50, or 53 nucleotides 3′ to the last nucleotide of the second complementarity domain.
In an embodiment, the targeting domain comprises, has, or consists of, 21 nucleotides (e.g., 21 consecutive nucleotides) having complementarity with the target domain, e.g., the targeting domain is 21 nucleotides in length; and there are at least 16, 19, 21, 26, 31, 32, 36, 41, 46, 50, 51, or 54 nucleotides 3′ to the last nucleotide of the second complementarity domain that is complementary to its corresponding nucleotide of the first complementarity domain.
In an embodiment, the targeting domain comprises, has, or consists of, 22 nucleotides (e.g., 22 consecutive nucleotides) having complementarity with the target domain, e.g., the targeting domain is 22 nucleotides in length; and the proximal and tail domain, when taken together, comprise at least 15, 18, 20, 25, 30, 31, 35, 40, 45, 49, 50, or 53 nucleotides.
In an embodiment, the targeting domain comprises, has, or consists of, 22 nucleotides (e.g., 22 consecutive nucleotides) having complementarity with the target domain, e.g., the targeting domain is 22 nucleotides in length; and there are at least 15, 18, 20, 25, 30, 31, 35, 40, 45, 49, 50, or 53 nucleotides 3′ to the last nucleotide of the second complementarity domain.
In an embodiment, the targeting domain comprises, has, or consists of, 22 nucleotides (e.g., 22 consecutive nucleotides) having complementarity with the target domain, e.g., the targeting domain is 22 nucleotides in length; and there are at least 16, 19, 21, 26, 31, 32, 36, 41, 46, 50, 51, or 54 nucleotides 3′ to the last nucleotide of the second complementarity domain that is complementary to its corresponding nucleotide of the first complementarity domain.
In an embodiment, the targeting domain comprises, has, or consists of, 23 nucleotides (e.g., 23 consecutive nucleotides) having complementarity with the target domain, e.g., the targeting domain is 23 nucleotides in length; and the proximal and tail domain, when taken together, comprise at least 15, 18, 20, 25, 30, 31, 35, 40, 45, 49, 50, or 53 nucleotides.
In an embodiment, the targeting domain comprises, has, or consists of, 23 nucleotides (e.g., 23 consecutive nucleotides) having complementarity with the target domain, e.g., the targeting domain is 23 nucleotides in length; and there are at least 15, 18, 20, 25, 30, 31, 35, 40, 45, 49, 50, or 53 nucleotides 3′ to the last nucleotide of the second complementarity domain.
In an embodiment, the targeting domain comprises, has, or consists of, 23 nucleotides (e.g., 23 consecutive nucleotides) having complementarity with the target domain, e.g., the targeting domain is 23 nucleotides in length; and there are at least 16, 19, 21, 26, 31, 32, 36, 41, 46, 50, 51, or 54 nucleotides 3′ to the last nucleotide of the second complementarity domain that is complementary to its corresponding nucleotide of the first complementarity domain.
In an embodiment, the targeting domain comprises, has, or consists of, 24 nucleotides (e.g., 24 consecutive nucleotides) having complementarity with the target domain, e.g., the targeting domain is 24 nucleotides in length; and the proximal and tail domain, when taken together, comprise at least 15, 18, 20, 25, 30, 31, 35, 40, 45, 49, 50, or 53 nucleotides.
In an embodiment, the targeting domain comprises, has, or consists of, 24 nucleotides (e.g., 24 consecutive nucleotides) having complementarity with the target domain, e.g., the targeting domain is 24 nucleotides in length; and there are at least 15, 18, 20, 25, 30, 31, 35, 40, 45, 49, 50, or 53 nucleotides 3′ to the last nucleotide of the second complementarity domain.
In an embodiment, the targeting domain comprises, has, or consists of, 24 nucleotides (e.g., 24 consecutive nucleotides) having complementarity with the target domain, e.g., the targeting domain is 24 nucleotides in length; and there are at least 16, 19, 21, 26, 31, 32, 36, 41, 46, 50, 51, or 54 nucleotides 3′ to the last nucleotide of the second complementarity domain that is complementary to its corresponding nucleotide of the first complementarity domain.
In an embodiment, the targeting domain comprises, has, or consists of, 25 nucleotides (e.g., 25 consecutive nucleotides) having complementarity with the target domain, e.g., the targeting domain is 25 nucleotides in length; and the proximal and tail domain, when taken together, comprise at least 15, 18, 20, 25, 30, 31, 35, 40, 45, 49, 50, or 53 nucleotides.
In an embodiment, the targeting domain comprises, has, or consists of, 25 nucleotides (e.g., 25 consecutive nucleotides) having complementarity with the target domain, e.g., the targeting domain is 25 nucleotides in length; and there are at least 15, 18, 20, 25, 30, 31, 35, 40, 45, 49, 50, or 53 nucleotides 3′ to the last nucleotide of the second complementarity domain.
In an embodiment, the targeting domain comprises, has, or consists of, 25 nucleotides (e.g., 25 consecutive nucleotides) having complementarity with the target domain, e.g., the targeting domain is 25 nucleotides in length; and there are at least 16, 19, 21, 26, 31, 32, 36, 41, 46, 50, 51, or 54 nucleotides 3′ to the last nucleotide of the second complementarity domain that is complementary to its corresponding nucleotide of the first complementarity domain.
In an embodiment, the targeting domain comprises, has, or consists of, 26 nucleotides (e.g., 26 consecutive nucleotides) having complementarity with the target domain, e.g., the targeting domain is 26 nucleotides in length; and the proximal and tail domain, when taken together, comprise at least 15, 18, 20, 25, 30, 31, 35, 40, 45, 49, 50, or 53 nucleotides.
In an embodiment, the targeting domain comprises, has, or consists of, 26 nucleotides (e.g., 26 consecutive nucleotides) having complementarity with the target domain, e.g., the targeting domain is 26 nucleotides in length; and there are at least 15, 18, 20, 25, 30, 31, 35, 40, 45, 49, 50, or 53 nucleotides 3′ to the last nucleotide of the second complementarity domain.
In an embodiment, the targeting domain comprises, has, or consists of, 26 nucleotides (e.g., 26 consecutive nucleotides) having complementarity with the target domain, e.g., the targeting domain is 26 nucleotides in length; and there are at least 16, 19, 21, 26, 31, 32, 36, 41, 46, 50, 51, or 54 nucleotides 3′ to the last nucleotide of the second complementarity domain that is complementary to its corresponding nucleotide of the first complementarity domain.
Methods for Designing gRNAs Methods for designing gRNAs are described herein, including methods for selecting, designing and validating target domains. Exemplary targeting domains are also provided herein. Targeting Domains discussed herein can be incorporated into the gRNAs described herein.
Methods for selection and validation of target sequences as well as off-target analyses are described, e.g., in Mali et al., 2013 SCIENCE 339(6121): 823-826; Hsu et al., 2013 NAT BIOTECHNOL, 31(9): 827-32; Fu et al., 2014 NAT BIOTECHNOL, doi: 10.1038/nbt.2808. PubMed PMID: 24463574; Heigwer et al., 2014 NAT METHODS 11(2):122-3. doi: 10.1038/nmeth.2812. PubMed PMID: 24481216; Bae et al., 2014 BIOINFORMATICS PubMed PMID: 24463181; Xiao A et al., 2014 BIOINFORMATICS PubMed PMID: 24389662.
For example, a software tool can be used to optimize the choice of gRNA within a user's target sequence, e.g., to minimize total off-target activity across the genome. Off target activity may be other than cleavage. For each possible gRNA choice e.g., using S. pyogenes Cas9, the tool can identify all off-target sequences (e.g., preceding either NAG or NGG PAMs) across the genome that contain up to certain number (e.g., 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10) of mismatched base-pairs. The cleavage efficiency at each off-target sequence can be predicted, e.g., using an experimentally-derived weighting scheme. Each possible gRNA is then ranked according to its total predicted off-target cleavage; the top-ranked gRNAs represent those that are likely to have the greatest on-target and the least off-target cleavage. Other functions, e.g., automated reagent design for CRISPR construction, primer design for the on-target Surveyor assay, and primer design for high-throughput detection and quantification of off-target cleavage via next-gen sequencing, can also be included in the tool. Candidate gRNA molecules can be evaluated by art-known methods or as described in Section IV herein.
Cas9 molecules of a variety of species can be used in the methods and compositions described herein. While the S. pyogenes and S. thermophilus Cas9 molecules are the subject of much of the disclosure herein, Cas9 molecules of, derived from, or based on the Cas9 proteins of other species listed herein can be used as well. In other words, while the much of the description herein uses S. pyogenes and S. thermophilus Cas9 molecules, Cas9 molecules from the other species can replace them, e.g., Staphylococcus aureus and Neisseria meningitidis Cas9 molecules. Additional Cas9 species include: Acidovorax avenae, Actinobacillus pleuropneumoniae, Actinobacillus succinogenes, Actinobacillus suis, Actinomyces sp., Cycliphilus denitrificans, Aminomonas paucivorans, Bacillus cereus, Bacillus smithii, Bacillus thuringiensis, Bacteroides sp., Blastopirellula marina, Bradyrhizobium sp., Brevibacillus laterosporus, Campylobacter coli, Campylobacter jejuni, Campylobacter lari, Candidatus puniceispirillum, Clostridium cellulolyticum, Clostridium perfringens, Corynebacterium accolens, Corynebacterium diphtheria, Corynebacterium matruchotii, Dinoroseobacter shibae, Eubacterium dolichum, Gamma proteobacterium, Gluconacetobacter diazotrophicus, Haemophilus parainfluenzae, Haemophilus sputorum, Helicobacter canadensis, Helicobacter cinaedi, Helicobacter mustelae, Ilyobacter polytropus, Kingella kingae, Lactobacillus crispatus, Listeria ivanovii, Listeria monocytogenes, Listeriaceae bacterium, Methylocystis sp., Methylosinus trichosporium, Mobiluncus mulieris, Neisseria bacilliformis, Neisseria cinerea, Neisseria flavescens, Neisseria lactamica, Neisseria sp., Neisseria wadsworthii, Nitrosomonas sp., Parvibaculum lavamentivorans, Pasteurella multocida, Phascolarctobacterium succinatutens, Ralstonia syzygii, Rhodopseudomonas palustris, Rhodovulum sp., Simonsiella muelleri, Sphingomonas sp., Sporolactobacillus vineae, Staphylococcus lugdunensis, Streptococcus sp., Subdoligranulum sp., Tistrella mobilis, Treponema sp., or Verminephrobacter eiseniae.
A Cas9 molecule, as that term is used herein, refers to a molecule that can interact with a gRNA molecule and, in concert with the gRNA molecule, localize (e.g., target or home) to a site which comprises a target domain and PAM sequence.
In an embodiment, the Cas9 molecule is capable of cleaving a target nucleic acid molecule. A Cas9 molecule that is capable of cleaving a target nucleic acid molecule is referred to herein as an eaCas9 (an enzymatically active Cas9) molecule. In an embodiment, an eaCas9 molecule, comprises one or more of the following activities:
a nickase activity, i.e., the ability to cleave a single strand, e.g., the non-complementary strand or the complementary strand, of a nucleic acid molecule;
a double stranded nuclease activity, i.e., the ability to cleave both strands of a double stranded nucleic acid and create a double stranded break, which in an embodiment is the presence of two nickase activities;
an endonuclease activity;
an exonuclease activity; and
a helicase activity, i.e., the ability to unwind the helical structure of a double stranded nucleic acid.
In an embodiment, an enzymatically active Cas9 or an eaCas9 molecule cleaves both DNA strands and results in a double stranded break. In an embodiment, an eaCas9 molecule cleaves only one strand, e.g., the strand to which the gRNA hybridizes to, or the strand complementary to the strand the gRNA hybridizes with. In an embodiment, an eaCas9 molecule comprises cleavage activity associated with an HNH-like domain. In an embodiment, an eaCas9 molecule comprises cleavage activity associated with an N-terminal RuvC-like domain. In an embodiment, an eaCas9 molecule comprises cleavage activity associated with an HNH-like domain and cleavage activity associated with an N-terminal RuvC-like domain. In an embodiment, an eaCas9 molecule comprises an active, or cleavage competent, HNH-like domain and an inactive, or cleavage incompetent, N-terminal RuvC-like domain. In an embodiment, an eaCas9 molecule comprises an inactive, or cleavage incompetent, HNH-like domain and an active, or cleavage competent, N-terminal RuvC-like domain.
In an embodiment, the ability of an eaCas9 molecule to interact with and cleave a target nucleic acid is PAM sequence dependent. A PAM sequence is a sequence in the target nucleic acid. In an embodiment, cleavage of the target nucleic acid occurs upstream from the PAM sequence. EaCas9 molecules from different bacterial species can recognize different sequence motifs (e.g., PAM sequences). In an embodiment, an eaCas9 molecule of S. pyogenes recognizes the sequence motif NGG and directs cleavage of a target nucleic acid sequence 1 to 10, e.g., 3 to 5, base pairs upstream from that sequence. See, e.g., Mali et al., SCIENCE 2013; 339(6121): 823-826. In an embodiment, an eaCas9 molecule of S. therrnophilus recognizes the sequence motif NGGNG and NNAGAAW (W=A or T) and directs cleavage of a core target nucleic acid sequence 1 to 10, e.g., 3 to 5, base pairs upstream from these sequences. See, e.g., Horvath et al., SCIENCE 2010; 327(5962):167-170, and Deveau et al., J BACTERIOL 2008; 190(4): 1390-1400. In an embodiment, an eaCas9 molecule of S. mutans recognizes the sequence motif NGG or NAAR (R=A or G) and directs cleavage of a core target nucleic acid sequence 1 to 10, e.g., 3 to 5 base pairs, upstream from this sequence. See, e.g., Deveau et al., J BACTERIOL 2008; 190(4): 1390-1400. In an embodiment, an eaCas9 molecule of S. aureus recognizes the sequence motif NNGRR (R=A or G) and directs cleavage of a target nucleic acid sequence 1 to 10, e.g., 3 to 5, base pairs upstream from that sequence. In an embodiment, an eaCas9 molecule of N. meningitidis recognizes the sequence motif NNNNGATT and directs cleavage of a target nucleic acid sequence 1 to 10, e.g., 3 to 5, base pairs upstream from that sequence. See, e.g., Hou et al., PNAS EARLY EDITION 2013, 1-6. The ability of a Cas9 molecule to recognize a PAM sequence can be determined, e.g., using a transformation assay described in Jinek et al., SCIENCE 2012, 337:816.
Some Cas9 molecules have the ability to interact with a gRNA molecule, and in conjunction with the gRNA molecule home (e.g., targeted or localized) to a core target domain, but are incapable of cleaving the target nucleic acid, or incapable of cleaving at efficient rates. Cas9 molecules having no, or no substantial, cleavage activity are referred to herein as an eiCas9 (an enzymatically inactive Cas9) molecule. For example, an eiCas9 molecule can lack cleavage activity or have substantially less, e.g., less than 20, 10, 5, 1 or 0.1% of the cleavage activity of a reference Cas9 molecule, as measured by an assay described herein.
Exemplary naturally occurring Cas9 molecules are described in Chylinski et al., RNA Biology 2013; 10:5, 727-737. Such Cas9 molecules include Cas9 molecules of a cluster 1 bacterial family, cluster 2 bacterial family, cluster 3 bacterial family, cluster 4 bacterial family, cluster 5 bacterial family, cluster 6 bacterial family, a cluster 7 bacterial family, a cluster 8 bacterial family, a cluster 9 bacterial family, a cluster 10 bacterial family, a cluster 11 bacterial family, a cluster 12 bacterial family, a cluster 13 bacterial family, a cluster 14 bacterial family, a cluster 15 bacterial family, a cluster 16 bacterial family, a cluster 17 bacterial family, a cluster 18 bacterial family, a cluster 19 bacterial family, a cluster 20 bacterial family, a cluster 21 bacterial family, a cluster 22 bacterial family, a cluster 23 bacterial family, a cluster 24 bacterial family, a cluster 25 bacterial family, a cluster 26 bacterial family, a cluster 27 bacterial family, a cluster 28 bacterial family, a cluster 29 bacterial family, a cluster 30 bacterial family, a cluster 31 bacterial family, a cluster 32 bacterial family, a cluster 33 bacterial family, a cluster 34 bacterial family, a cluster 35 bacterial family, a cluster 36 bacterial family, a cluster 37 bacterial family, a cluster 38 bacterial family, a cluster 39 bacterial family, a cluster 40 bacterial family, a cluster 41 bacterial family, a cluster 42 bacterial family, a cluster 43 bacterial family, a cluster 44 bacterial family, a cluster 45 bacterial family, a cluster 46 bacterial family, a cluster 47 bacterial family, a cluster 48 bacterial family, a cluster 49 bacterial family, a cluster 50 bacterial family, a cluster 51 bacterial family, a cluster 52 bacterial family, a cluster 53 bacterial family, a cluster 54 bacterial family, a cluster 55 bacterial family, a cluster 56 bacterial family, a cluster 57 bacterial family, a cluster 58 bacterial family, a cluster 59 bacterial family, a cluster 60 bacterial family, a cluster 61 bacterial family, a cluster 62 bacterial family, a cluster 63 bacterial family, a cluster 64 bacterial family, a cluster 65 bacterial family, a cluster 66 bacterial family, a cluster 67 bacterial family, a cluster 68 bacterial family, a cluster 69 bacterial family, a cluster 70 bacterial family, a cluster 71 bacterial family, a cluster 72 bacterial family, a cluster 73 bacterial family, a cluster 74 bacterial family, a cluster 75 bacterial family, a cluster 76 bacterial family, a cluster 77 bacterial family, or a cluster 78 bacterial family.
Exemplary naturally occurring Cas9 molecules include a Cas9 molecule of a cluster 1 bacterial family. Examples include a Cas9 molecule of: S. pyogenes (e.g., strain SF370, MGAS10270, MGAS10750, MGAS2096, MGAS315, MGAS5005, MGAS6180, MGAS9429, NZ131 and SSI-1), S. thermophilus (e.g., strain LMD-9), S. pseudoporcinus (e.g., strain SPIN 20026), S. mutans (e.g., strain UA159, NN2025), S. macacae (e.g., strain NCTC11558), S. gallolyticus (e.g., strain UCN34, ATCC BAA-2069), S. equines (e.g., strain ATCC 9812, MGCS 124), S. dysdalactiae (e.g., strain GGS 124), S. bovis (e.g., strain ATCC 700338), S. anginosus (e.g., strain F0211), S. agalactiae (e.g., strain NEM316, A909), Listeria monocytogenes (e.g., strain F6854), Listeria innocua (L. innocua, e.g., strain Clip11262), Enterococcus italicus (e.g., strain DSM 15952), or Enterococcus faecium (e.g., strain 1,231,408). Additional exemplary Cas9 molecules are a Cas9 molecule of Neisseria meningitidis (Hou et al. PNAS Early Edition 2013, 1-6) and a S. aureus Cas9 molecule.
In an embodiment, a Cas9 molecule, e.g., an eaCas9 molecule or eiCas9 molecule, comprises an amino acid sequence:
having 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% homology with;
differs at no more than, 2, 5, 10, 15, 20, 30, or 40% of the amino acid residues when compared with;
differs by at least 1, 2, 5, 10 or 20 amino acids but by no more than 100, 80, 70, 60, 50, 40 or 30 amino acids from; or is identical to;
any Cas9 molecule sequence described herein or a naturally occurring Cas9 molecule sequence, e.g., a Cas9 molecule from a species listed herein or described in Chylinski et al., RNA Biology 2013, 10:5, 727-737; Hou et al. PNAS Early Edition 2013, 1-6. In an embodiment, the Cas9 molecule comprises one or more of the following activities: a nickase activity; a double stranded cleavage activity (e.g., an endonuclease and/or exonuclease activity); a helicase activity; or the ability, together with a gRNA molecule, to localize to a target nucleic acid.
In an embodiment, a Cas9 molecule comprises the amino acid sequence of the consensus sequence of FIG. 2, wherein “*” indicates any amino acid found in the corresponding position in the amino acid sequence of a Cas9 molecule of S. pyogenes, S. therrnophilus, S. mutans and L. innocua, and “-” indicates any amino acid. In an embodiment, a Cas9 molecule differs from the sequence of the consensus sequence disclosed in FIG. 2 by at least 1, but no more than 2, 3, 4, 5, 6, 7, 8, 9, or 10 amino acid residues. In an embodiment, a Cas9 molecule comprises the amino acid sequence of SEQ ID NO:7 of FIG. 5, wherein “*” indicates any amino acid found in the corresponding position in the amino acid sequence of a Cas9 molecule of S. pyogenes, or N. meningitidis, “-” indicates any amino acid, and “-” indicates any amino acid or absent. In an embodiment, a Cas9 molecule differs from the sequence of SEQ ID NO:6 or 7 by at least 1, but no more than 2, 3, 4, 5, 6, 7, 8, 9, or 10 amino acid residues.
A comparison of the sequence of a number of Cas9 molecules indicate that certain regions are conserved. These are identified below as:
region 1 (residues 1 to 180, or in the case of region 1′ residues 120 to 180)
region 2 (residues 360 to 480);
region 3 (residues 660 to 720);
region 4 (residues 817 to 900); and
region 5 (residues 900 to 960).
In an embodiment, a Cas9 molecule comprises regions 1-5, together with sufficient additional Cas9 molecule sequence to provide a biologically active molecule, e.g., a Cas9 molecule having at least one activity described herein. In an embodiment, each of regions 1-6, independently, have, 50%, 60%, 70%, 80%, 85%, 90%, 95%, 96%, 97%, 98% or 99% homology with the corresponding residues of a Cas9 molecule described herein, e.g., a sequence from FIG. 2 or from FIG. 5.
In an embodiment, a Cas9 molecule, e.g., an eaCas9 molecule or eiCas9 molecule, comprises an amino acid sequence referred to as region 1:
having 50%, 60%, 70%, 80%, 85%, 90%, 95%, 96%, 97%, 98% or 99% homology with amino acids 1-180 (the numbering is according to the motif sequence in FIG. 2; 52% of residues in the four Cas9 sequences in FIG. 2 are conserved) of the amino acid sequence of Cas9 of S. pyogenes;
differs by at least 1, 2, 5, 10 or 20 amino acids but by no more than 90, 80, 70, 60, 50, 40 or 30 amino acids from amino acids 1-180 of the amino acid sequence of Cas9 of S. pyogenes, S. thermophilus, S. mutans, L. innocua, N. meningitidis, or S. aureus; or
is identical to 1-180 of the amino acid sequence of Cas9 of S. pyogenes, S. thermophilus, S. mutans, L. innocua, N. meningitidis, or S. aureus.
In an embodiment, a Cas9 molecule, e.g., an eaCas9 molecule or eiCas9 molecule, comprises an amino acid sequence referred to as region 1′:
having 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98% or 99% homology with amino acids 120-180 (55% of residues in the four Cas9 sequences in FIG. 2 are conserved) of the amino acid sequence of Cas9 of S. pyogenes, S. thermophilus, S. mutans or, L. innocua, N. meningitidis, or S. aureus;
differs by at least 1, 2, or 5 amino acids but by no more than 35, 30, 25, 20 or 10 amino acids from amino acids 120-180 of the amino acid sequence of Cas9 of S. pyogenes, S. thermophilus, S. mutans or, L. innocua, N. meningitidis, or S. aureus; or
is identical to 120-180 of the amino acid sequence of Cas9 of S. pyogenes, S. thermophilus, S. mutans or, L. innocua, N. meningitidis, or S. aureus.
In an embodiment, a Cas9 molecule, e.g., an eaCas9 molecule or eiCas9 molecule, comprises an amino acid sequence referred to as region 2:
having 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98% or 99% homology with amino acids 360-480 (52% of residues in the four Cas9 sequences in FIG. 2 are conserved) of the amino acid sequence of Cas9 of S. pyogenes, S. thermophilus, S. mutans or, L. innocua, N. meningitidis, or S. aureus;
differs by at least 1, 2, or 5 amino acids but by no more than 35, 30, 25, 20 or 10 amino acids from amino acids 360-480 of the amino acid sequence of Cas9 of S. pyogenes, S. thermophilus, S. mutans or, L. innocua, N. meningitidis, or S. aureus; or is identical to 360-480 of the amino acid sequence of Cas9 of S. pyogenes, S. thermophilus, S. mutans or, L. innocua, N. meningitidis, or S. aureus.
In an embodiment, a Cas9 molecule, e.g., an eaCas9 molecule or eiCas9 molecule, comprises an amino acid sequence referred to as region 3:
having 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98% or 99% homology with amino acids 660-720 (56% of residues in the four Cas9 sequences in FIG. 2 are conserved) of the amino acid sequence of Cas9 of S. pyogenes, S. thermophilus, S. mutans or, L. innocua, N. meningitidis, or S. aureus;
differs by at least 1, 2, or 5 amino acids but by no more than 35, 30, 25, 20 or 10 amino acids from amino acids 660-720 of the amino acid sequence of Cas9 of S. pyogenes, S. thermophilus, S. mutans or, L. innocua, N. meningitidis, or S. aureus; or is identical to 660-720 of the amino acid sequence of Cas9 of S. pyogenes, S. thermophilus, S. mutans or, L. innocua, N. meningitidis, or S. aureus.
In an embodiment, a Cas9 molecule, e.g., an eaCas9 molecule or eiCas9 molecule, comprises an amino acid sequence referred to as region 4:
having 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98% or 99% homology with amino acids 817-900 (55% of residues in the four Cas9 sequences in FIG. 2 are conserved) of the amino acid sequence of Cas9 of S. pyogenes, S. thermophilus, S. mutans or, L. innocua, N. meningitidis, or S. aureus;
differs by at least 1, 2, or 5 amino acids but by no more than 35, 30, 25, 20 or 10 amino acids from amino acids 817-900 of the amino acid sequence of Cas9 of S. pyogenes, S. thermophilus, S. mutans or, L. innocua, N. meningitidis, or S. aureus; or is identical to 817-900 of the amino acid sequence of Cas9 of S. pyogenes, S. thermophilus, S. mutans or, L. innocua, N. meningitidis, or S. aureus.
In an embodiment, a Cas9 molecule, e.g., an eaCas9 molecule or eiCas9 molecule, comprises an amino acid sequence referred to as region 5:
having 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98% or 99% homology with amino acids 900-960 (60% of residues in the four Cas9 sequences in FIG. 2 are conserved) of the amino acid sequence of Cas9 of S. pyogenes, S. thermophilus, S. mutans or, L. innocua, N. meningitidis, or S. aureus;
differs by at least 1, 2, or 5 amino acids but by no more than 35, 30, 25, 20 or 10 amino acids from amino acids 900-960 of the amino acid sequence of Cas9 of S. pyogenes, S. thermophilus, S. mutans or, L. innocua, N. meningitidis, or S. aureus; or
is identical to 900-960 of the amino acid sequence of Cas9 of S. pyogenes, S. thermophilus, S. mutans or, L. innocua, N. meningitidis, or S. aureus.
A RuvC-Like Domain and an HNH-Like Domain
In an embodiment, a Cas9 molecule comprises an HNH-like domain and an RuvC-like domain. In an embodiment, cleavage activity is dependent on a RuvC-like domain and an HNH-like domain. A Cas9 molecule, e.g., an eaCas9 or eiCas9 molecule, can comprise one or more of the following domains: a RuvC-like domain and an HNH-like domain. In an embodiment, a cas9 molecule is an eaCas9 molecule and the eaCas9 molecule comprises a RuvC-like domain, e.g., a RuvC-like domain described below, and/or an HNH-like domain, e.g., an HNH-like domain described below. In an embodiment, a Cas9 molecule is an eiCas9 molecule comprising one or more difference in an RuvC-like domain and/or in an HNH-like domain as compared to a reference Cas9 molecule, and the eiCas9 molecule does not cleave a nucleic acid, or cleaves with significantly less efficiency than does wildype, e.g., when compared with wild type in a cleavage assay, e.g., as described herein, cuts with less than 50, 25, 10, or 1% of the a reference Cas9 molecule, as measured by an assay described herein.
RuvC-Like Domains
In an embodiment, a RuvC-like domain cleaves, a single strand, e.g., the non-complementary strand of the target nucleic acid molecule. A Cas9 molecule can include more than one RuvC-like domain (e.g., one, two, three or more RuvC-like domains). In an embodiment, an RuvC-like domain is at least 5, 6, 7, 8 amino acids in length but not more than 20, 19, 18, 17, 16 or 15 amino acids in length. In an embodiment, the cas9 molecule comprises an N-terminal RuvC-like domain of about 10 to 20 amino acids, e.g., about 15 amino acids in length.
N-Terminal RuvC-Like Domains
Some naturally occurring Cas9 molecules comprise more than one RuvC-like domain, with cleavage being dependent on the N-terminal RuvC-like domain. Accordingly, Cas9 molecules can comprise an N-terminal RuvC-like domain. Exemplary N-terminal RuvC-like domains are described below.
In an embodiment, an eaCas9 molecule comprises an N-terminal RuvC-like domain comprising an amino acid sequence of formula I:
| (SEQ ID NO: 8) | |
| D-X1-G-X2-X3-X4-X5-G-X6-X7-X8-X9, |
wherein,
X1 is selected from I, V, M, L and T (e.g., selected from I, V, and L);
X2 is selected from T, I, V, S, N, Y, E and L (e.g., selected from T, V, and I);
X3 is selected from N, S, G, A, D, T, R, M and F (e.g., A or N);
X4 is selected from S, Y, N and F (e.g., S);
X5 is selected from V, I, L, C, T and F (e.g., selected from V, I and L);
X6 is selected from W, F, V, Y, S and L (e.g., W);
X7 is selected from A, S, C, V and G (e.g., selected from A and S);
X8 is selected from V, I, L, A, M and H (e.g., selected from V, I, M and L); and
X9 is selected from any amino acid or is absent (e.g., selected from T, V, I, L, A, F, S, A, Y, M and R, or, e.g., selected from T, V, I, L and A).
In an embodiment, the N-terminal RuvC-like domain differs from a sequence of SEQ ID NO:8, by as many as 1 but no more than 2, 3, 4, or 5 residues.
In embodiment the N-terminal RuvC-like domain is cleavage competent.
In embodiment the N-terminal RuvC-like domain is cleavage incompetent.
In an embodiment, an eaCas9 molecule comprises an N-terminal RuvC-like domain comprising an amino acid sequence of formula II:
| (SEQ ID NO: 9) | |
| D-X1-G-X2-X3-S-X5-G-X6-X7-X8-X9, |
wherein
X1 is selected from I, V, M, L and T (e.g., selected from I, V, and L);
X2 is selected from T, I, V, S, N, Y, E and L (e.g., selected from T, V, and I);
X3 is selected from N, S, G, A, D, T, R, M and F (e.g., A or N);
X5 is selected from V, I, L, C, T and F (e.g., selected from V, I and L);
X6 is selected from W, F, V, Y, S and L (e.g., W);
X7 is selected from A, S, C, V and G (e.g., selected from A and S);
X8 is selected from V, I, L, A, M and H (e.g., selected from V, I, M and L); and
X9 is selected from any amino acid or is absent (e.g., selected from T, V, I, L, A, F, S, A, Y, M and R or selected from e.g., T, V, I, L and A).
In an embodiment, the N-terminal RuvC-like domain differs from a sequence of SEQ ID NO:9 by as many as 1, but no more than 2, 3, 4, or 5 residues.
In an embodiment, the N-terminal RuvC-like domain comprises an amino acid sequence of formula III:
| (SEQ ID NO: 10) | |
| D-I-G-X2-X3-S-V-G-W-A-X8-X9, |
wherein
X2 is selected from T, I, V, S, N, Y, E and L (e.g., selected from T, V, and I);
X3 is selected from N, S, G, A, D, T, R, M and F (e.g., A or N);
X8 is selected from V, I, L, A, M and H (e.g., selected from V, I, M and L); and
X9 is selected from any amino acid or is absent (e.g., selected from T, V, I, L, A, F, S, A, Y, M and R or selected from e.g., T, V, I, L and A).
In an embodiment, the N-terminal RuvC-like domain differs from a sequence of SEQ ID NO:10 by as many as 1, but no more than, 2, 3, 4, or 5 residues.
In an embodiment, the N-terminal RuvC-like domain comprises an amino acid sequence of formula III:
| (SEQ ID NO: 11) | |
| D-I-G-T-N-S-V-G-W-A-V-X, |
wherein
X is a non-polar alkyl amino acid or a hydroxyl amino acid, e.g., X is selected from V, I, L and T (e.g., the eaCas9 molecule can comprise an N-terminal RuvC-like domain shown in FIG. 2 (depicted as “Y”)).
In an embodiment, the N-terminal RuvC-like domain differs from a sequence of SEQ ID NO:11 by as many as 1 but no more than, 2, 3, 4, or 5 residues.
In an embodiment, the N-terminal RuvC-like domain differs from a sequence of an N-terminal RuvC-like domain disclosed herein, e.g., in FIG. 3A or FIG. 5, as many as 1, but no more than 2, 3, 4, or 5 residues. In an embodiment, 1, 2, or all 3 of the highly conserved residues identified in FIG. 3A or FIG. 5 are present.
In an embodiment, the N-terminal RuvC-like domain differs from a sequence of an N-terminal RuvC-like domain disclosed herein, e.g., in FIG. 3B, as many as 1, but no more than 2, 3, 4, or 5 residues. In an embodiment, 1, 2, 3 or all 4 of the highly conserved residues identified in FIG. 3B are present.
Additional RuvC-Like Domains
In addition to the N-terminal RuvC-like domain, a Cas9 molecule, e.g., an eaCas9 molecule, can comprise one or more additional RuvC-like domains. In an embodiment, a Cas9 molecule can comprise two additional RuvC-like domains. Preferably, the additional RuvC-like domain is at least 5 amino acids in length and, e.g., less than 15 amino acids in length, e.g., 5 to 10 amino acids in length, e.g., 8 amino acids in length.
An additional RuvC-like domain can comprise an amino acid sequence:
I-X1-X2-E-X3-A-R-E (SEQ ID NO:12), wherein
X1 is V or H,
X2 is I, L or V (e.g., I or V); and
X3 is M or T.
In an embodiment, the additional RuvC-like domain comprises the amino acid sequence:
I-V-X2-E-M-A-R-E (SEQ ID NO:13), wherein
X2 is I, L or V (e.g., I or V) (e.g., the eaCas9 molecule can comprise an additional RuvC-like domain shown in FIG. 2 or FIG. 5 (depicted as “B”)).
An additional RuvC-like domain can comprise an amino acid sequence:
H-H-A-X1-D-A-X2-X3 (SEQ ID NO:14), wherein
X1 is H or L; X2 is R or V; and X3 is E or V.
In an embodiment, the additional RuvC-like domain comprises the amino acid sequence:
H-H-A-H-D-A-Y-L (SEQ ID NO:15).
In an embodiment, the additional RuvC-like domain differs from a sequence of SEQ ID NO:13, 15, 12 or 14 by as many as 1, but no more than 2, 3, 4, or 5 residues.
In an embodiment, the sequence flanking the N-terminal RuvC-like domain is a sequences of formula V:
| (SEQ ID NO: 16) | |
| K-X1′-Y-X2′-X3′-X4′-Z-T-D-X9′-Y, |
wherein
X1′ is selected from K and P,
X2′ is selected from V, L, I, and F (e.g., V, I and L);
X3′ is selected from G, A and S (e.g., G),
X4′ is selected from L, I, V and F (e.g., L);
X9′ is selected from D, E, N and Q; and
Z is an N-terminal RuvC-like domain, e.g., as described above.
HNH-Like Domains
In an embodiment, an HNH-like domain cleaves a single stranded complementary domain, e.g., a complementary strand of a double stranded nucleic acid molecule. In an embodiment, an HNH-like domain is at least 15, 20, 25 amino acids in length but not more than 40, 35 or 30 amino acids in length, e.g., 20 to 35 amino acids in length, e.g., 25 to 30 amino acids in length. Exemplary HNH-like domains are described below.
In an embodiment, an eaCas9 molecule comprises an HNH-like domain having an amino acid sequence of formula VI:
X1-X2-X3-H-X4-X5-P-X6-X7-X8-X9-X10-X11-X12-X13-X14-X15-N-X16-X17-X18-X19-X20-X21-X22-X23-N (SEQ ID NO:17), wherein
X1 is selected from D, E, Q and N (e.g., D and E);
X2 is selected from L, I, R, Q, V, M and K;
X3 is selected from D and E;
X4 is selected from I, V, T, A and L (e.g., A, I and V);
X5 is selected from V, Y, I, L, F and W (e.g., V, I and L);
X6 is selected from Q, H, R, K, Y, I, L, F and W;
X7 is selected from S, A, D, T and K (e.g., S and A);
X8 is selected from F, L, V, K, Y, M, I, R, A, E, D and Q (e.g., F);
X9 is selected from L, R, T, I, V, S, C, Y, K, F and G;
X10 is selected from K, Q, Y, T, F, L, W, M, A, E, G, and S;
X11 is selected from D, S, N, R, L and T (e.g., D);
X12 is selected from D, N and S;
X13 is selected from S, A, T, G and R (e.g., S);
X14 is selected from I, L, F, S, R, Y, Q, W, D, K and H (e.g., I, L and F);
X15 is selected from D, S, I, N, E, A, H, F, L, Q, M, G, Y and V;
X16 is selected from K, L, R, M, T and F (e.g., L, R and K);
X17 is selected from V, L, I, A and T;
X18 is selected from L, I, V and A (e.g., L and I);
X19 is selected from T, V, C, E, S and A (e.g., T and V);
X20 is selected from R, F, T, W, E, L, N, C, K, V, S, Q, I, Y, H and A;
X21 is selected from S, P, R, K, N, A, H, Q, G and L;
X22 is selected from D, G, T, N, S, K, A, I, E, L, Q, R and Y; and
X23 is selected from K, V, A, E, Y, I, C, L, S, T, G, K, M, D and F.
In an embodiment, a HNH-like domain differs from a sequence of SEQ ID NO:17 by at least 1, but no more than, 2, 3, 4, or 5 residues.
In an embodiment, the HNH-like domain is cleavage competent.
In an embodiment, the HNH-like domain is cleavage incompetent.
In an embodiment, an eaCas9 molecule comprises an HNH-like domain comprising an amino acid sequence of formula VII:
| (SEQ ID NO: 18) |
| X1-X2-X3-H-X4-X5-P-X6-S-X8-X9-X10-D-D-S-X14-X15-N- |
| K-V-L-X19-X20-X21-X22-X23-N, |
wherein
X1 is selected from D and E;
X2 is selected from L, I, R, Q, V, M and K;
X3 is selected from D and E;
X4 is selected from I, V, T, A and L (e.g., A, I and V);
X5 is selected from V, Y, I, L, F and W (e.g., V, I and L);
X6 is selected from Q, H, R, K, Y, I, L, F and W;
X8 is selected from F, L, V, K, Y, M, I, R, A, E, D and Q (e.g., F);
X9 is selected from L, R, T, I, V, S, C, Y, K, F and G;
X10 is selected from K, Q, Y, T, F, L, W, M, A, E, G, and S;
X14 is selected from I, L, F, S, R, Y, Q, W, D, K and H (e.g., I, L and F);
X15 is selected from D, S, I, N, E, A, H, F, L, Q, M, G, Y and V;
X19 is selected from T, V, C, E, S and A (e.g., T and V);
X20 is selected from R, F, T, W, E, L, N, C, K, V, S, Q, I, Y, H and A;
X21 is selected from S, P, R, K, N, A, H, Q, G and L;
X22 is selected from D, G, T, N, S, K, A, I, E, L, Q, R and Y; and
X23 is selected from K, V, A, E, Y, I, C, L, S, T, G, K, M, D and F.
In an embodiment, the HNH-like domain differs from a sequence of SEQ ID NO:18 by 1, 2, 3, 4, or 5 residues.
In an embodiment, an eaCas9 molecule comprises an HNH-like domain comprising an amino acid sequence of formula VII:
| (SEQ ID NO: 19) |
| X1-V-X3-H-I-V-P-X6-S-X8-X9-X10-D-D-S-X14-X15-N-K- |
| V-L-T-X20-X21-X22-X23-N, |
wherein
X1 is selected from D and E;
X3 is selected from D and E;
X6 is selected from Q, H, R, K, Y, I, L and W;
X8 is selected from F, L, V, K, Y, M, I, R, A, E, D and Q (e.g., F);
X9 is selected from L, R, T, I, V, S, C, Y, K, F and G;
X10 is selected from K, Q, Y, T, F, L, W, M, A, E, G, and S;
X14 is selected from I, L, F, S, R, Y, Q, W, D, K and H (e.g., I, L and F);
X15 is selected from D, S, I, N, E, A, H, F, L, Q, M, G, Y and V;
X20 is selected from R, F, T, W, E, L, N, C, K, V, S, Q, I, Y, H and A;
X21 is selected from S, P, R, K, N, A, H, Q, G and L;
X22 is selected from D, G, T, N, S, K, A, I, E, L, Q, R and Y; and
X23 is selected from K, V, A, E, Y, I, C, L, S, T, G, K, M, D and F.
In an embodiment, the HNH-like domain differs from a sequence of SEQ ID NO:19 by 1, 2, 3, 4, or 5 residues.
In an embodiment, an eaCas9 molecule comprises an HNH-like domain having an amino acid sequence of formula VIII:
| (SEQ ID NO: 20) |
| D-X2-D-H-I-X5-P-Q-X7-F-X9-X10-D-X12-S-I-D-N-X16- |
| V-L-X19-X20-S-X22-X23-N, |
wherein
X2 is selected from I and V;
X5 is selected from I and V;
X7 is selected from A and S;
X9 is selected from I and L;
X10 is selected from K and T;
X12 is selected from D and N;
X16 is selected from R, K and L; X19 is selected from T and V;
X20 is selected from S and R;
X22 is selected from K, D and A; and
X23 is selected from E, K, G and N (e.g., the eaCas9 molecule can comprise an HNH-like domain as described herein).
In an embodiment, the HNH-like domain differs from a sequence of SEQ ID NO:20 by as many as 1, but no more than 2, 3, 4, or 5 residues.
In an embodiment, an eaCas9 molecule comprises the amino acid sequence of formula
IX:
| (SEQ ID NO: 21) |
| L-Y-Y-L-Q-N-G-X1′-D-M-Y-X2′-X3′-X4′-X5′-L-D-I- |
| X6′-X7′-L-S-X8′-Y-Z-N-R-X9′-K-X10′-D-X11′-V-P, |
wherein
X1′ is selected from K and R;
X2′ is selected from V and T;
X3′ is selected from G and D;
X4′ is selected from E, Q and D;
X5′ is selected from E and D;
X6′ is selected from D, N and H;
X7′ is selected from Y, R and N;
X8′ is selected from Q, D and N; X9′ is selected from G and E;
X10′ is selected from S and G;
X11′ is selected from D and N; and
Z is an HNH-like domain, e.g., as described above.
In an embodiment, the eaCas9 molecule comprises an amino acid sequence that differs from a sequence of SEQ ID NO:21 by as many as 1, but no more than 2, 3, 4, or 5 residues.
In an embodiment, the HNH-like domain differs from a sequence of an HNH-like domain disclosed herein, e.g., in FIG. 4A or FIG. 5, as many as 1, but no more than 2, 3, 4, or 5 residues.
In an embodiment, the HNH-like domain differs from a sequence of an HNH-like domain disclosed herein, e.g., in FIG. 4B, by as many as 1, but no more than 2, 3, 4, or 5 residues. In an embodiment, 1, 2, all 3 of the highly conserved residues identified in FIG. 4B are present.
Altered Cas9 Molecules
Naturally occurring Cas9 molecules possess a number of properties, including: nickase activity, nuclease activity (e.g., endonuclease and/or exonuclease activity); helicase activity; the ability to associate functionally with a gRNA molecule; and the ability to target (or localize to) a site on a nucleic acid (e.g., PAM recognition and specificity). In an embodiment, a Cas9 molecules can include all or a subset of these properties. In a typical embodiment, Cas9 molecules have the ability to interact with a gRNA molecule and, in concert with the gRNA molecule, localize to a site in a nucleic acid. Other activities, e.g., PAM specificity, cleavage activity, or helicase activity can vary more widely in Cas9 molecules.
Cas9 molecules with desired properties can be made in a number of ways, e.g., by alteration of a parental, e.g., naturally occurring Cas9 molecules to provide an altered Cas9 molecule having a desired property. For example, one or more mutations or differences relative to a parental Cas9 molecule can be introduced. Such mutations and differences comprise: substitutions (e.g., conservative substitutions or substitutions of non-essential amino acids); insertions; or deletions. In an embodiment, a Cas9 molecule can comprises one or more mutations or differences, e.g., at least 1, 2, 3, 4, 5, 10, 15, 20, 30, 40 or 50 mutations but less than 200, 100, or 80 mutations relative to a reference Cas9 molecule.
In an embodiment, a mutation or mutations do not have a substantial effect on a Cas9 activity, e.g. a Cas9 activity described herein. In an embodiment, a mutation or mutations have a substantial effect on a Cas9 activity, e.g. a Cas9 activity described herein. In an embodiment, exemplary activities comprise one or more of PAM specificity, cleavage activity, and helicase activity. A mutation(s) can be present, e.g., in: one or more RuvC-like domain, e.g., an N-terminal RuvC-like domain; an HNH-like domain; a region outside the RuvC-like domains and the HNH-like domain. In an embodiment, a mutation(s) is present in an N-terminal RuvC-like domain. In an embodiment, a mutation(s) is present in an HNH-like domain. In an embodiment, mutations are present in both an N-terminal RuvC-like domain and an HNH-like domain.
Whether or not a particular sequence, e.g., a substitution, may affect one or more activity, such as targeting activity, cleavage activity, etc, can be evaluated or predicted, e.g., by evaluating whether the mutation is conservative or by the method described in Section III. In an embodiment, a “non-essential” amino acid residue, as used in the context of a Cas9 molecule, is a residue that can be altered from the wild-type sequence of a Cas9 molecule, e.g., a naturally occurring Cas9 molecule, e.g., an eaCas9 molecule, without abolishing or more preferably, without substantially altering a Cas9 activity (e.g., cleavage activity), whereas changing an “essential” amino acid residue results in a substantial loss of activity (e.g., cleavage activity).
In an embodiment, the altered Cas9 molecule is an eaCas9 molecule comprising the fixed amino acid residues of S. pyogenes shown in the consensus sequence disclosed in FIG. 2, and has one or more amino acids that differ from the amino acid sequence of S. pyogenes (e.g., has a substitution) at one or more residue (e.g., 2, 3, 5, 10, 15, 20, 30, 50, 70, 80, 90, 100, 200 amino acid residues) represented by an “-” in the consensus sequence disclosed in FIG. 2 or SEQ ID NO:7. In an embodiment, the altered Cas9 molecule is an eiCas9 molecule wherein one or more of the fixed amino acid residues of S. pyogenes shown in the consensus sequence disclosed in FIG. 2 (e.g., 2, 3, 5, 10, 15, 20, 30, 50, 70, 80, 90, 100, 200 amino acid residues) is mutated.
In an embodiment, the altered Cas9 molecule comprises a sequence in which:
the sequence corresponding to the fixed sequence of the consensus sequence disclosed in FIG. 2 differs at no more than 1, 2, 3, 4, 5, 10, 15, or 20% of the fixed residues in the consensus sequence disclosed in FIG. 2;
the sequence corresponding to the residues identified by “*” in the consensus sequence disclosed in FIG. 2 differ at no more than 1, 2, 3, 4, 5, 10, 15, 20, 25, 30, 35, or 40% of the “*” residues from the corresponding sequence of naturally occurring Cas9 molecule, e.g., an S. pyogenes Cas9 molecule; and,
the sequence corresponding to the residues identified by “-” in the consensus sequence disclosed in FIG. 2 differ at no more than 5, 10, 15, 20, 25, 30, 35, 40, 45, 55, or 60% of the “-” residues from the corresponding sequence of naturally occurring Cas9 molecule, e.g., an S. pyogenes Cas9 molecule.
In an embodiment, the altered Cas9 molecule is an eaCas9 molecule comprising the fixed amino acid residues of S. thermophilus shown in the consensus sequence disclosed in FIG. 2, and has one or more amino acids that differ from the amino acid sequence of S. thermophilus (e.g., has a substitution) at one or more residue (e.g., 2, 3, 5, 10, 15, 20, 30, 50, 70, 80, 90, 100, 200 amino acid residues) represented by an “-” in the consensus sequence disclosed in FIG. 2. In an embodiment, the altered Cas9 molecule is an eiCas9 molecule wherein one or more of the fixed amino acid residues of S. thermophilus shown in the consensus sequence disclosed in FIG. 2 (e.g., 2, 3, 5, 10, 15, 20, 30, 50, 70, 80, 90, 100, 200 amino acid residues) is mutated.
In an embodiment the altered Cas9 molecule comprises a sequence in which:
the sequence corresponding to the fixed sequence of the consensus sequence disclosed in FIG. 2 differs at no more than 1, 2, 3, 4, 5, 10, 15, or 20% of the fixed residues in the consensus sequence disclosed in FIG. 2;
the sequence corresponding to the residues identified by “*” in the consensus sequence disclosed in FIG. 2 differ at no more than 1, 2, 3, 4, 5, 10, 15, 20, 25, 30, 35, or 40% of the “*” residues from the corresponding sequence of naturally occurring Cas9 molecule, e.g., an S. thermophilus Cas9 molecule; and, the sequence corresponding to the residues identified by “-” in the consensus sequence disclosed in FIG. 2 differ at no more than 5, 10, 15, 20, 25, 30, 35, 40, 45, 55, or 60% of the “-” residues from the corresponding sequence of naturally occurring Cas9 molecule, e.g., an S. thermophilus Cas9 molecule.
In an embodiment, the altered Cas9 molecule is an eaCas9 molecule comprising the fixed amino acid residues of S. mutans shown in the consensus sequence disclosed in FIG. 2, and has one or more amino acids that differ from the amino acid sequence of S. mutans (e.g., has a substitution) at one or more residue (e.g., 2, 3, 5, 10, 15, 20, 30, 50, 70, 80, 90, 100, 200 amino acid residues) represented by an “-” in the consensus sequence disclosed in FIG. 2. In an embodiment, the altered Cas9 molecule is an eiCas9 molecule wherein one or more of the fixed amino acid residues of S. mutans shown in the consensus sequence disclosed in FIG. 2 (e.g., 2, 3, 5, 10, 15, 20, 30, 50, 70, 80, 90, 100, 200 amino acid residues) is mutated.
In an embodiment the altered Cas9 molecule comprises a sequence in which:
the sequence corresponding to the fixed sequence of the consensus sequence disclosed in FIG. 2 differs at no more than 1, 2, 3, 4, 5, 10, 15, or 20% of the fixed residues in the consensus sequence disclosed in FIG. 2;
the sequence corresponding to the residues identified by “*” in the consensus sequence disclosed in FIG. 2 differ at no more than 1, 2, 3, 4, 5, 10, 15, 20, 25, 30, 35, or 40% of the “*” residues from the corresponding sequence of naturally occurring Cas9 molecule, e.g., an S. mutans Cas9 molecule; and, the sequence corresponding to the residues identified by “-” in the consensus sequence disclosed in FIG. 2 differ at no more than 5, 10, 15, 20, 25, 30, 35, 40, 45, 55, or 60% of the “-” residues from the corresponding sequence of naturally occurring Cas9 molecule, e.g., an S. mutans Cas9 molecule.
In an embodiment, the altered Cas9 molecule is an eaCas9 molecule comprising the fixed amino acid residues of L. innocula shown in the consensus sequence disclosed in FIG. 2, and has one or more amino acids that differ from the amino acid sequence of L. innocula (e.g., has a substitution) at one or more residue (e.g., 2, 3, 5, 10, 15, 20, 30, 50, 70, 80, 90, 100, 200 amino acid residues) represented by an “-” in the consensus sequence disclosed in FIG. 2. In an embodiment, the altered Cas9 molecule is an eiCas9 molecule wherein one or more of the fixed amino acid residues of L. innocula shown in the consensus sequence disclosed in FIG. 2 (e.g., 2, 3, 5, 10, 15, 20, 30, 50, 70, 80, 90, 100, 200 amino acid residues) is mutated.
In an embodiment the altered Cas9 molecule comprises a sequence in which:
the sequence corresponding to the fixed sequence of the consensus sequence disclosed in FIG. 2 differs at no more than 1, 2, 3, 4, 5, 10, 15, or 20% of the fixed residues in the consensus sequence disclosed in FIG. 2;
the sequence corresponding to the residues identified by “*” in the consensus sequence disclosed in FIG. 2 differ at no more than 1, 2, 3, 4, 5, 10, 15, 20, 25, 30, 35, or 40% of the “*” residues from the corresponding sequence of naturally occurring Cas9 molecule, e.g., an L. innocula Cas9 molecule; and,
the sequence corresponding to the residues identified by “-” in the consensus sequence disclosed in FIG. 2 differ at no more than 5, 10, 15, 20, 25, 30, 35, 40, 45, 55, or 60% of the “-” residues from the corresponding sequence of naturally occurring Cas9 molecule, e.g., an L. innocula Cas9 molecule.
In an embodiment, the altered Cas9 molecule, e.g., an eaCas9 molecule or an eiCas9 molecule, can be a fusion, e.g., of two of more different Cas9 molecules, e.g., of two or more naturally occurring Cas9 molecules of different species. For example, a fragment of a naturally occurring Cas9 molecule of one species can be fused to a fragment of a Cas9 molecule of a second species. As an example, a fragment of Cas9 of S. pyogenes comprising an N-terminal RuvC-like domain can be fused to a fragment of Cas9 of a species other than S. pyogenes (e.g., S. therrnophilus) comprising an HNH-like domain.
Cas9 Molecules with Altered PAM Recognition or No PAM Recognition
Naturally occurring Cas9 molecules can recognize specific PAM sequences, for example the PAM recognition sequences described above for S. pyogenes, S. therrnophilus, S. mutans, S. aureus and N. meningitidis.
In an embodiment, a Cas9 molecule has the same PAM specificities as a naturally occurring Cas9 molecule. In an embodiment, a Cas9 molecule has a PAM specificity not associated with a naturally occurring Cas9 molecule, or a PAM specificity not associated with the naturally occurring Cas9 molecule to which it has the closest sequence homology. For example, a naturally occurring Cas9 molecule can be altered, e.g., to alter PAM recognition, e.g., to alter the PAM sequence that the Cas9 molecule recognizes to decrease off target sites and/or improve specificity; or eliminate a PAM recognition requirement. In an embodiment, a Cas9 molecule can be altered, e.g., to increase length of PAM recognition sequence and/or improve Cas9 specificity to high level of identity to decrease off target sites and increase specificity. In an embodiment, the length of the PAM recognition sequence is at least 4, 5, 6, 7, 8, 9, 10 or 15 amino acids in length. Cas9 molecules that recognize different PAM sequences and/or have reduced off-target activity can be generated using directed evolution. Exemplary methods and systems that can be used for directed evolution of Cas9 molecules are described, e.g., in Esvelt et al., NATURE 2011, 472(7344): 499-503. Candidate Cas9 molecules can be evaluated, e.g., by methods described in Section III.
Non-Cleaving and Modified-Cleavage Cas9 Molecules
In an embodiment, a Cas9 molecule comprises a cleavage property that differs from naturally occurring Cas9 molecules, e.g., that differs from the naturally occurring Cas9 molecule having the closest homology. For example, a Cas9 molecule can differ from naturally occurring Cas9 molecules, e.g., a Cas9 molecule of S. pyogenes, as follows: its ability to modulate, e.g., decreased or increased, cleavage of a double stranded break (endonuclease and/or exonuclease activity), e.g., as compared to a naturally occurring Cas9 molecule (e.g., a Cas9 molecule of S. pyogenes); its ability to modulate, e.g., decreased or increased, cleavage of a single strand of a nucleic acid, e.g., a non-complimentary strand of a nucleic acid molecule or a complementary strand of a nucleic acid molecule (nickase activity), e.g., as compared to a naturally occurring Cas9 molecule (e.g., a Cas9 molecule of S. pyogenes); or the ability to cleave a nucleic acid molecule, e.g., a double stranded or single stranded nucleic acid molecule, can be eliminated.
Modified Cleavage eaCas9 Molecules
In an embodiment, an eaCas9 molecule comprises one or more of the following activities: cleavage activity associated with an N-terminal RuvC-like domain; cleavage activity associated with an HNH-like domain; cleavage activity associated with an HNH domain and cleavage activity associated with an N-terminal RuvC-like domain.
In an embodiment an eaCas9 molecule comprises an active, or cleavage competent, HNH-like domain (e.g., an HNH-like domain described herein, e.g., SEQ ID NO:17, SEQ ID NO:18, SEQ ID NO:19, SEQ ID NO:20 or SEQ ID NO:21) and an inactive, or cleavage incompetent, N-terminal RuvC-like domain. An exemplary inactive, or cleavage incompetent N-terminal RuvC-like domain can have a mutation of an aspartic acid in an N-terminal RuvC-like domain, e.g., an aspartic acid at position 9 of the consensus sequence disclosed in FIG. 2 or an aspartic acid at position 10 of SEQ ID NO:7, e.g., can be substituted with an alanine. In an embodiment, the eaCas9 differs from wild type in the N-terminal RuvC-like domain and does not cleave the target nucleic acid, or cleaves with significantly less efficiency, e.g., less than 20, 10, 5, 1 or 0.1% of the cleavage activity of a reference Cas9 molecule, e.g., as measured by an assay described herein. The reference Cas9 molecule can by a naturally occurring unmodified Cas9 molecule, e.g., a naturally occurring Cas9 molecule such as a Cas9 molecule of S. pyogenes, or S. thermophilus. In an embodiment, the reference Cas9 molecule is the naturally occurring Cas9 molecule having the closest sequence identity or homology.
In an embodiment, an eaCas9 molecule comprises an inactive, or cleavage incompetent, HNH domain and an active, or cleavage competent, N-terminal RuvC-like domain (e.g., an HNH-like domain described herein, e.g., SEQ ID NO:8, SEQ ID NO:9, SEQ ID NO:10, SEQ ID NO:11, SEQ ID NO:12, SEQ ID NO:13, SEQ ID NO:14 or SEQ ID NO:15). Exemplary inactive, or cleavage incompetent HNH-like domains can have a mutation at one or more of: a histidine in an HNH-like domain, e.g., a histidine at position 856 of the consensus sequence disclosed in FIG. 2, e.g., can be substituted with an alanine; and one or more asparagines in an HNH-like domain, e.g., an asparagine at position 870 of the consensus sequence disclosed in FIG. 2 and/or at position 879 of the consensus sequence disclosed in FIG. 2, e.g., can be substituted with an alanine. In an embodiment, the eaCas9 differs from wild type in the HNH-like domain and does not cleave the target nucleic acid, or cleaves with significantly less efficiency, e.g., less than 20, 10, 5, 1 or 0.1% of the cleavage activity of a reference Cas9 molecule, e.g., as measured by an assay described herein. The reference Cas9 molecule can by a naturally occurring unmodified Cas9 molecule, e.g., a naturally occurring Cas9 molecule such as a Cas9 molecule of S. pyogenes, or S. thermophilus. In an embodiment, the reference Cas9 molecule is the naturally occurring Cas9 molecule having the closest sequence identity or homology.
Non-Cleaving eiCas9 Molecules
In an embodiment, the altered Cas9 molecule is an eiCas9 molecule which does not cleave a nucleic acid molecule (either double stranded or single stranded nucleic acid molecules) or cleaves a nucleic acid molecule with significantly less efficiency, e.g., less than 20, 10, 5, 1 or 0.1% of the cleavage activity of a reference Cas9 molecule, e.g., as measured by an assay described herein. The reference Cas9 molecule can by a naturally occurring unmodified Cas9 molecule, e.g., a naturally occurring Cas9 molecule such as a Cas9 molecule of S. pyogenes, S. thermophilus, S. aureus or N. meningitidis. In an embodiment, the reference Cas9 molecule is the naturally occurring Cas9 molecule having the closest sequence identity or homology. In an embodiment, the eiCas9 molecule lacks substantial cleavage activity associated with an N-terminal RuvC-like domain and cleavage activity associated with an HNH-like domain.
In an embodiment, an eiCas9 molecule comprises an inactive, or cleavage incompetent, N-terminal RuvC-like domain. An exemplary inactive, or cleavage incompetent N-terminal RuvC-like domain can have a mutation of an aspartic acid in an N-terminal RuvC-like domain, e.g., an aspartic acid at position 9 of the consensus sequence disclosed in FIG. 2 or an aspartic acid at position 10 of SEQ ID NO:7, e.g., can be substituted with an alanine.
In an embodiment an eiCas9 molecule comprises an inactive, or cleavage incompetent, HNH domain (e.g., an HNH-like domain described herein, e.g., SEQ ID NO:8, SEQ ID NO:9, SEQ ID NO:10, SEQ ID NO:11, SEQ ID NO:12, SEQ ID NO:13, SEQ ID NO:14 or SEQ ID NO:15). Exemplary inactive, or cleavage incompetent HNH-like domains can have a mutation at one or more of: a histidine in an HNH-like domain, e.g., a histidine at position 856 of the consensus sequence disclosed in FIG. 2, e.g., can be substituted with an alanine; and one or more asparagines in an HNH-like domain, e.g., an asparagine at position 870 of the consensus sequence disclosed in FIG. 2 and/or at position 879 of the consensus sequence disclosed in FIG. 2, e.g., can be substituted with an alanine.
A catalytically inactive Cas9 molecule may be fused with a transcription repressor. An eiCas9 fusion protein complexes with a gRNA and localizes to a DNA sequence specified by gRNA's targeting domain, but, unlike an eaCas9, it will not cleave the target DNA. Fusion of an effector domain, such as a transcriptional repression domain, to an eiCas9 enables recruitment of the effector to any DNA site specified by the gRNA. Site specific targeting of an eiCas9 or an eiCas9 fusion protein to a promoter region of a gene can block RNA polymerase binding to the promoter region, a transcription factor (e.g., a transcription activator) and/or a transcriptional enhancer to inhibit transcription activation. Alternatively, site specific targeting of an eiCas9-fusion to a transcription repressor to a promoter region of a gene can be used to decrease transcription activation.
Transcription repressors or transcription repressor domains that may be fused to an eiCas9 molecule can include Krüppel associated box (KRAB or SKD), the Mad mSIN3 interaction domain (SID) or the ERF repressor domain (ERD).
In another embodiment, an eiCas9 molecule may be fused with a protein that modifies chromatin. For example, an eiCas9 molecule may be fused to heterochromatin protein 1 (HP1), a histone lysine methyltransferase (e.g., SUV39H1, SUV39H2, G9A, ESET/SETDB1, Pr-SET7/8, SUV4-20H1, RIZ1), a histone lysine demethylates (e.g., LSD1/BHC110, SpLsd1/Sw,1/Saf110, Su(var)3-3, JMJD2A/JHDM3A, JMJD2B, JMJD2C/GASC1, JMJD2D, Rph1, JARID1A/RBP2, JAR1D1B/PLU-1, JAR1D1C/SMCX, JAR1D1D/SMCY, Lid, Jhn2, Jmj2), a histone lysine deacetylases (e.g., HDAC1, HDAC2, HDAC3, HDAC8, Rpd3, Hos1, Cir6, HDAC4, HDAC5, HDAC7, HDAC9, Hda1, Cir3, SIRT1, SIRT2, Sir2, Hst1, Hst2, Hst3, Hst4, HDAC11) and a DNA methylases (DNMT1, DNMT2a/DMNT3b, MET1). An eiCas9-chomatin modifying molecule fusion protein can be used to alter chromatin status to reduce expression a target gene.
The heterologous sequence (e.g., the transcription repressor domain) may be fused to the N- or C-terminus of the eiCas9 protein. In an alternative embodiment, the heterologous sequence (e.g., the transcription repressor domain) may be fused to an internal portion (i.e., a portion other than the N-terminus or C-terminus) of the eiCas9 protein.
The ability of a Cas9 molecule/gRNA molecule complex to bind to and cleave a target nucleic acid can be evaluated, e.g., by the methods described herein in Section III. The activity of a Cas9 molecule, either an eaCas9 or a eiCas9, alone or in a complex with a gRNA molecule may also be evaluated by methods well-known in the art, including, gene expression assays and chromatin-based assays, e.g., chromatin immunoprecipitation (ChiP) and chromatin in vivo assay (CiA).
Nucleic Acids Encoding Cas9 Molecules
Nucleic acids encoding the Cas9 molecules, e.g., an eaCas9 molecule or an eiCas9 molecule are provided herein.
Exemplary nucleic acids encoding Cas9 molecules are described in Cong et al., SCIENCE 2013, 399(6121):819-823; Wang et al., CELL 2013, 153(4):910-918; Mali et al., SCIENCE 2013, 399(6121):823-826; Jinek et al., SCIENCE 2012, 337(6096):816-821. Another exemplary nucleic acid encoding a Cas9 molecule of N. meningitidis is shown in FIG. 6.
In an embodiment, a nucleic acid encoding a Cas9 molecule can be a synthetic nucleic acid sequence. For example, the synthetic nucleic acid molecule can be chemically modified, e.g., as described in Section X. In an embodiment, the Cas9 mRNA has one or more of, e.g., all of the following properties: it is capped, polyadenylated, substituted with 5-methylcytidine and/or pseudouridine.
In addition or alternatively, the synthetic nucleic acid sequence can be codon optimized, e.g., at least one non-common codon or less-common codon has been replaced by a common codon. For example, the synthetic nucleic acid can direct the synthesis of an optimized messenger mRNA, e.g., optimized for expression in a mammalian expression system, e.g., described herein.
In addition, or alternatively, a nucleic acid encoding a Cas9 molecule may comprise a nuclear localization sequence (NLS). Nuclear localization sequences are known in the art.
Provided below is an exemplary codon optimized nucleic acid sequence encoding a Cas9 molecule of S. pyogenes.
| (SEQ ID NO: 22) | |
| ATGGATAAAA AGTACAGCAT CGGGCTGGAC ATCGGTACAA | |
| ACTCAGTGGG GTGGGCCGTG ATTACGGACG AGTACAAGGT | |
| ACCCTCCAAA AAATTTAAAG TGCTGGGTAA CACGGACAGA | |
| CACTCTATAA AGAAAAATCT TATTGGAGCC TTGCTGTTCG | |
| ACTCAGGCGA GACAGCCGAA GCCACAAGGT TGAAGCGGAC | |
| CGCCAGGAGG CGGTATACCA GGAGAAAGAA CCGCATATGC | |
| TACCTGCAAG AAATCTTCAG TAACGAGATG GCAAAGGTTG | |
| ACGATAGCTT TTTCCATCGC CTGGAAGAAT CCTTTCTTGT | |
| TGAGGAAGAC AAGAAGCACG AACGGCACCC CATCTTTGGC | |
| AATATTGTCG ACGAAGTGGC ATATCACGAA AAGTACCCGA | |
| CTATCTACCA CCTCAGGAAG AAGCTGGTGG ACTCTACCGA | |
| TAAGGCGGAC CTCAGACTTA TTTATTTGGC ACTCGCCCAC | |
| ATGATTAAAT TTAGAGGACA TTTCTTGATC GAGGGCGACC | |
| TGAACCCGGA CAACAGTGAC GTCGATAAGC TGTTCATCCA | |
| ACTTGTGCAG ACCTACAATC AACTGTTCGA AGAAAACCCT | |
| ATAAATGCTT CAGGAGTCGA CGCTAAAGCA ATCCTGTCCG | |
| CGCGCCTCTC AAAATCTAGA AGACTTGAGA ATCTGATTGC | |
| TCAGTTGCCC GGGGAAAAGA AAAATGGATT GTTTGGCAAC | |
| CTGATCGCCC TCAGTCTCGG ACTGACCCCA AATTTCAAAA | |
| GTAACTTCGA CCTGGCCGAA GACGCTAAGC TCCAGCTGTC | |
| CAAGGACACA TACGATGACG ACCTCGACAA TCTGCTGGCC | |
| CAGATTGGGG ATCAGTACGC CGATCTCTTT TTGGCAGCAA | |
| AGAACCTGTC CGACGCCATC CTGTTGAGCG ATATCTTGAG | |
| AGTGAACACC GAAATTACTA AAGCACCCCT TAGCGCATCT | |
| ATGATCAAGC GGTACGACGA GCATCATCAG GATCTGACCC | |
| TGCTGAAGGC TCTTGTGAGG CAACAGCTCC CCGAAAAATA | |
| CAAGGAAATC TTCTTTGACC AGAGCAAAAA CGGCTACGCT | |
| GGCTATATAG ATGGTGGGGC CAGTCAGGAG GAATTCTATA | |
| AATTCATCAA GCCCATTCTC GAGAAAATGG ACGGCACAGA | |
| GGAGTTGCTG GTCAAACTTA ACAGGGAGGA CCTGCTGCGG | |
| AAGCAGCGGA CCTTTGACAA CGGGTCTATC CCCCACCAGA | |
| TTCATCTGGG CGAACTGCAC GCAATCCTGA GGAGGCAGGA | |
| GGATTTTTAT CCTTTTCTTA AAGATAACCG CGAGAAAATA | |
| GAAAAGATTC TTACATTCAG GATCCCGTAC TACGTGGGAC | |
| CTCTCGCCCG GGGCAATTCA CGGTTTGCCT GGATGACAAG | |
| GAAGTCAGAG GAGACTATTA CACCTTGGAA CTTCGAAGAA | |
| GTGGTGGACA AGGGTGCATC TGCCCAGTCT TTCATCGAGC | |
| GGATGACAAA TTTTGACAAG AACCTCCCTA ATGAGAAGGT | |
| GCTGCCCAAA CATTCTCTGC TCTACGAGTA CTTTACCGTC | |
| TACAATGAAC TGACTAAAGT CAAGTACGTC ACCGAGGGAA | |
| TGAGGAAGCC GGCATTCCTT AGTGGAGAAC AGAAGAAGGC | |
| GATTGTAGAC CTGTTGTTCA AGACCAACAG GAAGGTGACT | |
| GTGAAGCAAC TTAAAGAAGA CTACTTTAAG AAGATCGAAT | |
| GTTTTGACAG TGTGGAAATT TCAGGGGTTG AAGACCGCTT | |
| CAATGCGTCA TTGGGGACTT ACCATGATCT TCTCAAGATC | |
| ATAAAGGACA AAGACTTCCT GGACAACGAA GAAAATGAGG | |
| ATATTCTCGA AGACATCGTC CTCACCCTGA CCCTGTTCGA | |
| AGACAGGGAA ATGATAGAAG AGCGCTTGAA AACCTATGCC | |
| CACCTCTTCG ACGATAAAGT TATGAAGCAG CTGAAGCGCA | |
| GGAGATACAC AGGATGGGGA AGATTGTCAA GGAAGCTGAT | |
| CAATGGAATT AGGGATAAAC AGAGTGGCAA GACCATACTG | |
| GATTTCCTCA AATCTGATGG CTTCGCCAAT AGGAACTTCA | |
| TGCAACTGAT TCACGATGAC TCTCTTACCT TCAAGGAGGA | |
| CATTCAAAAG GCTCAGGTGA GCGGGCAGGG AGACTCCCTT | |
| CATGAACACA TCGCGAATTT GGCAGGTTCC CCCGCTATTA | |
| AAAAGGGCAT CCTTCAAACT GTCAAGGTGG TGGATGAATT | |
| GGTCAAGGTA ATGGGCAGAC ATAAGCCAGA AAATATTGTG | |
| ATCGAGATGG CCCGCGAAAA CCAGACCACA CAGAAGGGCC | |
| AGAAAAATAG TAGAGAGCGG ATGAAGAGGA TCGAGGAGGG | |
| CATCAAAGAG CTGGGATCTC AGATTGTCAA AGAACACCCC | |
| GTAGAAAACA CACAGCTGCA GAACGAAAAA TTGTACTTGT | |
| ACTATCTGCA GAACGGCAGA GACATGTACG TCGACCAAGA | |
| ACTTGATATT AATAGACTGT CCGACTATGA CGTAGACCAT | |
| ATCGTGCCCC AGTCCTTCCT GAAGGACGAC TCCATTGATA | |
| ACAAAGTCTT GACAAGAAGC GACAAGAACA GGGGTAAAAG | |
| TGATAATGTG CCTAGCGAGG AGGTGGTGAA AAAAATGAAG | |
| AACTACTGGC GACAGCTGCT TAATGCAAAG CTCATTACAC | |
| AACGGAAGTT CGATAATCTG ACGAAAGCAG AGAGAGGTGG | |
| CTTGTCTGAG TTGGACAAGG CAGGGTTTAT TAAGCGGCAG | |
| CTGGTGGAAA CTAGGCAGAT CACAAAGCAC GTGGCGCAGA | |
| TTTTGGACAG CCGGATGAAC ACAAAATACG ACGAAAATGA | |
| TAAACTGATA CGAGAGGTCA AAGTTATCAC GCTGAAAAGC | |
| AAGCTGGTGT CCGATTTTCG GAAAGACTTC CAGTTCTACA | |
| AAGTTCGCGA GATTAATAAC TACCATCATG CTCACGATGC | |
| GTACCTGAAC GCTGTTGTCG GGACCGCCTT GATAAAGAAG | |
| TACCCAAAGC TGGAATCCGA GTTCGTATAC GGGGATTACA | |
| AAGTGTACGA TGTGAGGAAA ATGATAGCCA AGTCCGAGCA | |
| GGAGATTGGA AAGGCCACAG CTAAGTACTT CTTTTATTCT | |
| AACATCATGA ATTTTTTTAA GACGGAAATT ACCCTGGCCA | |
| ACGGAGAGAT CAGAAAGCGG CCCCTTATAG AGACAAATGG | |
| TGAAACAGGT GAAATCGTCT GGGATAAGGG CAGGGATTTC | |
| GCTACTGTGA GGAAGGTGCT GAGTATGCCA CAGGTAAATA | |
| TCGTGAAAAA AACCGAAGTA CAGACCGGAG GATTTTCCAA | |
| GGAAAGCATT TTGCCTAAAA GAAACTCAGA CAAGCTCATC | |
| GCCCGCAAGA AAGATTGGGA CCCTAAGAAA TACGGGGGAT | |
| TTGACTCACC CACCGTAGCC TATTCTGTGC TGGTGGTAGC | |
| TAAGGTGGAA AAAGGAAAGT CTAAGAAGCT GAAGTCCGTG | |
| AAGGAACTCT TGGGAATCAC TATCATGGAA AGATCATCCT | |
| TTGAAAAGAA CCCTATCGAT TTCCTGGAGG CTAAGGGTTA | |
| CAAGGAGGTC AAGAAAGACC TCATCATTAA ACTGCCAAAA | |
| TACTCTCTCT TCGAGCTGGA AAATGGCAGG AAGAGAATGT | |
| TGGCCAGCGC CGGAGAGCTG CAAAAGGGAA ACGAGCTTGC | |
| TCTGCCCTCC AAATATGTTA ATTTTCTCTA TCTCGCTTCC | |
| CACTATGAAA AGCTGAAAGG GTCTCCCGAA GATAACGAGC | |
| AGAAGCAGCT GTTCGTCGAA CAGCACAAGC ACTATCTGGA | |
| TGAAATAATC GAACAAATAA GCGAGTTCAG CAAAAGGGTT | |
| ATCCTGGCGG ATGCTAATTT GGACAAAGTA CTGTCTGCTT | |
| ATAACAAGCA CCGGGATAAG CCTATTAGGG AACAAGCCGA | |
| GAATATAATT CACCTCTTTA CACTCACGAA TCTCGGAGCC | |
| CCCGCCGCCT TCAAATACTT TGATACGACT ATCGACCGGA | |
| AACGGTATAC CAGTACCAAA GAGGTCCTCG ATGCCACCCT | |
| CATCCACCAG TCAATTACTG GCCTGTACGA AACACGGATC | |
| GACCTCTCTC AACTGGGCGG CGACTAG |
Provided below is the corresponding amino acid sequence of a S. pyogenes Cas9 molecule.
| (SEQ ID NO: 23) |
| MDKKYSIGLDIGTNSVGWAVITDEYKVPSKKFKVLGNTDRHSIKKNLIG |
| ALLFDSGETAEATRLKRTARRRYTRRKNRICYLQEIFSNEMAKVDDSFF |
| HRLEESFLVEEDKKHERHPIFGNIVDEVAYHEKYPTIYHLRKKLVDSTD |
| KADLRLIYLALAHMIKFRGHFLIEGDLNPDNSDVDKLFIQLVQTYNQLF |
| EENPINASGVDAKAILSARLSKSRRLENLIAQLPGEKKNGLFGNLIALS |
| LGLTPNFKSNFDLAEDAKLQLSKDTYDDDLDNLLAQIGDQYADLFLAAK |
| NLSDAILLSDILRVNTEITKAPLSASMIKRYDEHHQDLTLLKALVRQQL |
| PEKYKEIFFDQSKNGYAGYIDGGASQEEFYKFIKPILEKMDGTEELLVK |
| LNREDLLRKQRTFDNGSIPHQIHLGELHAILRRQEDFYPFLKDNREKIE |
| KILTFRIPYYVGPLARGNSRFAWMTRKSEETITPWNFEEVVDKGASAQS |
| FIERMTNFDKNLPNEKVLPKHSLLYEYFTVYNELTKVKYVTEGMRKPAF |
| LSGEQKKAIVDLLFKTNRKVTVKQLKEDYFKKIECFDSVEISGVEDRFN |
| ASLGTYHDLLKIIKDKDFLDNEENEDILEDIVLTLTLFEDREMIEERLK |
| TYAHLFDDKVMKQLKRRRYTGWGRLSRKLINGIRDKQSGKTILDFLKSD |
| GFANRNFMQLIHDDSLTFKEDIQKAQVSGQGDSLHEHIANLAGSPAIKK |
| GILQTVKVVDELVKVMGRHKPENIVIEMARENQTTQKGQKNSRERMKRI |
| EEGIKELGSQILKEHPVENTQLQNEKLYLYYLQNGRDMYVDQELDINRL |
| SDYDVDHIVPQSFLKDDSIDNKVLTRSDKNRGKSDNVPSEEVVKKMKNY |
| WRQLLNAKLITQRKFDNLTKAERGGLSELDKAGFIKRQLVETRQITKHV |
| AQILDSRMNTKYDENDKLIREVKVITLKSKLVSDFRKDFQFYKVREINN |
| YHHAHDAYLNAVVGTALIKKYPKLESEFVYGDYKVYDVRKMIAKSEQEI |
| GKATAKYFFYSNIMNFFKTEITLANGEIRKRPLIETNGETGEIVWDKGR |
| DFATVRKVLSMPQVNIVKKTEVQTGGFSKESILPKRNSDKLIARKKDWD |
| PKKYGGFDSPTVAYSVLVVAKVEKGKSKKLKSVKELLGITIMERSSFEK |
| NPIDFLEAKGYKEVKKDLIIKLPKYSLFELENGRKRMLASAGELQKGNE |
| LALPSKYVNFLYLASHYEKLKGSPEDNEQKQLFVEQHKHYLDEIIEQIS |
| EFSKRVILADANLDKVLSAYNKHRDKPIREQAENIIHLFTLTNLGAPAA |
| FKYFDTTIDRKRYTSTKEVLDATLIHQSITGLYETRIDLSQLGGD* |
Provided below is an exemplary codon optimized nucleic acid sequence encoding a Cas9 molecule of N. meningitidis.
| (SEQ ID NO: 24) |
| ATGGCCGCCTTCAAGCCCAACCCCATCAACTACATCCTGGGCCTGGACA |
| TCGGCATCGCCAGCGTGGGCTGGGCCATGGTGGAGATCGACGAGGACGA |
| GAACCCCATCTGCCTGATCGACCTGGGTGTGCGCGTGTTCGAGCGCGCT |
| GAGGTGCCCAAGACTGGTGACAGTCTGGCTATGGCTCGCCGGCTTGCTC |
| GCTCTGTTCGGCGCCTTACTCGCCGGCGCGCTCACCGCCTTCTGCGCGC |
| TCGCCGCCTGCTGAAGCGCGAGGGTGTGCTGCAGGCTGCCGACTTCGAC |
| GAGAACGGCCTGATCAAGAGCCTGCCCAACACTCCTTGGCAGCTGCGCG |
| CTGCCGCTCTGGACCGCAAGCTGACTCCTCTGGAGTGGAGCGCCGTGCT |
| GCTGCACCTGATCAAGCACCGCGGCTACCTGAGCCAGCGCAAGAACGAG |
| GGCGAGACCGCCGACAAGGAGCTGGGTGCTCTGCTGAAGGGCGTGGCCG |
| ACAACGCCCACGCCCTGCAGACTGGTGACTTCCGCACTCCTGCTGAGCT |
| GGCCCTGAACAAGTTCGAGAAGGAGAGCGGCCACATCCGCAACCAGCGC |
| GGCGACTACAGCCACACCTTCAGCCGCAAGGACCTGCAGGCCGAGCTGA |
| TCCTGCTGTTCGAGAAGCAGAAGGAGTTCGGCAACCCCCACGTGAGCGG |
| CGGCCTGAAGGAGGGCATCGAGACCCTGCTGATGACCCAGCGCCCCGCC |
| CTGAGCGGCGACGCCGTGCAGAAGATGCTGGGCCACTGCACCTTCGAGC |
| CAGCCGAGCCCAAGGCCGCCAAGAACACCTACACCGCCGAGCGCTTCAT |
| CTGGCTGACCAAGCTGAACAACCTGCGCATCCTGGAGCAGGGCAGCGAG |
| CGCCCCCTGACCGACACCGAGCGCGCCACCCTGATGGACGAGCCCTACC |
| GCAAGAGCAAGCTGACCTACGCCCAGGCCCGCAAGCTGCTGGGTCTGGA |
| GGACACCGCCTTCTTCAAGGGCCTGCGCTACGGCAAGGACAACGCCGAG |
| GCCAGCACCCTGATGGAGATGAAGGCCTACCACGCCATCAGCCGCGCCC |
| TGGAGAAGGAGGGCCTGAAGGACAAGAAGAGTCCTCTGAACCTGAGCCC |
| CGAGCTGCAGGACGAGATCGGCACCGCCTTCAGCCTGTTCAAGACCGAC |
| GAGGACATCACCGGCCGCCTGAAGGACCGCATCCAGCCCGAGATCCTGG |
| AGGCCCTGCTGAAGCACATCAGCTTCGACAAGTTCGTGCAGATCAGCCT |
| GAAGGCCCTGCGCCGCATCGTGCCCCTGATGGAGCAGGGCAAGCGCTAC |
| GACGAGGCCTGCGCCGAGATCTACGGCGACCACTACGGCAAGAAGAACA |
| CCGAGGAGAAGATCTACCTGCCTCCTATCCCCGCCGACGAGATCCGCAA |
| CCCCGTGGTGCTGCGCGCCCTGAGCCAGGCCCGCAAGGTGATCAACGGC |
| GTGGTGCGCCGCTACGGCAGCCCCGCCCGCATCCACATCGAGACCGCCC |
| GCGAGGTGGGCAAGAGCTTCAAGGACCGCAAGGAGATCGAGAAGCGCCA |
| GGAGGAGAACCGCAAGGACCGCGAGAAGGCCGCCGCCAAGTTCCGCGAG |
| TACTTCCCCAACTTCGTGGGCGAGCCCAAGAGCAAGGACATCCTGAAGC |
| TGCGCCTGTACGAGCAGCAGCACGGCAAGTGCCTGTACAGCGGCAAGGA |
| GATCAACCTGGGCCGCCTGAACGAGAAGGGCTACGTGGAGATCGACCAC |
| GCCCTGCCCTTCAGCCGCACCTGGGACGACAGCTTCAACAACAAGGTGC |
| TGGTGCTGGGCAGCGAGAACCAGAACAAGGGCAACCAGACCCCCTACGA |
| GTACTTCAACGGCAAGGACAACAGCCGCGAGTGGCAGGAGTTCAAGGCC |
| CGCGTGGAGACCAGCCGCTTCCCCCGCAGCAAGAAGCAGCGCATCCTGC |
| TGCAGAAGTTCGACGAGGACGGCTTCAAGGAGCGCAACCTGAACGACAC |
| CCGCTACGTGAACCGCTTCCTGTGCCAGTTCGTGGCCGACCGCATGCGC |
| CTGACCGGCAAGGGCAAGAAGCGCGTGTTCGCCAGCAACGGCCAGATCA |
| CCAACCTGCTGCGCGGCTTCTGGGGCCTGCGCAAGGTGCGCGCCGAGAA |
| CGACCGCCACCACGCCCTGGACGCCGTGGTGGTGGCCTGCAGCACCGTG |
| GCCATGCAGCAGAAGATCACCCGCTTCGTGCGCTACAAGGAGATGAACG |
| CCTTCGACGGTAAAACCATCGACAAGGAGACCGGCGAGGTGCTGCACCA |
| GAAGACCCACTTCCCCCAGCCCTGGGAGTTCTTCGCCCAGGAGGTGATG |
| ATCCGCGTGTTCGGCAAGCCCGACGGCAAGCCCGAGTTCGAGGAGGCCG |
| ACACCCCCGAGAAGCTGCGCACCCTGCTGGCCGAGAAGCTGAGCAGCCG |
| CCCTGAGGCCGTGCACGAGTACGTGACTCCTCTGTTCGTGAGCCGCGCC |
| CCCAACCGCAAGATGAGCGGTCAGGGTCACATGGAGACCGTGAAGAGCG |
| CCAAGCGCCTGGACGAGGGCGTGAGCGTGCTGCGCGTGCCCCTGACCCA |
| GCTGAAGCTGAAGGACCTGGAGAAGATGGTGAACCGCGAGCGCGAGCCC |
| AAGCTGTACGAGGCCCTGAAGGCCCGCCTGGAGGCCCACAAGGACGACC |
| CCGCCAAGGCCTTCGCCGAGCCCTTCTACAAGTACGACAAGGCCGGCAA |
| CCGCACCCAGCAGGTGAAGGCCGTGCGCGTGGAGCAGGTGCAGAAGACC |
| GGCGTGTGGGTGCGCAACCACAACGGCATCGCCGACAACGCCACCATGG |
| TGCGCGTGGACGTGTTCGAGAAGGGCGACAAGTACTACCTGGTGCCCAT |
| CTACAGCTGGCAGGTGGCCAAGGGCATCCTGCCCGACCGCGCCGTGGTG |
| CAGGGCAAGGACGAGGAGGACTGGCAGCTGATCGACGACAGCTTCAACT |
| TCAAGTTCAGCCTGCACCCCAACGACCTGGTGGAGGTGATCACCAAGAA |
| GGCCCGCATGTTCGGCTACTTCGCCAGCTGCCACCGCGGCACCGGCAAC |
| ATCAACATCCGCATCCACGACCTGGACCACAAGATCGGCAAGAACGGCA |
| TCCTGGAGGGCATCGGCGTGAAGACCGCCCTGAGCTTCCAGAAGTACCA |
| GATCGACGAGCTGGGCAAGGAGATCCGCCCCTGCCGCCTGAAGAAGCGC |
| CCTCCTGTGCGCTAA |
Provided below is the corresponding amino acid sequence of a N. meningitidis Cas9 molecule.
| (SEQ ID NO: 25) |
| MAAFKPNPINYILGLDIGIASVGWAMVEIDEDENPICLIDLGVRVFERA |
| EVPKTGDSLAMARRLARSVRRLTRRRAHRLLRARRLLKREGVLQAADFD |
| ENGLIKSLPNTPWQLRAAALDRKLTPLEWSAVLLHLIKHRGYLSQRKNE |
| GETADKELGALLKGVADNAHALQTGDFRTPAELALNKFEKESGHIRNQR |
| GDYSHTFSRKDLQAELILLFEKQKEFGNPHVSGGLKEGIETLLMTQRPA |
| LSGDAVQKMLGHCTFEPAEPKAAKNTYTAERFIWLTKLNNLRILEQGSE |
| RPLTDTERATLMDEPYRKSKLTYAQARKLLGLEDTAFFKGLRYGKDNAE |
| ASTLMEMKAYHAISRALEKEGLKDKKSPLNLSPELQDEIGTAFSLFKTD |
| EDITGRLKDRIQPEILEALLKHISFDKFVQISLKALRRIVPLMEQGKRY |
| DEACAEIYGDHYGKKNTEEKIYLPPIPADEIRNPVVLRALSQARKVING |
| VVRRYGSPARIHIETAREVGKSFKDRKEIEKRQEENRKDREKAAAKFRE |
| YFPNFVGEPKSKDILKLRLYEQQHGKCLYSGKEINLGRLNEKGYVEIDH |
| ALPFSRTWDDSFNNKVLVLGSENQNKGNQTPYEYFNGKDNSREWQEFKA |
| RVETSRFPRSKKQRILLQKFDEDGFKERNLNDTRYVNRFLCQFVADRMR |
| LTGKGKKRVFASNGQITNLLRGFWGLRKVRAENDRHHALDAVVVACSTV |
| AMQQKITRFVRYKEMNAFDGKTIDKETGEVLHQKTHFPQPWEFFAQEVM |
| IRVFGKPDGKPEFEEADTPEKLRTLLAEKLSSRPEAVHEYVTPLFVSRA |
| PNRKMSGQGHMETVKSAKRLDEGVSVLRVPLTQLKLKDLEKMVNREREP |
| KLYEALKARLEAHKDDPAKAFAEPFYKYDKAGNRTQQVKAVRVEQVQKT |
| GVWVRNHNGIADNATMVRVDVFEKGDKYYLVPIYSWQVAKGILPDRAVV |
| QGKDEEDWQLIDDSFNFKFSLHPNDLVEVITKKARMFGYFASCHRGTGN |
| INIRIHDLDHKIGKNGILEGIGVKTALSFQKYQIDELGKEIRPCRLKKR |
| PPVR* |
Provided below is an amino acid sequence of a S. aureus Cas9 molecule.
| (SEQ ID NO: 26) |
| MKRNYILGLDIGITSVGYGIIDYETRDVIDAGVRLFKEANVENNEGRRS |
| KRGARRLKRRRRHRIQRVKKLLFDYNLLTDHSELSGINPYEARVKGLSQ |
| KLSEEEFSAALLHLAKRRGVHNVNEVEEDTGNELSTKEQISRNSKALEE |
| KYVAELQLERLKKDGEVRGSINRFKTSDYVKEAKQLLKVQKAYHQLDQS |
| FIDTYIDLLETRRTYYEGPGEGSPFGWKDIKEWYEMLMGHCTYFPEELR |
| SVKYAYNADLYNALNDLNNLVITRDENEKLEYYEKFQIIENVFKQKKKP |
| TLKQIAKEILVNEEDIKGYRVTSTGKPEFTNLKVYHDIKDITARKEIIE |
| NAELLDQIAKILTIYQSSEDIQEELTNLNSELTQEEIEQISNLKGYTGT |
| HNLSLKAINLILDELWHTNDNQIAIFNRLKLVPKKVDLSQQKEIPTTLV |
| DDFILSPVVKRSFIQSIKVINAIIKKYGLPNDIIIELAREKNSKDAQKM |
| INEMQKRNRQTNERIEEIIRTTGKENAKYLIEKIKLHDMQEGKCLYSLE |
| AIPLEDLLNNPFNYEVDHIIPRSVSFDNSFNNKVLVKQEENSKKGNRTP |
| FQYLSSSDSKISYETFKKHILNLAKGKGRISKTKKEYLLEERDINRFSV |
| QKDFINRNLVDTRYATRGLMNLLRSYFRVNNLDVKVKSINGGFTSFLRR |
| KWKFKKERNKGYKHHAEDALIIANADFIFKEWKKLDKAKKVMENQMFEE |
| KQAESMPEIETEQEYKEIFITPHQIKHIKDFKDYKYSHRVDKKPNRELI |
| NDTLYSTRKDDKGNTLIVNNLNGLYDKDNDKLKKLINKSPEKLLMYHHD |
| PQTYQKLKLIMEQYGDEKNPLYKYYEETGNYLTKYSKKDNGPVIKKIKY |
| YGNKLNAHLDITDDYPNSRNKVVKLSLKPYRFDVYLDNGVYKFVTVKNL |
| DVIKKENYYEVNSKCYEEAKKLKKISNQAEFIASFYNNDLIKINGELYR |
| VIGVNNDLLNRIEVNMIDITYREYLENMNDKRPPRIIKTIASKTQSIKK |
| YSTDILGNLYEVKSKKHPQIIKKG* |
If any of the above Cas9 sequences are fused with a peptide or polypeptide at the C-terminus (e.g., an eiCas9 fused with a transcription repressor at the C-terminus), it is understood that the stop codon will be removed.
Other Cas Molecules
Various types of Cas molecules can be used to practice the inventions disclosed herein. In an embodiment, Cas molecules of Type II Cas systems are used. In an embodiment, Cas molecules of other Cas systems are used. For example, Type I or Type III Cas molecules may be used. Exemplary Cas molecules (and Cas systems) are described, e.g., in Haft et al., PLoS COMPUTATIONAL BIOLOGY 2005, 1(6): e60 and Makarova et al., NATURE REVIEW MICROBIOLOGY 2011, 9:467-477, the contents of both references are incorporated herein by reference in their entirety. Exemplary Cas molecules (and Cas systems) are also shown in Table II-1.
| TABLE II-1 |
| Cas Systems |
| Structure of | Families (and | ||||
| encoded protein | superfamily) of | ||||
| Gene | System type | Name from | (PDB | encoded | |
| name‡ | or subtype | Haft et al.§ | accessions)¶ | protein#** | Representatives |
| cas1 | Type I | cas1 | 3GOD, 3LFX and | COG1518 | SERP2463, SPy1047 |
| Type II | 2YZS | and ygbT | |||
| Type III | |||||
| cas2 | Type I | cas2 | 2IVY, 2I8E and | COG1343 and | SERP2462, SPy1048, |
| Type II | 3EXC | COG3512 | SPy1723 (N-terminal | ||
| Type III | domain) and ygbF | ||||
| cas3′ | Type I‡‡ | cas3 | NA | COG1203 | APE1232 and ygcB |
| cas3″ | Subtype I-A | NA | NA | COG2254 | APE1231 and BH0336 |
| Subtype I-B | |||||
| cas4 | Subtype I-A | cas4 and csa1 | NA | COG1468 | APE1239 and BH0340 |
| Subtype I-B | |||||
| Subtype I-C | |||||
| Subtype I-D | |||||
| Subtype II-B | |||||
| cas5 | Subtype I-A | cas5a, cas5d, | 3KG4 | COG1688 | APE1234, BH0337, |
| Subtype I-B | cas5e, cas5h, | (RAMP) | devS and ygcI | ||
| Subtype I-C | cas5p, cas5t | ||||
| Subtype I-E | and cmx5 | ||||
| cas6 | Subtype I-A | cas6 and cmx6 | 3I4H | COG1583 and | PF1131 and slr7014 |
| Subtype I-B | COG5551 | ||||
| Subtype I-D | (RAMP) | ||||
| Subtype III-A | |||||
| Subtype III-B | |||||
| cas6e | Subtype I-E | cse3 | 1WJ9 | (RAMP) | ygcH |
| cas6f | Subtype I-F | csy4 | 2XLJ | (RAMP) | y1727 |
| cas7 | Subtype I-A | csa2, csd2, | NA | COG1857 and | devR and ygcJ |
| Subtype I-B | cse4, csh2, csp1 | COG3649 | |||
| Subtype I-C | and cst2 | (RAMP) | |||
| Subtype I-E | |||||
| cas8a1 | Subtype I-A‡‡ | cmx1, cst1, | NA | BH0338-like | LA3191§§ and |
| csx8, csx13 and | PG2018§§ | ||||
| CXXC-CXXC | |||||
| cas8a2 | Subtype I-A‡‡ | csa4 and csx9 | NA | PH0918 | AF0070, AF1873, |
| MJ0385, PF0637, | |||||
| PH0918 and SSO1401 | |||||
| cas8b | Subtype I-B‡‡ | csh1 and | NA | BH0338-like | MTH1090 and |
| TM1802 | TM1802 | ||||
| cas8c | Subtype I-C‡‡ | csd1 and csp2 | NA | BH0338-like | BH0338 |
| cas9 | Type II‡‡ | csn1 and csx12 | NA | COG3513 | FTN_0757 and |
| SPy1046 | |||||
| cas10 | Type III‡‡ | cmr2, csm1 and | NA | COG1353 | MTH326, Rv2823c§§ |
| csx11 | and TM1794§§ | ||||
| cas10d | Subtype I-D‡‡ | csc3 | NA | COG1353 | slr7011 |
| csy1 | Subtype I-F‡‡ | csy1 | NA | y1724-like | y1724 |
| csy2 | Subtype I-F | csy2 | NA | (RAMP) | y1725 |
| csy3 | Subtype I-F | csy3 | NA | (RAMP) | y1726 |
| cse1 | Subtype I-E‡‡ | cse1 | NA | YgcL-like | ygcL |
| cse2 | Subtype I-E | cse2 | 2ZCA | YgcK-like | ygcK |
| csc1 | Subtype I-D | csc1 | NA | alr1563-like | alr1563 |
| (RAMP) | |||||
| csc2 | Subtype I-D | csc1 and csc2 | NA | COG1337 | slr7012 |
| (RAMP) | |||||
| csa5 | Subtype I-A | csa5 | NA | AF1870 | AF1870, MJ0380, |
| PF0643 and SSO1398 | |||||
| csn2 | Subtype II-A | csn2 | NA | SPy1049-like | SPy1049 |
| csm2 | Subtype III-A‡‡ | csm2 | NA | COG1421 | MTH1081 and |
| SERP2460 | |||||
| csm3 | Subtype III-A | csc2 and csm3 | NA | COG1337 | MTH1080 and |
| (RAMP) | SERP2459 | ||||
| csm4 | Subtype III-A | csm4 | NA | COG1567 | MTH1079 and |
| (RAMP) | SERP2458 | ||||
| csm5 | Subtype III-A | csm5 | NA | COG1332 | MTH1078 and |
| (RAMP) | SERP2457 | ||||
| csm6 | Subtype III-A | APE2256 and | 2WTE | COG1517 | APE2256 and |
| csm6 | SSO1445 | ||||
| cmr1 | Subtype III-B | cmr1 | NA | COG1367 | PF1130 |
| (RAMP) | |||||
| cmr3 | Subtype III-B | cmr3 | NA | COG1769 | PF1128 |
| (RAMP) | |||||
| cmr4 | Subtype III-B | cmr4 | NA | COG1336 | PF1126 |
| (RAMP) | |||||
| cmr5 | Subtype III-B‡‡ | cmr5 | 2ZOP and 2OEB | COG3337 | MTH324 and PF1125 |
| cmr6 | Subtype III-B | cmr6 | NA | COG1604 | PF1124 |
| (RAMP) | |||||
| csb1 | Subtype I-U | GSU0053 | NA | (RAMP) | Balac_1306 and |
| GSU0053 | |||||
| csb2 | Subtype I-U§§ | NA | NA | (RAMP) | Balac_1305 and |
| GSU0054 | |||||
| csb3 | Subtype I-U | NA | NA | (RAMP) | Balac_1303§§ |
| csx17 | Subtype I-U | NA | NA | NA | Btus_2683 |
| csx14 | Subtype I-U | NA | NA | NA | GSU0052 |
| csx10 | Subtype I-U | csx10 | NA | (RAMP) | Caur_2274 |
| csx16 | Subtype III-U | VVA1548 | NA | NA | VVA1548 |
| csaX | Subtype III-U | csaX | NA | NA | SSO1438 |
| csx3 | Subtype III-U | csx3 | NA | NA | AF1864 |
| csx1 | Subtype III-U | csa3, csx1, | 1XMX and 2I71 | COG1517 and | MJ1666, NE0113, |
| csx2, DXTHG, | COG4006 | PF1127 and TM1812 | |||
| NE0113 and | |||||
| TIGR02710 | |||||
| csx15 | Unknown | NA | NA | TTE2665 | TTE2665 |
| csf1 | Type U | csf1 | NA | NA | AFE_1038 |
| csf2 | Type U | csf2 | NA | (RAMP) | AFE_1039 |
| csf3 | Type U | csf3 | NA | (RAMP) | AFE_1040 |
| csf4 | Type U | csf4 | NA | NA | AFE_1037 |
Candidate Cas9 molecules, candidate gRNA molecules, candidate Cas9 molecule/gRNA molecule complexes, can be evaluated by art-known methods or as described herein. For example, exemplary methods for evaluating the endonuclease activity of Cas9 molecule are described, e.g., in Jinek et al., SCIENCE 2012; 337(6096):816-821.
Binding and Cleavage Assay: Testing the Endonuclease Activity of Cas9 Molecule
The ability of a Cas9 molecule/gRNA molecule complex to bind to and cleave a target nucleic acid can be evaluated in a plasmid cleavage assay. In this assay, synthetic or in vitro-transcribed gRNA molecule is pre-annealed prior to the reaction by heating to 95° C. and slowly cooling down to room temperature. Native or restriction digest-linearized plasmid DNA (300 ng (˜8 nM)) is incubated for 60 min at 37° C. with purified Cas9 protein molecule (50-500 nM) and gRNA (50-500 nM, 1:1) in a Cas9 plasmid cleavage buffer (20 mM HEPES pH 7.5, 150 mM KCl, 0.5 mM DTT, 0.1 mM EDTA) with or without 10 mM MgCl2. The reactions are stopped with 5×DNA loading buffer (30% glycerol, 1.2% SDS, 250 mM EDTA), resolved by a 0.8 or 1% agarose gel electrophoresis and visualized by ethidium bromide staining. The resulting cleavage products indicate whether the Cas9 molecule cleaves both DNA strands, or only one of the two strands. For example, linear DNA products indicate the cleavage of both DNA strands. Nicked open circular products indicate that only one of the two strands is cleaved.
Alternatively, the ability of a Cas9 molecule/gRNA molecule complex to bind to and cleave a target nucleic acid can be evaluated in an oligonucleotide DNA cleavage assay. In this assay, DNA oligonucleotides (10 pmol) are radiolabeled by incubating with 5 units T4 polynucleotide kinase and ˜3-6 pmol (˜20-40 mCi) [γ-32P]-ATP in 1×T4 polynucleotide kinase reaction buffer at 37° C. for 30 min, in a 50 μL reaction. After heat inactivation (65° C. for 20 min), reactions are purified through a column to remove unincorporated label. Duplex substrates (100 nM) are generated by annealing labeled oligonucleotides with equimolar amounts of unlabeled complementary oligonucleotide at 95° C. for 3 min, followed by slow cooling to room temperature. For cleavage assays, gRNA molecules are annealed by heating to 95° C. for 30 s, followed by slow cooling to room temperature. Cas9 (500 nM final concentration) is pre-incubated with the annealed gRNA molecules (500 nM) in cleavage assay buffer (20 mM HEPES pH 7.5, 100 mM KCl, 5 mM MgCl2, 1 mM DTT, 5% glycerol) in a total volume of 9 μl. Reactions are initiated by the addition of 1 μl target DNA (10 nM) and incubated for 1 h at 37° C. Reactions are quenched by the addition of 20 μl of loading dye (5 mM EDTA, 0.025% SDS, 5% glycerol in formamide) and heated to 95° C. for 5 min. Cleavage products are resolved on 12% denaturing polyacrylamide gels containing 7 M urea and visualized by phosphorimaging. The resulting cleavage products indicate that whether the complementary strand, the non-complementary strand, or both, are cleaved.
One or both of these assays can be used to evaluate the suitability of a candidate gRNA molecule or candidate Cas9 molecule.
Binding Assay: Testing the Binding of Cas9 Molecule to Target DNA
Exemplary methods for evaluating the binding of Cas9 molecule to target DNA are described, e.g., in Jinek et al., SCIENCE 2012; 337(6096):816-821.
For example, in an electrophoretic mobility shift assay, target DNA duplexes are formed by mixing of each strand (10 nmol) in deionized water, heating to 95° C. for 3 min and slow cooling to room temperature. All DNAs are purified on 8% native gels containing 1×TBE. DNA bands are visualized by UV shadowing, excised, and eluted by soaking gel pieces in DEPC-treated H2O. Eluted DNA is ethanol precipitated and dissolved in DEPC-treated H2O. DNA samples are 5′ end labeled with [γ-32P]-ATP using T4 polynucleotide kinase for 30 min at 37° C. Polynucleotide kinase is heat denatured at 65° C. for 20 min, and unincorporated radiolabel is removed using a column. Binding assays are performed in buffer containing 20 mM HEPES pH 7.5, 100 mM KCl, 5 mM MgCl2, 1 mM DTT and 10% glycerol in a total volume of 10 μl. Cas9 protein molecule is programmed with equimolar amounts of pre-annealed gRNA molecule and titrated from 100 pM to 1 μM. Radiolabeled DNA is added to a final concentration of 20 pM. Samples are incubated for 1 h at 37° C. and resolved at 4° C. on an 8% native polyacrylamide gel containing 1×TBE and 5 mM MgCl2. Gels are dried and DNA visualized by phosphorimaging.
The terms “template nucleic acid” and “swap nucleic acid” are used interchangeably and have identical meaning in this document and its priority documents.
Mutations in a gene or pathway described herein, e.g., in Section VIIB, e.g., in Table VII-13, VII-14, VII-15, VII-16, VII-17, VII-18, VII-19, VII-20, VII-21, VII-22, VII-23, VII-24, IX-1, IX-1A, IX-3, or XII-1, or in Section VIII, may be corrected using one of the approaches discussed herein. In an embodiment, a mutation in a gene or pathway described herein, e.g., in Section VIIB, e.g., in Table VII-13, VII-14, VII-15, VII-16, VII-17, VII-18, VII-19, VII-20, VII-21, VII-22, VII-23, VII-24, IX-1, IX-1A, IX-3, or XII-1, or in Section VIII, is corrected by homology directed repair (HDR) using a template nucleic acid (see Section IV.1). In an embodiment, a mutation in a gene or pathway described herein, e.g., in Section VIIB, e.g., in Table VII-13, VII-14, VII-15, VII-16, VII-17, VII-18, VII-19, VII-20, VII-21, VII-22, VII-23, VII-24, IX-1, IX-1A, IX-3, or XII-1, or in Section VIII, is corrected by Non-Homologous End Joining (NHEJ) repair using a template nucleic acid (see Section IV.2).
IV.1 HDR Repair and Template Nucleic Acids
As described herein, nuclease-induced homology directed repair (HDR) can be used to alter a target sequence and correct (e.g., repair or edit) a mutation in the genome. While not wishing to be bound by theory, it is believed that alteration of the target sequence occurs by homology-directed repair (HDR) with a donor template or template nucleic acid. For example, the donor template or the template nucleic acid provides for alteration of the target sequence. It is contemplated that a plasmid donor can be used as a template for homologous recombination. It is further contemplated that a single stranded donor template can be used as a template for alteration of the target sequence by alternate methods of homology directed repair (e.g., single strand annealing) between the target sequence and the donor template. Donor template-effected alteration of a target sequence depends on cleavage by a Cas9 molecule. Cleavage by Cas9 can comprise a double strand break or two single strand breaks.
In an embodiment, a mutation can be corrected by either a single double-strand break or two single strand breaks. In an embodiment, a mutation can be corrected by (1) a single double-strand break, (2) two single strand breaks, (3) two double stranded breaks with a break occurring on each side of the target sequence, (4) one double stranded breaks and two single strand breaks with the double strand break and two single strand breaks occurring on each side of the target sequence or (5) four single stranded breaks with a pair of single stranded breaks occurring on each side of the target sequence.
Double Strand Break Mediated Correction
In an embodiment, double strand cleavage is effected by a Cas9 molecule having cleavage activity associated with an HNH-like domain and cleavage activity associated with a RuvC-like domain, e.g., an N-terminal RuvC-like domain, e.g., a wild type Cas9. Such an embodiment requires only a single gRNA.
Single Strand Break Mediated Correction
In an embodiment, two single strand breaks, or nicks, are effected by a Cas9 molecule having nickase activity, e.g., cleavage activity associated with an HNH-like domain or cleavage activity associated with an N-terminal RuvC-like domain. Such an embodiment requires two gRNAs, one for placement of each single strand break. In an embodiment, the Cas9 molecule having nickase activity cleaves the strand to which the gRNA hybridizes, but not the strand that is complementary to the strand to which the gRNA hybridizes. In an embodiment, the Cas9 molecule having nickase activity does not cleave the strand to which the gRNA hybridizes, but rather cleaves the strand that is complementary to the strand to which the gRNA hybridizes.
In an embodiment, the nickase has HNH activity, e.g., a Cas9 molecule having the RuvC activity inactivated, e.g., a Cas9 molecule having a mutation at D10, e.g., the D10A mutation. D10A inactivates RuvC; therefore, the Cas9 nickase has (only) HNH activity and will cut on the strand to which the gRNA hybridizes (e.g., the complementary strand, which does not have the NGG PAM on it). In an embodiment, a Cas9 molecule having an H840, e.g., an H840A, mutation can be used as a nickase. H840A inactivates HNH; therefore, the Cas9 nickase has (only) RuvC activity and cuts on the non-complementary strand (e.g., the strand that has the NGG PAM and whose sequence is identical to the gRNA).
In an embodiment, in which a nickase and two gRNAs are used to position two single strand nicks, one nick is on the + strand and one nick is on the − strand of the target nucleic acid. The PAMs are outwardly facing. The gRNAs can be selected such that the gRNAs are separated by, from about 0-50, 0-100, or 0-200 nucleotides. In an embodiment, there is no overlap between the target sequence that is complementary to the targeting domains of the two gRNAs. In an embodiment, the gRNAs do not overlap and are separated by as much as 50, 100, or 200 nucleotides. In an embodiment, the use of two gRNAs can increase specificity, e.g., by decreasing off-target binding (Ran et al., CELL 2013).
In an embodiment, a single nick can be used to induce HDR. It is contemplated herein that a single nick can be used to increase the ratio of HR to NHEJ at a given cleavage site.
Placement of the Double Strand Break or a Single Strand Break Relative to Target Position
The double strand break or single strand break in one of the strands should be sufficiently close to target position such that correction occurs. In an embodiment, the distance is not more than 50, 100, 200, 300, 350 or 400 nucleotides. While not wishing to be bound by theory, it is believed that the break should be sufficiently close to target position such that the break is within the region that is subject to exonuclease-mediated removal during end resection. If the distance between the target position and a break is too great, the mutation may not be included in the end resection and, therefore, may not be corrected, as donor sequence may only be used to correct sequence within the end resection region.
In an embodiment, in which a gRNA (unimolecular (or chimeric) or modular gRNA) and Cas9 nuclease induce a double strand break for the purpose of inducing HDR-mediated correction, the cleavage site is between 0-200 bp (e.g., 0 to 175, 0 to 150, 0 to 125, 0 to 100, 0 to 75, 0 to 50, 0 to 25, 25 to 200, 25 to 175, 25 to 150, 25 to 125, 25 to 100, 25 to 75, 25 to 50, 50 to 200, 50 to 175, 50 to 150, 50 to 125, 50 to 100, 50 to 75, 75 to 200, 75 to 175, 75 to 150, 75 to 125, 75 to 100 bp) away from the target position. In an embodiment, the cleavage site is between 0-100 bp (e.g., 0 to 75, 0 to 50, 0 to 25, 25 to 100, 25 to 75, 25 to 50, 50 to 100, 50 to 75 or 75 to 100 bp) away from the target position.
In an embodiment, in which two gRNAs (independently, unimolecular (or chimeric) or modular gRNA) complexing with Cas9 nickases induce two single strand breaks for the purpose of inducing HDR-mediated correction, the closer nick is between 0-200 bp (e.g., 0 to 175, 0 to 150, 0 to 125, 0 to 100, 0 to 75, 0 to 50, 0 to 25, 25 to 200, 25 to 175, 25 to 150, 25 to 125, 25 to 100, 25 to 75, 25 to 50, 50 to 200, 50 to 175, 50 to 150, 50 to 125, 50 to 100, 50 to 75, 75 to 200, 75 to 175, 75 to 150, 75 to 125, 75 to 100 bp) away from the target position and the two nicks will ideally be within 25-55 bp of each other (e.g., 25 to 50, 25 to 45, 25 to 40, 25 to 35, 25 to 30, 30 to 55, 30 to 50, 30 to 45, 30 to 40, 30 to 35, 35 to 55, 35 to 50, 35 to 45, 35 to 40, 40 to 55, 40 to 50, 40 to 45 bp) and no more than 100 bp away from each other (e.g., no more than 90, 80, 70, 60, 50, 40, 30, 20, 10 or 5 bp away from each other). In an embodiment, the cleavage site is between 0-100 bp (e.g., 0 to 75, 0 to 50, 0 to 25, 25 to 100, 25 to 75, 25 to 50, 50 to 100, 50 to 75 or 75 to 100 bp) away from the target position.
In one embodiment, two gRNAs, e.g., independently, unimolecular (or chimeric) or modular gRNA, are configured to position a double-strand break on both sides of a target position. In an alternate embodiment, three gRNAs, e.g., independently, unimolecular (or chimeric) or modular gRNA, are configured to position a double strand break (i.e., one gRNA complexes with a cas9 nuclease) and two single strand breaks or paired single stranded breaks (i.e., two gRNAs complex with Cas9 nickases) on either side of the target position (e.g., the first gRNA is used to target upstream (i.e., 5′) of the target position and the second gRNA is used to target downstream (i.e., 3′) of the target position). In another embodiment, four gRNAs, e.g., independently, unimolecular (or chimeric) or modular gRNA, are configured to generate two pairs of single stranded breaks (i.e., two pairs of two gRNAs complex with Cas9 nickases) on either side of the target position (e.g., the first gRNA is used to target upstream (i.e., 5′) of the target position and the second gRNA is used to target downstream (i.e., 3′) of the target position). The double strand break(s) or the closer of the two single strand nicks in a pair will ideally be within 0-500 bp of the target position (e.g., no more than 450, 400, 350, 300, 250, 200, 150, 100, 50 or 25 bp from the target position). When nickases are used, the two nicks in a pair are within 25-55 bp of each other (e.g., between 25 to 50, 25 to 45, 25 to 40, 25 to 35, 25 to 30, 50 to 55, 45 to 55, 40 to 55, 35 to 55, 30 to 55, 30 to 50, 35 to 50, 40 to 50, 45 to 50, 35 to 45, or 40 to 45 bp) and no more than 100 bp away from each other (e.g., no more than 90, 80, 70, 60, 50, 40, 30, 20 or 10 bp).
In one embodiment, two gRNAs, e.g., independently, unimolecular (or chimeric) or modular gRNA, are configured to position a double-strand break on both sides of a target position. In an alternate embodiment, three gRNAs, e.g., independently, unimolecular (or chimeric) or modular gRNA, are configured to position a double strand break (i.e., one gRNA complexes with a cas9 nuclease) and two single strand breaks or paired single stranded breaks (i.e., two gRNAs complex with Cas9 nickases) on either side of the target position (e.g., the first gRNA is used to target upstream (i.e., 5′) of the mutation in a gene or pathway described herein, e.g., in Section VIIB, e.g., in Table VII-13, VII-14, VII-15, VII-16, VII-17, VII-18, VII-19, VII-20, VII-21, VII-22, VII-23, VII-24, IX-1, IX-1A, IX-3, or XII-1, or in Section VIII and the second gRNA is used to target downstream (i.e., 3′) of the mutation in a gene or pathway described herein, e.g., in Section VIIB, e.g., in Table VII-13, VII-14, VII-15, VII-16, VII-17, VII-18, VII-19, VII-20, VII-21, VII-22, VII-23, VII-24, IX-1, IX-1A, IX-3, or XII-1, or in Section VIII). In another embodiment, four gRNAs, e.g., independently, unimolecular (or chimeric) or modular gRNA, are configured to generate two pairs of single stranded breaks (i.e., two pairs of two gRNAs complex with Cas9 nickases) on either side of the target position (e.g., the first gRNA is used to target upstream (i.e., 5′) of the mutation in a gene or pathway described herein, and the second gRNA is used to target downstream (i.e., 3′) of the mutation in a gene or pathway described herein). The double strand break(s) or the closer of the two single strand nicks in a pair will ideally be within 0-500 bp of the target position (e.g., no more than 450, 400, 350, 300, 250, 200, 150, 100, 50 or 25 bp from the target position). When nickases are used, the two nicks in a pair are within 25-55 bp of each other (e.g., between 25 to 50, 25 to 45, 25 to 40, 25 to 35, 25 to 30, 50 to 55, 45 to 55, 40 to 55, 35 to 55, 30 to 55, 30 to 50, 35 to 50, 40 to 50, 45 to 50, 35 to 45, or 40 to 45 bp) and no more than 100 bp away from each other (e.g., no more than 90, 80, 70, 60, 50, 40, 30, 20 or 10 bp).
Length of the Homology Arms
The homology arm should extend at least as far as the region in which end resection may occur, e.g., in order to allow the resected single stranded overhang to find a complementary region within the donor template. The overall length could be limited by parameters such as plasmid size or viral packaging limits. In an embodiment, a homology arm does not extend into repeated elements, e.g., ALU repeats, LINE repeats.
Exemplary homology arm lengths include a least 50, 100, 250, 500, 750 or 1000 nucleotides.
Target position, as used herein, refers to a site on a target nucleic acid (e.g., the chromosome) that is modified by a Cas9 molecule-dependent process. For example, the target position can be a modified Cas9 molecule cleavage of the target nucleic acid and template nucleic acid directed modification, e.g., correction, of the target position. In an embodiment, a target position can be a site between two nucleotides, e.g., adjacent nucleotides, on the target nucleic acid into which one or more nucleotides is added. The target position may comprise one or more nucleotides that are altered, e.g., corrected, by a template nucleic acid. In an embodiment, the target position is within a target sequence (e.g., the sequence to which the gRNA binds). In an embodiment, a target position is upstream or downstream of a target sequence (e.g., the sequence to which the gRNA binds).
A template nucleic acid, as that term is used herein, refers to a nucleic acid sequence which can be used in conjunction with a Cas9 molecule and a gRNA molecule to alter the structure of a target position. The term “template nucleic acid” is synonymous with the term “swap nucleic acid” used in the priority document and herein. The terms “template nucleic acid” and “swap nucleic acid” have exactly the same meaning and can be used interchangeably. In an embodiment, the target nucleic acid is modified to have some or all of the sequence of the template nucleic acid, typically at or near cleavage site(s). In an embodiment, the template nucleic acid is single stranded. In an alternate embodiment, the tempolate nuceic acid is double stranded. In an embodiment, the template nucleic acid is DNA, e.g., double stranded DNA. In an alternate embodiment, the template nucleic acid is single stranded DNA.
In an embodiment, the template nucleic acid alters the structure of the target position by participating in a homology directed repair event. In an embodiment, the template nucleic acid alters the sequence of the target position. In an embodiment, the template nucleic acid results in the incorporation of a modified, or non-naturally occurring, nucleotide into the target nucleic acid.
Typically, the template sequence undergoes a breakage mediated or catalyzed recombination with the target sequence. In an embodiment, the template nucleic acid includes sequence that corresponds to a site on the target sequence that is cleaved by an eaCas9 mediated cleavage event. In an embodiment, the template nucleic acid includes sequence that corresponds to both, a first site on the target sequence that is cleaved in a first Cas9 mediated event, and a second site on the target sequence that is cleaved in a second Cas9 mediated event.
In an embodiment, the template nucleic acid can include sequence which results in an alteration in the coding sequence of a translated sequence, e.g., one which results in the substitution of one amino acid for another in a protein product, e.g., transforming a mutant allele into a wild type allele, transforming a wild type allele into a mutant allele, and/or introducing a stop codon, insertion of an amino acid residue, deletion of an amino acid residue, or a nonsense mutation.
In an embodiment, the template nucleic acid can include sequence which results in an alteration in a non-coding sequence, e.g., an alteration in an exon or in a 5′ or 3′ non-translated or non-transcribed region. Such alterations include an alteration in a control element, e.g., a promoter, enhancer, and an alteration in a cis-acting or trans-acting control element.
A template nucleic acid having homology with a target position in a gene or pathway described herein, e.g., in Section VIIB, e.g., in Table VII-13, VII-14, VII-15, VII-16, VII-17, VII-18, VII-19, VII-20, VII-21, VII-22, VII-23, VII-24, IX-1, IX-1A, IX-3, or XII-1, or in Section VIII, can be used to alter the structure of a target sequence. The template sequence can be used to alter an unwanted structure, e.g., an unwanted or mutant nucleotide.
The template nucleic acid can include sequence which, when integrated, results in:
The template nucleic acid can include sequence which results in:
In an embodiment, the template nucleic acid is 20+/−10, 30+/−10, 40+/−10, 50+/−10, 60+/−10, 70+/−10, 80+/−10, 90+/−10, 100+/−10, 110+/−10, 120+/−10, 130+/−10, 140+/−10, 150+/−10, 160+/−10, 170+/−10, 180+/−10, 190+/−10, 200+/−10, 210+/−10, of 220+/−10 nucleotides in length.
In an embodiment, the template nucleic acid is 30+/−20, 40+/−20, 50+/−20, 60+/−20, 70+/−20, 80+/−20, 90+/−20, 100+/−20, 110+/−20, 120+/−20, 130+/−20, 140+/−20, 150+/−20, 160+/−20, 170+/−20, 180+/−20, 190+/−20, 200+/−20, 210+/−20, of 220+/−20 nucleotides in length.
In an embodiment, the template nucleic acid is 10 to 1,000, 20 to 900, 30 to 800, 40 to 700, 50 to 600, 50 to 500, 50 to 400, 50 to 300, 50 to 200, or 50 to 100 nucleotides in length.
A template nucleic acid comprises the following components:
[5′ homology arm]-[replacement sequence]-[3′ homology arm].
The homology arms provide for recombination into the chromosome, thus replacing the undesired element, e.g., a mutation or signature, with the replacement sequence. In an embodiment, the homology arms flank the most distal cleavage sites.
In an embodiment, the 3′ end of the 5′ homology arm is the position next to the 5′ end of the replacement sequence. In an embodiment, the 5′ homology arm can extend at least 10, 20, 30, 40, 50, 100, 200, 300, 400, 500, 600, 700, 800, 900, 1000, 1500, or 2000 nucleotides 5′ from the 5′ end of the replacement sequence.
In an embodiment, the 5′ end of the 3′ homology arm is the position next to the 3′ end of the replacement sequence. In an embodiment, the 3′ homology arm can extend at least 10, 20, 30, 40, 50, 100, 200, 300, 400, 500, 600, 700, 800, 900, 1000, 1500, or 2000 nucleotides 3′ from the 3′ end of the replacement sequence.
It is contemplated herein that one or both homology arms may be shortened to avoid including certain sequence repeat elements, e.g., Alu repeats, LINE elements. For example, a 5′ homology arm may be shortened to avoid a sequence repeat element. In an embodiment, a 3′ homology arm may be shortened to avoid a sequence repeat element. In an embodiment, both the 5′ and the 3′ homology arms may be shortened to avoid including certain sequence repeat elements.
It is contemplated herein that template nucleic acids for correcting a mutation may designed for use as a single-stranded oligonucleotide (ssODN). When using a ssODN, 5′ and 3′ homology arms may range up to about 200 base pairs (bp) in length, e.g., at least 25, 50, 75, 100, 125, 150, 175, or 200 bp in length. Longer homology arms are also contemplated for ssODNs as improvements in oligonucleotide synthesis continue to be made.
In an embodiment, an ssODN may be used to correct a mutation in a gene or pathway described herein, e.g., in Section VIIB, e.g., in Table VII-13, VII-14, VII-15, VII-16, VII-17, VII-18, VII-19, VII-20, VII-21, VII-22, VII-23, VII-24, IX-1, IX-1A, IX-3, or XII-1, or in Section VIII.
IV.2 NHEJ Approaches for Gene Targeting
As described herein, nuclease-induced non-homologous end-joining (NHEJ) can be used to target gene-specific knockouts. Nuclease-induced NHEJ can also be used to remove (e.g., delete) sequence in a gene of interest.
While not wishing to be bound by theory, it is believed that, in an embodiment, the genomic alterations associated with the methods described herein rely on nuclease-induced NHEJ and the error-prone nature of the NHEJ repair pathway. NHEJ repairs a double-strand break in the DNA by joining together the two ends; however, generally, the original sequence is restored only if two compatible ends, exactly as they were formed by the double-strand break, are perfectly ligated. The DNA ends of the double-strand break are frequently the subject of enzymatic processing, resulting in the addition or removal of nucleotides, at one or both strands, prior to rejoining of the ends. This results in the presence of insertion and/or deletion (indel) mutations in the DNA sequence at the site of the NHEJ repair. Two-thirds of these mutations typically alter the reading frame and, therefore, produce a non-functional protein. Additionally, mutations that maintain the reading frame, but which insert or delete a significant amount of sequence, can destroy functionality of the protein. This is locus dependent as mutations in critical functional domains are likely less tolerable than mutations in non-critical regions of the protein.
The indel mutations generated by NHEJ are unpredictable in nature; however, at a given break site certain indel sequences are favored and are over represented in the population, likely due to small regions of microhomology. The lengths of deletions can vary widely; most commonly in the 1-50 bp range, but they can easily reach greater than 100-200 bp. Insertions tend to be shorter and often include short duplications of the sequence immediately surrounding the break site. However, it is possible to obtain large insertions, and in these cases, the inserted sequence has often been traced to other regions of the genome or to plasmid DNA present in the cells.
Because NHEJ is a mutagenic process, it can also be used to delete small sequence motifs as long as the generation of a specific final sequence is not required. If a double-strand break is targeted near to a short target sequence, the deletion mutations caused by the NHEJ repair often span, and therefore remove, the unwanted nucleotides. For the deletion of larger DNA segments, introducing two double-strand breaks, one on each side of the sequence, can result in NHEJ between the ends with removal of the entire intervening sequence. Both of these approaches can be used to delete specific DNA sequences; however, the error-prone nature of NHEJ may still produce indel mutations at the site of repair.
Both double strand cleaving eaCas9 molecules and single strand, or nickase, eaCas9 molecules can be used in the methods and compositions described herein to generate NHEJ-mediated indels. NHEJ-mediated indels targeted to the gene, e.g., a coding region, e.g., an early coding region of a gene of interest can be used to knockout (i.e., eliminate expression of) a gene of interest. For example, early coding region of a gene of interest includes sequence immediately following a transcription start site, within a first exon of the coding sequence, or within 500 bp of the transcription start site (e.g., less than 500, 450, 400, 350, 300, 250, 200, 150, 100 or 50 bp).
Placement of Double Strand or Single Strand Breaks Relative to the Target Position
In an embodiment, in which a gRNA and Cas9 nuclease generate a double strand break for the purpose of inducing NHEJ-mediated indels, a gRNA, e.g., a unimolecular (or chimeric) or modular gRNA molecule, is configured to position one double-strand break in close proximity to a nucleotide of the target position. In an embodiment, the cleavage site is between 0-500 bp away from the target position (e.g., less than 500, 400, 300, 200, 100, 50, 40, 30, 25, 20, 15, 10, 9, 8, 7, 6, 5, 4, 3, 2 or 1 bp from the target position).
In an embodiment, in which two gRNAs complexing with Cas9 nickases induce two single strand breaks for the purpose of inducing NHEJ-mediated indels, two gRNAs, e.g., independently, unimolecular (or chimeric) or modular gRNA, are configured to position two single-strand breaks to provide for NHEJ repair a nucleotide of the target position. In an embodiment, the gRNAs are configured to position cuts at the same position, or within a few nucleotides of one another, on different strands, essentially mimicking a double strand break. In an embodiment, the closer nick is between 0-30 bp away from the target position (e.g., less than 30, 25, 20, 15, 10, 9, 8, 7, 6, 5, 4, 3, 2 or 1 bp from the target position), and the two nicks are within 25-55 bp of each other (e.g., between 25 to 50, 25 to 45, 25 to 40, 25 to 35, 25 to 30, 50 to 55, 45 to 55, 40 to 55, 35 to 55, 30 to 55, 30 to 50, 35 to 50, 40 to 50, 45 to 50, 35 to 45, or 40 to 45 bp) and no more than 100 bp away from each other (e.g., no more than 90, 80, 70, 60, 50, 40, 30, 20 or 10 bp). In an embodiment, the gRNAs are configured to place a single strand break on either side of a nucleotide of the target position.
Both double strand cleaving eaCas9 molecules and single strand, or nickase, eaCas9 molecules can be used in the methods and compositions described herein to generate breaks both sides of a target position. Double strand or paired single strand breaks may be generated on both sides of a target position (e.g., of a gene or pathway described herein, e.g., in Section VIIB, e.g., in Table VII-13, VII-14, VII-15, VII-16, VII-17, VII-18, VII-19, VII-20, VII-21, VII-22, VII-23, VII-24, IX-1, IX-1A, IX-3, or XII-1, or in Section VIII, to remove the nucleic acid sequence between the two cuts (e.g., the region between the two breaks is deleted). In one embodiment, two gRNAs, e.g., independently, unimolecular (or chimeric) or modular gRNA, are configured to position a double-strand break on both sides of a target position (e.g., the first gRNA is used to target upstream (i.e., 5′) of the mutation in a gene or pathway described herein, and the second gRNA is used to target downstream (i.e., 3′) of the mutation in a gene or pathway described herein). In an alternate embodiment, three gRNAs, e.g., independently, unimolecular (or chimeric) or modular gRNA, are configured to position a double strand break (i.e., one gRNA complexes with a cas9 nuclease) and two single strand breaks or paired single stranded breaks (i.e., two gRNAs complex with Cas9 nickases) on either side of a target position (e.g., the first gRNA is used to target upstream (i.e., 5′) of the mutation in a gene or pathway described herein, and the second gRNA is used to target downstream (i.e., 3′) of the mutation in a gene or pathway described herein). In another embodiment, four gRNAs, e.g., independently, unimolecular (or chimeric) or modular gRNA, are configured to generate two pairs of single stranded breaks (i.e., two pairs of two gRNAs complex with Cas9 nickases) on either side of the target position (e.g., the first gRNA is used to target upstream (i.e., 5′) of the mutation in a gene or pathway described herein, and the second gRNA is used to target downstream (i.e., 3′) of the mutation in a gene or pathway described herein). The double strand break(s) or the closer of the two single strand nicks in a pair will ideally be within 0-500 bp of the target position (e.g., no more than 450, 400, 350, 300, 250, 200, 150, 100, 50 or 25 bp from the target position). When nickases are used, the two nicks in a pair are within 25-55 bp of each other (e.g., between 25 to 50, 25 to 45, 25 to 40, 25 to 35, 25 to 30, 50 to 55, 45 to 55, 40 to 55, 35 to 55, 30 to 55, 30 to 50, 35 to 50, 40 to 50, 45 to 50, 35 to 45, or 40 to 45 bp) and no more than 100 bp away from each other (e.g., no more than 90, 80, 70, 60, 50, 40, 30, 20 or 10 bp).
IV.3 Targeted Knockdown
Unlike CRISPR/Cas-mediated gene knockout, which permanently eliminates expression by mutating the gene at the DNA level, CRISPR/Cas knockdown allows for temporary reduction of gene expression through the use of artificial transcription factors. Mutating key residues in both DNA cleavage domains of the Cas9 protein (e.g. the D10A and H840A mutations) results in the generation of a catalytically inactive Cas9 (eiCas9 which is also known as dead Cas9 or dCas9). A catalytically inactive Cas9 complexes with a gRNA and localizes to the DNA sequence specified by that gRNA's targeting domain, however, it does not cleave the target DNA. Fusion of the dCas9 to an effector domain, e.g., a transcription repression domain, enables recruitment of the effector to any DNA site specified by the gRNA. While it has been show that the eiCas9 itself can block transcription when recruited to early regions in the coding sequence, more robust repression can be achieved by fusing a transcriptional repression domain (for example KRAB, SID or ERD) to the Cas9 and recruiting it to the promoter region of a gene. It is likely that targeting DNAseI hypersensitive regions of the promoter may yield more efficient gene repression or activation because these regions are more likely to be accessible to the Cas9 protein and are also more likely to harbor sites for endogenous transcription factors. Especially for gene repression, it is contemplated herein that blocking the binding site of an endogenous transcription factor would aid in downregulating gene expression. In another embodiment, an eiCas9 can be fused to a chromatin modifying protein. Altering chromatin status can result in decreased expression of the target gene.
In an embodiment, a gRNA molecule can be targeted to a known transcription response elements (e.g., promoters, enhancers, etc.), a known upstream activating sequences (UAS), and/or sequences of unknown or known function that are suspected of being able to control expression of the target DNA.
CRISPR/Cas-mediated gene knockdown can be used to reduce expression of an unwanted allele or transcript. Contemplated herein are scenarios wherein permanent destruction of the gene is not ideal. In these scenarios, site-specific repression may be used to temporarily reduce or eliminate expression. It is also contemplated herein that the off-target effects of a Cas-repressor may be less severe than those of a Cas-nuclease as a nuclease can cleave any DNA sequence and cause mutations whereas a Cas-repressor may only have an effect if it targets the promoter region of an actively transcribed gene. However, while nuclease-mediated knockout is permanent, repression may only persist as long as the Cas-repressor is present in the cells. Once the repressor is no longer present, it is likely that endogenous transcription factors and gene regulatory elements would restore expression to its natural state.
IV.4 Examples of gRNAs in Genome Editing Methods
gRNA molecules as described herein can be used with Cas9 molecules that generate a double strand break or a single strand break to alter the sequence of a target nucleic acid, e.g., a target position or target genetic signature. gRNA molecules useful in these methods are described below.
In an embodiment, the gRNA, e.g., a chimeric gRNA, is configured such that it comprises one or more of the following properties;
a) it can position, e.g., when targeting a Cas9 molecule that makes double strand breaks, a double strand break (i) within 50, 100, 150 or 200 nucleotides of a target position, or (ii) sufficiently close that the target position is within the region of end resection;
b) it has a targeting domain of at least 15, 16, 17, 18, 19 or 20, nucleotides, e.g., a targeting domain of (i) 17, (ii) 18, or (iii) 20 nucleotides; and
c)
In an embodiment, the gRNA is configured such that it comprises properties: a and b(i).
In an embodiment, the gRNA is configured such that it comprises properties: a and b(ii).
In an embodiment, the gRNA is configured such that it comprises properties: a and b(iii).
In an embodiment, the gRNA is configured such that it comprises properties: a and c.
In an embodiment, the gRNA is configured such that in comprises properties: a, b, and c.
In an embodiment, the gRNA is configured such that in comprises properties: a(i), b(i), and c(i).
In an embodiment, the gRNA is configured such that in comprises properties: a(i), b(i), and c(ii).
In an embodiment, the gRNA is configured such that in comprises properties: a(i), b(iii), and c(i).
In an embodiment, the gRNA is configured such that in comprises properties: a(i), b(iii), and c(ii).
In an embodiment, the gRNA, e.g., a chimeric gRNA, is configured such that it comprises one or more of the following properties;
a) it can position, e.g., when targeting a Cas9 molecule that makes single strand breaks, a single strand break (i) within 50, 100, 150 or 200 nucleotides of a target position, or (ii) sufficiently close that the target position is within the region of end resection;
b) it has a targeting domain of at least 15, 16, 17, 18, 19, or 20, nucleotides, e.g., a targeting domain of (i) 17, (ii) 18, or (iii) 20 nucleotides; and
c)
In an embodiment, the gRNA is configured such that it comprises properties: a and b(i).
In an embodiment, the gRNA is configured such that it comprises properties: a and b(ii).
In an embodiment, the gRNA is configured such that it comprises properties: a and b(iii).
In an embodiment, the gRNA is configured such that it comprises properties: a and c.
In an embodiment, the gRNA is configured such that in comprises properties: a, b, and c.
In an embodiment, the gRNA is configured such that in comprises properties: a(i), b(i), and c(i).
In an embodiment, the gRNA is configured such that in comprises properties: a(i), b(i), and c(ii).
In an embodiment, the gRNA is configured such that in comprises properties: a(i), b(iii), and c(i).
In an embodiment, the gRNA is configured such that in comprises properties: a(i), b(iii), and c(ii).
In an embodiment, the gRNA is used with a Cas9 nickase molecule having HNH activity, e.g., a Cas9 molecule having the RuvC activity inactivated, e.g., a Cas9 molecule having a mutation at D10, e.g., the D10A mutation.
In an embodiment, the gRNA is used with a Cas9 nickase molecule having RuvC activity, e.g., a Cas9 molecule having the HNH activity inactivated, e.g., a Cas9 molecule having a mutation at H840, e.g., a H840A.
In an embodiment, a pair of gRNAs, e.g., a pair of chimeric gRNAs, comprising a first and a second gRNA, is configured such that they comprises one or more of the following properties;
a) one or both of the gRNAs can position, e.g., when targeting a Cas9 molecule that makes single strand breaks, a single strand break within (i) 50, 100, 150 or 200 nucleotides of a target position, or (ii) sufficiently close that the target position is within the region of end resection;
b) one or both have a targeting domain of at least 17 nucleotides, e.g., a targeting domain of (i) 17 or (ii) 18 nucleotides;
c) one or both:
d) the gRNAs are configured such that, when hybridized to target nucleic acid, they are separated by 0-50, 0-100, 0-200, at least 10, at least 20, at least 30 or at least 50 nucleotides;
e) the breaks made by the first gRNA and second gRNA are on different strands; and
f) the PAMs are facing outwards.
In an embodiment, one or both of the gRNAs is configured such that it comprises properties: a and b(i).
In an embodiment, one or both of the gRNAs is configured such that it comprises properties: a and b(ii).
In an embodiment, one or both of the gRNAs is configured such that it comprises properties: a and b(iii).
In an embodiment, one or both of the gRNAs configured such that it comprises properties: a and c.
In an embodiment, one or both of the gRNAs is configured such that in comprises properties: a, b, and c.
In an embodiment, one or both of the gRNAs is configured such that in comprises properties: a(i), b(i), and c(i).
In an embodiment, one or both of the gRNAs is configured such that in comprises properties: a(i), b(i), and c(ii).
In an embodiment, one or both of the gRNAs is configured such that in comprises properties: a(i), b(i), c, and d.
In an embodiment, one or both of the gRNAs is configured such that in comprises properties: a(i), b(i), c, and e.
In an embodiment, one or both of the gRNAs is configured such that in comprises properties: a(i), b(i), c, d, and e.
In an embodiment, one or both of the gRNAs is configured such that in comprises properties: a(i), b(iii), and c(i).
In an embodiment, one or both of the gRNAs is configured such that in comprises properties: a(i), b(iii), and c(ii).
In an embodiment, one or both of the gRNAs is configured such that in comprises properties: a(i), b(iii), c, and d.
In an embodiment, one or both of the gRNAs is configured such that in comprises properties: a(i), b(iii), c, and e.
In an embodiment, one or both of the gRNAs is configured such that in comprises properties: a(i), b(iii), c, d, and e.
In an embodiment, the gRNAs are used with a Cas9 nickase molecule having HNH activity, e.g., a Cas9 molecule having the RuvC activity inactivated, e.g., a Cas9 molecule having a mutation at D10, e.g., the D10A mutation.
In an embodiment, the gRNAs are used with a Cas9 nickase molecule having RuvC activity, e.g., a Cas9 molecule having the HNH activity inactivated, e.g., a Cas9 molecule having a mutation at H840, e.g., a H840A.
The components, e.g., a Cas9 molecule or gRNA molecule, or both, can be delivered, formulated, or administered in a variety of forms, see, e.g., Table V-la and Table V-lb. When a component is delivered encoded in DNA the DNA will typically include a control region, e.g., comprising a promoter, to effect expression. Useful promoters for Cas9 molecule sequences include CMV, EF-1a, MSCV, PGK, CAG control promoters. Useful promoters for gRNAs include H1, EF-1a and U6 promoters. Promoters with similar or dissimilar strengths can be selected to tune the expression of components. Sequences encoding a Cas9 molecule can comprise a nuclear localization signal (NLS), e.g., an SV40 NLS. In an embodiment, a promoter for a Cas9 molecule or a gRNA molecule can be, independently, inducible, tissue specific, or cell specific.
Table V-1a and Table V-1b provide examples of how the components can be formulated, delivered, or administered.
| TABLE V-1a |
| Element |
| Cas9 | gRNA | Template | |
| Molecule(s) | molecule(s) | Nucleic Acid | Comments |
| DNA | DNA | DNA | In an embodiment, a Cas9 molecule, typically an |
| eaCas9 molecule, and a gRNA are transcribed | |||
| from DNA. In this embodiment, they are | |||
| encoded on separate molecules. In an | |||
| embodiment, the donor template is provided as a | |||
| separate DNA molecule. A governing gRNA | |||
| molecule can also be present. It can be encoded | |||
| on the molecule that encodes the Cas9 molecule | |||
| or the gRNA molecule or can be on a third | |||
| nucleic acid molecule. The governing gRNA | |||
| molecule can be a Cas9-targeting gRNA | |||
| molecule or a gRNA-targeting gRNA molecule. | |||
| In an embodiment, both are present. In an | |||
| embodiment, the governing gRNA molecule is a | |||
| Cas9-targeting gRNA molecule which targets, by | |||
| binding and/or cleavage, the sequence that | |||
| encodes the Cas9 molecule and results in | |||
| substantial reduction of the production of Cas9 | |||
| molecule. In an embodiment, the governing | |||
| gRNA molecule is a gRNA-targeting gRNA | |||
| molecule which targets, by binding and/or | |||
| cleavage, the sequence that encodes the gRNA | |||
| molecule and results in substantial reduction of | |||
| the production of gRNA molecule. |
| DNA | DNA | In an embodiment, a Cas9 molecule, typically an |
| eaCas9 molecule, and a gRNA are transcribed | ||
| from DNA. In this embodiment, they are | ||
| encoded on separate molecules. In this | ||
| embodiment, the donor template is provided on | ||
| the same DNA molecule that encodes the gRNA. | ||
| A governing gRNA molecule can also be | ||
| present. It can be encoded on the molecule that | ||
| encodes the Cas9 molecule and the gRNA | ||
| molecule or can be on a second nucleic acid | ||
| molecule. The governing gRNA molecule can | ||
| be a Cas9-targeting gRNA molecule or a gRNA- | ||
| targeting gRNA molecule. In an embodiment, | ||
| both are present. In an embodiment, the | ||
| governing gRNA molecule is a Cas9-targeting | ||
| gRNA molecule which targets, by binding and/or | ||
| cleavage, the sequence that encodes the Cas9 | ||
| molecule and results in substantial reduction of | ||
| the production of Cas9 molecule. In an | ||
| embodiment, the governing gRNA molecule is a | ||
| gRNA-targeting gRNA molecule which targets, | ||
| by binding and/or cleavage, the sequence that | ||
| encodes the gRNA molecule and results in | ||
| substantial reduction of the production of gRNA | ||
| molecule. |
| DNA | DNA | In an embodiment, a Cas9 molecule, typically an |
| eaCas9 molecule, and a gRNA are transcribed | ||
| from DNA, here from a single molecule. In this | ||
| embodiment, the donor template is provided as a | ||
| separate DNA molecule. A governing gRNA | ||
| molecule can also be present. It can be encoded | ||
| on the molecule that encodes the Cas9 molecule | ||
| and the gRNA molecule or can be on a second | ||
| nucleic acid molecule. The governing gRNA | ||
| molecule can be a Cas9-targeting gRNA | ||
| molecule or a gRNA-targeting gRNA molecule. | ||
| In an embodiment, both are present. In an | ||
| embodiment, the governing gRNA molecule is a | ||
| Cas9-targeting gRNA molecule which targets, by | ||
| binding and/or cleavage, the sequence that | ||
| encodes the Cas9 molecule and results in | ||
| substantial reduction of the production of Cas9 | ||
| molecule. In an embodiment, the governing | ||
| gRNA molecule is a gRNA-targeting gRNA | ||
| molecule which targets, by binding and/or | ||
| cleavage, the sequence that encodes the gRNA | ||
| molecule and results in substantial reduction of | ||
| the production of gRNA molecule. |
| DNA | DNA | DNA | In an embodiment, a Cas9 molecule, typically an |
| eaCas9 molecule, and a gRNA are transcribed | |||
| from DNA. In this embodiment, they are | |||
| encoded on separate molecules. In this | |||
| embodiment, the donor template is provided on | |||
| the same DNA molecule that encodes the Cas9. | |||
| A governing gRNA molecule can also be | |||
| present. It can be encoded on the molecule that | |||
| encodes the Cas9 molecule or the gRNA | |||
| molecule or can be on a third nucleic acid | |||
| molecule. The governing gRNA molecule can | |||
| be a Cas9-targeting gRNA molecule or a gRNA- | |||
| targeting gRNA molecule. In an embodiment, | |||
| both are present. In an embodiment, the | |||
| governing gRNA molecule is a Cas9-targeting | |||
| gRNA molecule which targets, by binding and/or | |||
| cleavage, the sequence that encodes the Cas9 | |||
| molecule and results in substantial reduction of | |||
| the production of Cas9 molecule. In an | |||
| embodiment, the governing gRNA molecule is a | |||
| gRNA-targeting gRNA molecule which targets, | |||
| by binding and/or cleavage, the sequence that | |||
| encodes the gRNA molecule and results in | |||
| substantial reduction of the production of gRNA | |||
| molecule. | |||
| DNA | RNA | DNA | In an embodiment, a Cas9 molecule, typically an |
| eaCas9 molecule, is transcribed from DNA, and | |||
| a gRNA is provided as in vitro transcribed or | |||
| synthesized RNA. In this embodiment, the | |||
| donor template is provided as a separate DNA | |||
| molecule. In an embodiment, the gRNA | |||
| comprises one or more modifications, e.g., as | |||
| described in Section X. A governing gRNA | |||
| molecule can also be present. It can be encoded | |||
| on the molecule that encodes the Cas9 molecule | |||
| or can be on a second nucleic acid molecule. In | |||
| an embodiment, the governing gRNA molecule | |||
| is a Cas9-targeting gRNA molecule which | |||
| targets, by binding and/or cleavage, the sequence | |||
| that encodes the Cas9 molecule and results in | |||
| substantial reduction of the production of Cas9 | |||
| molecule. | |||
| DNA | RNA | DNA | In an embodiment, a Cas9 molecule, typically an |
| eaCas9 molecule, is transcribed from DNA, and | |||
| a gRNA is provided as in vitro transcribed or | |||
| synthesized RNA. In this embodiment, the | |||
| donor template is provided on the same DNA | |||
| molecule that encodes the Cas9. In an | |||
| embodiment, the gRNA comprises one or more | |||
| modifications, e.g., as described in Section X. A | |||
| governing gRNA molecule can also be present. | |||
| It can be encoded on the molecule that encodes | |||
| the Cas9 molecule or can be on a second nucleic | |||
| acid molecule. In an embodiment, the governing | |||
| gRNA molecule is a Cas9-targeting gRNA | |||
| molecule which targets, by binding and/or | |||
| cleavage, the sequence that encodes the Cas9 | |||
| molecule and results in substantial reduction of | |||
| the production of Cas9 molecule. | |||
| mRNA | RNA | DNA | In an embodiment, a Cas9 molecule, typically an |
| eaCas9 molecule, is translated from in vitro | |||
| transcribed mRNA, and a gRNA is provided as | |||
| in vitro transcribed or synthesized RNA. In this | |||
| embodiment, the donor template is provided as a | |||
| DNA molecule. In an embodiment, the gRNA | |||
| comprises one or more modifications, e.g., as | |||
| described in Section X. In an embodiment, the | |||
| mRNA comprises one or more modifications, | |||
| e.g., as described in Section X. | |||
| mRNA | DNA | DNA | In an embodiment, a Cas9 molecule, typically an |
| eaCas9 molecule, is translated from in vitro | |||
| transcribed mRNA, and a gRNA is transcribed | |||
| from DNA. In this embodiment, the donor | |||
| template is provided as a separate DNA | |||
| molecule. In an embodiment, the mRNA | |||
| comprises one or more modifications, e.g., as | |||
| described in Section X. A governing gRNA | |||
| molecule can also be present. It can be encoded | |||
| on the molecule that encodes the gRNA | |||
| molecule or can be on a second nucleic acid | |||
| molecule. In an embodiment, the governing | |||
| gRNA molecule is a gRNA-targeting gRNA | |||
| molecule which targets, by binding and/or | |||
| cleavage, the sequence that encodes the gRNA | |||
| molecule and results in substantial reduction of | |||
| the production of gRNA molecule. |
| mRNA | DNA | In an embodiment, a Cas9 molecule, typically an |
| eaCas9 molecule, is translated from in vitro | ||
| transcribed mRNA, and a gRNA is transcribed | ||
| from DNA. In this embodiment, the donor | ||
| template is provided on the same DNA molecule | ||
| that encodes the gRNA. In an embodiment, the | ||
| mRNA comprises one or more modifications, | ||
| e.g., as described in Section X. A governing | ||
| gRNA molecule can also be present. It can be | ||
| encoded on the molecule that encodes the gRNA | ||
| molecule or can be on a second nucleic acid | ||
| molecule. In an embodiment, the governing | ||
| gRNA molecule is a gRNA-targeting gRNA | ||
| molecule which targets, by binding and/or | ||
| cleavage, the sequence that encodes the gRNA | ||
| molecule and results in substantial reduction of | ||
| the production of gRNA molecule. |
| Protein | DNA | DNA | In an embodiment, a Cas9 molecule, typically an |
| eaCas9 molecule, is provided as a protein, and a | |||
| gRNA is transcribed from DNA. In this | |||
| embodiment, the donor template is provided as a | |||
| separate DNA molecule. A governing gRNA | |||
| molecule can also be present. It can be encoded | |||
| on the molecule that encodes the gRNA | |||
| molecule or can be on a second nucleic acid | |||
| molecule. In an embodiment the governing | |||
| gRNA molecule is a gRNA-targeting gRNA | |||
| molecule which targets, by binding and/or | |||
| cleavage, the sequence that encodes the gRNA | |||
| molecule and results in substantial reduction of | |||
| the production of gRNA molecule. |
| Protein | DNA | In an embodiment, a Cas9 molecule, typically an |
| eaCas9 molecule, is provided as a protein, and a | ||
| gRNA is transcribed from DNA. In this | ||
| embodiment, the donor template is provided on | ||
| the same DNA molecule that encodes the gRNA. | ||
| A governing gRNA molecule can also be | ||
| present. It can be encoded on the molecule that | ||
| encodes the gRNA molecule or can be on a | ||
| second nucleic acid molecule. In an embodiment | ||
| the governing gRNA molecule is a gRNA- | ||
| targeting gRNA molecule which targets, by | ||
| binding and/or cleavage, the sequence that | ||
| encodes the gRNA molecule and results in | ||
| substantial reduction of the production of gRNA | ||
| molecule. |
| Protein | RNA | DNA | In an embodiment, an eaCas9 molecule is |
| provided as a protein, and a gRNA is provided as | |||
| transcribed or synthesized RNA. In this | |||
| embodiment, the donor template is provided as a | |||
| DNA molecule. In an embodiment, the gRNA | |||
| comprises one or more modifications, e.g., as | |||
| described in Section X. | |||
| TABLE V-1b |
| Element |
| Cas9 | gRNA | ||
| Molecule(s) | molecule(s) | Payload | Comments |
| DNA | DNA | Yes | In this embodiment, a Cas9 molecule, typically |
| an eiCas9 molecule, and a gRNA are transcribed | |||
| from DNA. Here they are provided on separate | |||
| molecules. A governing gRNA molecule can | |||
| also be present. It can be encoded on the | |||
| molecule that encodes the Cas9 molecule or the | |||
| gRNA molecule or can be on a third nucleic acid | |||
| molecule. The governing gRNA molecule can | |||
| be a Cas9-targeting gRNA or molecule or a | |||
| gRNA-targeting gRNA molecule. In an | |||
| embodiment, both are present. In an | |||
| embodiment, the governing gRNA molecule is a | |||
| Cas9-targeting gRNA molecule which targets, | |||
| by binding and/or cleavage, the sequence that | |||
| encodes the Cas9 molecule and results in | |||
| substantial reduction of the production of Cas9 | |||
| molecule. In an embodiment, the governing | |||
| gRNA molecule is a gRNA-targeting gRNA | |||
| molecule which targets, by binding and/or | |||
| cleavage, the sequence that encodes the gRNA | |||
| molecule and results in substantial reduction of | |||
| the production of gRNA molecule. |
| DNA | Yes | Similar to above, but in this embodiment, a Cas9 |
| molecule, typically an eiCas9 molecule, and a | ||
| gRNA are transcribed from a single molecule. A | ||
| governing gRNA molecule can also be present. | ||
| It can be encoded on the molecule that encodes | ||
| the Cas9 molecule or the gRNA molecule or can | ||
| be on a second nucleic acid molecule. The | ||
| governing gRNA molecule can be a Cas9- | ||
| targeting gRNA molecule or a gRNA-targeting | ||
| gRNA molecule. In an embodiment, both are | ||
| present. In an embodiment, the governing | ||
| gRNA molecule is a Cas9-targeting gRNA | ||
| molecule which targets, by binding and/or | ||
| cleavage, the sequence that encodes the Cas9 | ||
| molecule and results in substantial reduction of | ||
| the production of Cas9 molecule. In an | ||
| embodiment, the governing gRNA molecule is a | ||
| gRNA-targeting gRNA molecule which targets, | ||
| by binding and/or cleavage, the sequence that | ||
| encodes the gRNA molecule and results in | ||
| substantial reduction of the production of gRNA | ||
| molecule. |
| DNA | RNA | Yes | In this embodiment, a Cas9 molecule, typically |
| an eiCas9 molecule, is transcribed from DNA. | |||
| A gRNA is provided as RNA. In an | |||
| embodiment, the gRNA comprises one or more | |||
| modifications, e.g., as described in Section X. | |||
| A governing gRNA molecule can also be | |||
| present. It can be encoded on the molecule that | |||
| encodes the Cas9 molecule or can be on a | |||
| second nucleic acid molecule. In an | |||
| embodiment the governing gRNA molecule is a | |||
| Cas9-targeting gRNA molecule which targets, | |||
| by binding and/or cleavage, the sequence that | |||
| encodes the Cas9 molecule and results in | |||
| substantial reduction of the production of Cas9 | |||
| molecule. | |||
| mRNA | RNA | Yes | In this embodiment, a Cas9 molecule, typically |
| an eiCas9 molecule, is provided as encoded in | |||
| mRNA. A gRNA is provided as RNA. In an | |||
| embodiment, the gRNA comprises one or more | |||
| modifications, e.g., as described in Section X. | |||
| In an embodiment, the mRNA comprises one or | |||
| more modifications, e.g., as described in section | |||
| X. | |||
| Protein | DNA | Yes | In this embodiment a Cas9 molecule, typically |
| an eiCas9 molecule, is provided as a protein. A | |||
| gRNA is provided encoded in DNA. A | |||
| governing gRNA molecule can also be present. | |||
| It can be encoded on the molecule that encodes | |||
| the gRNA molecule or can be on a second | |||
| nucleic acid molecule. In an embodiment the | |||
| governing gRNA molecule is a gRNA-targeting | |||
| gRNA molecule which targets, by binding | |||
| and/or cleavage, the sequence that encodes the | |||
| gRNA molecule and results in substantial | |||
| reduction of the production of the gRNA | |||
| molecule. | |||
| Protein | RNA | Yes | In this embodiment, a Cas9 molecule, typically |
| an eiCas9 molecule, is provided as a protein. A | |||
| gRNA is provided as RNA. In an embodiment, | |||
| the gRNA comprises one or more modifications, | |||
| e.g., as described in Section X. | |||
In an embodiment, the components of a Cas system are delivered in vivo, e.g., using a method describe herein. In another embodiment, the components a Cas system are delivered ex vivo, e.g., using a method described herein.
Table V-2 summerizes various delivery methods the components of a Cas system, e.g., the Cas9 molecule component and the gRNA molecule component are described herein, e.g., in Table V-2.
| TABLE V-2 | ||||
| Delivery | ||||
| into Non- | Duration | Type of | ||
| Dividing | of | Genome | Molecule | |
| Delivery Vector/Mode | Cells | Expression | Integration | Delivered |
| Physical (eg, electroporation, | YES | Transient | NO | Nucleic Acids |
| particle gun, Calcium | and Proteins | |||
| Phosphate transfection) |
| Viral | Retrovirus | NO | Stable | YES | RNA |
| Lentivirus | YES | Stable | YES/NO with | RNA | |
| modifications | |||||
| Adenovirus | YES | Transient | NO | DNA | |
| Adeno- | YES | Stable | NO | DNA | |
| Associated | |||||
| Virus (AAV) | |||||
| Vaccinia Virus | YES | Very | NO | DNA | |
| Transient | |||||
| Herpes Simplex | YES | Stable | NO | DNA | |
| Virus | |||||
| Non-Viral | Cationic | YES | Transient | Depends on | Nucleic Acids |
| Liposomes | what is | and Proteins | |||
| delivered | |||||
| Polymeric | YES | Transient | Depends on | Nucleic Acids | |
| Nanoparticles | what is | and Proteins | |||
| delivered | |||||
| Biological | Attenuated | YES | Transient | NO | Nucleic Acids |
| Non-Viral | Bacteria | ||||
| Delivery | Engineered | YES | Transient | NO | Nucleic Acids |
| Vehicles | Bacteriophages | ||||
| Mammalian | YES | Transient | NO | Nucleic Acids | |
| Virus-like | |||||
| Particles | |||||
| Biological | YES | Transient | NO | Nucleic Acids | |
| liposomes: | |||||
| Erythrocyte | |||||
| Ghosts and | |||||
| Exosomes | |||||
DNA-Based Delivery of a Cas9 Molecule and or a gRNA Molecule
DNA encoding Cas9 molecules (e.g., eaCas9 molecules or eiCas9 molecules), gRNA molecules, and/or template nucleic acids, can be administered to subjects or delivered into cells by art-known methods or as described herein. For example, Cas9-encoding and/or gRNA-encoding DNA can be delivered, e.g., by vectors (e.g., viral or non-viral vectors), non-vector based methods (e.g., using naked DNA or DNA complexes), or a combination thereof.
In an embodiment, the DNA includes a nucleic acid that encodes a governing gRNA molecule. The governing gRNA molecule can complex with the Cas9 molecule to inactivate or silence a component of the system, e.g., the nucleic acid that encodes the Cas9 molecule or the nucleic acid that encodes the gRNA molecule. In either case, the governing gRNA, e.g., a Cas9-targeting gRNA molecule, or a gRNA targeting gRNA molecule, limits the effect of the Cas9/gRNA complex mediated gene targeting, and can place temporal limits on activity or reduce off-target activity.
In an embodiment, the Cas9- and/or gRNA-encoding DNA is delivered by a vector (e.g., viral vector/virus or plasmid).
A vector can comprise a sequence that encodes a Cas9 molecule and/or a gRNA molecule. A vector can also comprise a sequence encoding a signal peptide (e.g., for nuclear localization, nucleolar localization, mitochondrial localization), fused, e.g., to a Cas9 molecule sequence. For example, a vector can comprise a nuclear localization sequence (e.g., from SV40) fused to the sequence encoding the Cas9 molecule.
One or more regulatory/control elements, e.g., a promoter, an enhancer, an intron, a polyadenylation signal, a Kozak consensus sequence, internal ribosome entry sites (IRES), a 2A sequence, and a splice acceptor or donor can be included in the vectors. In an embodiment, the promoter is recognized by RNA polymerase II (e.g., a CMV promoter). In an embodiment, the promoter is recognized by RNA polymerase III (e.g., a U6 promoter). In an embodiment, the promoter is a regulated promoter (e.g., inducible promoter). In an embodiment, the promoter is a constitutive promoter. In an embodiment, the promoter is a tissue specific promoter. In an embodiment, the promoter is a viral promoter. In an embodiment, the promoter is a non-viral promoter.
In an embodiment, the vector or delivery vehicle is a viral vector (e.g., for generation of recombinant viruses). In an embodiment, the virus is a DNA virus (e.g., dsDNA or ssDNA virus). In an embodiment, the virus is an RNA virus (e.g., an ssRNA virus). Exemplary viral vectors/viruses include, e.g., retroviruses, lentiviruses, adenovirus, adeno-associated virus (AAV), vaccinia viruses, poxviruses, and herpes simplex viruses. In an embodiment, the viral vector, e.g., an AAV, comprises a sequence that encodes a governing gRNA molecule, e.g., a Cas9-targeting gRNA molecule or a gRNA-targeting gRNA molecule.
In an embodiment, the viral vector has the ability of cell type and/or tissue type recognition. For example, the viral vectors can be pseudotyped with different/alternative viral envelope glycoproteins; engineered with cell type-specific receptors (e.g., genetically modification of viral envelope glycoproteins to incorporate targeting ligands such as peptide ligands, single chain antibodies, growth factors); and/or engineered to have a molecular bridge with dual specificities with one end recognizing viral glycoproteins and the other end recognizing a moiety of the target cell surface (e.g., ligand-receptor, monoclonal antibodies, avidin-biotin and chemical conjugation).
In an embodiment, the viral vector achieves cell type specific expression. For example, tissue-specific promoter can be constructed to restrict expression of the transgene (Cas 9 and gRNA) in only the target cells. The specificity of the vectors can also be mediated by microRNA-dependent control of transgene expression. In an embodiment, the viral vector has increased efficiency of fusion of viral vector and target cell membrane. For example, fusion proteins such as fusion-competent hemagglutin (HA) can be incorporated to increase viral uptake into cells. In an embodiment, the viral vector has the ability of nuclear localization. For example, certain viruses that require the breakdown of the cell wall (during cell division) will not infect non-diving cell. Incorporated nuclear localization peptides into the matrix proteins of the virus allow transduction into non-proliferating cells.
In an embodiment, the virus infects dividing cells. In an embodiment, the virus infects non-dividing cells. In an embodiment, the virus infects both dividing and non-dividing cells. In an embodiment, the virus can integrate into the host genome. In an embodiment, the virus is engineered to have reduced immunity, e.g., in human. In an embodiment, the virus is replication-competent. In an embodiment, the virus is replication-defective, e.g., having one or more coding regions for the genes necessary for additional rounds of virion replication and/or packaging replaced with other genes or deleted. In an embodiment, the virus causes transient expression of the Cas9 molecule and/or the gRNA molecule. In an embodiment, the virus causes long-lasting, e.g., at least 1 week, 2 weeks, 1 month, 2 months, 3 months, 6 months, 9 months, 1 year, 2 years, or permanent expression, of the Cas9 molecule and/or the gRNA molecule. The packaging capacity of the viruses may vary, e.g., from at least about 4 kb to at least about 30 kb, e.g., at least about 5 kb, 10 kb, 15 kb, 20 kb, 25 kb, 30 kb, 35 kb, 40 kb, 45 kb, or 50 kb.
In an embodiment, the Cas9- and/or gRNA-encoding DNA is delivered by a recombinant retrovirus. In an embodiment, the retrovirus (e.g., Moloney murine leukemia virus) comprises a reverse transcriptase, e.g., that allows integration into the host genome. In an embodiment, the retrovirus is replication-competent. In an embodiment, the retrovirus is replication-defective, e.g., having one of more coding regions for the genes necessary for additional rounds of virion replication and packaging replaced with other genes, or deleted.
In an embodiment, the Cas9- and/or gRNA-encoding DNA is delivered by a recombinant lentivirus. For example, the lentivirus is replication-defective, e.g., does not comprise one or more genes required for viral replication.
In an embodiment, the Cas9- and/or gRNA-encoding DNA is delivered by a recombinant adenovirus. In an embodiment, the adenovirus is engineered to have reduced immunity in human.
In an embodiment, the Cas9- and/or gRNA-encoding DNA is delivered by a recombinant AAV. In an embodiment, the AAV can incorporate its genome into that of a host cell, e.g., a target cell as described herein. In an embodiment, the AAV is a self-complementary adeno-associated virus (scAAV), e.g., a scAAV that packages both strands which anneal together to form double stranded DNA. AAV serotypes that may be used in the disclosed methods include, e.g., AAV1, AAV2, modified AAV2 (e.g., modifications at Y444F, Y500F, Y730F and/or S662V), AAV3, modified AAV3 (e.g., modifications at Y705F, Y731F and/or T492V), AAV4, AAV5, AAV6, modified AAV6 (e.g., modifications at S663V and/or T492V), AAV8, AAV 8.2, AAV9, AAV rh 10, and pseudotyped AAV, such as AAV2/8, AAV2/5 and AAV2/6 can also be used in the disclosed methods.
In an embodiment, the Cas9- and/or gRNA-encoding DNA is delivered by a hybrid virus, e.g., a hybrid of one or more of the viruses described herein.
A packaging cell is used to form a virus particle that is capable of infecting a host or target cell. Such a cell includes a 293 cell, which can package adenovirus, and a w2 cell or a PA317 cell, which can package retrovirus. A viral vector used in gene therapy is usually generated by a producer cell line that packages a nucleic acid vector into a viral particle. The vector typically contains the minimal viral sequences required for packaging and subsequent integration into a host or target cell (if applicable), with other viral sequences being replaced by an expression cassette encoding the protein to be expressed. For example, an AAV vector used in gene therapy typically only possesses inverted terminal repeat (ITR) sequences from the AAV genome which are required for packaging and gene expression in the host or target cell. The missing viral functions are supplied in trans by the packaging cell line. Henceforth, the viral DNA is packaged in a cell line, which contains a helper plasmid encoding the other AAV genes, namely rep and cap, but lacking ITR sequences. The cell line is also infected with adenovirus as a helper. The helper virus promotes replication of the AAV vector and expression of AAV genes from the helper plasmid. The helper plasmid is not packaged in significant amounts due to a lack of ITR sequences. Contamination with adenovirus can be reduced by, e.g., heat treatment to which adenovirus is more sensitive than AAV.
In an embodiment, the viral vector has the ability of cell type and/or tissue type recognition. For example, the viral vector can be pseudotyped with a different/alternative viral envelope glycoprotein; engineered with a cell type-specific receptor (e.g., geneticmodification of the viral envelope glycoproteins to incorporate targeting ligands such as a peptide ligand, a single chain antibodie, a growth factor); and/or engineered to have a molecular bridge with dual specificities with one end recognizing a viral glycoprotein and the other end recognizing a moiety of the target cell surface (e.g., ligand-receptor, monoclonal antibody, avidin-biotin and chemical conjugation).
In an embodiment, the viral vector achieves cell type specific expression. For example, a tissue-specific promoter can be constructed to restrict expression of the transgene (Cas 9 and gRNA) in only the target cell. The specificity of the vector can also be mediated by microRNA-dependent control of transgene expression. In an embodiment, the viral vector has increased efficiency of fusion of the viral vector and a target cell membrane. For example, a fusion protein such as fusion-competent hemagglutin (HA) can be incorporated to increase viral uptake into cells. In an embodiment, the viral vector has the ability of nuclear localization. For example, aviruse that requires the breakdown of the cell wall (during cell division) and therefore will not infect a non-diving cell can be altered to incorporate a nuclear localization peptide in the matrix protein of the virus thereby enabling the transduction of non-proliferating cells. In an embodiment, the Cas9- and/or gRNA-encoding DNA is delivered by a non-viral vector or non-vector based method (e.g., using naked DNA or DNA complexes). For example, the DNA can be delivered, e.g., by organically modified silica or silicate (Ormosil), electroporation, gene gun, sonoporation, magnetofection, lipid-mediated transfection, dendrimers, inorganic nanoparticles, calcium phosphates, or a combination thereof. In an embodiment, the DNA is delivered by an inorganic nanoparticle (e.g., attached to the payload to the surface of the nanoparticle). Exemplary inorganic nanoparticles include, e.g., magnetic nanoparticles (e.g., Fe3MnO2), silica (e.g., can integrate multi-functionality, e.g., conjugate the outer surface of the nanoparticle with a positively charged polymer (e.g., polyethylenimine, polylysine, polyserine) which allows for attachment (e.g., conjugation or entrapment) of payload and internal magnetic component, mesaporous silica nanoparticles with a positive charged polymer loaded with chloroquine to enhance transfection of the non-viral vector in vitro, high density lipoproteins and gold nanoparticles, gold nanoparticles coated with payload which gets released when nanoparticles are exposed to increased temperature by exposure to near infrared light, gold, iron or silver nanoparticles with surface modified with polylysine or another charge polymer to capture the nucleic acid cargo. In an embodiment, the DNA is delivered by an organic nanoparticle (e.g., entrapment of the payload inside the nanoparticle). Exemplary organic nanoparticles include, e.g., SNALP liposomes that contain cationic lipids together with neutral helper lipids which are coated with polyethylene glycol (PEG) and protamine and nucleic acid complex coated with lipid coating.
In an embodiment, the delivery vehicle is a physical vehicle. In an embodiment, the vehicle is low density ultrasound. For example, microbubbles containing payload (e.g., made of biocompatible material such protein, surfactant, or biocompatible polymer or lipid shell) can be used and the microbubbles can be destructed by a focused ultrasound bean during microvascular transit. In an embodiment, the vehicle is electroporation. For example, naked nucleic acids or proteins can be delivered by electroporation, e.g., into cell suspensions or tissue environment, such as retina and embryonic tissue. In an embodiment, the vehicle is needle or jet injection. For example, naked nucleic acids or protein can be injected into, e.g., muscular, liver, skin, brain or heart tissue.
In an embodiment, the Cas9- and/or gRNA-encoding DNA is delivered by a combination of a vector and a non-vector based method. For example, a virosome comprises a liposome combined with an inactivated virus (e.g., HIV or influenza virus), which can result in more efficient gene transfer, e.g., in a respiratory epithelial cell than either a viral or a liposomal method alone.
In an embodiment, the delivery vehicle is a non-viral vector. In an embodiment, the non-viral vector is an inorganic nanoparticle (e.g., attached to the payload to the surface of the nanoparticle). Exemplary inorganic nanoparticles include, e.g., magnetic nanoparticles (e.g., Fe3MnO2), or silica. The outer surface of the nanoparticle can be conjugated with a positively charged polymer (e.g., polyethylenimine, polylysine, polyserine) which allows for attachment (e.g., conjugation or entrapment) of payload. In an embodiment, the non-viral vector is an organic nanoparticle (e.g., entrapment of the payload inside the nanoparticle). Exemplary organic nanoparticles include, e.g., SNALP liposomes that contain cationic lipids together with neutral helper lipids which are coated with polyethylene glycol (PEG) and protamine and nucleic acid complex coated with lipid coating.
Exemplary lipids for gene transfer are shown in Table V-3.
| TABLE V-3 |
| Lipids Used for Gene Transfer |
| Lipid | Abbreviation | Feature |
| 1,2-Dioleoyl-sn-glycero-3-phosphatidylcholine | DOPC | Helper |
| 1,2-Dioleoyl-sn-glycero-3-phosphatidylethanolamine | DOPE | Helper |
| Cholesterol | Helper | |
| N-[1-(2,3-Dioleyloxy)prophyl]N,N,N-trimethylammonium | DOTMA | Cationic |
| chloride | ||
| 1,2-Dioleoyloxy-3-trimethylammonium-propane | DOTAP | Cationic |
| Dioctadecylamidoglycylspermine | DOGS | Cationic |
| N-(3-Aminopropyl)-N,N-dimethyl-2,3-bis(dodecyloxy)-1- | GAP-DLRIE | Cationic |
| propanaminium bromide | ||
| Cetyltrimethylammonium bromide | CTAB | Cationic |
| 6-Lauroxyhexyl ornithinate | LHON | Cationic |
| 1-(2,3-Dioleoyloxypropyl)-2,4,6-trimethylpyridinium | 2Oc | Cationic |
| 2,3-Dioleyloxy-N-[2(sperminecarboxamido-ethyl]-N,N-dimethyl- | DOSPA | Cationic |
| 1-propanaminium trifluoroacetate | ||
| 1,2-Dioleyl-3-trimethylammonium-propane | DOPA | Cationic |
| N-(2-Hydroxyethyl)-N,N-dimethyl-2,3-bis(tetradecyloxy)-1- | MDRIE | Cationic |
| propanaminium bromide | ||
| Dimyristooxypropyl dimethyl hydroxyethyl ammonium bromide | DMRI | Cationic |
| 3β-[N-(N′,N′-Dimethylaminoethane)-carbamoyl]cholesterol | DC-Chol | Cationic |
| Bis-guanidium-tren-cholesterol | BGTC | Cationic |
| 1,3-Diodeoxy-2-(6-carboxy-spermyl)-propylamide | DOSPER | Cationic |
| Dimethyloctadecylammonium bromide | DDAB | Cationic |
| Dioctadecylamidoglicylspermidin | DSL | Cationic |
| rac-[(2,3-Dioctadecyloxypropyl)(2-hydroxyethyl)]- | CLIP-1 | Cationic |
| dimethylammonium chloride | ||
| rac-[2(2,3-Dihexadecyloxypropyl- | CLIP-6 | Cationic |
| oxymethyloxy)ethyl]trimethylammonium bromide | ||
| Ethyldimyristoylphosphatidylcholine | EDMPC | Cationic |
| 1,2-Distearyloxy-N,N-dimethyl-3-aminopropane | DSDMA | Cationic |
| 1,2-Dimyristoyl-trimethylammonium propane | DMTAP | Cationic |
| O,O′-Dimyristyl-N-lysyl aspartate | DMKE | Cationic |
| 1,2-Distearoyl-sn-glycero-3-ethylphosphocholine | DSEPC | Cationic |
| N-Palmitoyl D-erythro-sphingosyl carbamoyl-spermine | CCS | Cationic |
| N-t-Butyl-N0-tetradecyl-3-tetradecylaminopropionamidine | diC14-amidine | Cationic |
| Octadecenolyoxy[ethyl-2-heptadecenyl-3 hydroxyethyl] | DOTIM | Cationic |
| imidazolinium chloride | ||
| N1-Cholesteryloxycarbonyl-3,7-diazanonane-1,9-diamine | CDAN | Cationic |
| 2-(3-[Bis(3-amino-propyl)-amino]propylamino)-N- | RPR209120 | Cationic |
| ditetradecylcarbamoylme-ethyl-acetamide | ||
| 1,2-dilinoleyloxy-3-dimethylaminopropane | DLinDMA | Cationic |
| 2,2-dilinoleyl-4-dimethylaminoethyl-[1,3]-dioxolane | DLin-KC2- | Cationic |
| DMA | ||
| dilinoleyl-methyl-4-dimethylaminobutyrate | DLin-MC3- | Cationic |
| DMA | ||
Exemplary polymers for gene transfer are shown below in Table V-4.
| TABLE V-4 |
| Polymers Used for Gene Transfer |
| Polymer | Abbreviation | |
| Poly(ethylene)glycol | PEG | |
| Polyethyleniminc | PEI | |
| Dithiobis(succinimidylpropionate) | DSP | |
| Dimethyl-3,3′-dithiobispropionimidate | DTBP | |
| Poly(ethyleneimine)biscarbamate | PEIC | |
| Poly(L-lysine) | PLL | |
| Histidine modified PLL | ||
| Poly(N-vinylpyrrolidone) | PVP | |
| Poly(propylenimine) | PPI | |
| Poly(amidoamine) | PAMAM | |
| Poly(amidoethylenimine) | SS-PAEI | |
| Triethylenetetramine | TETA | |
| Poly(β-aminoester) | ||
| Poly(4-hydroxy-L-proline ester) | PHP | |
| Poly(allylamine) | ||
| Poly(α-[4-aminobutyl]-L-glycolic acid) | PAGA | |
| Poly(D,L-lactic-co-glycolic acid) | PLGA | |
| Poly(N-ethyl-4-vinylpyridinium bromide) | ||
| Poly(phosphazene)s | PPZ | |
| Poly(phosphoester)s | PPE | |
| Poly(phosphoramidate)s | PPA | |
| Poly(N-2-hydioxypropylmethacrylamide) | pHPMA | |
| Poly(2-(dimethylamino)ethyl methacrylate) | pDMAEMA | |
| Poly(2-aminoethyl propylene phosphate) | PPE-EA | |
| Chitosan | ||
| Galactosylated chitosan | ||
| N-Dodacylated chitosan | ||
| Histone | ||
| Collagen | ||
| Dextran-spermine | D-SPM | |
In an embodiment, the vehicle has targeting modifications to increase target cell uptake of nanoparticles and liposomes, e.g., cell specific antigens, monoclonal antibodies, single chain antibodies, aptamers, polymers, sugars, and cell penetrating peptides. In an embodiment, the vehicle uses fusogenic and endosome-destabilizing peptides/polymers. In an embodiment, the vehicle undergoes acid-triggered conformational changes (e.g., to accelerate endosomal escape of the cargo). In an embodiment, a stimuli-cleavable polymer is used, e.g., for release in a cellular compartment. For example, disulfide-based cationic polymers that are cleaved in the reducing cellular environment can be used.
In an embodiment, liposomes are used for delivery, e.g., to blood or bone marrow, e.g., as a way of targeting hematopoietic stem cells (HSCs) and progenitors. For example, long-term treatment can be enabled by direct delivery using liposomes for conditions where obtaining HSCs is difficult (e.g., HSCs are not stable or HSCs are rare). These conditions can include, e.g., sickle cell anemia, Fanconi anemia, and aplastic anemia. In an embodiment, liposomes are used for delivery to localized specific tissues, e.g., to liver or lung, via intravenous delivery or via localized injection to target organ or its blood flow. For example, long-term treatment can be enable to concentrate effect in that specific organ or tissue type. These conditions can include urea cycle disorders, alpha-1-anti-trypsin or cystic fibrosis.
In an embodiment, the delivery vehicle is a biological non-viral delivery vehicle. In an embodiment, the vehicle is an attenuated bacterium (e.g., naturally or artificially engineered to be invasive but attenuated to prevent pathogenesis and expressing the transgene (e.g., Listeria monocytogenes, certain Salmonella strains, Bifidobacterium longum, and modified Escherichia coli), bacteria having nutritional and tissue-specific tropism to target specific tissues, bacteria having modified surface proteins to alter target tissue specificity). In an embodiment, the vehicle is a genetically modified bacteriophage (e.g., engineered phages having large packaging capacity, less immunogenic, containing mammalian plasmid maintenance sequences and having incorporated targeting ligands). In an embodiment, the vehicle is a mammalian virus-like particle. For example, modified viral particles can be generated (e.g., by purification of the “empty” particles followed by ex vivo assembly of the virus with the desired cargo). The vehicle can also be engineered to incorporate targeting ligands to alter target tissue specificity. In an embodiment, the vehicle is a biological liposome. For example, the biological liposome is a phospholipid-based particle derived from human cells (e.g., erythrocyte ghosts, which are red blood cells broken down into spherical structures derived from the subject (e.g., tissue targeting can be achieved by attachment of various tissue or cell-specific ligands), or secretory exosomes—subject (i.e., patient) derived membrane-bound nanovescicle (30-100 nm) of endocytic origin (e.g., can be produced from various cell types and can therefore be taken up by cells without the need of for targeting ligands).
In an embodiment, delivery of Cas components by nanoparticles in the bone marrow is an in vivo approach to curing blood and immune diseases.
In an embodiment, the components of a Cas system, e.g., the Cas9 molecule component and the gRNA molecule component described herein is delivered by nucleofection. For example, Nucleofector™ (Lonza Cologne AG) is a transfection technology that can be used for delivery to primary cells and difficult-to-transfect cell lines. It is a non-viral method based on a combination of electrical parameters and cell-type specific solutions. It allows transfected nucleic acids to directly enter the nucleus (e.g., without relying on cell division for the transfer of nucleic acids into the nucleus), providing the ability to transfect non-dividing cells, such as neurons and resting blood cells. In an embodiment, nucleofection is used as an ex vivo delivery method.
In an embodiment, the components of a Cas system, e.g., the Cas9 molecule component and the gRNA molecule component described herein is delivered by methods utilizing endogenous receptor-mediate transporters, e.g., antibody-based molecular Trojan Horses (ArmaGen). Such methods can allow for non-invasive delivery of therapeutics to locations that are otherwise difficult to reach, e.g., brain (e.g., to cross blood brain barrier (BBB), e.g., via endogenous receptor-mediated transport processes).
In an embodiment, one or more nucleic acid molecules (e.g., DNA molecules) other than the components of a Cas system, e.g., the Cas9 molecule component and/or the gRNA molecule component described herein, are delivered. In an embodiment, the nucleic acid molecule is delivered at the same time as one or more of the components of the Cas system are delivered. In an embodiment, the nucleic acid molecule is delivered before or after (e.g., less than about 30 minutes, 1 hour, 2 hours, 3 hours, 6 hours, 9 hours, 12 hours, 1 day, 2 days, 3 days, 1 week, 2 weeks, or 4 weeks) one or more of the components of the Cas system are delivered. In an embodiment, the nucleic acid molecule is delivered by a different means than one or more of the components of the Cas system, e.g., the Cas9 molecule component and/or the gRNA molecule component, are delivered. The nucleic acid molecule can be delivered by any of the delivery methods described herein. For example, the nucleic acid molecule can be delivered by a viral vector, e.g., an integration-deficient lentivirus, and the Cas9 molecule component and/or the gRNA molecule component can be delivered by electroporation, e.g., such that the toxicity caused by nucleic acids (e.g., DNAs) can be reduced. In an embodiment, the nucleic acid molecule encodes a therapeutic protein, e.g., a protein described herein. In an embodiment, the nucleic acid molecule encodes an RNA molecule, e.g., an RNA molecule described herein.
Delivery of RNA Encoding a Cas9 Molecule
RNA encoding Cas9 molecules (e.g., eaCas9 molecules, eiCas9 molecules or eiCas9 fusion proteins) and/or gRNA molecules, can be delivered into cells, e.g., target cells described herein, by art-known methods or as described herein. For example, Cas9-encoding and/or gRNA-encoding RNA can be delivered, e.g., by microinjection, electroporation, lipid-mediated transfection, peptide-mediated delivery, or a combination thereof.
Delivery Cas9 Molecule Protein
Cas9 molecules (e.g., eaCas9 molecules, eiCas9 molecules or eiCas9 fusion proteins) can be delivered into cells by art-known methods or as described herein. For example, Cas9 protein molecules can be delivered, e.g., by microinjection, electroporation, lipid-mediated transfection, peptide-mediated delivery, or a combination thereof. Delivery can be accompanied by DNA encoding a gRNA or by a gRNA.
Route of Administration
Systemic modes of administration include oral and parenteral routes. Parenteral routes include, by way of example, intravenous, intrarterial, intraosseous, intramuscular, intradermal, subcutaneous, intranasal and intraperitoneal routes. Components administered systemically may be modified or formulated to target the components to a specific organ or cell type.
Local modes of administration include, by way of example, intrathecal, intracerebroventricular, intraparenchymal (e.g., localized intraparenchymal delivery to the striatum (e.g., into the caudate or into the putamen)), cerebral cortex, precentral gyrus, hippocampus (e.g., into the dentate gyrus or CA3 region), temporal cortex, amygdala, frontal cortex, thalamus, cerebellum, medulla, hypothalamus, tectum, tegmentum or substantia nigra intraocular, intraorbital, subconjuctival, intravitreal, subretinal or transscleral routes. In an embodiment, significantly smaller amounts of the components (compared with systemic approaches) may exert an effect when administered locally (for example, intraparenchymal or intravitreal) compared to when administered systemically (for example, intravenously). Local modes of administration can reduce or eliminate the incidence of potentially toxic side effects that may occur when therapeutically effective amounts of a component are administered systemically.
In an embodiment, components described herein are delivered by intraparenchymal injection into discrete regions of the brain, including, e.g., regions comprising medium spiny neurons, or regions comprising cortical neurons. Injections may be made directly into more than one region of the brain.
In an embodiment, components described herein are delivered by subretinally, e.g., by subretinal injection. Subretinal injections may be made directly into the macular, e.g., submacular injection.
In an embodiment, components described herein are delivered by intravitreal injection. Intravitreal injection has a relatively low risk of retinal detachment risk. In an embodiment, a nanoparticle or viral vector, e.g., AAV vector, e.g., an AAV2 vector, e.g., a modified AAV2 vector, is delivered intravitreally.
In an embodiment, a nanoparticle or viral vector, e.g., AAV vector, delivery is via intraparenchymal injection.
Methods for administration of agents to the eye are known in the medical arts and can be used to administer components described herein. Exemplary methods include intraocular injection (e.g., retrobulbar, subretinal, submacular, intravitreal and intrachoridal), iontophoresis, eye drops, and intraocular implantation (e.g., intravitreal, sub-Tenons and sub-conjunctival).
Administration may be provided as a periodic bolus (for example, subretinally, intravenously or intravitreally) or as continuous infusion from an internal reservoir (for example, from an implant disposed at an intra- or extra-ocular location (see, U.S. Pat. Nos. 5,443,505 and 5,766,242)) or from an external reservoir (for example, from an intravenous bag). Components may be administered locally, for example, by continuous release from a sustained release drug delivery device immobilized to an inner wall of the eye or via targeted transscleral controlled release into the choroid (see, for example, PCT/US00/00207, PCT/US02/14279, Ambati et al., (2000) INVEST. OPHTHALMOL. VIS. SCI. 41:1181-1185, and Ambati et al., (2000) INVEST. OPHTHALMOL. VIS. SCI. 41:1186-1191). A variety of devices suitable for administering components locally to the inside of the eye are known in the art. See, for example, U.S. Pat. Nos. 6,251,090, 6,299,895, 6,416,777, 6,413,540, and PCT/US00/28187.
In addition, components may be formulated to permit release over a prolonged period of time. A release system can include a matrix of a biodegradable material or a material which releases the incorporated components by diffusion. The components can be homogeneously or heterogeneously distributed within the release system. A variety of release systems may be useful, however, the choice of the appropriate system will depend upon rate of release required by a particular application. Both non-degradable and degradable release systems can be used. Suitable release systems include polymers and polymeric matrices, non-polymeric matrices, or inorganic and organic excipients and diluents such as, but not limited to, calcium carbonate and sugar (for example, trehalose). Release systems may be natural or synthetic. However, synthetic release systems are preferred because generally they are more reliable, more reproducible and produce more defined release profiles. The release system material can be selected so that components having different molecular weights are released by diffusion through or degradation of the material.
Representative synthetic, biodegradable polymers include, for example: polyamides such as poly(amino acids) and poly(peptides); polyesters such as poly(lactic acid), poly(glycolic acid), poly(lactic-co-glycolic acid), and poly(caprolactone); poly(anhydrides); polyorthoesters; polycarbonates; and chemical derivatives thereof (substitutions, additions of chemical groups, for example, alkyl, alkylene, hydroxylations, oxidations, and other modifications routinely made by those skilled in the art), copolymers and mixtures thereof. Representative synthetic, non-degradable polymers include, for example: polyethers such as poly(ethylene oxide), poly(ethylene glycol), and poly(tetramethylene oxide); vinyl polymers-polyacrylates and polymethacrylates such as methyl, ethyl, other alkyl, hydroxyethyl methacrylate, acrylic and methacrylic acids, and others such as poly(vinyl alcohol), poly(vinyl pyrolidone), and poly(vinyl acetate); poly(urethanes); cellulose and its derivatives such as alkyl, hydroxyalkyl, ethers, esters, nitrocellulose, and various cellulose acetates; polysiloxanes; and any chemical derivatives thereof (substitutions, additions of chemical groups, for example, alkyl, alkylene, hydroxylations, oxidations, and other modifications routinely made by those skilled in the art), copolymers and mixtures thereof.
Poly(lactide-co-glycolide) microsphere can also be used for intraocular injection. Typically the microspheres are composed of a polymer of lactic acid and glycolic acid, which are structured to form hollow spheres. The spheres can be approximately 15-30 microns in diameter and can be loaded with components described herein.
Bi-Modal or Differential Delivery of Components
Separate delivery of the components of a Cas system, e.g., the Cas9 molecule component and the gRNA molecule component, and more particularly, delivery of the components by differing modes, can enhance performance, e.g., by improving tissue specificity and safety.
In an embodiment, the Cas9 molecule and the gRNA molecule are delivered by different modes, or as sometimes referred to herein as differential modes. Different or differential modes, as used herein, refer modes of delivery that confer different pharmacodynamic or pharmacokinetic properties on the subject component molecule, e.g., a Cas9 molecule, gRNA molecule, or template nucleic acid. For example, the modes of delivery can result in different tissue distribution, different half-life, or different temporal distribution, e.g., in a selected compartment, tissue, or organ.
Some modes of delivery, e.g., delivery by a nucleic acid vector that persists in a cell, or in progeny of a cell, e.g., by autonomous replication or insertion into cellular nucleic acid, result in more persistent expression of and presence of a component. Examples include viral, e.g., adeno associated virus or lentivirus, delivery.
By way of example, the components, e.g., a Cas9 molecule and a gRNA molecule, can be delivered by modes that differ in terms of resulting half life or persistent of the delivered component the body, or in a particular compartment, tissue or organ. In an embodiment, a gRNA molecule can be delivered by such modes. The Cas9 molecule component can be delivered by a mode which results in less persistence or less exposure of its to the body or a particular compartment or tissue or organ.
More generally, in an embodiment, a first mode of delivery is used to deliver a first component and a second mode of delivery is used to deliver a second component. The first mode of delivery confers a first pharmacodynamic or pharmacokinetic property. The first pharmacodynamic property can be, e.g., distribution, persistence, or exposure, of the component, or of a nucleic acid that encodes the component, in the body, a compartment, tissue or organ. The second mode of delivery confers a second pharmacodynamic or pharmacokinetic property. The second pharmacodynamic property can be, e.g., distribution, persistence, or exposure, of the component, or of a nucleic acid that encodes the component, in the body, a compartment, tissue or organ.
In an embodiment, the first pharmacodynamic or pharmacokinetic property, e.g., distribution, persistence or exposure, is more limited than the second pharmacodynamic or pharmacokinetic property.
In an embodiment, the first mode of delivery is selected to optimize, e.g., minimize, a pharmacodynamic or pharmacokinetic property, e.g., distribution, persistence or exposure.
In an embodiment, the second mode of delivery is selected to optimize, e.g., maximize, a pharmacodynamic or pharmcokinetic property, e.g., distribution, persistence or exposure.
In an embodiment, the first mode of delivery comprises the use of a relatively persistent element, e.g., a nucleic acid, e.g., a plasmid or viral vector, e.g., an AAV or lentivirus. As such vectors are relatively persistent product transcribed from them would be relatively persistent.
In an embodiment, the second mode of delivery comprises a relatively transient element, e.g., an RNA or protein.
In an embodiment, the first component comprises gRNA, and the delivery mode is relatively persistent, e.g., the gRNA is transcribed from a plasmid or viral vector, e.g., an AAV or lentivirus. Transcription of these genes would be of little physiological consequence because the genes do not encode for a protein product, and the gRNAs are incapable of acting in isolation. The second component, a Cas9 molecule, is delivered in a transient manner, for example as mRNA or as protein, ensuring that the full Cas9 molecule/gRNA molecule complex is only present and active for a short period of time.
Furthermore, the components can be delivered in different molecular form or with different delivery vectors that complement one another to enhance safety and tissue specificity.
Use of differential delivery modes can enhance performance, safety and efficacy. For example, the likelihood of an eventual off-target modification can be reduced. Delivery of immunogenic components, e.g., Cas9 molecules, by less persistent modes can reduce immunogenicity, as peptides from the bacterially-derived Cas enzyme are displayed on the surface of the cell by MHC molecules. A two-part delivery system can alleviate these drawbacks.
Differential delivery modes can be used to deliver components to different, but overlapping target regions. The formation active complex is minimized outside the overlap of the target regions. Thus, in an embodiment, a first component, e.g., a gRNA molecule is delivered by a first delivery mode that results in a first spatial, e.g., tissue, distribution. A second component, e.g., a Cas9 molecule is delivered by a second delivery mode that results in a second spatial, e.g., tissue, distribution. In an embodiment, the first mode comprises a first element selected from a liposome, nanoparticle, e.g., polymeric nanoparticle, and a nucleic acid, e.g., viral vector. The second mode comprises a second element selected from the group. In an embodiment, the first mode of delivery comprises a first targeting element, e.g., a cell specific receptor or an antibody, and the second mode of delivery does not include that element. In an embodiment, the second mode of delivery comprises a second targeting element, e.g., a second cell specific receptor or second antibody.
When the Cas9 molecule is delivered in a virus delivery vector, a liposome, or polymeric nanoparticle, there is the potential for delivery to and therapeutic activity in multiple tissues, when it may be desirable to only target a single tissue. A two-part delivery system can resolve this challenge and enhance tissue specificity. If the gRNA molecule and the Cas9 molecule are packaged in separated delivery vehicles with distinct but overlapping tissue tropism, the fully functional complex is only be formed in the tissue that is targeted by both vectors.
Cas9 molecules, typically eiCas9 molecules and gRNA molecules, e.g., an eiCas9 molecule/gRNA molecule complex, can be used to deliver a wide variety of payloads. In an embodiment, the payload is delivered to target nucleic acids or to chromatin, or other components, near or associated with a target nucleic acid.
While not wishing to be bound by theory, it is believed that the sequence specificity of the gRNA molecule of an eiCas9 molecule/gRNA molecule complex contributes to a specific interaction with the target sequence, thereby effecting the delivery of a payload associated with, e.g., covalently or noncovalently coupled to, the Cas9 molecule/gRNA molecule complex.
In an embodiment, the payload is covalently or non-covalently coupled to a Cas9, e.g., an eiCas9 molecule. In an embodiment, the payload is covalently or non-covalently coupled to a gRNA molecule. In an embodiment, the payload is linked to a Cas9 molecule, or gRNA molecule, by a linker, e.g., a linker which comprises a bond cleavable under physiological conditions. In an embodiment the bond is not cleavable or is only poorly cleavable, under physiological conditions. In an embodiment, “covalently coupled” means as part of a fusion protein containing a Cas9 molecule.
Delivery of Multiple Payloads
In an embodiment, a first payload molecule is delivered by a first Cas9 molecule and a second payload molecule is delivered by a second Cas9 molecule. In an embodiment, the first and second payloads are the same. In an embodiment, first and second Cas9 molecules are the same, e.g. are from the same species, have the same PAM, and/or have the same sequence. In an embodiment, first and second Cas9 molecules are different, e.g. are from different species, have the different PAMs, and/or have different sequences. Examples of configurations are provided in Table VI-1. Typically the Cas9 molecules of Table VI-1 are eiCas9 molecules. In an embodiment, a Cas9 molecule is selected such that payload delivery and cleavage are both effected. In an embodiment, multiple payloads, e.g., two payloads, is delivered with a single Cas9 molecule.
| TABLE VI-1 |
| Configurations for delivery of payloads by more |
| than one Cas9 molecule/gRNA molecule complex |
| Sec- | ||||
| Second | First | ond | ||
| First Cas9 | Cas9 | Pay- | Pay- | |
| molecule | molecule | load | load | Comments |
| C1 | C1 | P1 | P1 | In this embodiment, both Cas9 |
| molecules are the same, as are | ||||
| both payloads. In an embodi- | ||||
| ment, the first and second | ||||
| Cas9 molecule are guided by | ||||
| different gRNA molecules. | ||||
| C1 | C1 | P1 | P2 | In this embodiment, both Cas9 |
| molecules are the same but each | ||||
| delivers a different Payloads. | ||||
| In an embodiment, the first and | ||||
| second Cas9 molecule are | ||||
| guided by different gRNA | ||||
| molecules. | ||||
| C1 | C2 | P1 | P1 | In this embodiment, the Cas9 |
| molecules are different but each | ||||
| delivers the same payload. In an | ||||
| embodiment, the first and | ||||
| second Cas9 molecule are | ||||
| guided by different gRNA | ||||
| molecules. | ||||
| C1 | C2 | P1 | P2 | In this embodiment, the Cas9 |
| molecules are different as are the | ||||
| payloads. In an embodiment, the | ||||
| first and second Cas9 molecule | ||||
| are guided by different gRNA | ||||
| molecules. | ||||
In an embodiment, two different drugs are delivered. In an embodiment, a first payload, e.g., a drug, coupled by a first linker to a first Cas9 molecule and a second payload, e.g., a drug, coupled by a second linker to a second Cas9 molecule are delivered. In an embodiment, the first and second payloads are the same, and, in an embodiment, are coupled to the respective Cas9 molecule by different linkers, e.g., having different release kinetics. In an embodiment, the first and second payloads are different, and, in an embodiment, are coupled to the respective Cas9 molecule by the same linker. In an embodiment, the first and second payload interact. E.g., the first and second payloads form a complex, e.g., a dimeric or multimeric complex, e.g., a dimeric protein. In an embodiment, the first payload can activate the second payload, e.g., the first payload can modify, e.g., cleave or phosphorylate, the second payload. In an embodiment the first payload interacts with the second payload to modify, e.g., increase or decrease, an activity of the second payload.
A payload can be delivered in vitro, ex vivo, or in vivo.
Classes of Payloads A payload can comprise a large molecule or biologics (e.g., antibody molecules), a fusion protein, an amino acid sequence fused, as a fusion partner, to a Cas9 molecule, e.g., an eiCas9 molecule, an enzyme, a small molecules (e.g., HDAC and other chromatin modifiers/inhibitors, exon skipping molecules, transcription inhibitors), a microsatellite extension inhibitor, a carbohydrate, and DNA degraders (e.g., in an infectious disease or “foreign” DNA setting), a nucleic acid, e.g., a DNA, RNA, mRNA, siRNA, RNAi, or an antisense oligonucleotide.
Table VI-2 provides exemplary classes of payloads.
| TABLE VI-2 |
| Exemplary Classes of Payloads |
| Large Molecules | |
| Small Molecules | |
| Polymers | |
| Biologics | |
| Proteins and polypeptides, e.g., antibodies, | |
| enzymes, structural peptides, ligands, receptors, | |
| fusion proteins, fusion partners (as a fusion protein | |
| with a Cas9, e.g., and eiCas9) | |
| Carbohydrates | |
| HDAC and other chromatin modifiers/inhibitors | |
| Exon skipping molecules, | |
| Transcription inhibitors | |
| Microsatellite extension inhibitors | |
| Entities that degrade DNA | |
Large Molecules
In an embodiment a payload comprises a polymer, e.g., a biological polymer, e.g., a protein, nucleic acid, or carbohydrate.
In an embodiment the payload comprises a protein, biologic, or other large molecule (i.e., a molecule having a molecular weight of at least, 3, 5, 10, 20, 30, 40, 50, 60, 70, 80, 90, or 100 kD). In an embodiment a payload comprises a polymer, e.g., a biological polymer, e.g., a protein, nucleic acid, or carbohydrate. The polymer can be a naturally occurring or non-naturally occurring polymer. In an embodiment, the payload is a natural product. For example, the natural product can be a large molecule or a small molecule.
Polypeptides, Proteins
In an embodiment the payload comprises a protein or polypeptide, e.g., a protein or polypeptide covalently or non-covalently coupled to a Cas9 molecule.
In an embodiment, the protein or polypeptide is dimeric or multimeric, and each subunit is delivered by a Cas9 molecule. In an embodiment, a first protein and second protein are delivered by one or more Cas9 molecules, e.g., each by a separate Cas9 molecule or both by the same Cas9 molecule.
In an embodiment, the protein or polypeptide is linked to a Cas9 molecule by a linker, e.g., a linker which comprises a bond cleavable under physiological conditions. In an embodiment, a linker is a linker from Section XI herein. In an embodiment, the bond is not cleavable under physiological conditions.
Specific Binding Ligands, Antibodies
In an embodiment the payload comprises a ligand, e.g., a protein, having specific affinity for a counter ligand. In an embodiment, the ligand can be a receptor (or the ligand for a receptor), or an antibody.
In an embodiment a payload comprises an antibody molecule. Exemplary antibody molecules include, e.g., proteins or polypeptides that include at least one immunoglobulin variable domain. For example, an antibody can include a heavy (H) chain variable region (abbreviated herein as VH), and a light (L) chain variable region (abbreviated herein as VL). In another example, an antibody includes two heavy (H) chain variable regions and two light (L) chain variable regions. The term “antibody” encompasses antigen-binding fragments of antibodies (e.g., single chain antibodies, Fab and sFab fragments, F(ab′)2, Fd fragments, Fv fragments, scFv, and domain antibodies (dAb) fragments (de Wildt et al., EUR J IMMUNOL. 1996; 26(3):629-639)). For example, antigen-binding fragments of antibodies can include, e.g., (i) a Fab fragment, a monovalent fragment consisting of the VL, VH, CL and CH1 domains; (ii) a F(ab′)2 fragment, a bivalent fragment including two Fab fragments linked by a disulfide bridge at the hinge region; (iii) a Fd fragment consisting of the VH and CH1 domains; (iv) a Fv fragment consisting of the VL and VH domains of a single arm of an antibody, (v) a dAb fragment (Ward et al., (1989) NATURE 341:544-546), which consists of a VH domain; and (vi) an isolated complementarity determining region (CDR) that retains functionality. Furthermore, although the two domains of the Fv fragment, VL and VH, are coded for by separate genes, they can be joined, using recombinant methods, by a synthetic linker that enables them to be made as a single protein chain in which the VL and VH regions pair to form monovalent molecules known as single chain Fv (scFv). See, e.g., U.S. Pat. Nos. 5,260,203, 4,946,778, and 4,881,175; Bird et al., (1988) SCIENCE 242:423-426; and Huston et al., (1988) PROC. NATL. ACAD. SCI. USA 85:5879-5883. An antibody can have the structural features of IgA, IgG, IgE, IgD, IgM (as well as subtypes thereof). Antibodies may be from any source, but primate (human and non-human primate) and primatized are preferred. In an embodiment, the antibody is a human antibody or humanized antibody.
In an embodiment, the antibody molecule is a single-domain antibody (e.g., an sdAb, e.g., a nanobody), e.g., an antibody fragment consisting of a single monomeric variable antibody domain. In an embodiment, the molecular weight of the single-domain antibody is about 12-15 kDa. For example, the single-domain antibody can be engineered from heavy-chain antibodies found in camelids (e.g., VHH fragments). Cartilaginous fishes also have heavy-chain antibodies (IgNAR, ‘immunoglobulin new antigen receptor’), from which single-domain antibodies called VNAR fragments can be obtained. An alternative approach is to split the dimeric variable domains from common immunoglobulin G (IgG), e.g., from humans or mice, into monomers. Single-domain antibodies derived from either heavy or light chain can be obtained to bind specifically to target epitopes. For example, a single-domain antibody can be a peptide chain of about 110 amino acids long, comprising one variable domain (VH) of a heavy-chain antibody, or of a common IgG.
Single-domain antibodies can have similar affinity to antigens as whole antibodies. They can also be more heat-resistant and/or stable towards detergents and high concentrations of urea. Those, e.g., derived from camelid and fish antibodies can be less lipophilic and more soluble in water, owing to their complementarity determining region 3 (CDR3), which forms an extended loop covering the lipophilic site that normally binds to a light chain. In an embodiment, the single-domain antibody does not show complement system triggered cytotoxicity, e.g., because they lack an Fc region. Single-domain antibodies, e.g., camelid and fish derived sdAbs, can bind to hidden antigens that may not be accessible to whole antibodies, for example to the active sites of enzymes. This property can result from their extended CDR3 loop, which is able to penetrate such sites.
A single-domain antibody can be obtained by immunization of, e.g., dromedaries, camels, llamas, alpacas or sharks with the desired antigen and subsequent isolation of the mRNA coding for heavy-chain antibodies. By reverse transcription and polymerase chain reaction, a gene library of single-domain antibodies containing several million clones is produced. Screening techniques like phage display and ribosome display help to identify the clones binding the antigen.
A different method uses gene libraries from animals that have not been immunized beforehand. Such naïve libraries usually contain only antibodies with low affinity to the desired antigen, making it necessary to apply affinity maturation by random mutagenesis as an additional step.
When the most potent clones have been identified, their DNA sequence can be optimized, for example to improve their stability towards enzymes. Another goal is humanization to prevent immunological reactions of the human organism against the antibody. The final step is the translation of the optimized single-domain antibody in E. coli, Saccharomyces cerevisiae or other suitable organisms.
Alternatively, single-domain antibodies can be made from common murine or human IgG with four chains. The process is similar, comprising gene libraries from immunized or naïve donors and display techniques for identification of the most specific antigens. Monomerization is usually accomplished by replacing lipophilic by hydrophilic amino acids. If affinity can be retained, the single-domain antibodies can likewise be produced in E. coli, S. cerevisiae or other organisms.
In an embodiment, a payload comprises a transcription activator protein or domain, e.g., a VP16 protein or domain, or a transcription repressor protein or domain.
Fusion Proteins and Fusion Partners In an embodiment the payload comprises a fusion protein. Exemplary fusion proteins include a first and second fusion partner, which can possess different functional properties or which can be derived from different proteins. In an embodiment, the fusion protein can comprise a first fusion partner that binds a nucleic acid and a second fusion partner that that comprises an enzymatic activity or that promotes or inhibits gene expression. In an embodiment, the payload itself is a fusion protein. In an embodiment, the payload is fused to a Cas9 molecule. For example, the fusion protein can contain a segment that adds stability and/or deliverability to the fused protein. In an embodiment, the fusion protein can be a protein described herein (e.g., a receptor) fused to an immunoglobulin fragment (e.g., Fc fragment), transferring, or a plasma protein, e.g., albumin. The fusion protein can also contain a segment that adds toxicity to the fused protein (e.g. conveyed by toxins, enzymes or cytokines). Fusion proteins can also be used to enable delivery and/or targeting routes (e.g., by HIV-1 TAT protein). Other examples include, e.g., fusions that allow for mutivalency, such as streptavidin fusions, or fusions of two active components (e.g., with or without a cleavable linker in between).
In an embodiment, the protein or polypeptide is a fusion partner with a Cas9 molecule, e.g., an eiCas9 molecule.
In an embodiment, a payload comprises fusion partner with a Cas9 molecule comprising a transcription activator protein or domain, e.g., a VP16 protein or domain, or a transcription repressor protein or domain.
Enzymes
In an embodiment a payload comprises an enzyme. Exemplary enzymes include, e.g., oxidoreductases (e.g., catalyze oxidation/reduction reactions), transferases (e.g., transfer a functional group (e.g. a methyl or phosphate group)), hydrolases (e.g., catalyze the hydrolysis of various bonds), lyases (e.g., cleave various bonds by means other than hydrolysis and oxidation), isomerases (catalyze isomerization changes within a single molecule), and ligases (e.g., join two molecules with covalent bonds). In an embodiment an enzymes mediates or is associated with one or more functions in the cell nucleus, e.g., DNA synthesis, transcription, epigenetic modification of DNA and histones, RNA post-transcriptional modification, cell cycle control, DNA damage repair, or genomic instability.
Small Molecules
In an embodiment a payload comprises a small molecule compounds.
In an embodiment a small molecule is a regulator of a biological process. For example, a small molecule can bind to a second molecule, e.g., biopolymer, e.g., a carbohydrate, protein, polypeptide, or a nucleic acid, and in an embodiment, alter one or more of the structure, distribution, activity, or function of the second molecule. In an embodiment, the size of the small molecule is on the order of 10−9 m. In an embodiment, the molecular weight of the small molecule is, e.g., between 200 amu and 500 amu, between 300 amu and 700 amu, between 500 amu and 700 amu, between 700 amu and 900 amu, or between 500 amu and 900 amu.
Exemplary small molecules include histone deacetylase (HDAC) inhibitors (e.g., suberoylanilide hydroxamic acid (SAHA), or romidepsin), histone methyltransferase inhibitors (, DNA methyltransferase inhibitors (e.g., azacitidine (or 5-azacitidine), decitabine (or 5-aza-2′-deoxycytidine), or DNA replication inhibitors. Small molecules can also include, e.g., small nucleic acid molecules (1-4 bases depending upon the base, e.g., that would be under 2 kD) and peptides.
Microsatellite Extension Inhibitors
In an embodiment a payload comprises a microsatellite extension inhibitor. In an embodiment, the microsatellite extension inhibitor is a DNA mismatch repair protein.
Exemplary DNA mismatch repair proteins that can be delivered by the molecules and methods described herein include, e.g., MSH2, MSH3, MSH6, MLH1, MLH3, PMS1, PMS2.
Signal Generators, Radionuclides, Reporter Molecules, Diagnostic Probes
In an embodiment a payload comprises a molecule that generates a signal. Such payloads are useful, e.g., in research, therapeutic (e.g., cancer therapy) and diagnostic applications. In an embodiment, the signal comprises: an electromagnetic emission, e.g., in the infrared, visible, or ultraviolet range; a particle, e.g., a product of radioactive decay, e.g., an alpha, beta, or gamma particle; a detectable substrate, e.g., a colored substrate; a reaction product, e.g., the product of an enzymatic reaction; or a ligand detectable by a specific binding agent, e.g., an antibody; or a dye. In an embodiment the signal comprises a fluorescent emission, e.g., by a fluorescent protein. Exemplary fluorescent proteins include, Blue/UV Proteins (e.g., TagBFP, mTagBFP, Azurite, EBFP2, mKalama1, Sirius, Sapphire, T-Sapphire), Cyan Proteins (e.g., ECFP, Cerulean, SCFP3A, mTurquoise, mTurquoise2, monomeric Midoriishi-Cyan, TagCFP, mTFP1), Green Proteins (e.g., EGFP, Emerald, Superfolder GFP, Monomeric Azami Green, TagGFP2, mUKG, mWasabi, Clover, mNeonGreen), Yellow Proteins (e.g., EYFP, Citrine, Venus, SYFP2, TagYFP), Orange Proteins (e.g., Monomeric Kusabira-Orange, mKOK, mKO2, mOrange, mOrange2), Red Proteins (mRaspberry, mCherry, mStrawberry, mTangerine, tdTomato, TagRFP, TagRFP-T, mApple, mRuby, mRuby2), Far-Red Proteins (e.g., mPlum, HcRed-Tandem, mKate2, mNeptune, NirFP, TagRFP657, IFP1.4, iRFP), Long Stokes Shift Proteins (e.g., mKeima Red, LSS-mKate1, LSS-mKate2, mBeRFP), Photoactivatible Proteins (e.g., PA-GFP, PAmCherry1, PATagRFP), Photoconvertible Proteins (e.g., Kaede (green), Kaede (red), KikGR1 (green), KikGR1 (red), PS-CFP2, mEos2 (green), mEos2 (red), mEos3.2 (green), mEos3.2 (red), PSmOrange), Photoswitchable Proteins (e.g., Dronpa).
In an embodiment, a signal producing moiety is provided as the fusion partner of a Cas9 molecule, e.g., an eiCas9 molecule.
Signal generators or reporters, useful, e.g., for labelingr polypeptides include, but are not limited to, the following: radioisotopes or radionuclides (e.g., indium (111In) iodine (131I or 125I), , yttrium (90Y), lutetium (177Lu), actinium (225 Ac), bismuth (212Bi or 213Bi), sulfur (35S), carbon (14C), tritium (3H), rhodium (188Rb), technetium (99mTc), praseodymium, or phosphorous (32P) or a positron-emitting radionuclide, e.g., carbon-11 (11C), potassium-40 (40K) nitrogen-13 (13N), oxygen 15 (15O), fluorine-18 (18F), and iodine-121 (121I)), fluorescent labels (e.g., FITC, rhodamine, lanthanide phosphors), enzymatic labels (e.g., horseradish peroxidase, beta-galactosidase, luciferase, alkaline phosphatase), chemiluminescent, biotinyl groups (which can be detected by a marked avidin, e.g., a molecule containing a streptavidin moiety and a fluorescent marker or an enzymatic activity that can be detected by optical or calorimetric methods), and predetermined polypeptide epitopes recognized by a secondary reporter (e.g., leucine zipper pair sequences, binding sites for secondary antibodies, metal binding domains, epitope tags). In an embodiment, labels are attached by spacer arms of various lengths to reduce potential steric hindrance.
In an embodiment, a payload comprises a radionuclide. The radionuclide can be incorporated into the gRNA molecule, the Cas9 molecule, or into a payload molecule. Exemplary radionuclides include, e.g., beta emitters, alpha emitters or gamma emitters. In an embodiment the radionuclide is iodine, e.g., 131I or 125I, yttrium, e.g., 90Y, lutetium, e.g., 177Lu, Actinium, e.g., 225Ac, bismuth, e.g., 212Bi or 213Bi), sulfur, e.g., 35S), carbon, e.g., 14C, tritium, 3H), rhodium, e.g., 188 technetium, e.g., 99Tc, praseodymium, or phosphorous, e.g., 32P.
Modulators of DNA and Chromatin Structure
In an embodiment, a payload comprises an endogenous or exogenous modulator of DNA structure. A modulator, as is typical of payloads, can be delivered in vitro, ex vivo, or in vivo.
In an embodiment, the payload comprises a modulator of an epigenetic state or characteristic of DNA. In an embodiment an epigenetic state or characteristic can be altered to treat a disorder, or to influence the developmental or other state of a cell.
In an embodiment, the epigenetic state or characteristic comprises DNA methylation. For example, the payloads described herein can modulate the addition of methyl groups to DNA, e.g., to convert cytosine to 5-methylcytosine, e.g., at CpG sites.
Aberrant DNA methylation patterns (e.g., hypermethylation and hypomethylation compared to normal tissue) are associated with various diseases and conditions, e.g., cancer. The modulators described herein can be used to reactivate transcriptionally silenced genes or to inhibit transcriptionally hyperactive genes, e.g., to treat diseases, e.g., cancer.
DNA methylation can affect gene transcription. Genes with high levels of 5-methylcytosine, e.g., in their promoter region, can be transcriptionally less active or silent. Thus, methods described herein can be used to target and suppress transcriptional activity, e.g., of genes described herein.
In an embodiment, the modulator promotes maintenance of DNA methylation. For example, the modulators can have DNA methyltransferase (DNMT) activity or modulate DNMT activity, e.g., to maintain DNA methylation or reduce passive DNA demethylation, e.g., after DNA replication.
In an embodiment, the modulator promotes de novo DNA methylation. For example, the modulators described herein can have de novo DNA methyltransferase (DNMT) (e.g., DNMT3a, DNMT3b, DNMT3L) activity or modulate de novo DNMT (e.g., DNMT3a, DNMT3b, DNMT3L) activity, e.g., to produce DNA methylation patterns, e.g., early in development. Epigenetic changes in DNA (e.g., methylation), can be evaluated by art-known methods or as described herein. Exemplary methods for detecting DNA methylation include, e.g., Methylation-Specific PCR (MSP), whole genome bisulfite sequencing (BS-Seq), HELP (HpaII tiny fragment Enrichment by Ligation-mediated PCR) assay, ChIP-on-chip assays, restriction landmark genomic scanning, Methylated DNA immunoprecipitation (MeDIP), pyrosequencing of bisulfite treated DNA, molecular break light assay for DNA adenine methyltransferase activity, methyl sensitive Southern Blotting, separation of native DNA into methylated and unmethylated fractions using MethylCpG Binding Proteins (MBPs) and fusion proteins containing just the Methyl Binding Domain (MBD).
In an embodiment, the modulator cleaves DNA. For example, a modulator can catalyze the hydrolytic cleavage of phosphodiester linkages in the DNA backbone. In an embodiment, the modulator (e.g., DNase I) cleaves DNA preferentially at phosphodiester linkages adjacent to a pyrimidine nucleotide, yielding 5′-phosphate-terminated polynucleotides with a free hydroxyl group on position 3′. In an embodiment, the modulator (e.g., DNase II) hydrolyzes deoxyribonucleotide linkages in DNA, yielding products with 3′-phosphates. In an embodiment, the modulator comprises endodeoxyribonuclease activity. In an embodiment, the modulator comprises exodeoxyribonuclease activity (e.g., having 3′ to 5′ or 5′ to 3′ exodeoxyribonuclease activity). In an embodiment, the modulator recognizes a specific DNA sequence (e.g., a restriction enzyme). In an embodiment, the modulator does not cleave DNA in a sequence-specific manner. A modulator can cleave single-stranded DNA (e.g., having nickase activity), double-stranded DNA, or both.
In an embodiment, modulator affects, e.g., alters or preserves, tertiary or quaternary DNA structure. For example, the modulators described herein can modulate tertiary structure, e.g., handedness (right or left), length of the helix turn, number of base pairs per turn, and/or difference in size between the major and minor grooves. In an embodiment, the modulator mediates the formation of B-DNA, A-DNA, and/or Z-DNA. The modulators described herein can also modulate quaternary structure, e.g., the interaction of DNA with other molecules (DNA or non-DNA molecules, e.g., histones), e.g., in the form of chromatin. In an embodiment, the modulator that mediate or modify tertiary or quaternary DNA structure comprises DNA helicases activity or modulates DNA helicase activity.
In an embodiment, the modulator promotes or inhibits DNA damage response and/or repair. For example, a modulator can promote one or more DNA damage response and repair mechanisms, e.g., direct reversal, base excision repair (BER), nucleotide excision repair (NER) (e.g., global genomic repair (GG-NER), transcription-coupled repair (TC-NER)), mismatch repair (MMR), non-homologous end joining (NHEJ), microhomology-mediated end joining (MMEJ), homologous recombination, and/or translesion synthesis (TLS). In an embodiment, a modulator promotes the step of damage recognition. In an embodiment, a modulator promotes the step of DNA repair.
Aberrant DNA damage repair is associated with various diseases and conditions, e.g., aging, hereditary DNA repair disorders, and cancer. For example, DNA repair gene mutations that can increase cancer risk include, e.g., BRCA1 and BRCA2 (e.g., involved in homologous recombination repair (HRR) of double-strand breaks and daughter strand gaps, e.g., in breast and ovarian cancer); ATM (e.g., different mutations reduce HRR, single strand annealing (SSA),
NHEJ or homology-directed DSBR (HDR), e.g., in leukemia, lymphoma, and breast cancer), NBS (e.g., involved in NHEJ, e.g., in lymphoid malignancies); MRE11 (e.g., involved in HRR, e.g., in breast cancer); BLM (e.g., involved in HRR, e.g., in leukemia, lymphoma, colon, breast, skin, auditory canal, tongue, esophagus, stomach, tonsil, larynx, lung, and uterus cancer); WRN (e.g., involved in HRR, NHEJ, long-patch BER, e.g., in soft tissue sarcomas, colorectal, skin, thyroid, and pancreatic cancer); RECQ4 (RECQL4) (e.g., involved in HRR, e.g., causing Rothmund-Thomson syndrome (RTS), RAPADILINO syndrome or Baller Gerold syndrome, cutaneous carcinomas, including basal cell carcinoma, squamous cell carcinoma, and Bowen's disease); FANCA, FANCB, FANCC, FANCD1, FANCD2, FANCE, FANCF, FANCG, FANCI, FANCJ, FANCL, FANCM, and FANCN (e.g., involved in HRR and TLS, e.g., in leukemia, liver tumors, solid tumors in many locations), XPC and XPE(DDB2) (e.g., involved in NER(GGR type), e.g., in skin cancer (melanoma and non-melanoma)); XPA, XPB, XPD, XPF, and XPG (e.g., involved in NER (both GGR type and TCR type), e.g., in skin cancer (melanoma and non-melanoma) and central nervous system); XPV(POLH) (e.g., involved in TLS, e.g., in skin cancer (melanoma and non-melanoma)); hMSH2, hMSH6, hMLH1, and hPMS2 (involved in MMR, e.g., in colorectal, endometrial and ovarian cancer); MUTYH (e.g., involved in BER of A mispaired with 80H-dG, as well as mispairs with G, FapydG and C, e.g., in colon cancer)
Modulators can be used to treat a disease or condition associated with aberrant DNA damage repair, e.g., by modulating one or more DNA damage repair mechanisms described herein.
In an embodiment, the modulator is selected from, or modulates, one or more proteins involved in direct reversal, e.g., methyl guanine methyl transferase (MGMT).
In an embodiment, the modulator is selected from, or modulates, one or more proteins involved in BER, e.g., DNA glycosylase, AP endonuclease, DNA polymerase, DNA ligase.
In an embodiment, the modulator is selected from, or modulates, one or more proteins involved in GG-NER, e.g., XPC, HR23b, CAK, TFIIH, XPA, RPA, XPG, XPF, ERCC1, TFIIH, PCNA, RFC, ADN Pol, and Ligase I.
In an embodiment, the modulator is selected from, or modulates, one or more proteins involved in TC-NER, e.g., CSB, XPA, RPA, XPG, XPF, ERCC1, CSA-CNS, TFIIH, CAK, PCNA, RFC, Ligase I, and RNA Polymerase II.
In an embodiment, the modulator is selected from, or modulates, one or more DNA mismatch repair proteins.
In an embodiment, the modulator is selected from, or modulates, one or more proteins involved in NHEJ, e.g., Ku70/80, DNA-PKcs, DNA Ligase IV, XRCC4, XLF, Artemis, DNA polymerase mu, DNA polymerase lambda, PNKP, Aprataxin, and APLF.
In an embodiment, the modulator is selected from, or modulates, one or more proteins involved in homologous recombination, e.g., as described herein.
In an embodiment, the modulator is selected from, or modulates, one or more proteins involved in TLS, e.g., DNA polymerase eta, iota, kappa, zeta, and PCNA.
In an embodiment, a modulator can modulate global response to DNA damage, e.g., DNA damage checkpoints and/or transcriptional responses to DNA damage. For example, DNA damage checkpoints can occur at the G1/S and G2/M boundaries. An intra-S checkpoint can also exist. Checkpoint activation can be modulated by two master kinases, ATM and ATR. ATM can respond to DNA double-strand breaks and disruptions in chromatin structure and ATR can respond to stalled replication forks. These kinases can phosphorylate downstream targets in a signal transduction cascade, e.g., leading to cell cycle arrest. A class of checkpoint mediator proteins (e.g., BRCA1, MDC1, and 53BP1), which transmit the checkpoint activation signal to downstream proteins, can be modulated. Exemplary downstream proteins that can be modulated include, e.g., p53, p21, and cyclin/cyclin-dependent kinase complexes.
In an embodiment, the modulator modulates nuclear DNA damage response and repair. In an embodiment, the modulator modulates mitochondrial DNA damage response and repair.
In an embodiment, the modulator promotes or inhibits DNA replication. For example, a modulator can promote or inhibit one or more stages of DNA replication, e.g., initiation (e.g., assembly of pre-replicative complex and/or initiation complex), elongation (e.g., formation of replication fork), and termination (e.g., formation of replication fork barrier). In an embodiment, the modulator is selected from, or modulates, one or more proteins involved in initiation, e.g., the origin recognition complex (ORC), CDC6, CDT1, minichromosome maintenance proteins (e.g., MCM2, MCM3, MCM4, MCM5, MCM6, MCMI, and MCM10), CDC45, CDK, DDK, CDC101, CDC102, CDC103, and CDC105. In an embodiment, the modulator is selected from, or modulates, one or more proteins involved in elongation, e.g., DNA helicases, DNA polymerase, PCNA, CDC45-MCM-GINS helicase complex, and Replication Factor C complex.
In an embodiment, the modulator is selected, from or modulates, one or more proteins involved in termination, e.g., type II topoisomerase and telomerase. In an embodiment, the modulator is selected from, or modulates, one or more replication checkpoint proteins, e.g., ATM, ATR, ATRIP, TOPBP1, RAD9, HUS1, Rad1, and CHK1.
In an embodiment, the payload comprises a modulator of nuclear DNA replication. In an embodiment, the modulator promotes or inhibits mitochondrial DNA replication.
Defects in DNA replication can be associated with various diseases and conditions, e.g., cancer and neurological diseases (e.g., Alzheimer's disease). Defects in mitochondrial DNA replication can also be associated with diseases and conditions, e.g., mtDNA depletion syndromes (e.g., Alpers or early infantile hepatocerebral syndromes) and mtDNA deletion disorders (e.g., progressive external ophthalmoplegia (PEO), ataxia-neuropathy, or mitochondrial neurogastrointestinal encephalomyopathy (MNGIE)). A modulator can be used to treat a disease or condition associated with aberrant DNA replication, e.g., by modulating DNA replication as described herein.
Exemplary endogenous or exogenous modulators of DNA structure are described herein, e.g., in Table VI-3.
| TABLE VI-3 | |
| DNA2 | DNA replication helicase/nuclease 2 |
| DNAAF1 | dynein, axonemal, assembly factor 1 |
| DNAAF2 | dynein, axonemal, assembly factor 2 |
| DNAAF3 | dynein, axonemal, assembly factor 3 |
| DNAH1 | dynein, axonemal, heavy chain 1 |
| DNAH2 | dynein, axonemal, heavy chain 2 |
| DNAH3 | dynein, axonemal, heavy chain 3 |
| DNAH5 | dynein, axonemal, heavy chain 5 |
| DNAH6 | dynein, axonemal, heavy chain 6 |
| DNAH7 | dynein, axonemal, heavy chain 7 |
| DNAH8 | dynein, axonemal, heavy chain 8 |
| DNAH9 | dynein, axonemal, heavy chain 9 |
| DNAH10 | dynein, axonemal, heavy chain 10 |
| DNAH10OS | dynein, axonemal, heavy chain 10 opposite strand |
| DNAH11 | dynein, axonemal, heavy chain 11 |
| DNAH12 | dynein, axonemal, heavy chain 12 |
| DNAH14 | dynein, axonemal, heavy chain 14 |
| DNAH17 | dynein, axonemal, heavy chain 17 |
| DNAH17-AS1 | DNAH17 antisense RNA 1 |
| DNAI1 | dynein, axonemal, intermediate chain 1 |
| DNAI2 | dynein, axonemal, intermediate chain 2 |
| DNAJB8-AS1 | DNAJB8 antisense RNA 1 |
| DNAJC3-AS1 | DNAJC3 antisense RNA 1 (head to head) |
| DNAJC9-AS1 | DNAJC9 antisense RNA 1 |
| DNAJC25- | DNAJC25-GNG10 readthrough |
| GNG10 | |
| DNAJC27- | DNAJC27 antisense RNA 1 |
| AS1 | |
| DNAL1 | dynein, axonemal, light chain 1 |
| DNAL4 | dynein, axonemal, light chain 4 |
| DNALI1 | dynein, axonemal, light intermediate chain 1 |
| DNASE1 | deoxyribonuclease I |
| DNASE1L1 | deoxyribonuclease I-like 1 |
| DNASE1L2 | deoxyribonuclease I-like 2 |
| DNASE1L3 | deoxyribonuclease I-like 3 |
| DNASE2 | deoxyribonuclease II, lysosomal |
| DNASE2B | deoxyribonuclease II beta |
| CD226 | CD226 molecule |
| FAM120A | family with sequence similarity 120A |
| GAK | cyclin G associated kinase |
| GCFC2 | GC-rich sequence DNA-binding factor 2 |
| MCM10 | minichromosome maintenance complex component 10 |
| PRKDC | protein kinase, DNA-activated, catalytic polypeptide |
| SACS | spastic ataxia of Charlevoix-Saguenay (sacsin) |
| SCNN1D | sodium channel, non-voltage-gated 1, delta subunit |
| SPATS2L | spermatogenesis associated, serine-rich 2-like |
| MT7SDNA | mitochondrially encoded 7S DNA |
| DCLRE1A | DNA cross-link repair 1A |
| DCLRE1B | DNA cross-link repair 1B |
| DCLRE1C | DNA cross-link repair 1C |
| DDIT3 | DNA-damage-inducible transcript 3 |
| DDIT4 | DNA-damage-inducible transcript 4 |
| DDIT4L | DNA-damage-inducible transcript 4-like |
| DFFA | DNA fragmentation factor, 45 kDa, alpha polypeptide |
| DFFB | DNA fragmentation factor, 40 kDa, beta polypeptide |
| (caspase-activated DNase) | |
| DMAP1 | DNA methyltransferase 1 associated protein 1 |
| DMC1 | DNA meiotic recombinase 1 |
| DNMT1 | DNA (cytosine-5-)-methyltransferase 1 |
| DNMT3A | DNA (cytosine-5-)-methyltransferase 3 alpha |
| DNMT3B | DNA (cytosine-5-)-methyltransferase 3 beta |
| DNMT3L | DNA (cytosine-5-)-methyltransferase 3-like |
| DNTT | DNA nucleotidylexotransferase |
| DRAM1 | DNA-damage regulated autophagy modulator 1 |
| DRAM2 | DNA-damage regulated autophagy modulator 2 |
| DSCC1 | DNA replication and sister chromatid cohesion 1 |
| ZBP1 | Z-DNA binding protein 1 |
| SON | SON DNA binding protein |
| TARDBP | TAR DNA binding protein |
| BMF | Bcl2 modifying factor |
| CENPBD1 | CENPB DNA-binding domains containing 1 |
| UNG | uracil-DNA glycosylase |
| PDRG1 | p53 and DNA-damage regulated 1 |
| TDG | thymine-DNA glycosylase |
| TDP1 | tyrosyl-DNA phosphodiesterase 1 |
| TDP2 | tyrosyl-DNA phosphodiesterase 2 |
| AHDC1 | AT hook, DNA binding motif, containing 1 |
| GMNN | geminin, DNA replication inhibitor |
| PRIM1 | primase, DNA, polypeptide 1 (49 kDa) |
| PRIM2 | primase, DNA, polypeptide 2 (58 kDa) |
| HELB | helicase (DNA) B |
| LIG1 | ligase I, DNA, ATP-dependent |
| SUMF1 | sulfatase modifying factor 1 |
| SUMF2 | sulfatase modifying factor 2 |
| LIG4 | ligase IV, DNA, ATP-dependent |
| LIG3 | ligase III, DNA, ATP-dependent |
| MDC1 | mediator of DNA-damage checkpoint 1 |
| MMS22L | MMS22-like, DNA repair protein |
| POLA1 | polymerase (DNA directed), alpha 1, catalytic subunit |
| POLA2 | polymerase (DNA directed), alpha 2, accessory subunit |
| POLB | polymerase (DNA directed), beta |
| POLD1 | polymerase (DNA directed), delta 1, catalytic subunit |
| POLD2 | polymerase (DNA directed), delta 2, accessory subunit |
| POLD3 | polymerase (DNA-directed), delta 3, accessory subunit |
| POLD4 | polymerase (DNA-directed), delta 4, accessory subunit |
| POLDIP2 | polymerase (DNA-directed), delta interacting protein 2 |
| POLDIP3 | polymerase (DNA-directed), delta interacting protein 3 |
| POLE | polymerase (DNA directed), epsilon, catalytic subunit |
| POLE2 | polymerase (DNA directed), epsilon 2, accessory subunit |
| POLE3 | polymerase (DNA directed), epsilon 3, accessory subunit |
| POLE4 | polymerase (DNA-directed), epsilon 4, accessory subunit |
| POLG | polymerase (DNA directed), gamma |
| POLG2 | polymerase (DNA directed), gamma 2, accessory subunit |
| POLH | polymerase (DNA directed), eta |
| POLI | polymerase (DNA directed) iota |
| POLK | polymerase (DNA directed) kappa |
| POLL | polymerase (DNA directed), lambda |
| POLM | polymerase (DNA directed), mu |
| POLN | polymerase (DNA directed) nu |
| POLO | polymerase (DNA directed), theta |
| ID1 | inhibitor of DNA binding 1, dominant negative helix- |
| loop-helix protein | |
| ID2 | inhibitor of DNA binding 2, dominant negative helix- |
| loop-helix protein | |
| ID3 | inhibitor of DNA binding 3, dominant negative helix- |
| loop-helix protein | |
| ID4 | inhibitor of DNA binding 4, dominant negative helix- |
| loop-helix protein | |
| OGGI | 8-oxoguanine DNA glycosylase |
| MSANTD1 | Myb/SANT-like DNA-binding domain containing 1 |
| MSANTD2 | Myb/SANT-like DNA-binding domain containing 2 |
| MSANTD3 | Myb/SANT-like DNA-binding domain containing 3 |
| MSANTD4 | Myb/SANT-like DNA-binding domain containing 4 with |
| coiled-coils | |
| PIF1 | PIF1 5′-to-3′ DNA helicase |
| TONSL | tonsoku-like, DNA repair protein |
| MPG | N-methylpurine-DNA glycosylase |
| TOP1 | topoisomerase (DNA) I |
| TOP1MT | topoisomerase (DNA) I, mitochondrial |
| TOP2A | topoisomerase (DNA) II alpha 170 kDa |
| TOP2B | topoisomerase (DNA) II beta 180 kDa |
| TOP3A | topoisomerase (DNA) III alpha |
| TOP3B | topoisomerase (DNA) III beta |
| TOPBP1 | topoisomerase (DNA) II binding protein 1 |
| DDB1 | damage-specific DNA binding protein 1, 127 kDa |
| DDB2 | damage-specific DNA binding protein 2, 48 kDa |
| SSBP1 | single-stranded DNA binding protein 1, mitochondrial |
| SSBP2 | single-stranded DNA binding protein 2 |
| SSBP3 | single stranded DNA binding protein 3 |
| SSBP4 | single stranded DNA binding protein 4 |
| GADD45A | growth arrest and DNA-damage-inducible, alpha |
| GADD45B | growth arrest and DNA-damage-inducible, beta |
| GADD45G | growth arrest and DNA-damage-inducible, gamma |
| GADD45GIP1 | growth arrest and DNA-damage-inducible, gamma |
| interacting protein 1 | |
| MGMT | O-6-methylguanine-DNA methyltransferase |
| REV1 | REV1, polymerase (DNA directed) |
| RECQL | RecQ protein-like (DNA helicase Q1-like) |
| CCDC6 | coiled-coil domain containing 6 |
| KLRK1 | killer cell lectin-like receptor subfamily K, member 1 |
| N6AMT1 | N-6 adenine-specific DNA methyltransferase 1 (putative) |
| N6AMT2 | N-6 adenine-specific DNA methyltransferase 2 (putative) |
| POLR2A | polymerase (RNA) II (DNA directed) polypeptide A, |
| 220 kDa | |
| POLR2B | polymerase (RNA) II (DNA directed) polypeptide B, |
| 140 kDa | |
| POLR2C | polymerase (RNA) II (DNA directed) polypeptide C, |
| 33 kDa | |
| POLR2D | polymerase (RNA) II (DNA directed) polypeptide D |
| POLR2E | polymerase (RNA) II (DNA directed) polypeptide E, |
| 25 kDa | |
| POLR2F | polymerase (RNA) II (DNA directed) polypeptide F |
| POLR2G | polymerase (RNA) II (DNA directed) polypeptide G |
| POLR2H | polymerase (RNA) II (DNA directed) polypeptide H |
| POLR2I | polymerase (RNA) II (DNA directed) polypeptide I, |
| 14.5 kDa | |
| POLR2J | polymerase (RNA) II (DNA directed) polypeptide J, |
| 13.3 kDa | |
| POLR2J2 | polymerase (RNA) II (DNA directed) polypeptide J2 |
| POLR2J3 | polymerase (RNA) II (DNA directed) polypeptide J3 |
| POLR2K | polymerase (RNA) II (DNA directed) polypeptide K, |
| 7.0 kDa | |
| POLR2L | polymerase (RNA) II (DNA directed) polypeptide L, |
| 7.6 kDa | |
| POLR2M | polymerase (RNA) II (DNA directed) polypeptide M |
| TRDMT1 | tRNA aspartic acid methyltransferase 1 |
| CHD1 | chromodomain helicase DNA binding protein 1 |
| CHD1L | chromodomain helicase DNA binding protein 1-like |
| CHD2 | chromodomain helicase DNA binding protein 2 |
| CHD3 | chromodomain helicase DNA binding protein 3 |
| CHD4 | chromodomain helicase DNA binding protein 4 |
| CHD5 | chromodomain helicase DNA binding protein 5 |
| CHD6 | chromodomain helicase DNA binding protein 6 |
| CHD7 | chromodomain helicase DNA binding protein 7 |
| CHD8 | chromodomain helicase DNA binding protein 8 |
| CHD9 | chromodomain helicase DNA binding protein 9 |
| KLLN | killin, p53-regulated DNA replication inhibitor |
| POLR3A | polymerase (RNA) III (DNA directed) polypeptide A, |
| 155 kDa | |
| POLR3B | polymerase (RNA) III (DNA directed) polypeptide B |
| POLR3C | polymerase (RNA) III (DNA directed) polypeptide C |
| (62 kD) | |
| POLR3D | polymerase (RNA) III (DNA directed) polypeptide D, |
| 44 kDa | |
| POLR3E | polymerase (RNA) III (DNA directed) polypeptide E |
| (80 kD) | |
| POLR3F | polymerase (RNA) III (DNA directed) polypeptide F, |
| 39 kDa | |
| POLR3G | polymerase (RNA) III (DNA directed) polypeptide G |
| (32 kD) | |
| POLR3GL | polymerase (RNA) III (DNA directed) polypeptide G |
| (32 kD)-like | |
| POLR3H | polymerase (RNA) III (DNA directed) polypeptide H |
| (22.9 kD) | |
| POLR3K | polymerase (RNA) III (DNA directed) polypeptide K, |
| 12.3 kDa | |
| WDHD1 | WD repeat and HMG-box DNA binding protein 1 |
| PGAP1 | post-GPI attachment to proteins 1 |
| PGAP2 | post-GPI attachment to proteins 2 |
| PGAP3 | post-GPI attachment to proteins 3 |
| REV3L | REV3-like, polymerase (DNA directed), zeta, catalytic |
| subunit | |
| CDT1 | chromatin licensing and DNA replication factor 1 |
| PANDAR | promoter of CDKN1A antisense DNA damage activated |
| RNA | |
| APEX1 | APEX nuclease (multifunctional DNA repair enzyme) 1 |
| CHMP1A | charged multivesicular body protein 1A |
| CHMP1B | charged multivesicular body protein 1B |
| CHMP2A | charged multivesicular body protein 2A |
| CHMP2B | charged multivesicular body protein 2B |
| CHMP4A | charged multivesicular body protein 4A |
| CHMP4B | charged multivesicular body protein 4B |
| CHMP4C | charged multivesicular body protein 4C |
| CHMP5 | charged multivesicular body protein 5 |
| CHMP6 | charged multivesicular body protein 6 |
| POLRMT | polymerase (RNA) mitochondrial (DNA directed) |
| SPIDR | scaffolding protein involved in DNA repair |
| MCIDAS | multiciliate differentiation and DNA synthesis associated |
| cell cycle protein | |
| PAPD7 | PAP associated domain containing 7 |
| RFX8 | RFX family member 8, lacking RFX DNA binding |
| domain | |
| DEK | DEK oncogene |
| NUB1 | negative regulator of ubiquitin-like proteins 1 |
| PAXBP1 | PAX3 and PAX7 binding protein 1 |
| RAMP1 | receptor (G protein-coupled) activity modifying protein 1 |
| RAMP2 | receptor (G protein-coupled) activity modifying protein 2 |
| RAMP3 | receptor (G protein-coupled) activity modifying protein 3 |
| RC3H2 | ring finger and CCCH-type domains 2 |
| ARHGAP35 | Rho GTPase activating protein 35 |
| SMUG1 | single-strand-selective monofunctional uracil-DNA |
| glycosylase 1 | |
| CXXC1 | CXXC finger protein 1 |
| FAM50A | family with sequence similarity 50, member A |
| FANCG | Fanconi anemia, complementation group G |
| GLI3 | GLI family zinc finger 3 |
| GTF2H5 | general transcription factor IIH, polypeptide 5 |
| LAGE3 | L antigen family, member 3 |
| MYCNOS | MYCN opposite strand/antisense RNA |
| NFRKB | nuclear factor related to kappaB binding protein |
| RAD51D | RAD51 paralog D |
| RFX2 | regulatory factor X, 2 (influences HLA class II |
| expression) | |
| RFXANK | regulatory factor X-associated ankyrin-containing |
| protein | |
| RRP1 | ribosomal RNA processing 1 |
| SPRTN | SprT-like N-terminal domain |
| XRCC4 | X-ray repair complementing defective repair in Chinese |
| hamster cells 4 | |
| CDK11A | cyclin-dependent kinase 11A |
| CDK11B | cyclin-dependent kinase 11B |
| LURAP1L | leucine rich adaptor protein 1-like |
| MAD2L2 | MAD2 mitotic arrest deficient-like 2 (yeast) |
| PRDM2 | PR domain containing 2, with ZNF domain |
| NABP2 | nucleic acid binding protein 2 |
| NABP1 | nucleic acid binding protein 1 |
| PPP1R15A | protein phosphatase 1, regulatory subunit 15A |
| TATDN1 | TatD DNase domain containing 1 |
| TATDN2 | TatD DNase domain containing 2 |
| TATDN3 | TatD DNase domain containing 3 |
| CEBPB | CCAAT/enhancer binding protein (C/EBP), beta |
| INIP | INTS3 and NABP interacting protein |
| INTS3 | integrator complex subunit 3 |
| SDIM1 | stress responsive DNAJB4 interacting membrane protein |
| 1 | |
| DHX9 | DEAH (Asp-Glu-Ala-His) (SEQ ID NO: 39) box helicase |
| 9 | |
| SATB1 | SATB homeobox 1 |
| FEN1 | flap structure-specific endonuclease 1 |
| HCST | hematopoietic cell signal transducer |
| TYROBP | TYRO protein tyrosine kinase binding protein |
| AFA | ankyloblepharon filiforme adnatum |
| C9orf169 | chromosome 9 open reading frame 169 |
| TSPO2 | translocator protein 2 |
| TCIRG1 | T-cell, immune regulator 1, ATPase, H+ transporting, |
| lysosomal V0 subunit A3 | |
| C1orf61 | chromosome 1 open reading frame 61 |
| HLA-DOA | major histocompatibility complex, class II, DO alpha |
| SPINK13 | serine peptidase inhibitor, Kazal type 13 (putative) |
In an embodiment, the payload comprises a modulator of an epigenetic state or characteristic of a component of chromatin, e.g., a chromatin associated protein, e.g., a histone. For example, the epigenetic state or characteristic can comprise histone acetylation, deacetylation, methylation (e.g., mono, di, or tri-methylation), demethylation, phosphorylation, dephosphorylation, ubiquitination (e.g., mono or polyubiquitination), deubiquitination, sumoylation, ADP-ribosylation, deimination, or a combination thereof.
In an embodiment, the modulator is selected from, or modulates, one or more histone modifying enzymes. In an embodiment, the histone modifying enzyme is a histone methyltransferase (HMT). In an embodiment, the histone modifying enzyme is a histone demethyltransferase (HDMT). In an embodiment, the histone modification enzyme is a histone acetyltransferase (HAT). In an embodiment, the histone modifying enzyme is a histone deacetylase (HDAC). In an embodiment, the histone modification enzyme is a kinase. In an embodiment, the histone modifying enzyme is a phosphatase. In an embodiment, the histone modifying enzyme is ubiquitin-activating enzymes (E1s), ubiquitin-conjugating enzymes (E2s), or ubiquitin ligases (E3s). In an embodiment, the histone modifying enzyme is a deubiquitinating (DUB) enzyme.
In an embodiment, histone modifications involved in regulation of gene transcription are modulated. For example, mono-methylation of H3K4, H3K9, H3K27, H3K79, H4K20, H2BK5, di-methylation of H3K79, tri-methylation of H3K4, H3K79, H3K36, and acetylation of H3K9, H3K14, H3K27, can be associated with transcription activation. As another example, di-methylation of H3K9, H3K27, and tri-methylation of H3K9, H3K27, H3K79, H2BK5 can be associated with transcription repression. In an embodiment, the modulator modulates trimethylation of H3 lysine 4 (H3K4Me3) and/or trimethylation of H3 lysine 36 (H3K36Me3), e.g., in active genes. In an embodiment, the modulator modulates trimethylation of H3 lysine 27 (H3K27Me3), di- and tri-methylation of H3 lysine 9 (H3K9Me2/3), and/or trimethylation of H4 lysine 20 (H4K20Me3), e.g., in repressed genes. In an embodiment, the modulator modulates both activating (e.g., H3K4Me3) and repressing (e.g., H3K27Me3) marks, e.g., in stem cells.
In an embodiment, histone modifications involved in DNA damage response and repair are modulated. For example, the modulators described herein can modulate phosphorylation of H2AX at Serine 139 and/or acetylation of H3 lysine 56 (H3K56Ac).
Aberrant histone modifications are associated with various diseases and conditions, e.g., cancer, cardiovascular disease, and neurodegenerative disorder. The modulators described herein can be used to treat a disease or condition described herein, e.g., by modulating one or more histone modifications, as described herein.
Epigenetic changes in histones can be evaluated by art-known methods or as described herein. Exemplary methods for detecting histone modifications include, e.g., chromatin immunoprecipitation (ChIP) using antibodies against modified histones, e.g., followed by quantitative PCR.
Exemplary endogenous or exogenous modulators of chromatin structure are described herein, e.g., in Table VI-4.
| TABLE VI-4 | |||
| Approved | |||
| Symbol | Approved Name | Synonyms | Ref Seq IDs |
| SUV39H1 | suppressor of variegation 3-9 | KMT1A | NM_003173 |
| homolog 1 (Drosophila) | |||
| SUV39H2 | suppressor of variegation 3-9 | FLJ23414, KMT1B | NM_024670 |
| homolog 2 (Drosophila) | |||
| EHMT2 | euchromatic histone-lysine N- | G9A, Em: AF134726.3, | NM_006709 |
| methyltransferase 2 | NG36/G9a, KMT1C | ||
| EHMT1 | euchromatic histone-lysine N- | Eu-HMTase1, | NM_024757 |
| methyltransferase 1 | FLJ12879, KIAA1876, | ||
| bA188C12.1, KMT1D | |||
| SETDB1 | SET domain, bifurcated 1 | KG1T, KIAA0067, | |
| ESET, KMT1E, | |||
| TDRD21 | |||
| SETDB2 | SET domain, bifurcated 2 | CLLD8, CLLL8, | NM_031915 |
| KMT1F | |||
| KMT2A | lysine (K)-specific methyltransferase | TRX1, HRX, ALL-1, | NM_005933 |
| 2A | HTRX1, CXXC7, | ||
| MLL1A | |||
| KMT2B | lysine (K)-specific methyltransferase | KIAA0304, MLL2, | NM_014727 |
| 2B | TRX2, HRX2, WBP7, | ||
| MLL1B, MLL4 | |||
| KMT2C | lysine (K)-specific methyltransferase | KIAA1506, HALR | |
| 2C | |||
| KMT2D | lysine (K)-specific methyltransferase | ALR, MLL4, | |
| 2D | CAGL114 | ||
| KMT2E | lysine (K)-specific methyltransferase | HDCMC04P | |
| 2E | |||
| SETD1A | SET domain containing 1A | KIAA0339, Set1, | NM_014712 |
| KMT2F | |||
| SETD1B | SET domain containing 1B | KIAA1076, Set1B, | XM_037523 |
| KMT2G | |||
| ASH1L | ash1 (absent, small, or homeotic)-like | huASH1, ASH1, | NM_018489 |
| (Drosophila) | ASH1L1, KMT2H | ||
| SETD2 | SET domain containing 2 | HYPB, HIF-1, | NM_014159 |
| KIAA1732, FLJ23184, | |||
| KMT3A | |||
| NSD1 | nuclear receptor binding SET domain | ARA267, FLJ22263, | NM_172349 |
| protein 1 | KMT3B | ||
| SMYD2 | SET and MYND domain containing | HSKM-B, ZMYND14, | NM_020197 |
| 2 | KMT3C | ||
| SMYD1 | SET and MYND domain containing | BOP, ZMYND22, | XM_097915 |
| 1 | KMT3D | ||
| SMYD3 | SET and MYND domain containing | KMT3E | NM_022743 |
| 3 | |||
| DOT1L | DOT1-like histone H3K79 | KIAA1814, DOT1, | NM_032482 |
| methyltransferase | KMT4 | ||
| SETD8 | SET domain containing (lysine | SET8, SET07, PR- | NM_020382 |
| methyltransferase) 8 | Set7, KMT5A | ||
| SUV420H1 | suppressor of variegation 4-20 | CGI-85, KMT5B | NM_017635 |
| homolog 1 (Drosophila) | |||
| SUV420H2 | suppressor of variegation 4-20 | MGC2705, KMT5C | NM_032701 |
| homolog 2 (Drosophila) | |||
| EZH2 | enhancer of zeste homolog 2 | EZH1, ENX-1, KMT6, | |
| (Drosophila) | KMT6A | ||
| EZH1 | enhancer of zeste homolog 1 | KIAA0388, KMT6B | NM_001991 |
| (Drosophila) | |||
| SETD7 | SET domain containing (lysine | KIAA1717, SET7, | NM_030648 |
| methyltransferase) 7 | SET7/9, Set9, KMT7 | ||
| PRDM2 | PR domain containing 2, with ZNF | RIZ, RIZ1, RIZ2, | NM_012231 |
| domain | KMT8, MTB-ZF, | ||
| HUMHOXY1 | |||
| HAT1 | histone acetyltransferase 1 | KAT1 | NM_003642 |
| KAT2A | K(lysine) acetyltransferase 2A | GCN5, PCAF-b | NM_021078 |
| KAT2B | K(lysine) acetyltransferase 2B | P/CAF, GCN5, | NM_003884 |
| GCN5L | |||
| CREBBP | CREB binding protein | RTS, CBP, KAT3A | NM_004380 |
| EP300 | E1A binding protein p300 | p300, KAT3B | NM_001429 |
| TAF1 | TAF1 RNA polymerase II, TATA | NSCL2, TAFII250, | NM_004606 |
| box binding protein (TBP)-associated | KAT4, DYT3/TAF1 | ||
| factor, 250 kDa | |||
| KAT5 | K(lysine) acetyltransferase 5 | TIP60, PLIP, cPLA2, | NM_006388 |
| HTATIP1, ESA1, | |||
| ZC2HC5 | |||
| KAT6A | K(lysine) acetyltransferase 6A | MOZ, ZC2HC6A | NM_006766 |
| KAT6B | K(lysine) acetyltransferase 6B | querkopf, qkf, Morf, | NM_012330 |
| MOZ2, ZC2HC6B | |||
| KAT7 | K(lysine) acetyltransferase 7 | HBOA, HBO1, | NM_007067 |
| ZC2HC7 | |||
| KAT8 | K(lysine) acetyltransferase 8 | MOF, FLJ14040, | NM_032188 |
| hMOF, ZC2HC8 | |||
| ELP3 | elongator acetyltransferase complex | FLJ10422, KAT9 | NM_018091 |
| subunit 3 | |||
| GTF3C4 | general transcription factor IIIC, | TFIIIC90, KAT12 | |
| polypeptide 4, 90 kDa | |||
| NCOA1 | nuclear receptor coactivator 1 | SRC1, F-SRC-1, | NM_147223 |
| NCoA-1, KAT13A, | |||
| RIP160, bHLHe74 | |||
| NCOA3 | nuclear receptor coactivator 3 | RAC3, AIB1, ACTR, | NM_006534 |
| p/CIP, TRAM-1, | |||
| CAGH16, TNRC16, | |||
| KAT13B, bHLHe42, | |||
| SRC-3, SRC3 | |||
| NCOA2 | nuclear receptor coactivator 2 | TIF2, GRIP1, NCoA-2, | |
| KAT13C, bHLHe75 | |||
| CLOCK | clock circadian regulator | KIAA0334, KAT13D, | NM_004898 |
| bHLHe8 | |||
| KDM1A | lysine (K)-specific demethylase 1A | KIAA0601, BHC110, | NM_015013 |
| LSD1 | |||
| KDM1B | lysine (K)-specific demethylase 1B | FLJ34109, FLJ33898, | NM_153042 |
| dJ298J15.2, | |||
| bA204B7.3, FLJ43328, | |||
| LSD2 | |||
| KDM2A | lysine (K)-specific demethylase 2A | KIAA1004, FBL11, | NM_012308 |
| LILINA, | |||
| DKFZP434M1735, | |||
| FBL7, FLJ00115, | |||
| CXXC8, JHDM1A | |||
| KDM2B | lysine (K)-specific demethylase 2B | PCCX2, CXXC2, | NM_032590 |
| Fbl10, JHDM1B | |||
| KDM3A | lysine (K)-specific demethylase 3A | TSGA, KIAA0742, | NM_018433 |
| JHMD2A | |||
| KDM3B | lysine (K)-specific demethylase 3B | KIAA1082, NET22 | NM_016604 |
| KDM4A | lysine (K)-specific demethylase 4A | KIAA0677, JHDM3A, | NM_014663 |
| TDRD14A | |||
| KDM4B | lysine (K)-specific demethylase 4B | KIAA0876, TDRD14B | NM_015015 |
| KDM4C | lysine (K)-specific demethylase 4C | GASC1, KIAA0780, | NM_015061 |
| TDRD14C | |||
| KDM4D | lysine (K)-specific demethylase 4D | FLJ10251 | NM_018039 |
| KDM4E | lysine (K)-specific demethylase 4E | JMJD2E | NM_001161630 |
| KDM5A | lysine (K)-specific demethylase 5A | NM_005056 | |
| KDM5B | lysine (K)-specific demethylase 5B | RBBP2H1A, PLU-1, | NM_006618 |
| CT31 | |||
| KDM5C | lysine (K)-specific demethylase 5C | DXS1272E, XE169 | NM_004187 |
| KDM5D | lysine (K)-specific demethylase 5D | KIAA0234 | NM_004653 |
| KDM6A | lysine (K)-specific demethylase 6A | NM_021140 | |
| KDM6B | lysine (K)-specific demethylase 6B | KIAA0346 | XM_043272 |
| JHDM1D | jumonji C domain containing histone | KIAA1718 | NM_030647 |
| demethylase 1 homolog D (S. | |||
| cerevisiae) | |||
| PHF8 | PHD finger protein 8 | ZNF422, KIAA1111, | NM_015107 |
| JHDM1F | |||
| PHF2 | PHD finger protein 2 | KIAA0662, JHDM1E, | NM_005392 |
| CENP-35 | |||
| KDM8 | lysine (K)-specific demethylase 8 | FLJ13798 | NM_024773 |
Modulators of Gene Expression
In an embodiment a payload comprises a modulator of gene expression. A modulator of gene expression can be delivered in vitro, ex vivo, or in vivo.
In an embodiment, the payload comprises a transcription factor. Transcription factors can bind to specific DNA sequences (e.g., an enhancer or promoter region) adjacent to the genes that they regulate. For example, transcription factors can stabilize or inhibit the binding of RNA polymerase to DNA, catalyze the acetylation or deacetylation of histone proteins (e.g., directly or by recruiting other proteins with such catalytic activity), or recruit coactivator or corepressor proteins to the transcription factor/DNA complex. Modulators of gene expression also include, e.g., any proteins that interact with transcription factors directly or indirectly.
In an embodiment, the transcription factor is a general transcription factor, e.g., is ubiquitous and interacts with the core promoter region surrounding the transcription start site(s) of many, most or all class II genes. Exemplary general transcription factors include, e.g., TFIIA, TFIIB, TFIID, TFIIE, TFIIF, and TFIIH. In an embodiment, the transcription factor is an upstream transcription factor, e.g., binds upstream of the initiation site to stimulate or repress transcription. In an embodiment, the transcription factor is a specific transcription factor, e.g., a transcription factor dependent on a recognition sequence present in the proximity of the gene. Exemplary specific transcription factors include, e.g., SP1, AP-1, C/EBP, heat shock factor, ATF/CREB, -Myc, OCT-1, and NF-1.
In an embodiment, the transcription factor is constitutively active, e.g., a general transcription factor, SP1, NF-1, or CCAAT. In an embodiment, the transcription factor is conditionally active, e.g. it requires activation, e.g., developmental (e.g., GATA, HNF, PIT-1, MyoD, Myf5, Hox, Winged Helix), signal-dependent (e.g., extracellular ligand (endocrine or paracrine)-dependent, intracellular ligand (autocrine)-dependent (e.g., SREBP, p53, orphan nuclear receptors), cell membrane receptor-dependent (e.g., resident nuclear factors (e.g., CREB, AP-1, Mef2) or latent cytoplasmic factors (e.g., STAT, R-SMAD, NF-κB, Notch, TUBBY, NFAT).
Other exemplary transcription factors are described herein, e.g., in Table VI-5.
| TABLE VI-5 |
| Selected Transcription Factors with Anotations |
| Transcription | |
| factor family | |
| (# genes/family) | Comments |
| AF-4(4) | Exemplary diseases include acute lymphoblastic leukemia (AF4 and |
| AFF3) and mental retardation (FMR2). | |
| CBF(1) | Exemplary functions include regulator of hematopoiesis. For |
| example, CBF is also involved in the chondrocyte differentiation and | |
| ossification. | |
| CSL(2) | Exemplary functions include universal transcriptional effector of |
| Notch signaling. For example, Notch signaling is dysregulated in | |
| many cancers and faulty notch signaling is implicated in many | |
| diseases. Exemplary disease include T-ALL (T-cell acute | |
| lymphoblastic leukemia), CADASIL (Cerebral Autosomal-Dominant | |
| Arteriopathy with Sub-cortical Infarcts and Leukoencephalopathy), | |
| MS (Multiple Sclerosis), Tetralogy of Fallot, Alagille syndrome. | |
| ETS(29) | Exemplary functions include regulation of cellular differentiation, cell |
| cycle control, cell migration, cell proliferation, apoptosis | |
| (programmed cell death) and angiogenesis. Exemplary diseases | |
| include dieases associated with cancer, such as through gene fusion, | |
| e.g., prostate cancer. | |
| HMGI/HMGY(2) | Overexpression in certain cancers |
| MH1(8) | Exemplary diseases include cancer, fibrosis and autoimmune |
| diseases. | |
| Nuclear orphan | Exemplary functions include superfamily of transcription regulators |
| receptor(3) | that are involved in widely diverse physiological functions, including |
| control of embryonic development, cell differentiation and | |
| homeostasis. Exemplary diseases include inflammation, cancer, and | |
| metabolic disorders. | |
| PC4(1) | Exemplary functions include replication, DNA repair and |
| transcription. | |
| RFX(8) | Exemplary functions include regulation of development and function |
| of cilia. Exemplary diseases include Bardet-Biedl syndrome. | |
| STAT(7) | Exemplary functions include regulation of many aspects of growth, |
| survival and differentiation in cells. Exemplary diseases include | |
| angiogenesis, enhanced survival of tumors and immunosuppression. | |
| Thyroid hormone | Involved in widely diverse physiological functions, including control |
| receptor(25) | of embryonic development, cell differentiation and homeostasis |
| zf-C2HC(6) | Highly transcribed in the developing nervous system. Exemplary |
| diseases include Duane Radial Ray Syndrome. | |
| Androgen | Exemplary functions include diverse physiological functions, |
| receptor(1) | including control of embryonic development, cell differentiation and |
| homeostasis. Exemplary diseases include X-linked spinal, bulbar | |
| muscular atrophy and prostate cancer. | |
| CG-1(2) | Exemplary functions include calcium signaling by direct binding of |
| calmodulin. | |
| CTF/NFI(4) | Exemplary functions include both viral DNA replication and |
| regulation of gene expression. Exemplary diseases include leukemia, | |
| juvenile myelomonocytic. | |
| Fork head(49) | Involvement in early developmental decisions of cell fates during |
| embryogenesis. Exemplary diseases include lymphedema-distichiasis, | |
| developmental verbal dyspraxia, autoimmune diseases. | |
| Homeobox(205) | Exemplary functions include involvement in a wide range of critical |
| activities during development. Exemplary diseases include limb | |
| malformations, eye disorders, and abnormal head, face, and tooth | |
| development. Additionally, increased or decreased activity of certain | |
| homeobox genes has been associated with several forms of cancer. | |
| MYB(25) | Exemplary functions include regulator of proliferation, differentiation |
| and cell fate. Exemplary diseases include cancer (e.g., oncogenic | |
| disease). | |
| Oestrogen | Control of embryonic development, cell differentiation and |
| receptor(1) | homeostasis. Exemplary diseases include estrogen resistance, familial |
| breast cancer, migrane, myocardial infaction. | |
| POU(21) | Wide variety of functions, related to the function of the |
| neuroendocrine system and the development of an organism. | |
| Exemplary diseases include non-syndromic deafness. | |
| RHD(10) | Exemplary diseases include autoimmune arthritis, asthma, septic |
| shock, lung fibrosis, glomerulonephritis, atherosclerosis, and AIDS. | |
| T-box(17) | |
| TSC22(4) | |
| zf-GATA(14) | |
| AP-2(5) | |
| COE(4) | |
| CUT(7) | |
| GCM(2) | |
| HSF(8) | |
| NDT80/PhoG(1) | |
| Other nuclear | |
| receptor(2) | |
| PPAR receptor(3) | |
| ROR receptor(4) | |
| TEA(4) | |
| Tub(5) | |
| zf-LITAF-like(2) | |
| ARID(15) | |
| COUP(3) | |
| DM(7) | |
| GCR(1) | |
| HTH(2) | |
| NF-YA(1) | |
| Others(3) | |
| Progesterone | |
| receptor(1) | |
| Runt(3) | |
| TF_bZIP(46) | |
| ZBTB(48) | |
| zf-MIZ(7) | |
| bHLH(106) | |
| CP2(7) | |
| E2F(11) | |
| GTF2I(5) | |
| IRF(9) | |
| NF-YB/C(2) | |
| P53(3) | |
| Prox1(2) | |
| SAND(8) | |
| TF_Otx(3) | |
| zf-BED(5) | |
| zf-NF-X1(2) | |
| C/EBP(10) | |
| CSD(8) | |
| Ecdystd | |
| receptor(2) | |
| HMG(50) | |
| MBD(9) | |
| Nrf1(1) | |
| PAX(9) | |
| Retinoic acid | |
| receptor(7) | |
| SRF(6) | |
| THAP(12) | |
| zf-C2H2(634) | |
| CRX | Exemplary diseases include dominant cone-rod dystrophy. Repair |
| mutation. | |
| FOCX2 | Exemplary diseases include lymphedema-distichiasis. Repair |
| mutation. | |
| FOXP2 | Exemplary diseases include developmental verbal dyspraxia. Repair |
| mutation. | |
| FOXP3 | Exemplary diseases include autoimmune diseases. Repair mutation. |
| GAT4 | Exemplary diseases include congenital heart defects. Repair mutation. |
| HNF1 through | Exemplary diseases include mature onset diabetes of the young |
| HNF6 | (MODY), hepatic adenomas and renal cysts. Repair mutation. |
| LHX3 | Exemplary diseases include Pituitary disease. Repair mutation. |
| MECP2 | Exemplary diseases include Rett syndrome. Repair mutation. |
| MEF2A | Exemplary diseases include Coronary artery disease. Repair mutation. |
| NARA2 | Exemplary diseases include Parkinson disease. Repair mutation. |
| NF-κB | Exemplary diseases include autoimmune arthritis, asthma, septic |
| Activation | shock, lung fibrosis, glomerulonephritis, atherosclerosis, and AIDS. |
| Repair mutation. | |
| NF-κB | Exemplary diseases include apoptosis, inappropriate immune cell |
| Inhibition | development, and delayed cell growth. Repair mutation. |
| NIKX2-5 | Exemplary diseases include cardiac malformations and |
| atrioventricular conduction abnormalities. | |
| NOTCH1 | Exemplary diseases include aortic valve abnormalities. |
Modulators of Alternative Splicing
In an embodiment, the modulator of gene expression modulates splicing. For example, a modulator can modulate exon skipping or cassette exon, mutually exclusive exons, alternative donor site, alternative acceptor site, intron retention, or a combination thereof. In an embodiment, the modulator is selected from or modulates one or more general or alternative splicing factors, e.g., ASF1. In an embodiment, the modulator modulates alternative splicing (e.g., influences splice site selection) in a concentration-dependent manner.
Modulators of Post-Transcriptional Modification
In an embodiment, the modulator of gene expression modulates post-transcriptional modification. For example, the modulators described herein can promote or inhibit 5′ capping, 3′ polyadenylation, and RNA splicing. In an embodiment, the modulator is selected from, or modulates, one or more factors involved in 5′ capping, e.g., phosphatase and guanosyl transferase. In an embodiment, the modulator is selected from, or modulates, one or more factors involved in 3′ polyadenylation, e.g., polyadenylate polymerase, cleavage and polyadenylation specificity factor (CPSF), and poly(A) binding proteins. In an embodiment, the modulator is selected from, or modulates, one or more factors involved in RNA splicing, e.g., general or alternative splicing factors.
Exemplary endogenous or exogenous modulators of post-transcriptional modification are described herein, e.g., in Table VI-6.
| TABLE VI-6 | |
| POST-TRANSCRIPTIONAL CONTROL MODULATORS | |
| mRNA processing | |
| Polyadenylation | |
| PARN: polyadenylation specific ribonuclease | |
| PAN: PolyA nuclease | |
| CPSF: cleavage/polyadenylation specificity factor | |
| CstF: cleavage stimulation factor | |
| PAP: polyadenylate polymerase | |
| PABP: polyadenylate binding protein | |
| PAB2: polyadenylate binding protein 2 | |
| CFI: cleavage factor I | |
| CFII: cleavage factor II | |
| Capping/Methylation of 5′end | |
| RNA triposphatase | |
| RNA gluanyltransferase | |
| RNA mehyltransferase | |
| SAM synthase | |
| ubiquitin-conjugating enzyme E2R1 | |
| Splicing | |
| SR proteins SFRS1-SFR11 which, when bound to | |
| exons, tend to promote | |
| hnRNP proteins: coded by the following | |
| genes: HNRNPA0, HNRNPA1, HNRNPA1L1, | |
| HNRNPA1L2, HNRNPA3, HNRNPA2B1, | |
| HNRNPAB, HNRNPB1, HNRNPC, HNRNPCL1, | |
| HNRNPD, HNRPDL, HNRNPF, HNRNPH1, | |
| HNRNPH2, HNRNPH3, HNRNPK, HNRNPL, | |
| HNRPLL, HNRNPM, HNRNPR, HNRNPU, | |
| HNRNPUL1, HNRNPUL2, HNRNPUL3 | |
| Editing protein | |
| ADAR | |
| Nuclear export proteins | |
| Mex67 | |
| Mtr2 | |
| Nab2 | |
| DEAD-box helicase (“DEAD” disclosed as SEQ ID | |
| NO: 40) | |
| TRANSLATION | |
| Initiation | |
| eIF4A, eIF4B, eIF4E, and eIF4G: Eukaryotic initiation | |
| factors | |
| GEF: Guanine exchange factor | |
| GCN2, PKR, HRI and PERK: Kinases involved in | |
| phosphorylating some of the initiation factors | |
| Elongation | |
| eEF1 and eEF2: elongation factors | |
| GCN: kinase | |
| Termination | |
| eRF3: translation termination factor | |
| POST-TRANSLATIONAL CONTROL | |
| mRNA Degradation | |
| ARE-specific binding proteins | |
| EXRN1: exonuclease | |
| DCP1, DCP2: Decapping enzymes | |
| RCK/p54, CPEB, eIF4E: Translation repression | |
| microRNAs and siRNAs: Probably regulate 30% of all | |
| genes | |
| DICER | |
| Ago proteins | |
| Nonsense-mediated mRNA decay proteins | |
| UPF3A | |
| UPF3B | |
| eIF4A3 | |
| MLN51 | |
| Y14/MAGOH | |
| MG-1 | |
| SMG-5 | |
| SMG-6 | |
| SMG-7 | |
| mRNA Modification | |
| Enzymes carry the following functions | |
| Phosphorylation | |
| N-linked glycosylation | |
| Acetylation | |
| Amidation | |
| Hydroxylation | |
| Methylation | |
| O-linked glycosylation | |
| Ubiquitylation | |
Inhibitors
In an embodiment a payload comprises an inhibitor of a payload described above, e.g., an inhibitor of an enzyme transcription factor. In an embodiment a payload comprises an inhibitor of any of the aforementioned payload molecules, processes, activities or mechanisms. In an embodiment, the inhibitor is an antibody molecule (e.g., a full antibody or antigen binding fragment thereof) specific for one of the payload molecules described herein. In an embodiment the inhibitor is a small molecule compound. In an embodiment, the inhibitor is a nucleic acid (e.g., siRNA, shRNA, ribozyme, antisense-oligonucleotide, and aptamer). For example, the payload is an inhibitor of a target, e.g., a transcription factor, a post-translational modification enzyme, a post-transcriptional modification enzyme, etc., or a nucleic acid sequence encoding any of the foregoing.
Orthologs
If a non-human gene or protein is recited herein it is understood that the invention also comprises the human counterpart or ortholog and uses thereof.
Cas9 molecules and gRNA molecules, e.g., a Cas9 molecule/gRNA molecule complex, can be used to manipulate a cell (e.g., an animal cell or a plant cell), e.g., to deliver a payload, or edit a target nucleic acid, in a wide variety of cells. Typically an eiCas9 molecule/gRNA molecule complex is used to deliver a payload and an eaCas9 molecule/gRNA complex is used to edit or alter the structure of a target nucleic acid. Delivery or editing can be performed in vitro, ex vivo, or in vivo.
In an embodiment, a cell is manipulated by editing (e.g., introducing a mutation or correcting) one or more target genes, e.g., as described herein. In an embodiment, a cell is manipulated by delivering a payload comprising one or more modulators (e.g., as described herein) to the cell, e.g., to a target sequence in the genome of the cell. In an embodiment, the expression of one or more target genes (e.g., one or more target genes described herein) is modulated, e.g., in vivo. In an embodiment, the expression of one or more target genes (e.g., one or more target genes described herein) is modulated, e.g., ex vivo.
In an embodiment, the cells are manipulated (e.g., converted or differentiated) from one cell type to another. In an embodiment, a pancreatic cell is manipulated into a beta islet cell. In an embodiment, a fibroblast is manipulated into an iPS cell. In an embodiment, a preadipocyte is manipulated into a brown fat cell. Other exemplary cells include, e.g., muscle cells, neural cells, leukocytes, and lymphocytes.
In an embodiment, the cell is a diseased or mutant-bearing cell. Such cells can be manipulated to treat the disease, e.g., to correct a mutation, or to alter the phenotyope of the cell, e.g., to inhibit the growth of a cancer cell. For examples, a cell is associated with one or more diseases or conditions describe herein. In an embodiment, the cell is a cancer stem cell. For example, cancer stem cells can be manipulated by modulating the expression of one or more genes selected from: TWIST (TF), HIF-1α, HER2/neu, Snail (TF), or Wnt.
In an embodiment, the manipulated cell is a normal cell.
In an embodiment, the manipulated cell is a stem cell or progenitor cell (e.g., iPS, embryonic, hematopoietic, adipose, germline, lung, or neural stem or progenitor cells).
In an embodiment, the manipulated cells are suitable for producing a recombinant biological product. For example, the cells can be CHO cells or fibroblasts. In an embodiment, a manipulated cell is a cell that has been engineered to express a protein.
In an embodiment, the cell being manipulated is selected from fibroblasts, monocytic precursors, B cells, exocrine cells, pancreatic progenitors, endocrine progenitors, hepatoblasts, myoblasts, or preadipocytes. In an embodiment, the cell is manipulated (e.g., converted or differentiated) into muscle cells, erythroid-megakaryocytic cells, eosinophils, iPS cells, macrophages, T cells, islet beta-cells, neurons, cardiomyocytes, blood cells, endocrine progenitors, exocrine progenitors, ductal cells, acinar cells, alpha cells, beta cells, delta cells, PP cells, hepatocytes, cholangiocytes, or brown adipocytes.
In an embodiment, the cell is a muscle cell, erythroid-megakaryocytic cell, eosinophil, iPS cell, macrophage, T cell, islet beta-cell, neuron, cardiomyocyte, blood cell, endocrine progenitor, exocrine progenitor, ductal cell, acinar cell, alpha cell, beta cell, delta cell, PP cell, hepatocyte, cholangiocyte, or white or brown adipocyte.
The Cas9 and gRNA molecules described herein can be delivered to a target cell. In an embodiment, the target cell is a normal cell.
In an embodiment, the target cell is a stem cell or progenitor cell (e.g., iPS, embryonic, hematopoietic, adipose, germline, lung, or neural stem or progenitor cells).
In an embodiment, the target cell is a CHO cell.
In an embodiment, the target cell is a fibroblast, monocytic precursor, B cells exocrine cell, pancreatic progenitor, endocrine progenitor, hepatoblast, myoblast, or preadipocyte.
In an embodiment, the target cell is a muscle cell, erythroid-megakaryocytic cell, eosinophil, iPS cell, macrophage, T cell, islet beta-cell, neurons (e.g., a neuron in the brain, e.g., a neuron in the striatum (e.g., a medium spiny neuron), cerebral cortex, precentral gyms, hippocampus (e.g., a neuron in the dentate gyrus or the CA3 region of the hippocampus), temporal cortex, amygdala, frontal cortex, thalamus, cerebellum, medulla, putamen, hypothalamus, tectum, tegmentum or substantia nigra), cardiomyocyte, blood cell, endocrine progenitor, exocrine progenitor, ductal cell, acinar cell, alpha cell, beta cell, delta cell, PP cell, hepatocyte, cholangiocyte, or brown adipocyte.
In an embodiment, the target cell is manipulated ex vivo by editing (e.g., introducing a mutation or correcting) one or more target genes and/or modulating the expression of one or more target genes, and administered to the subject.
Exemplary cells that can be manipulated and exemplary genes that can be modulated are described in Table VII-8.
| TABLE VII-8 | |||
| Cell starting | Differentiated | Exemplary gene(s) to | |
| point | state | Exemplary payload manipulation | modify expression of |
| fibroblasts | Muscle cells | Deliver Cas9-activators to target | MyoD |
| activation of transcription factors | |||
| required for differentiation in vivo. | |||
| Monocytic | Erythroid- | Deliver Cas9-activators to target | GATA1 |
| precursors | megakaryocytic | activation of transcription factors | |
| cells, | required for differentiation in vivo. | ||
| eosinophils | |||
| fibroblasts | iPS cells | Deliver Cas9-activators to target | Oct4 |
| activation of transcription factors | Sox2 | ||
| required for differentiation in vivo. | Klf4 | ||
| Multiplex. | Myc | ||
| B cells | Macrophages | Deliver Cas9-activators to target | C/EBPα |
| activation of transcription factors | |||
| required for differentiation in vivo. | |||
| B cells | T cells, | Delivery Cas9-repressors OR | Pax5 |
| macrophages | deliver Cas9 endonuclease to | ||
| ablate Pax5 | |||
| Exocrine | Islet β-cells | Deliver Cas9-activators to target | Pdx1 |
| cells | activation of transcription factors | Ngn3 | |
| required for differentiation in vivo. | MafA | ||
| Multiplex. | |||
| Fibroblasts | Neurons | Deliver Cas9-activators to target | Ascl1 |
| activation of transcription factors | Brn2 | ||
| required for differentiation in vivo. | Myt1l | ||
| Multiplex. | |||
| fibroblasts | cardiomyocytes | Deliver Cas9-activators to target | Gata4 |
| activation of transcription factors | Mef2c | ||
| required for differentiation in vivo. | Tbx5 | ||
| Multiplex. | |||
| Fibroblasts | Blood cells | Deliver Cas9-activators to target | Oct4 |
| activation of transcription factors | |||
| required for differentiation in vivo. | |||
| Fibroblasts | cardiomyocytes | Deliver Cas9-activators to target | Oct4 |
| activation of transcription factors | Sox2 | ||
| required for differentiation in vivo. | Klf4 | ||
| Multiplex. | |||
| Pancreatic | Endocrine | Deliver Cas9-activators to target | Ngn3 |
| progenitor | progenitor | activation of transcription factors | |
| required for differentiation in vivo. | |||
| Pancreatic | Exocrine | Deliver Cas9-activators to target | P48 |
| progenitor | progenitor | activation of transcription factors | |
| required for differentiation in vivo. | |||
| Pancreatic | Duct | Deliver Cas9-activators to target | Hnf6/OC-1 |
| progenitor | activation of transcription factors | ||
| required for differentiation in vivo. | |||
| Pancreatic | acinar | Deliver Cas9-activators to target | Ptf1a |
| progenitor | activation of transcription factors | Rpbjl | |
| required for differentiation in vivo. | |||
| Multiplex. | |||
| Endocrine | α cell | Deliver Cas9-activators to target | Foxa2 |
| progenitor | activation of transcription factors | Nkx2.2 | |
| (to make | required for differentiation in vivo. | Pax6 | |
| glucagon) | Multiplex. | Arx | |
| Endocrine | β cell | Deliver Cas9-activators to target | Mafa |
| progenitor | activation of transcription factors | Pdx1 | |
| (to make | required for differentiation in vivo. | Hlxb9 | |
| insulin) | Multiplex. | Pax4 | |
| Pax6 | |||
| Isl1 | |||
| Nkx2.2 | |||
| Nkx6.1 | |||
| Endocrine | δ cell | Deliver Cas9-activators to target | Pax4 |
| progenitor | activation of transcription factors | Pax6 | |
| (to make | required for differentiation in vivo. | ||
| somatostatin) | Multiplex. | ||
| Endocrine | PP cell | Deliver Cas9-activators to target | Nkx2.2 |
| progenitor | activation of transcription factors | ||
| (to make | required for differentiation in vivo. | ||
| pancreatic | |||
| polypeptide) | |||
| Hepatoblast | hepatocyte | Deliver Cas9-activators to target | Hnf4 |
| activation of transcription factors | |||
| required for differentiation in vivo. | |||
| Hepatoblast | Cholangiocyte | Deliver Cas9-activators to target | Hnf6/OC-1 |
| activation of transcription factors | |||
| required for differentiation in vivo. | |||
| Myoblasts | Brown | Deliver Cas9-activators to target | PRDM16 |
| adipocyte | activation of transcription factors | C/EBP | |
| required for differentiation in vivo. | PGC1α | ||
| Multiplex. | PPARγ | ||
| preadipocytes | Brown | Deliver Cas9-activators to target | PRDM16 |
| adipocyte | activation of transcription factors | C/EBP | |
| required for differentiation in vivo. | |||
| Multiplex. | |||
| TABLE VII-9 |
| Exemplary cells for manipulation |
| Pancreatic cells, e.g., beta cells | |
| Muscle cells | |
| Adipocytes | |
| Pre-adipocytes | |
| Neural cells | |
| Blood cells | |
| Leukocytes | |
| Lymphocyes | |
| B cells | |
| T cells | |
| TABLE VII-10 |
| Exemplary stem cells for manipulation |
| embryonic stem cells | |
| non-embryonic stem cells | |
| hematopoietic stem cells | |
| adipose stem cells | |
| germline stem cells | |
| lung stem cells | |
| neural stem cells | |
| TABLE VII-11 |
| Exemplary cancer cells for manipulation |
| lung cancer cells | |
| breast cancer cells | |
| skin cancer cells | |
| brain cancer cells, | |
| pancreatic cancer cells | |
| hematopoietic cancer cells | |
| liver cancer cells | |
| kidney cancer cells | |
| ovarian cancer cells | |
| TABLE VII-12 |
| Exemplary non-human cells for manipulation |
| Table VII-12 Non-human cells for manipulation |
| Plant cells, e.g., crop cells, e.g., corn, wheat, | |
| soybean, citrus or vegetable cells | |
| Animal cells, e.g., a cow, pig, horse, goat, dog or cat | |
| cell | |
Exemplary endogenous or exogenous modulators of cancer stem cells (CSCs) are described herein, e.g., in Table VII-13.
| TABLE VII-13 | |
| TWIST 1 (TF) | |
| HIF-1α (TF) | |
| HER2/neu | |
| Snail (TF) | |
| Wnt | |
| TGFβ | |
| FGF | |
| EGF | |
| HGF | |
| STAT3 (TF) | |
| Notch | |
| P63 (TF) | |
| PI3K)/AKT | |
| Hedgehog | |
| NF-κB (TF) | |
| ATF2 (TF) | |
| miR-200 and miR-34 | |
| P53 (TF) | |
| E-cadherin | |
| Transcription factors that inhibit E-cadherin directly | |
| ZEB1 | |
| ZEB2 | |
| E47 | |
| KLF8 | |
| Transcription factors that inhibit E-cadherin directly | |
| TCF4 | |
| SIX1 | |
| FOXC2 | |
| G-CSF and CD34 in AML | |
| PML and FOXO in CML | |
| CD133 in glioblastoma multiforme, osteosarcoma, Ewing's sarcoma, | |
| endometrial, hepatocellular, colon and lung carcinomas and ovarian | |
| and pancreatic adenocarcinoma | |
| CD44 in head and neck cancer, prostate, gastric and colorectal | |
| carcinoma stem cells | |
| CD34 in leukemia | |
| CD38 in leukemia | |
| IL3Rα in leukemia | |
| EpCAM in colon carcinoma and pancreatic adenocarcinoma stem | |
| cells | |
| ALDH in melanoma, colorectal, breast, prostate and squamous cell | |
| carcinomas, pancreatic adenocarcinoma, and osteosarcoma | |
| MAP2 in melanoma | |
| α6-integrin in glioblastoma | |
| SSEA-1 in gliobalstoma | |
| CD24 in breast cancer and other tumors | |
Cas9 molecules and gRNA molecules, e.g., a Cas9 molecule/gRNA molecule complex, can be used to manipulate a cell (e.g., a cell described herein), e.g., to deliver a payload, or edit a target nucleic acid, e.g., to increase cell engraftment, e.g., to achieve stable engraftment of cells into a native microenvironment. The engrafting cells, the cells in the native microenvironment, or both, can be manipulated. Typically an eiCas9 molecule/gRNA molecule complex is used to deliver a payload and an eaCas9 molecule/gRNA complex is used to edit or alter the structure of a target nucleic acid.
For example, increased efficiency of engraftment of cells can be achieved by: increasing the expression of one or more of the genes described herein, e.g., homing genes, adhesion genes, survival genes, proliferative genes, immune evasion genes, and/or cell protection genes, and/or decreasing the expression of one or more of the genes described herein, e.g., quiescence genes, death/apoptosis genes, and/or immune recognition genes.
In an embodiment, the gene encodes a homing receptor or an adhesion molecule, e.g., that is involved in directing cell migration towards a tissue in association with a tissue-expressed ligand or region rich in soluble cytokine. In an embodiment, the homing receptor or adhesion molecule is expressed on leukocytes, e.g., lymphocytes or hematopoietic stem cells. In an embodiment, the tissue is bone marrow, e.g., extracellular matrix or stromal cells. In an embodiment, the homing receptor or adhesion molecule is C-X-C chemokine receptor type 4 (CXCR4, also known as fusin or CD184). For example, the expression of CXCR4 on hematopoietic stem cells is upregulated. In an embodiment, the ligand is stromal-derived-factor-1 (SDF-1, also known as CXCL12). In an embodiment, the homing receptor or adhesion molecule is CD34. In an embodiment, the ligand is addressin (also known as mucosal vascular addressin cell adhesion molecule 1 (MAdCAM-1)).
In an embodiment, the gene encodes a receptor, e.g., expressed on a stem cell or progenitor cell, that binds to a ligand, e.g., a chemokine or cytokine. For example, the receptor can be associated with stemness of the cell and/or attracting the cell to a desired microenvironment. In an embodiment, the receptor is expressed on a hematopoietic stem cell. In an embodiment, the receptor is expressed on a neural stem cell. In an embodiment, the receptor is mast/stem cell growth factor receptor (SCFR, also known as proto-oncogene c-Kit or tyrosine-protein kinase Kit or CD117). In an embodiment, the ligand is stem cell factor (SCF, also known as steel factor or c-kit ligand). In an embodiment, the receptor is myeloproliferative leukemia virus oncogene (MPL, also known as CD110). In an embodiment, the ligand is thrombopoietin (TPO).
In an embodiment, the gene encodes a marker, e.g., that promotes survival or proliferation of the cells expressing that marker, or allows the cells expressing that marker to evade an immune response or to be protected from an adverse environment, e.g., that leads to cell death. For example, cells expressing CD47 (also known as integrin associated protein (IAP) can avoid phagocytosis, e.g., during cell migration. As another example, cells that express BCL2 can be protected from apoptosis. In an embodiment, the cell is a blood cell, e.g., an erythrocyte or leukocyte. In an embodiment, the cell is a hematopoietic stem cell or progenitor cell.
In an embodiment, the expression of one or more of CXCR4, SDF1, CD117, MPL, CD47, or BCL2, in a stem cell or progenitor cell, e.g., a hematopoietic stem cell or progenitor cell, is upregulated.
Cas9 molecules and gRNA molecules, e.g., a Cas9 molecule/gRNA molecule complex, can be used to manipulate a cell (e.g., a cell described herein), e.g., to deliver a payload, or edit a target nucleic acid, e.g., to manipulate (e.g., dictate) the fate of a targeted cell, e.g., to better target specific cell type of interest and/or as a suicide mechanism. Typically an eiCas9 molecule/gRNA molecule complex is used to deliver a payload and/or an eaCas9 molecule/gRNA complex is used to edit or alter the structure of a target nucleic acid. Exemplary genes that can be modulated include, e.g., one or more of chemotherapy resistance genes, chemotherapy sensitivity genes, antibiotic resistance genes, antibiotic sensitivity genes, and cell surface receptor genes, e.g., as described herein.
In an embodiment, a chemotherapy resistance gene, a chemotherapy sensitivity gene, an antibiotic resistance gene, and/or an antibiotic sensitivity gene is modulated, e.g., such that modified or undesirable cells (e.g., modified or undesirable hematopoietic stem cells (HSCs), e.g., in bone marrow) can be reduced or removed, e.g., by chemotherapeutic or antibiotic treatment.
For example, genes or gene products that modulate (e.g., increase) chemotherapy resistance or antibiotic resistance can be delivered into the cells. Cells modified by the chemotherapy or antibiotic resistance gene or gene product can have a higher (e.g., at least about 2, 3, 4, 5, 6, 7, 8, 9, 10, 25, 50, 75, or 100 fold higher) survival rate than cells without such modification after chemotherapeutic or antibiotic treatment. In an embodiment, the chemotherapeutic or antibiotic treatment is performed in vivo. In an embodiment, the chemotherapeutic or antibiotic treatment is performed in vitro or ex vivo. In an embodiment, the chemotherapy resistance gene is a gene encoding O6-alkylguanine DNA alkyltransferase (MGMT). In an embodiment, the chemotherapy comprises temozolomide.
As another example, genes or gene products that modulate (e.g., increase) chemotherapy sensitivity or antibiotic sensitivity can be delivered into the cells. The genes or gene products that confer chemotherapy sensitivity or antibiotic sensitivity can be used as suicide signals, e.g., causing apoptosis of the cells. Cells modified by the chemotherapy or antibiotic sensitivity gene or gene product can have a lower (e.g., at least about 2, 3, 4, 5, 6, 7, 8, 9, 10, 25, 50, 75, or 100 fold lower) survival rate than cells without such modification after chemotherapeutic or antibiotic treatment. In an embodiment, the chemotherapeutic or antibiotic treatment is performed in vivo. In an embodiment, the chemotherapeutic or antibiotic treatment is performed in vitro or ex vivo.
The method described herein can be used to select or enrich cells that have a modified or desired phenotype, e.g., chemotherapy resistance and/or antibiotic resistance. The method described herein can also be used to remove or reduce the number of cells that have a modified or undesired phenotype, e.g., chemotherapy sensitivity and/or antibiotic sensitivity. For example, cells that exhibit an undesired effect, e.g., an off-target effect or a cancer phenotype, e.g., caused by editing of a nucleic acid in an undesired genomic location or cell type, can be removed.
In an embodiment, a cell surface receptor gene is modulated (e.g., the expression of the cell surface receptor is increased or decreased), such that a therapeutic agent (e.g., a therapeutic antibody) can be used to target a cell (e.g., to kill the cell) that has increased or decreased expression of the cell surface receptor. In an embodiment, the cell surface receptor is CD20. In an embodiment, the therapeutic antibody is Rituximab.
In an embodiment, the cell surface receptor is selected from, e.g., CD52, VEGFR, CD30, EGFR, CD33, or ErbB2. In an embodiment, the therapeutic antibody is selected from, e.g., Alemtuzumab, Rituximab, Cetuximab, Panitumumab, Gentuzaumab, and Trastuzumab. In an embodiment, the cell surface receptor is CD52 and the therapeutic antibody is Alemtuzumab. In an embodiment, the gene encodes VEGF and the therapeutic antibody is Rituximab. In an embodiment, the cell surface receptor is EGFR and the therapeutic antibody is Cetuximab or Panitumumab. In an embodiment, the cell surface receptor is CD33 and the therapeutic antibody is Gentuzaumab. In an embodiment, the cell surface receptor is ErbB2 and the therapeutic antibody is Trastuzumab.
In an embodiment, the expression or activity of the Cas9 molecule and/or the gRNA molecule is induced or repressed, e.g., when the cell is treated with a drug, e.g., an antibiotic, e.g., in vivo. For example, the induction or repression of the expression or activity of the Cas9 molecule and/or the gRNA molecule can be used to reduce toxicity and/or off-target effects, e.g., in certain tissues. In an embodiment, the expression of the Cas9 molecule, the gRNA molecule, or both, is driven by an inducible promoter. In an embodiment, binding of a drug (e.g., an antibiotic) to the Cas9 molecule and/or the gRNA molecule activates or inhibits the activity of the Cas9 molecule and/or the gRNA molecule. In an embodiment, the drug (e.g., antibiotic) is administered locally. In an embodiment, the cell treated with the drug (e.g., antibiotic) is located in the eye, ear, nose, mouth, or skin.
Cas9 molecules and gRNA molecules, e.g., a Cas9 molecule/gRNA molecule complex, can be used to manipulate a cell (e.g., a cell described herein), e.g., to deliver a payload, or edit a target nucleic acid, e.g., in directed enzyme prodrug therapy (DEPT). Typically an eiCas9 molecule/gRNA molecule complex is used to deliver a payload and an eaCas9 molecule/gRNA complex is used to edit or alter the structure of a target nucleic acid.
Directed enzyme prodrug therapy (DEPT) uses enzymes artificially introduced into the body to convert prodrugs, which have no or poor biological activity, to the active form in the desired location within the body. For example, directed enzyme prodrug therapy can be used to reduce the systemic toxicity of a drug, by achieving high levels of the active drug only at the desired site.
In an embodiment, an enzyme required for prodrug conversion or a gene encoding such an enzyme is delivered to a target cell, e.g., a cancer cell. For example, the enzymes or genes can be delivered by a method described herein. In an embodiment, the gene encoding the enzyme required for prodrug conversion is delivered by a viral vector.
Cas9 molecules and gRNA molecules, e.g., a Cas9 molecule/gRNA molecule complex, can be used to manipulate a cell (e.g., a cell described herein), e.g., to deliver a payload, or edit a target nucleic acid, e.g., to improve immunotherapy, e.g. cancer immunotherapy. Typically an eiCas9 molecule/gRNA molecule complex is used to deliver a payload and an eaCas9 molecule/gRNA complex is used to edit or alter the structure of a target nucleic acid. Exemplary genes that can be modulated include, e.g., one or more genes described herein, e.g., PD-L1 and/or PD-L2 genes.
Cas9 molecules and gRNA molecules, e.g., a Cas9 molecule/gRNA molecule complex, can be used to manipulate one, two, three or more, elements or a pathway, e.g., by targeting sequences that encode an RNA or protein of a pathway, or sequences that control the expression of an RNA or protein of a pathway. In an embodiment, an element of a first pathway and an element of a second pathway are manipulated. In an embodiment, manipulation comprises delivery of a payload to, or editing, a target nucleic acid. Typically an eiCas9 molecule/gRNA molecule complex is used to deliver a payload and an eaCas9 molecule/gRNA complex is used to edit or alter the structure of a target nucleic acid. Delivery or editing can be performed in vitro, ex vivo, or in vivo.
An element of a pathway can be up or down regulated, e.g., the expression of a gene encoding a protein of a pathway can be increased or decreased. The increase or decrease can be effected by delivery of a payload (e.g., a transcription factor or inhibitor of a transcription factor) or by editing a target nucleic acid (e.g., the use of a template nucleic acid to alter a sequence, e.g., correct or introduce a mutation, in e.g., a control or coding region).
Exemplary pathways comprise pathways associated with: cell proliferation; cell cycle; carbon metabolism; energy metabolism; glycolysis, anerobic respiration, anerobic respiration; transmembrane signal transduction, angiogenesis, DNA replication or repair, or pain.
Exemplary pathways and genes are discussed herein. It will be understood that a pathway or gene can be associated with one or more aspect of cell or organismal function, e.g., a pathway or gene can be involved in both cancer and energy metabolism. Manipulation of a pathway or gene is not limited to the exemplary cell or organismal function listed below. In an embodiment a pathway is associated with one or more diseases or conditions.
In an embodiment, the pathway is associated with cancer, e.g., associated with proliferation (e.g., RAF pathway), evading growth repressors, resisting cell death, enabling replicative immortality/aging, inducing angiogenesis, activating invasion and metastasis, energy metabolism and evading, cancer stem cells, cytokine-receptor interactions, or tumor suppressors. In an embodiment, the pathway is associated with cell cycle control. In an embodiment, the pathway is associated with angiogenesis.
Pathways and genes associated with cancer are described herein, e.g., include the following:
| TABLE VII-14 |
| Target Genes from Selected Pathways |
| CRISPR | |||
| Protein/Gene | Pathway | Disease | Regulation |
| Cancer |
| PI3K | Proliferation | Down | |
| B-Raf | Proliferation | 66% of all melanoma cancers have a | Down |
| single substitution in codon 599 | |||
| AKT | Proliferation | Down | |
| PTEN | Proliferation | Germline mutations leading to a | Down |
| predisposition to breast and | |||
| thyroid cancer | |||
| Mutations found in sporadic | |||
| brain, breast and prostate | |||
| mTOR | Proliferation | Down | |
| JUN | Proliferation | Down | |
| FOS | Proliferation | Down | |
| ERK | Proliferation | Down | |
| MEK | Proliferation | Down | |
| TGF-b | Proliferation | Down | |
| Myc | Proliferation | Down | |
| K-Ras | Proliferation | Mutated in lung cancer (10% of all | Down |
| Asians and 30% of all Caucasians) | |||
| Src | Proliferation | Down | |
| PYK2 | Proliferation | Down | |
| PAK | Proliferation | Down | |
| FAK | Proliferation | Down | |
| PKA | Proliferation | Down | |
| RAC | Proliferation | Down | |
| ALK | Proliferation | Mutated in a subset (2-7%) of lung | |
| cancers | |||
| Rb | Evading growth | Up | |
| suppressors/pro- | |||
| apoptotic | |||
| P53 | Evading growth | Mutation in colon, lung, esophagus, | Up |
| suppressors/pro- | breast, liver, brain reticuloendothelial | ||
| apoptotic | tissues, and hemopoietic tissues | ||
| APC | Evading growth | Mutations found in colon and intestine | |
| suppressors/pro- | |||
| apoptotic | |||
| CDK4/6 | Evading growth | Up | |
| suppressors/pro- | |||
| apoptotic | |||
| INK4B | Evading growth | Up | |
| suppressors/pro- | |||
| apoptotic | |||
| CDK2 | Evading growth | Up | |
| suppressors/pro- | |||
| apoptotic | |||
| WNT | Evading growth | Up | |
| suppressors/pro- | |||
| apoptotic | |||
| WAF1 | Evading growth | Up | |
| suppressors/pro- | |||
| apoptotic | |||
| Frizzled | Evading growth | Up | |
| suppressors/pro- | |||
| apoptotic | |||
| VHL | Evading growth | Mutated in all clear cell renal | Up |
| suppressors/pro- | carcinomas | ||
| apoptotic | |||
| Fas ligand | Resisting cell death/ | Down | |
| anti-apoptotic | |||
| Fas receptor | Resisting cell death/ | Down | |
| anti-apoptotic | |||
| Caspase 8 | Resisting cell death/ | Down | |
| anti-apoptotic | |||
| Caspase 9 | Resisting cell death/ | Down | |
| anti-apoptotic | |||
| Bcl-2 | Resisting cell death/ | Correct mutation large deletion in | Down |
| anti-apoptotic | follicular lymphoma, breast prostate | ||
| CLL, melanoma | |||
| Bcl-xL | Resisting cell death/ | Down | |
| anti-apoptotic | |||
| Bcl-w | Resisting cell death/ | Down | |
| anti-apoptotic | |||
| Mcl-1 | Resisting cell death/ | Down | |
| anti-apoptotic | |||
| Bax | Resisting cell death/ | Down | |
| anti-apoptotic | |||
| Bak | Resisting cell death/ | Down | |
| anti-apoptotic | |||
| IGF-1 | Resisting cell death/ | Down | |
| anti-apoptotic | |||
| Puma | Resisting cell death/ | Down | |
| anti-apoptotic | |||
| Bim | Resisting cell death/ | Down | |
| anti-apoptotic | |||
| Beclin-1 | Resisting cell death/ | Down | |
| anti-apoptotic | |||
| TGF-b | Enabling replicative | ||
| immortality/aging | |||
| Telomerase/TERT | Enabling replicative | Down | |
| immortality/aging | |||
| ATAD2 | Enabling replicative | ||
| immortality/aging | |||
| DAF-2 | Enabling replicative | ||
| immortality/aging | |||
| SRT | Enabling replicative | ||
| immortality/aging | |||
| Eph-A/B | Inducing angiogenesis | Down | |
| Robo | Inducing angiogenesis | Down | |
| Neuropilin | Inducing angiogenesis | Down | |
| Notch | Inducing angiogenesis | Down | |
| Endostatin | Inducing angiogenesis | Down | |
| Angiostatin | Inducing angiogenesis | Down | |
| FGF family | Inducing angiogenesis | Down | |
| Extracellular | Inducing angiogenesis | Down | |
| matrix-degrading | |||
| proteases (e.g., | |||
| MMP-2 & MMP- | |||
| 9) | |||
| VEGF-A | Inducing angiogenesis | Down | |
| TSP-1 | Inducing angiogenesis | Down | |
| VEGFR-1 | Inducing angiogenesis | Down | |
| VEGFR-2 | Inducing angiogenesis | Down | |
| VEGFR-3 | Inducing angiogenesis | Down | |
| NF2 | Activating invasion and | Down | |
| metastasis | |||
| LKB1 | Activating invasion and | Up- regulated in multiple cancer, | Down |
| metastasis | including intestine | ||
| Snail | Activating invasion and | Down | |
| metastasis | |||
| Slug | Activating invasion and | Down | |
| metastasis | |||
| Twist | Activating invasion and | Down | |
| metastasis | |||
| Zeb1/2 | Activating invasion and | Down | |
| metastasis | |||
| CCLR5 | Activating invasion and | Down | |
| metastasis | |||
| cysteine cathepsin | Activating invasion and | Down | |
| protease family | metastasis | ||
| Extracellular | Activating invasion and | Down | |
| matrix-degrading | metastasis | ||
| proteases (e.g., | |||
| MMP-2 & MMP- | |||
| 9) | |||
| EGF | Activating invasion and | Down | |
| metastasis | |||
| CSF-1 | Activating invasion and | ||
| metastasis | |||
| PP2 | Energy metabolism | Down | |
| eIF4E | Energy metabolism | Down | |
| RSK | Energy metabolism | Down | |
| PIK3CA | Energy metabolism | Mutated in many breast, bladder | Down |
| cancers and hepatocellular carcinoma | |||
| BAP1 | Energy metabolism | Mutated in renal cell carcinoma | Down |
| TWIST (TF) | Cancer Stem Cells | Down | |
| HIF-1α | Cancer Stem Cells | Over expressed in renal cell carcinoma | Down |
| HER2/neu | Cancer Stem Cells | Down | |
| Snail (TF) | Cancer Stem Cells | Down | |
| Wnt | Cancer Stem Cells | Down | |
| EPCAM | Cancer Stem Cells | Overexpressed in breast, colon, uterus | Down |
| and other cancers | |||
| EGF | Cytokine-receptor | Down | |
| interactions | |||
| TGFa | Cytokine-receptor | Down | |
| interactions | |||
| PDGF | Cytokine-receptor | Down | |
| IGF-1 | interactions | ||
| KILTLG | |||
| FLT3LG | Cytokine-receptor | Down | |
| interactions | |||
| HGF | Cytokine-receptor | Down | |
| interactions | |||
| FGF | Cytokine-receptor | Down | |
| interactions | |||
| EGFR | Cytokine-receptor | Mutated in lung cancer (40% of all | Down |
| interactions | Asians and 10-15% of all Caucasians) | ||
| ERBB2 | Cytokine-receptor | Down | |
| interactions | |||
| PDGFR | Cytokine-receptor | Down | |
| interactions | |||
| IGFR | Cytokine-receptor | Down | |
| interactions | |||
| c-KIT | Cytokine-receptor | Down | |
| interactions | |||
| FLT3 | Cytokine-receptor | Down | |
| interactions | |||
| MET | Cytokine-receptor | Down | |
| interactions | |||
| FGFR | Cytokine-receptor | Mutations in bladder cancer | Down |
| interactions |
| DNA damage and genomic instability |
| DNMT1 | Methyl transferases | ||
| DNMT2 | Methyl transferases | ||
| DNMT3a | Methyl transferases | ||
| DNMT3b | Methyl transferases | ||
| H3K9Me3 | Histone methylation | ||
| H3K27Me | Histone methylation | ||
| Lsh | Helicase activity | ||
| BLM | Helicase activity | Bloom's syndrome > Cancer | Correct |
| WRN | Helicase activity | Werner's syndrome > Cancer | Correct |
| RTS | Helicase activity | Rothmund-Thompson > Cancer | Correct |
| XPA through XPG | Nucleotide excision | Xeroderma pigmentosa | |
| repair | |||
| XPB | Nucleotide excision | Cockayne's syndrome | |
| repair | |||
| XAB2 | Nucleotide excision | ||
| repair | |||
| XPD | Nucleotide excision | Cockayne's syndrome | |
| repair | |||
| TFIIH | Nucleotide excision | ||
| repair | |||
| RFC | Nucleotide excision | ||
| repair | |||
| PCNA | Nucleotide excision | ||
| repair | |||
| LIG 1 | Nucleotide excision | ||
| repair | |||
| Flap | Nucleotide excision | ||
| endonueclease 1 | repair | ||
| MNAT | Nucleotide excision | ||
| repair | |||
| MMS19 | Nucleotide excision | ||
| repair | |||
| RAD23A | Nucleotide excision | ||
| repair | |||
| RAD23B | Nucleotide excision | ||
| repair | |||
| RPA1 | Nucleotide excision | ||
| repair | |||
| RPA2 | Nucleotide excision | ||
| repair | |||
| CCNH | Nucleotide excision | ||
| repair | |||
| CDK7 | Nucleotide excision | ||
| repair | |||
| CETN2 | Nucleotide excision | ||
| repair | |||
| DDB1 | Nucleotide excision | ||
| repair | |||
| DDB2 | Nucleotide excision | ||
| repair | |||
| ERCC1 | Nucleotide excision | ||
| repair | |||
| ATM | Recombinational repair | ||
| NBN | Recombinational repair | ||
| BRCA1 | Recombinational repair | Breast, ovarian and pancreatic cancer | Correct |
| susceptibility | or Up | ||
| BRCA2 | Recombinational repair | Breast cancer and ovarian | Correct |
| susceptibility | or UP | ||
| RAD51 | Recombinational repair | ||
| RAD52 | Recombinational repair | ||
| WRN | Recombinational repair | ||
| BLM | Recombinational repair | ||
| FANCB | Recombinational repair | ||
| MLH1 | Mismatch repair | Multiple (including colon and uterus) | |
| MLH2 | Mismatch repair | Multiple (including colon and uterus) | |
| MSH2 | Mismatch repair | ||
| MSH3 | Mismatch repair | ||
| MSH4 | Mismatch repair | ||
| MSH5 | Mismatch repair | ||
| MSH6 | Mismatch repair | Multiple (including colon and uterus) | |
| PMS1 | Mismatch repair | ||
| PMS2 | Mismatch repair | Multiple (including colon and uterus) | |
| PMS2L3 | Mismatch repair |
| Aging |
| DAF-2 | |||
| IGF-1 | |||
| SRT1 | |||
| TABLE VII-15 |
| Genes Mutated in Common Cancers |
| Bladder | FGFR3, RB1, HRAS, KRAS, TP53, TSC1, FGFR3 |
| Breast and Ovarian | BRCA, BRCA 2, BARD1, BRIP1, CHEK2, MRE11A, NBN, |
| PALB2, PTEN, RAD50, RAD50, RAD51C, RAD51D, PPMID, | |
| TP53, BRIP1, RAD54L, SLC22A1L, PIK3CA, RB1CC1, | |
| Cervical | FGFR3 |
| Colon and Rectal | PT53, STK11, PTEN, BMPR1A, SMAD, MLH1, MSH2, |
| MSH6, PMS, EPCAM, AKT1, APC, MYH, PTPRJ, AXIN2 | |
| Endometrial/Uterine | MLH1, MSH2, MSH6, PMS, EPCAM |
| Esophageal | DLEC1, TGFBR2, RNF6, LZT1S1, WWOX |
| Hepatocellular carcinoma | PDGFRL, CTNNB1, TP53, MET, CASP8, PIK3CA |
| Renal | VHL, PBRMQ, BAP1, SETD2, HIF1-α |
| Lung | KRAS, EGFR, ALK, BRAF, ERBB2, FLCN, DIRC2, RNF139, |
| OGG1, PRCC, TFE, MET, PPP2R1B, RASSF1, SLC22A1L | |
| Melanoma | BRAF, CDKA, CDKN2A, CDKN2B, CDKND, MC1R, TERT, |
| ATF1, CREB1, EWSR1 | |
| Non-Hodgkin Lymphoma | CASP10, EGFR, IRF1, PIK3CA |
| Osteosarcoma | CKEK2, LOJ18CR1, RB1 |
| Ovarian | PRKN, AKT1 |
| Pancreatic | KRAS, BRCA2, CDKN2A, MANF, PALB2, SMAD4, TP53, |
| IPF1 | |
| Prostate | MLH1, MSH2, MSH6, and PMS2, BRCA 1, HOXB13, CHEK2, |
| ELAC2, EPHB2, SDR5A2, PRKAR1A, PMC1 | |
| Papillary and Follicular | BRAF, NARAS, ERC1, FOXE1, GOLGA5, NCOA4, NKX2-1, |
| Thyroid | PMC1, RET, TFG, TPR, TRIM24, TRIM27, TRIM33 |
| Erwing Sarcoma | ERG, ETV1, ETV4, EWSR1, FLI1 |
| Leukemia | BRC, AMCR2, GMPS, JAK2, AF10, ARFGEF12, CEBPA, |
| FLT3, KIT, LPP, MLF1, NPM1, NSD1, NUP214, PICALM, | |
| RUNX1, SH3GL1, WHSC1L1, ETV6, RARA, BCR, | |
| ARHGAP26, NF1, PTPN11, GATA1 | |
Any of the following cancer associated genes provided in Table VII-16 can be targeted.
| TABLE VII-16 |
| ABL1, ABL2, ACSL3, AF15Q14, AF1Q, AF3p21, AF5q31, AKAP9, AKT1, AKT2, ALDH2, ALK, |
| ALO17, APC, ARHGEF12, ARHH, ARID1A, ARID2, ARNT, ASPSCR1, ASXL1, ATF1, ATIC, |
| ATM, ATRX, AXIN1, BAP1, BCL10, BCL11A, BCL11B, BCL2, BCL3, BCL5, BCL6, BCL7A, |
| BCL9, BCOR, BCR, BHD, BIRC3, BLM, BMPR1A, BRAF, BRCA1, BRCA2, BRD3, BRD4, BRIP1, |
| BTG1, BUB1B, C12orf9, C15orf21, C15orf55, C16orf75, C2orf44, CAMTA1, CANT1, CARD11, |
| CARS, CBFA2T1, CBFA2T3, CBFB, CBL, CBLB, CBLC, CCDC6, CCNB1IP1, CCND1, CCND2, |
| CCND3, CCNE1, CD273, CD274, CD74, CD79A, CD79B, CDH1, CDH11, CDK12, CDK4, CDK6, |
| CDKN2A, CDKN2a(p14), CDKN2C, CDX2, CEBPA, CEP1, CHCHD7, CHEK2, CHIC2, CHN1, CIC, |
| CIITA, CLTC, CLTCL1, CMKOR1, CNOT3, COL1A1, COPEB, COX6C, CREB1, CREB3L1, |
| CREB3L2, CREBBP, CRLF2, CRTC3, CTNNB1, CYLD, D10S170, DAXX, DDB2, DDIT3, DDX10, |
| DDX5, DDX6, DEK, DICER1, DNM2, DNMT3A, DUX4, EBF1, ECT2L, EGFR, EIF4A2, ELF4, |
| ELK4, ELKS, ELL, ELN, EML4, EP300, EPS15, ERBB2, ERCC2, ERCC3, ERCC4, ERCC5, ERG, |
| ETV1, ETV4, ETV5, ETV6, EVI1, EWSR1, EXT1, EXT2, EZH2, EZR, FACL6, FAM22A, FAM22B, |
| FAM46C, FANCA, FANCC, FANCD2, FANCE, FANCF, FANCG, FBXO11, FBXW7, FCGR2B, |
| FEV, FGFR1, FGFR1OP, FGFR2, FGFR3, FH, FHIT, FIP1L1, FLI1, FLJ27352, FLT3, FNBP1, |
| FOXL2, FOXO1A, FOXO3A, FOXP1, FSTL3, FUBP1, FUS, FVT1, GAS7, GATA1, GATA2, |
| GATA3, GMPS, GNA11, GNAQ, GNAS, GOLGA5, GOPC, GPC3, GPHN, GRAF, H3F3A, |
| HCMOGT-1, HEAB, HERPUD1, HEY1, HIP1, HIST1H3B, HIST1H4I, HLF, HLXB9, HMGA1, |
| HMGA2, HNRNPA2B1, HOOK3, HOXA11, HOXA13, HOXA9, HOXC11, HOXC13, HOXD11, |
| HOXD13, HRAS, HRPT2, HSPCA, HSPCB, IDH1, IDH2, IGH@, IGK@, IGL@, IKZF1, IL2, IL21R, |
| IL6ST, IL7R, IRF4, IRTA1, ITK, JAK1, JAK2, JAK3, JAZF1, JUN, KCNJ5, KDM5A, KDM5C, |
| KDM6A, KDR, KIAA1549, KIF5B, KIT, KLF4, KLK2, KRAS, KTN1, LAF4, LASP1, LCK, LCP1, |
| LCX, LHFP, LIFR, LMO1, LMO2, LPP, LRIG3, LYL1, MADH4, MAF, MAFB, MALT1, MAML2, |
| MAP2K1, MAP2K2, MAP2K4, MAX, MDM2, MDM4, MDS1, MDS2, MECT1, MED12, MEN1, |
| MET, MITF, MKL1, MLF1, MLH1, MLL, MLL2, MLL3, MLLT1, MLLT10, MLLT2, MLLT3, |
| MLLT4, MLLT6, MLLT7, MN1, MPL, MSF, MSH2, MSH6, MSI2, MSN, MTCP1, MUC1, MUTYH, |
| MYB, MYC, MYCL1, MYCN, MYD88, MYH11, MYH9, MYST4, NACA, NBS1, NCOA1, NCOA2, |
| NCOA4, NDRG1, NF1, NF2, NFE2L2, NFIB, NFKB2, NIN, NKX2-1, NONO, NOTCH1, NOTCH2, |
| NPM1, NR4A3, NRAS, NSD1, NT5C2, NTRK1, NTRK3, NUMA1, NUP214, NUP98, OLIG2, OMD, |
| P2RY8, PAFAH1B2, PALB2, PAX3, PAX5, PAX7, PAX8, PBRM1, PBX1, PCM1, PCSK7, |
| PDE4DIP, PDGFB, PDGFRA, PDGFRB, PER1, PHF6, PHOX2B, PICALM, PIK3CA, PIK3R1, PIM1, |
| PLAG1, PML, PMS1, PMS2, PMX1, PNUTL1, POT1, POU2AF1, POU5F1, PPARG, PPP2R1A, |
| PRCC, PRDM1, PRDM16, PRF1, PRKAR1A, PRO1073, PSIP2, PTCH, PTEN, PTPN11, RAB5EP, |
| RAC1, RAD51L1, RAF1, RALGDS, RANBP17, RAP1GDS1, RARA, RB1, RBM15, RECQL4, REL, |
| RET, RNF43, ROS1, RPL10, RPL22, RPL5, RPN1, RUNDC2A, RUNX1, RUNXBP2, SBDS, SDC4, |
| SDH5, SDHB, SDHC, SDHD, SEPT6, SET, SETBP1, SETD2, SF3B1, SFPQ, SFRS3, SH2B3, |
| SH3GL1, SIL, SLC34A2, SLC45A3, SMARCA4, SMARCB1, SMARCE1, SMO, SOCS1, SOX2, |
| SRGAP3, SRSF2, SS18, SS18L1, SSH3BP1, SSX1, SSX2, SSX4, STAT3, STK11, STL, SUFU, |
| SUZ12, SYK, TAF15, TAL1, TAL2, TCEA1, TCF1, TCF12, TCF3, TCF7L2, TCL1A, TCL6, TERT, |
| TET2, TFE3, TFEB, TFG, TFPT, TFRC, THRAP3, TIF1, TLX1, TLX3, TMPRSS2, TNFAIP3, |
| TNFRSF14, TNFRSF17, TNFRSF6, TOP1, TP53, TPM3, TPM4, TPR, TRA@, TRAF7, TRB@, |
| TRD@, TRIM27, TRIM33, TRIP11, TSC1, TSC2, TSHR, TTL, U2AF1, USP6, VHL, VTI1A, WAS, |
| WHSC1, WHSC1L1, WIF1, WRN, WT1, WTX, WWTR1, XPA, XPC, XPO1, YWHAE, ZNF145, |
| ZNF198, ZNF278, ZNF331, ZNF384, ZNF521, ZNF9, or ZRSR2 |
Exemplary pathways and genes associated with energy metabolism are provided in Table VII-17. Exemplary metabolic targets disclosed herein may be modulated using CRISPR/Cas9 as described herein. Modulation may be used to knockdown a gene of interest, correct a defect or mutation in the gene, or to activate a gene of interest.
| TABLE VII-17 |
| Exemplary Metabolic Target List |
| Target | How to Modulate | |
| ACAT, acyl-CoA: cholesterol | Knock down | |
| acyltransferase | ||
| AGPAT2, 1-acyl-glcero-3-phos- | Knock down | |
| phate acyltransferase 2 | ||
| DGAT, diacylglycerol acyltrans- | Knock down | |
| ferase | ||
| GL, gastric lipase | Knock down | |
| PL, pancreatic lipase | Knock down | |
| sPLA2, secretory phospholipase | Knock down | |
| A2 | ||
| ACC, acetyl-CoA carboxylase | Knock down | |
| CPT, carnitine palmitoyl trans- | Knock down | |
| ferase | ||
| FAS, fatty-acid synthase | Knock down | |
| MTP, microsomal triglyceride- | Knock down | |
| transfer protein | ||
| Insulin receptor | Correct defects or activate | |
| SU receptor/K+ ATP channel | Activate with mutation | |
| a-glucosidase | Knock down | |
| PPARy | Activate with mutation | |
| Glycogen phosphorylase | Knock down | |
| Fructose-1,6-bisphosphatase | Knock down | |
| glucose-6-phosphatase | Knock down | |
| PTP-1B | Knock down | |
| SHIP-2 | Knock down | |
| GSK-3 | Knock down | |
| lkB kinase | Knock down | |
| PKCq | Knock down | |
| GLP1R | Correct mutation | |
| GIPR | Correct mutation | |
| GPR40 | Correct mutation | |
| GPR119 | Correct mutation | |
| GPR41 | Correct mutation | |
| GPR43 | Correct mutation | |
| GPR120 | Correct mutation | |
| GCGR | Correct mutation | |
| PAC1 | Correct mutation | |
| VPAC2 | Correct mutation | |
| Y1 | Knock down | |
| GHSR | Knock down | |
| CCKAR | Correct mutation | |
| b2 | Correct mutation | |
| a2 | Knock down | |
| MT1 | Knock down | |
| M3 | Correct mutation | |
| CB1 | Knock down | |
| P2Y | Correct mutation | |
| H3 | Inhibit | |
| MCH-R1 | Correct mutation | |
| MCH-R2 | Correct mutation | |
| Ghrelin R | Inhibit | |
| FASN | Inhibit | |
| Bombesin-R3 | Inhibit | |
| CCK-A Receptor | Correct mutation | |
| Seratonin System | Correct mutation | |
| CBI Cannabinoid Receptors | Inhibit | |
| Dopaminergic System | Correct mutation | |
| Enterostatin | Mutate to super agonist | |
| CNTF | Mutate to super agonist | |
| CNTF-R | Correct mutation | |
| SOCS-3 | Knock down | |
| 46a | Knock down | |
| PrPP Receptors | Correct mutation | |
| Amylin | Mutate to super agonist | |
| CRH System | Mutate to super agonist | |
| Galanin Receptors | Knock down | |
| Orexin Receptors | Knock down | |
| Noradrenalin System | Mutate to super agonist | |
| CART | Mutate to super agonist | |
| FATP4 | Knock down | |
| Pancreatic Lipase | Knock down | |
| ACRP30 | Super agonist mutations | |
| Thyroid Hormone | Correct mutation | |
| B-3 Adrenergic Receptor | Correct mutation | |
| UCPs | Upregulate | |
| PTP-1B | Knock down | |
| MC3 | Correct mutation | |
| ACC2 | Knock down | |
| Perilipin | Knock down | |
| HMGIC | Knock down | |
| 11BHSD-1 | Knock down | |
| Glucagon R | Knock down | |
| Glucocoricoid R | Knock down | |
| 11beta-HSD I | Knock down | |
| PGC-1 | Correct mutation | |
| DPPP-IV | Knock down | |
| GLP | Mutate to super agonist | |
| GIP | Mutate to super agonist | |
| GLP-IR | Correct mutation | |
| AMP Kinase | Correct mutation | |
| IKK-b | Knock down | |
| PPARa/g | Knock down | |
| INS-R | Knock down | |
| SGLT | Knock down | |
| a-glucosidase | Knock down | |
| HMGCR | Knock down | |
| PCSK9 | Knock down | |
| ApoB-100 | Knock down | |
| Leptin | Mutate to super agonist | |
| Leptin Receptor | Mutate to constitutively active | |
| receptor | ||
| MC4R | Mutate to constitutively active | |
| receptor | ||
| VOMC | Mutate MSH region to super | |
| agonist | ||
| AGRP | Knock down | |
| IVPY Receptors | Introduce constitutively active | |
| mutations | ||
| 5HT2C | Introduce constitutively active | |
| mutations | ||
| GLP-1 | Mutate to super agonist | |
| GLP-1 Receptor | Mutate to constitutively active | |
| receptor | ||
In an embodiment, the pathways and genes described herein, e.g., in Table VII-17, are also associated with diabetes, obesity, and/or cholesterol and lipids.
Exemplary pathways and genes associated with the cell cycle are provided in Table VII-18.
| TABLE VII-18 |
| CELL CYCLE PATHWAYS and REPRESENTATIVE GENES |
| DNA Damage | Mismatch repair | Apoptosis |
| ATM | PMS2 | Fas-L | ||
| MRE11 | MLH1 | FasR | ||
| NBS1 | MSH6 | Trail-L | ||
| RAD50 | MSH2 | Trail-R | ||
| 53BP1 | RFC | TNF-α | ||
| P53 | PCNA | TNF-R1 | ||
| CHKE | MSH3 | FADD | ||
| E2F1 | MutS homolog | TRADD | ||
| PML | MutL homolog | RIPI | ||
| FANCD2 | Exonuclease | MyD88 | ||
| SMC1 | DNA Polymerase | IRAK | ||
| BLM1 | delta | NIL | ||
| BRCA1 | (POLD1, POLD2, | IKK | ||
| H2AX | POLD3, and | NF-Kβ | ||
| ATR | POLD4 -genes | IκBα | ||
| RPA | encoding subunits) | IAP | ||
| ATRIP | Topoisomerase 1 | Caspase 3 | ||
| RAD9 | Topoisomerase 2 | Caspase 6 | ||
| RAD1 | RNAseH1 | Caspase 7 | ||
| HUS | Ligase 1 | Caspase 8 | ||
| RAD17 | DNA polymerase 1 | Caspase 10 | ||
| RFC | DNA polymerase 3 | HDAC1 | ||
| CHK1 | Primase | HDAC2 | ||
| TLK1 | Helicase | Cytochrome | ||
| CDC25 | Single-strand | C | ||
| binding | Bxl-xL | |||
| proteins | STAT3 | |||
| STAT5 | ||||
| DFF45 | ||||
| Vcl-2 | ||||
| ENDO-G | ||||
| PI3K | ||||
| Akt | ||||
| Calpain | ||||
| Bad | ||||
| Bax | ||||
| Cell Pro- | ||
| Ubiquitin-mediated proteolysis | Hypoxia | liferation |
| E1 | HERC1 | TRAF6 | HIF-1α | MAPK |
| E2 | UBE2Q | MEKK1 | HIF-1β | MAPKK |
| E3 | UBE2R | COP1 | Ref1 | MAPKKK |
| UBLE1A | UBE2S | PIFH2 | HSP90 | c-Met |
| UBLE1B | UBE2U | cIAP | VEGF | HGF |
| UBLE1C | UBE2W | PIAS | PAS | ERKS1/2 |
| UBE2A | UBE2Z | SYVN | ARNT | ATK |
| UBE2B | AFCLLCN | NHLRC1 | VHL | PKCs |
| UBE2C | UBE1 | AIRE | HLF | Paxilin |
| UBE2A | E6AP | MGRN1 | EPF | FAK |
| UBE2E | UBE3B | BRCA1 | VDU2 | Adducin |
| UBE2F | Smurf | FANCL | SUMORESUME | PYK1 |
| UBE2G1 | Itch | MID1 | SENP1 | RB |
| UBE2G2 | HERC2 | Cdc20 | Calcineurin A | RB1 |
| UBE2I | HERC3 | Cdh1 | RACK1 | Raf-1 |
| UBE2J1 | HERC4 | Apc1 | PTB | A-Raf |
| UBE2J2 | UBE4A | Apc2 | Hur | B-raf |
| UBE2L3 | UBE4B | Apc3 | PHD2 | MEK1/2 |
| UBE2L6 | CHIP | Apc4 | SSAT2 | ERK1/2 |
| UBE2M | CYC4 | Apc5 | SSAT1 | Ets |
| UBE2N | PPR19 | Apc6 | GSK3β | Elk1 |
| UBE2O | UIP5 | Apc7 | CBP | SAP1 |
| WWPI | Mdm2 | Apc8 | FOXO4 | cPLA2 |
| WWP2 | Parkin | Apc9 | FIH-1 | |
| TRIP12 | Trim32 | Apc10 | ||
| NEED4 | Trim37 | Apc11 | ||
| ARF-BP1 | SIAH-1 | Apc12 | ||
| EDD1 | PML | |||
| Cell | ||||
| survival | Cell cycle arrest | |||
| SMAD1 | P21 | |||
| SMAD5 | BAX | |||
| SAMD8 | MDR | |||
| LEF1 | DRAIL IGFBP3 | |||
| TCF3 | GADD45 | |||
| TCF4 | ||||
| P300 | ||||
| HAT1 | ||||
| PI3K | ||||
| Akt | ||||
| GF1 | ||||
Exemplary cell cycle genes characterized by their function are provided in Table VII-19.
| TABLE VII-19 |
| CELL CYCLE GENES |
| Translation | Cyclin- | |
| initiation | dependent Kinases | |
| factors | Cyclins | (DKs) |
| E2F1 | CCNA1, CCNA2, CCNB1, | CDK1, CDK2, CDK3, CDK5, |
| E2F2 | CCNB2, CCNB3, CCNC, | CDK6, CDK7, CDK8, CDK9, |
| E2F3 | CCND1, CCND2, CCND3, | CDK11, |
| E2F4 | CCNE1, CCNE2, CCNF, | |
| E2F5 | CCNG1, CCNG2, CCNH, | |
| E2F6 | CCNI, CCNI2, , CCNO, | |
| E2F8 | CCNT1, CCNT2, CCNY, | |
| CCNYL1, CCNYL2, | ||
| CCNYL3 | ||
| Cyclin | CDK inhibitory | CDK regulators (both |
| regulators | proteins (CDKIs) | positive and negative) |
| c-Jun | INK4 family | RINGO/Speedy family |
| c-Fos | P15 | P53 |
| P16 | MDM2 | |
| P18 | RB | |
| P19 | CHK1 | |
| CIP/KIP family | CHk2 | |
| P21 | ATM | |
| P27 | ATR | |
| P57 | CDC2 | |
| HDAC1 | ||
| HDAC2 | ||
Exemplary pathways and genes associated with the angiogenesis are described provided in Table VII-20.
| TABLE VII-20 |
| ANGIOGENESIS PATHWAY GENES |
| Cell surface | Transcription | ||
| Extracellular ligands | receptors | Signal transduction | factors |
| PLGF | VEGFR1 | PLCγ | c-FOS |
| VEGF | VEGFR2 | SHC | E2F7 |
| VEGFB | VEGFR3 | PI3K | |
| VEGFC | Nrp1 | PIP3 | |
| VEGFD | IP3 | ||
| DAG | |||
| GRB2 | |||
| SOS | |||
| Akt | |||
| PKB | |||
| PKC | |||
| Ras | |||
| RAF1 | |||
| DAG | |||
| eNOS | |||
| NO | |||
| ERK1 | |||
| ERK2 | |||
| cPLA2 | |||
| MEK1 | |||
| MEK2 | |||
Exemplary pathways and genes associated with the mitochondrial function are provided in Table VII-24.
| TABLE VII-24 |
| Pathways and genes associated with mitochondrial function |
| Mitochondrial | Valine oxidation | ||
| B-oxidation | TCA Cycle | apoptosis | pathway |
| acyl CoA | Citrate synthase | Transaminase | |
| dehydrogenase | Aconitase | BCKADH complex | |
| enoyl CoA hydratase | Isocitrate dehydrogenase | ACAD-8 | |
| 3-hydroxyacyl-CoA | Alpha-ketoglutarate | Crotonoase | |
| dehydrogenase | dehydrogenase | HIBCH | |
| β-ketothiolase | Succinyl-CoA synthetase | HIBADH | |
| Succinate dehydrogenase | MMSDH | ||
| Fumarase | Aminotransferase | ||
| Malate dehydrogenase | Hydratase | ||
| Deacylase | |||
| Dehydrogenase | |||
| Carboxylase | |||
| Mutase | |||
| Fatty acid oxidation | |||
| disorders (enzyme | Leucine Oxidation | Isoleucine | |
| deficiencies) | Pathway | oxidation pathway | |
| OCTN2 | Aminotransferase | Aminotransferase | |
| FATP1-6 | Branched chain | Branched chain | |
| CPT-1 | aminotransferase 2, | aminotransferase 2, | |
| CACT | mitochondrial | mitochondrial | |
| CPT-II | Isobutytyl-CoA | 2-methylbutytyl-CoA | |
| SCAD | dehydrogenase | Dehydrogenase | |
| MCAD | (Branched Chain | (Branched Chain | |
| VLCAD | Keto Acid | Keto Acid | |
| ETF-DH | Dehydrogase | Dehydrogenase | |
| Alpha-ETF | Complex) | Complex) | |
| Beta-ETF | Hydratase | Hydratase | |
| SCHAD | HMG-CoA lyase | 2-methyl-3-OH- | |
| LCHAD | butyryl-CoA | ||
| MTP | dehydrogenase | ||
| LKAT | 3-Oxothiolase | ||
| DECR1 | |||
| HMGCS2 | |||
| HMGCL | |||
| Additional mitochondrial genes and related diseases caused by mutations |
| Mt-ND1 | Leber's hereditary optic neuropathy | |
| Mt-ND4 | Leber's hereditary optic neuropathy | |
| Mt-ND6 | Leber's hereditary optic neuropathy | |
| OPA1 | Autosomal dominant optic atrophy | |
| CMT2A | Charcot-Marie-Toothhereditary neuropathy type 2A | |
| mt-TK | Myoclonic epilepsy with ragged red fibres | |
| Mitochondrial | |
| Respiratory chain | |
| genes | Related diseases |
| NADH CoQ | Alpers, Alzheimer's, Parkinsonism, Cardiomyopathy, Deficiency (Barth |
| Reductase | and/or Lethal Infantile), Encephalopathy, Infantile CNS, Leber's, Leigh, |
| Longevity, MELAS, MERRF, Myopathy ± CNS, PEO, Spinal cord | |
| disorders | |
| Succinate-CoQ | Kearns-Sayre, Leigh's, Myopathy (e.g., Infantile ± CNS), Paraganglioma, |
| Reductase | Pheochromocytoma |
| CoQ-Cytochrome C | Cardiomyopathy, Fatal infantile, GRACILE, Leber's, Myopathy (e.g., ± |
| Reductase | CNS, PEO) |
| Cytochrome C | Alper's, Ataxia, Deafness, Leber's, Leigh's, Myopathy (e.g., Infantile (e.g., |
| Oxidase | Fatal, Benign), Adult), Rhabdomyolysis, PEO, KSS, MNGIE, MERRF, |
| MELAS | |
| ATP Synthase | Cardiomyopathy, Encephalopathy, Leber's, Leigh, Multisystem, NARP |
| Complex I (NADH-Ubiquinone Oxidoreductase) |
| Subunits involved | |||
| Nuclear encoded | Mitochondral DNA | Supernumerary | in regulation of |
| proteins | encoded proteins | subunits | Complext I activity |
| NDUFS1: Childhood | ND1 | NDUFAB1 (SDAP): | NDUFS4 (AQDQ) |
| encephalopathy; Most | ND2 | Carrier of fatty acid | Functions: |
| common Complex I | ND3 | chain | Increased Complex |
| mutations (3%) | ND4 | NDUFA1 (MWFE) | I activity with |
| NDUFS2: | ND4L | Primarily expressed | phosphorylation |
| Cardiomyopathy + | ND5 | in heart & skeletal | Disorders: |
| Encephalomyopathy | ND6 | muscle | Multisystem |
| NDUFS3: Leigh | Disorders: | childhood | |
| NDUFS7: Leigh | Encephalopathies | encephalopathy | |
| NDUFS8: Leigh | NDUFA2: | with Complex I | |
| NDUFV1: Childhood | Encephalopathy & | deficiency; Leigh | |
| encephalopathy | Cardiomyopathy | syndrome | |
| NDUFV2: | NDUFA9: Leigh | ||
| Encephalopathy + | syndrome | ||
| Cardiomyopathy | NDUFA10: Leigh | ||
| ELAC2: | syndrome | ||
| Cardiomyopathy, | NDUFA11 | ||
| Hypertrophic | Disorder: | ||
| Encephalopathy & | |||
| Cardiomyopathy | |||
| NDUFA12: Leigh | |||
| syndrome | |||
| NDUFB9: | |||
| Hypotonia | |||
| NDUFS6: Lethal | |||
| Infantile | |||
| Mitochondrial | |||
| Disease | |||
| Proteins involved in | |||
| Complex I assembly | Other | ||
| NDUFAF1: | NDUFA13: Thyroid | ||
| Cardiomyopathy + | carcinoma (Hurthle | ||
| Encephalomyopathy | cell) | ||
| NDUFAF2 | NDUFB3: Severe | ||
| (NDUFA12L): | lethal mitochondrial | ||
| Childhood | complex I deficiency | ||
| encephalopathy; | MTHFR deficiency | ||
| Usually null | MGME1: PEO + | ||
| mutations | Myopathy | ||
| NDUFAF3: Lethal | |||
| neonatal | |||
| encephalopathy | |||
| NDUFAF4: | |||
| Encephalopathy | |||
| C6ORF66: | |||
| Encephalopathy | |||
| C8orf38: Leigh | |||
| syndrome | |||
| C20orf7: Lethal | |||
| neonatal | |||
| NUBPL: | |||
| Encephalomyopathy | |||
| ACAD9: Fatigue & | |||
| Exercise intolerance; | |||
| Most missense | |||
| mutations | |||
| FOXRED1: Leigh | |||
| syndrome | |||
| Ecsit | |||
| AIF (AIFM1; | |||
| PDCD8) | |||
| Ind1 | |||
| Complex I (NABH-Ubiquinone Oxidoreductase) |
| Flavoprotein: FAD (SDHA; Fp) | Mutations cause Leigh syndrome with |
| Complex II deficiency | |
| Late onset neurodegenerative disorder) | |
| Iron-Sulfur protein: SDHB (Ip) | Mutations cause Reduced tumor suppression |
| Neoplasms: Pheochromocytoma & | |
| Paraganglioma | |
| SDHC; SDHD (cytochrome C subunits) - | mutations lead to paraganglioma |
| Complex III (Cytochrome reductase) |
| Cytochrome c1 (CYC1) | |
| Rieske FeS protein (UQCRFS1) | |
| Ubiquinol-cytochrome c reductase core | May mediate formation of complex between |
| protein I (UQCRC1; QCR; Subunit 1) | cytochromes c and c1 |
| Ubiquinol-cytochrome c reductase core | Required for assembly of complex III |
| protein II (UQCRC2; QCR2; Subunit 2) | |
| UQCRH (Subunit 6) | May mediate formation of complex between |
| cytochromes c and c1 | |
| Ubiquinone-binding protein (UQBC; | Redox-linked proton pumping |
| UQPC; UQCRB; UQBP; Subunit 7) | |
| UQCRQ (Subunit 8) | Binds to ubiquinone |
| Ubiquinol-cytochrome C reductase | Interacts with cytochrome c1 |
| complex, 7.2-KD Subunit (UCRC; | |
| UQCR10; Subunit 9) | |
| UQCR (UQCR11; Subunit 10) | function as iron-sulfur protein binding factor |
| Cleavage product of UQCRFS1 | |
| (Cytochrome b-c1 complex subunit 11) | |
| Inner membrane proteins and related disorders | |
| ABCB7: Ataxia + Anemia | |
| ACADVL: Myopathy | |
| ADCK3: SACR9 | |
| AGK: Sengers | |
| ATP5A1: Encephalopathy, neonatal | |
| ATP5E: Retardation + Neuropathy | |
| BRP44L: Encephalopathy | |
| c12orf62: Encephalocardiomyopathy | |
| Cardiolipin: Barth | |
| COX4I2: Pancreas + Anemia | |
| COX6B1: Encephalomyopathy | |
| CPT2: Myopathy | |
| CRAT: Encephalomyopathy | |
| CYC1: Hyperglycemia & Encephalopathy | |
| CYCS | |
| CYP11A1 | |
| CYP11B1 | |
| CYP11B2 | |
| CYP24A1 | |
| CYP27A1: Cerebrotendinous Xanthomatosis | |
| CYP27B1 | |
| DHODH | |
| DNAJC19: Cardiac + Ataxia | |
| FASTKD2: Encephalomyopathy | |
| GPD2 | |
| HADHA: Multisystem; Myopathy | |
| HADHB: Encephalomyopathy | |
| HCCS: MIDAS | |
| L2HGDH: Encephalopathy | |
| MMAA | |
| MPV17: Hepatocerebral | |
| NDUFA1: Encephalopathy | |
| NDUFA2: Leigh + Cardiac | |
| NDUFA4: Leigh | |
| NDUFA9: Leigh | |
| NDUFA10: Leigh | |
| NDUFA11: Encephalocardiomyopathy | |
| NDUFA12: Leigh | |
| NDUFA13 | |
| NDUFB3: Lethal infantile | |
| NDUFB9: Encephalopathy | |
| NDUFV1: Encephalopathy | |
| NDUFV2: Encephalopathy + Cardiac | |
| NDUFS1: Leukodystrophy | |
| NDUFS2: Encephalopathy + Cardiac | |
| NDUFS3: Dystonia | |
| NDUFS4: Encephalopathy | |
| NDUFS6: Lethal infantile | |
| NDUFS7: Encephalopathy | |
| NDUFS8: CNS + Cardiac | |
| OPA1: Optic atrophy | |
| OPA3: Optic atrophy | |
| PDSS1: Coenzyme Q10 deficiency | |
| SDHA: Leigh; Cardiac; Paraganglioma | |
| SDHB: Paraganglioma | |
| SDHC: Paraganglioma | |
| SDHD: Paraganglioma | |
| SLC25A carriers | |
| SLC25A1: Epileptic encephalopathy | |
| SLC25A3: Cardiac; Exercise intolerance | |
| SLC25A4: PEOA2 | |
| SLC25A12: Hypomyelination | |
| SLC25A13: Citrullinemia | |
| SLC25A15: HHH | |
| SLC25A19: Microcephaly | |
| SLC25A20: Encephalocardiomyopathy | |
| SLC25A22: Myoclonic epilepsy | |
| SLC25A38: Anemia | |
| Paraplegin: SPG7 | |
| TIMM8A: Deaf-Dystonia-Dementia | |
| UCP1 | |
| UCP2 | |
| UCP3 | |
| UQCRB: Hypoglycemia, Hepatic | |
| UQCRC2: Episodic metabolic encephalopathy | |
| UQCRQ: Encephalopathy | |
Pathways and genes associated with DNA damage and genomic instability include the following methyl transferases, histone methylation, helicase activity, nucleotide excision repair, recombinational repair, or mismatch repair provided in Table VII-21. See also Table VI-22.
| TABLE VII-21 |
| PATHWAYS and GENES ASSOCIATED with |
| DNA DAMAGE and GENOMIC INSTABILITY |
| Non-Homologous | |||
| Double-stranded Breaks | Replication Stress | DNA Methylation | End-Joining |
| ATM | ATR | DNMT1 | Ku70 | |
| RAD50 | RAD17 | DNMT2 | Ku80 | |
| MRE119 | ATRIP | DNMT3A | DNA | |
| NBS1 | RAD9 | DNMT3B | PKc | |
| CRCA1 | RPA | DNMT3L | XRCC4 | |
| H2AX | CHK1 | MeCP2 | DNA ligase 4 | |
| 53BP1 | BLM | MBD2 | XLF | |
| MDC1 | H2AX | Rad50 | ||
| SMC1 | 53BP1 | Artemis | ||
| P53 | P53 | Rad27 | ||
| TdT | ||||
| Nucleotide-Excision | Homologous | ||
| Base-Excision repair | Repair | Recombination | Mismatch repair |
| APE1 | UvrA | RecA | PMS2 | |
| APE2 | UvrB | SSB | MLH1 | |
| NEIL1 | UvrC | Mre11 | MSH6 | |
| NEIL2 | XPC | Rad50 | MSH2 | |
| NEIL3 | Rad23B | Nbs1 | RFC | |
| XRCC1 | CEN2 | CtIP | PCNA | |
| PNKP | DDB1 | RPA | MSH3 | |
| Tdp1 | XPE | Rad51 | MutS | |
| APTX | CSA, | Rad52 | MutL |
| DNA polymerase β | CSB | Rad54 | Exonuclease |
| DNA polymerase δ | TFIIH | BRCA1 | Topoisomerase 1 |
| DNA polymerase ε | XPB | BRCA2 | Topoisomerase 2 |
| PCNA | XPD | Exo1 | RNAseH1 | |
| FEN1 | XPA | BLM | Ligase 1 | |
| RFC | RPA | TopIIIα | DNA polymerase 1 | |
| PARP1 | XPG | GEN1 | DNA polymerase 3 | |
| Lig1 | ERCC1 | Yen1 | Primase | |
| Lig3 | XPF | Slx1 | Helicase | |
| UNG | DNA polymerase δ | Slx4 | SSBs | |
| MUTY | DNA polymerase ε | Mus8 | ||
| SMUG | Eme1 | |||
| MBD4 | Dss1 | |||
| Histone Methylation | |||
| ASH1L | SETD4 | |||
| DOT1L | SETD5 | |||
| EHMT1 | SETD6 | |||
| EHMT2 | SETD7 | |||
| EZH1 | SETD8 | |||
| EZH2 | SETD9 | |||
| MLL | SETDB1 | |||
| MLL2 | SETDB2 | |||
| MLL3 | SETMAR | |||
| MLL4 | SMYD1 | |||
| MLL5 | SMYD2 | |||
| NSD1 | SMYD3 | |||
| PRDM2 | SMYD4 | |||
| SET | SMYD5 | |||
| SETBP1 | SUV39H1 | |||
| SETD1A | SUV39H2 | |||
| SETD1B | SUV420H1 | |||
| SETD2 | SUV420H2 | |||
| SETD3 | ||||
| TABLE VII-22 |
| Selected Transcription FactorsTranscription factors |
| NIKX2-5 | Cardiac malformations and | |
| atrioventricular conduction | ||
| abnormalities | ||
| MECP2 | Rett syndrome | |
| HNF1 through | Mature onset diabetes of the young | |
| HNF6 | (MODY), hepatic adenomas and renal | |
| cysts | ||
| FOXP2 | Developmental verbal dyspraxia | |
| FOXP3 | Autoimmune diseases | |
| NOTCH1 | Aortic valve abnormalities | |
| MEF2A | Coronary artery disease | |
| CRX | Dominant cone-rod dystrophy | |
| FOCX2 | Lymphedema-distichiasis | |
| NF-κB | Autoimmune arthritis, asthma, septic | |
| Activation | shock, lung fibrosis, | |
| glomerulonephritis, atherosclerosis, | ||
| and AIDS | ||
| NF-κB Inhibition | Apoptosis, inappropriate immune cell | |
| development, and delayed cell growth | ||
| NARA2 | Parkinson disease | |
| LHX3 | Pituitary disease | |
| GAT4 | Congenital heart defects | |
| P53, APC | Cancer | |
| CTCF | Epigenetics and cell growth regulation | |
| EGR2 | Congenital hypomyelinating | |
| neuropathy (CHN) and Charcot-Marie- | ||
| Tooth type 1 (CMT1) | ||
| STAT family | Cancer and immunosuppression | |
| NF-AT family | Cancer and inflammation | |
| AP-1 family | Cancer and inflammation | |
A gene including receptors and ionophores relevant to pain in this table can be targeted, by editing or payload delivery. Pathways and genes associated with pain are described herein, e.g., include the following those in Table VII-23.
| TABLE VII-23 | ||||
| Part of | ||||
| nervous | ||||
| Type of pain | system | Target | Area | How to affect |
| nociceptive | central | 5-HT | central inhibition | |
| nociceptive | central | 5HT1A | central inhibition | agonists (activation) serve |
| as analgesic, | ||||
| antidepressants, anxiolytics, | ||||
| psychosis | ||||
| nociceptive | central | 5HT1A | central inhibition | antagonists can work as |
| antidepressants, nootropics | ||||
| nociceptive | central | 5HT1B | central inhibition | migraines |
| nociceptive | central | 5HT1D | central inhibition | migraines |
| nociceptive | central | 5HT1E | central inhibition | |
| nociceptive | central | 5HT1F | central inhibition | agonists - psychedelics |
| nociceptive | central | 5HT1F | central inhibition | antagonists - atypical |
| antipsychotics, NaSSAsm | ||||
| treatig sertonin syndrome, | ||||
| sleeping aid | ||||
| nociceptive | central | 5HT2A | central inhibition | agonists - psychadelics |
| nociceptive | central | 5HT2A | central inhibition | antagonists - atypical |
| antipsychotics, NaSSAs, | ||||
| treating seratonin syndrome, | ||||
| sleeping aid | ||||
| nociceptive | central | 5HT2B | central inhibition | migraines |
| nociceptive | central | 5HT2C | central inhibition | antidepressant, orexigenic, |
| anorectic, antipsychotic | ||||
| nociceptive | central | 5HT3 | central inhibition | antiemetic |
| nociceptive | central | 5HT4 | central inhibition | gastroproknetics |
| nociceptive | central | 5HT5A | central inhibition | |
| nociceptive | central | 5HT5B | central inhibition | |
| nociceptive | central | 5HT6 | central inhibition | antidepressant (antagonists |
| and agonists), anxiolytic | ||||
| (antagonists and agonists), | ||||
| nootropic (antagonists), | ||||
| anorectic (antagonists) | ||||
| nociceptive | central | 5HT7 | central inhibition | antidepressant (antagonists), |
| anxiolytics (antagonists), | ||||
| nootropic (antagonists) | ||||
| nociceptive | central | CB1 | central inhibition | |
| nociceptive | central | GABA | central inhibition | |
| nociceptive | central | GABAA-$ | central inhibition | |
| nociceptive | central | GABAB-R | central inhibition | |
| nociceptive | central | Glucine-R | central inhibition | |
| nociceptive | central | NE | central inhibition | |
| nociceptive | central | Opiod | central inhibition | |
| receptors | ||||
| nociceptive | central | c-fos | gene expression | |
| nociceptive | central | c-jun | gene expression | |
| nociceptive | central | CREB | gene expression | |
| nociceptive | central | DREAM | gene expression | |
| nociceptive | peripheral | K+ channel | membrane | |
| excitability of | ||||
| primary afferents | ||||
| nociceptive | peripheral | Nav1.8 | membrane | |
| excitability of | ||||
| primary afferents | ||||
| nociceptive | peripheral | Nav1.9 | membrane | |
| excitability of | ||||
| primary afferents | ||||
| nociceptive | peripheral | CaMKIV | peripheral | |
| sensitization | ||||
| nociceptive | peripheral | COX2 | peripheral | |
| sensitization | ||||
| nociceptive | peripheral | cPLA2 | peripheral | |
| sensitization | ||||
| nociceptive | peripheral | EP1 | peripheral | |
| sensitization | ||||
| nociceptive | peripheral | EP3 | peripheral | |
| sensitization | ||||
| nociceptive | peripheral | EP4 | peripheral | |
| sensitization | ||||
| nociceptive | peripheral | ERK1/2 | peripheral | |
| sensitization | ||||
| nociceptive | peripheral | IL-1beta | peripheral | |
| sensitization | ||||
| nociceptive | peripheral | JNK | peripheral | |
| sensitization | ||||
| nociceptive | peripheral | Nav1.8 | peripheral | |
| sensitization | ||||
| nociceptive | peripheral | NGF | peripheral | |
| sensitization | ||||
| nociceptive | peripheral | p38 | peripheral | |
| sensitization | ||||
| nociceptive | peripheral | PKA | peripheral | |
| sensitization | ||||
| nociceptive | peripheral | PKC | peripheral | |
| isoforms | sensitization | |||
| nociceptive | peripheral | TNFalpha | peripheral | |
| sensitization | ||||
| nociceptive | peripheral | TrkA | peripheral | |
| sensitization | ||||
| nociceptive | peripheral | TRPV1 | peripheral | |
| sensitization | ||||
| nociceptive | central | AMPA/kai- | postsynaptic | |
| nate-R | transmission | |||
| nociceptive | central | K+ channels | postsynaptic | |
| transmission | ||||
| nociceptive | central | mGlu-$ | postsynaptic | |
| transmission | ||||
| nociceptive | central | Nav1.3 | postsynaptic | |
| transmission | ||||
| nociceptive | central | NK1 | postsynaptic | |
| transmission | ||||
| nociceptive | central | NMDA-R | postsynaptic | |
| transmission | ||||
| nociceptive | peripheral | Adenosine- | presynaptic | |
| R | transmission | |||
| nociceptive | peripheral | mGluR | presynaptic | |
| transmission | ||||
| nociceptive | peripheral | VGCC | presynaptic | |
| transmission | ||||
| nociceptive | central | ERK | signal | |
| transduction | ||||
| nociceptive | central | JNK | signal | |
| transduction | ||||
| nociceptive | central | p38 | signal | |
| transduction | ||||
| nociceptive | central | PKA | signal | |
| transduction | ||||
| nociceptive | central | PKC | signal | |
| isoforms | transduction | |||
| nociceptive | peripheral | ASIC | transduction | |
| nociceptive | peripheral | BK1 | transduction | |
| nociceptive | peripheral | BK2 | transduction | |
| nociceptive | peripheral | DRASIC | transduction | |
| nociceptive | peripheral | MDEG | transduction | |
| nociceptive | peripheral | P2X3 | transduction | |
| nociceptive | peripheral | TREK-1 | transduction | |
| nociceptive | peripheral | TRPM8 | transduction | |
| nociceptive | peripheral | TRPV1 | transduction | |
| nociceptive | peripheral | TRPV2 | transduction | |
| nociceptive | peripheral | TRPV3 | transduction | |
| neuropathic | ||||
| pain | ||||
| Inflammatory | histamine | |||
| pain | ||||
| Inflammatory | ATP | |||
| pain | ||||
| Inflammatory | bradykinin | |||
| pain | ||||
| Inflammatory | CB2 | |||
| pain | ||||
| Inflammatory | Endothelins | |||
| pain | ||||
| Inflammatory | H+ | |||
| pain | ||||
| Inflammatory | Interleukins | |||
| pain | ||||
| Inflammatory | NGF | |||
| pain | ||||
| Inflammatory | prostaglandins | |||
| pain | ||||
| Inflammatory | serotonin | |||
| pain | ||||
| Inflammatory | TNFalpha | |||
| pain | ||||
Cas9 molecules, typically eiCas9 molecules or eaCas9 molecules, and gRNA molecules, e.g., an eiCas9 molecule/gRNA molecule complex, e.g., an eaCas9 molecule/gRNA molecule complex, can be used to treat or control diseases associated with disease causing organisms, e.g., to treat infectious diseases. In an embodiment, the infectious disease is treated by editing (e.g., correcting) one or more target genes, e.g., of the organism or of the subject. In an embodiment, the infectious disease is treated by delivering one or more payloads (e.g., as described herein) to the cell of a disease causing organism or to an infected cell of the subject, e.g., to a target gene. In an embodiment, the target gene is in the infectious pathogen. Exemplary infectious pathogens include, e.g., viruses, bacteria, fungi, protozoa, or mutlicellular parasites.
In an embodiment, the target gene is in the host cell. For example, modulation of a target gene in the host cell can result in resistance to the infectious pathogen. Host genes involved in any stage of the life cycle of the infectious pathogen (e.g., entry, replication, latency) can be modulated. In an embodiment, the target gene encodes a cellular receptor or co-receptor for the infectious pathogen. In an embodiment, the infectious pathogen is a virus, e.g., a virus described herein, e.g., HIV. In an embodiment, the target gene encodes a co-receptor for HIV, e.g., CCR5 or CXCR4.
Exemplary infectious diseases that can be treated by the molecules and methods described herein, include, e.g., AIDS, Hepatitis A, Hepatitis B, Hepatitis C, Herpes simplex, HPV infection, or Influenza.
Exemplary targets are provided in Table VIII-1. The disease and causative organism are provided.
| TABLE VIII-1 | |
| DISEASE | SOURCE OF DISEASE |
| Acinetobacter infections | Acinetobacter baumannii |
| Actinomycosis | Actinomyces israelii, Actinomyces |
| gerencseriae and Propionibacterium | |
| propionicus | |
| African sleeping sickness | Trypanosoma brucei |
| (African trypanosomiasis) | |
| AIDS (Acquired | HIV (Human immunodeficiency virus) |
| immunodeficiency syndrome) | |
| Amebiasis | Entamoeba histolytica |
| Anaplasmosis | Anaplasma genus |
| Anthrax | Bacillus anthracis |
| Arcanobacterium haemolyticum | Arcanobacterium haemolyticum |
| infection | |
| Argentine hemorrhagic fever | Junin virus |
| Ascariasis | Ascaris lumbricoides |
| Aspergillosis | Aspergillus genus |
| Astrovirus infection | Astroviridae family |
| Babesiosis | Babesia genus |
| Bacillus cereus infection | Bacillus cereus |
| Bacterial pneumonia | multiple bacteria |
| Bacterial vaginosis (BV) | multiple bacteria |
| Bacteroides infection | Bacteroides genus |
| Balantidiasis | Balantidium coli |
| Baylisascaris infection | Baylisascaris genus |
| BK virus infection | BK virus |
| Black piedra | Piedraia hortae |
| Blastocystis hominis infection | Blastocystis hominis |
| Blastomycosis | Blastomyces dermatitidis |
| Bolivian hemorrhagic fever | Machupo virus |
| Borrelia infection | Borrelia genus |
| Botulism (and Infant botulism) | Clostridium botulinum; Note: Botulism is |
| not an infection by Clostridium botulinum | |
| but caused by the intake of botulinum | |
| toxin. | |
| Brazilian hemorrhagic fever | Sabia |
| Brucellosis | Brucella genus |
| Bubonic plague | the bacterial family Enterobacteriaceae |
| Burkholderia infection | usually Burkholderia cepacia and other |
| Burkholderia species | |
| Buruli ulcer | Mycobacterium ulcerans |
| Calicivirus infection (Norovirus | Caliciviridae family |
| and Sapovirus) | |
| Campylobacteriosis | Campylobacter genus |
| Candidiasis (Moniliasis; Thrush) | usually Candida albicans and other |
| Candida species | |
| Cat-scratch disease | Bartonella henselae |
| Cellulitis | usually Group A Streptococcus and |
| Staphylococcus | |
| Chagas Disease (American | Trypanosoma cruzi |
| trypanosomiasis) | |
| Chancroid | Haemophilus ducreyi |
| Chickenpox | Varicella zoster virus (VZV) |
| Chlamydia | Chlamydia trachomatis |
| Chlamydophila pneumoniae | Chlamydophila pneumoniae |
| infection (Taiwan acute | |
| respiratory agent or TWAR) | |
| Cholera | Vibrio cholerae |
| Chromoblastomycosis | usually Fonsecaea pedrosoi |
| Clonorchiasis | Clonorchis sinensis |
| Clostridium difficile infection | Clostridium difficile |
| Coccidioidomycosis | Coccidioides immitis and Coccidioides |
| posadasii | |
| Colorado tick fever (CTF) | Colorado tick fever virus (CTFV) |
| Common cold (Acute viral | usually rhinoviruses and coronaviruses. |
| rhinopharyngitis; Acute coryza) | |
| Creutzfeldt-Jakob disease (CJD) | PRNP |
| Crimean-Congo hemorrhagic | Crimean-Congo hemorrhagic fever virus |
| fever (CCHF) | |
| Cryptococcosis | Cryptococcus neoformans |
| Cryptosporidiosis | Cryptosporidium genus |
| Cutaneous larva migrans (CLM) | usually Ancylostoma braziliense; multiple |
| other parasites | |
| Cyclosporiasis | Cyclospora cayetanensis |
| Cysticercosis | Taenia solium |
| Cytomegalovirus infection | Cytomegalovirus |
| Dengue fever | Dengue viruses (DEN-1, DEN-2, DEN-3 |
| and DEN-4) - Flaviviruses | |
| Dientamoebiasis | Dientamoeba fragilis |
| Diphtheria | Corynebacterium diphtheriae |
| Diphyllobothriasis | Diphyllobothrium |
| Dracunculiasis | Dracunculus medinensis |
| Ebola hemorrhagic fever | Ebolavirus (EBOV) |
| Echinococcosis | Echinococcus genus |
| Ehrlichiosis | Ehrlichia genus |
| Enterobiasis (Pinworm infection) | Enterobius vermicularis |
| Enterococcus infection | Enterococcus genus |
| Enterovirus infection | Enterovirus genus |
| Epidemic typhus | Rickettsia prowazekii |
| Erythema infectiosum (Fifth | Parvovirus B19 |
| disease) | |
| Exanthem subitum (Sixth | Human herpesvirus 6 (HHV-6) and Human |
| disease) | herpesvirus 7 (HHV-7) |
| Fasciolopsiasis | Fasciolopsis buski |
| Fasciolosis | Fasciola hepatica and Fasciola gigantica |
| Fatal familial insomnia (FFI) | PRNP |
| Filariasis | Filarioidea superfamily |
| Food poisoning by Clostridium | Clostridium perfringens |
| perfringens | |
| Free-living amebic infection | multiple |
| Fusobacterium infection | Fusobacterium genus |
| Gas gangrene (Clostridial | usually Clostridium perfringens; other |
| myonecrosis) | Clostridium species |
| Geotrichosis | Geotrichum candidum |
| Gerstmann-Sträussler-Scheinker | PRNP |
| syndrome (GSS) | |
| Giardiasis | Giardia intestinalis |
| Glanders | Burkholderia mallei |
| Gnathostomiasis | Gnathostoma spinigerum and Gnathostoma |
| hispidum | |
| Gonorrhea | Neisseria gonorrhoeae |
| Granuloma inguinale | Klebsiella granulomatis |
| (Donovanosis) | |
| Group A streptococcal infection | Streptococcus pyogenes |
| Group B streptococcal infection | Streptococcus agalactiae |
| Haemophilus influenzae | Haemophilus influenzae |
| infection | |
| Hand, foot and mouth disease | Enteroviruses, mainly Coxsackie A virus and |
| (HFMD) | Enterovirus 71 (EV71) |
| Hantavirus Pulmonary | Sin Nombre virus |
| Syndrome (HPS) | |
| Helicobacter pylori infection | Helicobacter pylori |
| Hemolytic-uremic syndrome | Escherichia coli O157:H7, O111 and |
| (HUS) | O104:H4 |
| Hemorrhagic fever with renal | Bunyaviridae family |
| syndrome (HFRS) | |
| Hepatitis A | Hepatitis A Virus |
| Hepatitis B | Hepatitis B Virus |
| Hepatitis C | Hepatitis C Virus |
| Hepatitis D | Hepatitis D Virus |
| Hepatitis E | Hepatitis E Virus |
| Herpes simplex | Herpes simplex virus 1 and 2 (HSV-1 and |
| HSV-2) | |
| Histoplasmosis | Histoplasma capsulatum |
| Hookworm infection | Ancylostoma duodenale and Necator |
| americanus | |
| Human bocavirus infection | Human bocavirus (HBoV) |
| Human ewingii ehrlichiosis | Ehrlichia ewingii |
| Human granulocytic | Anaplasma phagocytophilum |
| anaplasmosis (HGA) | |
| Human metapneumovirus | Human metapneumovirus (hMPV) |
| infection | |
| Human monocytic ehrlichiosis | Ehrlichia chaffeensis |
| Human papillomavirus (HPV) | Human papillomavirus (HPV) |
| infection | |
| Human parainfluenza virus | Human parainfluenza viruses (HPIV) |
| infection | |
| Hymenolepiasis | Hymenolepis nana and Hymenolepis |
| diminuta | |
| Epstein-Barr Virus Infectious | Epstein-Barr Virus (EBV) |
| Mononucleosis (Mono) | |
| Influenza (flu) | Orthomyxoviridae family |
| Isosporiasis | Isospora belli |
| Kawasaki disease | unknown; evidence supports that it is |
| infectious | |
| Keratitis | multiple |
| Kingella kingae infection | Kingella kingae |
| Kuru | PRNP |
| Lassa fever | Lassa virus |
| Legionellosis (Legionnaires' | Legionella pneumophila |
| disease) | |
| Legionellosis (Pontiac fever) | Legionella pneumophila |
| Leishmaniasis | Leishmania genus |
| Leprosy | Mycobacterium leprae and Mycobacterium |
| lepromatosis | |
| Leptospirosis | Leptospira genus |
| Listeriosis | Listeria monocytogenes |
| Lyme disease (Lyme borreliosis) | usually Borrelia burgdorferi and other |
| Borrelia species | |
| Lymphatic filariasis | Wuchereria bancrofti and Brugia malayi |
| (Elephantiasis) | |
| Lymphocytic choriomeningitis | Lymphocytic choriomeningitis virus |
| (LCMV) | |
| Malaria | Plasmodium genus |
| Marburg hemorrhagic fever | Marburg virus |
| (MHF) | |
| Measles | Measles virus |
| Melioidosis (Whitmore's | Burkholderia pseudomallei |
| disease) | |
| Meningitis | multiple |
| Meningococcal disease | Neisseria meningitidis |
| Metagonimiasis | usually Metagonimus yokagawai |
| Microsporidiosis | Microsporidia phylum |
| Molluscum contagiosum (MC) | Molluscum contagiosum virus (MCV) |
| Monkeypox | Monkeypox virus |
| Mumps | Mumps virus |
| Murine typhus (Endemic typhus) | Rickettsia typhi |
| Mycoplasma pneumonia | Mycoplasma pneumoniae |
| Mycetoma | numerous species of bacteria |
| (Actinomycetoma) and fungi (Eumycetoma) | |
| Myiasis | parasitic dipterous fly larvae |
| Neonatal conjunctivitis | most commonly Chlamydia trachomatis and |
| (Ophthalmia neonatorum) | Neisseria gonorrhoeae |
| (New) Variant Creutzfeldt-Jakob | PRNP |
| disease (vCJD, nvCJD) | |
| Nocardiosis | usually Nocardia asteroides and other |
| Nocardia species | |
| Onchocerciasis (River blindness) | Onchocerca volvulus |
| Paracoccidioidomycosis (South | Paracoccidioides brasiliensis |
| American blastomycosis) | |
| Paragonimiasis | usually Paragonimus westermani and other |
| Paragonimus species | |
| Pasteurellosis | Pasteurella genus |
| Pediculosis capitis (Head lice) | Pediculus humanus capitis |
| Pediculosis corporis (Body lice) | Pediculus humanus corporis |
| Pediculosis pubis (Pubic lice, | Phthirus pubis |
| Crab lice) | |
| Pelvic inflammatory disease | multiple |
| (PID) | |
| Pertussis (Whooping cough) | Bordetella pertussis |
| Plague | Yersinia pestis |
| Pneumococcal infection | Streptococcus pneumoniae |
| Pneumocystis pneumonia (PCP) | Pneumocystis jirovecii |
| Pneumonia | multiple |
| Poliomyelitis | Poliovirus |
| Prevotella infection | Prevotella genus |
| Primary amoebic | usually Naegleria fowleri |
| meningoencephalitis (PAM) | |
| Progressive multifocal | JC virus |
| leukoencephalopathy | |
| Psittacosis | Chlamydophila psittaci |
| Q fever | Coxiella burnetii |
| Rabies | Rabies virus |
| Rat-bite fever | Streptobacillus moniliformis and Spirillum |
| minus | |
| Respiratory syncytial virus | Respiratory syncytial virus (RSV) |
| infection | |
| Rhinosporidiosis | Rhinosporidium seeberi |
| Rhinovirus infection | Rhinovirus |
| Rickettsial infection | Rickettsia genus |
| Rickettsialpox | Rickettsia akari |
| Rift Valley fever (RVF) | Rift Valley fever virus |
| Rocky Mountain spotted fever | Rickettsia rickettsii |
| (RMSF) | |
| Rotavirus infection | Rotavirus |
| Rubella | Rubella virus |
| Salmonellosis | Salmonella genus |
| SARS (Severe Acute | SARS coronavirus |
| Respiratory Syndrome) | |
| Scabies | Sarcoptes scabiei |
| Schistosomiasis | Schistosoma genus |
| Sepsis | multiple |
| Shigellosis (Bacillary dysentery) | Shigella genus |
| Shingles (Herpes zoster) | Varicella zoster virus (VZV) |
| Smallpox (Variola) | Variola major or Variola minor |
| Sporotrichosis | Sporothrix schenckii |
| Staphylococcal food poisoning | Staphylococcus genus |
| Staphylococcal infection | Staphylococcus genus |
| Strongyloidiasis | Strongyloides stercoralis |
| Subacute sclerosing | Measles virus |
| panencephalitis | |
| Syphilis | Treponema pallidum |
| Taeniasis | Taenia genus |
| Tetanus (Lockjaw) | Clostridium tetani |
| Tinea barbae (Barber's itch) | usually Trichophyton genus |
| Tinea capitis (Ringworm of the | usually Trichophyton tonsurans |
| Scalp) | |
| Tinea corporis (Ringworm of the | usually Trichophyton genus |
| Body) | |
| Tinea cruris (Jock itch) | usually Epidermophyton floccosum, |
| Trichophyton rubrum, and Trichophyton | |
| mentagrophytes | |
| Tinea manuum (Ringworm of | Trichophyton rubrum |
| the Hand) | |
| Tinea nigra | usually Hortaea werneckii |
| Tinea pedis (Athlete's foot) | usually Trichophyton genus |
| Tinea unguium (Onychomycosis) | usually Trichophyton genus |
| Tinea versicolor (Pityriasis | Malassezia genus |
| versicolor) | |
| Toxocariasis (Ocular Larva | Toxocara canis or Toxocara cati |
| Migrans (OLM)) | |
| Toxocariasis (Visceral Larva | Toxocara canis or Toxocara cati |
| Migrans (VLM)) | |
| Toxoplasmosis | Toxoplasma gondii |
| Trichinellosis | Trichinella spiralis |
| Trichomoniasis | Trichomonas vaginalis |
| Trichuriasis (Whipworm | Trichuris trichiura |
| infection) | |
| Tuberculosis | usually Mycobacterium tuberculosis |
| Tularemia | Francisella tularensis |
| Ureaplasma urealyticum | Ureaplasma urealyticum |
| infection | |
| Valley fever | Coccidioides immitis or Coccidioides |
| posadasii. | |
| Venezuelan equine encephalitis | Venezuelan equine encephalitis virus |
| Venezuelan hemorrhagic fever | Guanarito virus |
| Viral pneumonia | multiple viruses |
| West Nile Fever | West Nile virus |
| White piedra (Tinea blanca) | Trichosporon beigelii |
| Yersinia pseudotuberculosis | Yersinia pseudotuberculosis |
| infection | |
| Yersiniosis | Yersinia enterocolitica |
| Yellow fever | Yellow fever virus |
| Zygomycosis | Mucorales order (Mucormycosis) and |
| Entomophthorales order | |
| (Entomophthoramycosis) | |
AIDS/HIV
HIV Genomic Structural Elements
Long terminal repeat (LTR) refers to the DNA sequence flanking the genome of integrated proviruses. It contains important regulatory regions, especially those for transcription initiation and polyadenylation.
Target sequence (TAR) for viral transactivation, the binding site for Tat protein and for cellular proteins; consists of approximately the first 45 nucleotides of the viral mRNAs in HIV-1 (or the first 100 nucleotides in HIV-2 and SIV.) TAR RNA forms a hairpin stem-loop structure with a side bulge; the bulge is necessary for Tat binding and function.
Rev responsive element (RPE) refers to an RNA element encoded within the env region of HIV-1. It consists of approximately 200 nucleotides (positions 7327 to 7530 from the start of transcription in HIV-1, spanning the border of gp120 and gp41). The RRE is necessary for Rev function; it contains a high affinity site for Rev; in all, approximately seven binding sites for Rev exist within the RRE RNA. Other lentiviruses (HIV-2, SIV, visna, CAEV) have similar RRE elements in similar locations within env, while HTLVs have an analogous RNA element (RXRE) serving the same purpose within their LTR; RRE is the binding site for Rev protein, while RXRE is the binding site for Rex protein. RRE (and RXRE) form complex secondary structures, necessary for specific protein binding.
Psi elements (PE) are a set of 4 stem-loop structures preceding and overlapping the Gag start codon which are the sites recognized by the cysteine histidine box, a conserved motif with the canonical sequence CysX2CysX4HisX4Cys (SEQ ID NO: 41), present in the Gag p7 MC protein. The Psi Elements are present in unspliced genomic transcripts but absent from spliced viral mRNAs.
SLIP, an TTTTTT slippery site, followed by a stem-loop structure, is responsible for regulating the −1 ribosomal frameshift out of the Gag reading frame into the Pol reading frame.
Cis-acting repressive sequences (CRS) are postulated to inhibit structural protein expression in the absence of Rev. One such site was mapped within the pol region of HIV-1. The exact function has not been defined; splice sites have been postulated to act as CRS sequences.
Inhibitory/Instability RNA sequences (INS) are found within the structural genes of HIV-1 and of other complex retroviruses. Multiple INS elements exist within the genome and can act independently; one of the best characterized elements spans nucleotides 414 to 631 in the gag region of HIV-1. The INS elements have been defined by functional assays as elements that inhibit expression posttranscriptionally. Mutation of the RNA elements was shown to lead to INS inactivation and up regulation of gene expression.
Genes and Gene Products
Essential for Replication
The genomic region (GAG) encoding the capsid proteins (group specific antigens). The precursor is the p55 myristylated protein, which is processed to p17 (MAtrix), p24 (CApsid), p7 (NucleoCapsid), and p6 proteins, by the viral protease. Gag associates with the plasma membrane where the virus assembly takes place. The 55 kDa Gag precursor is called assemblin to indicate its role in viral assembly.
The genomic region, POL, encoding the viral enzymes protease, reverse transcriptase, RNAse, and integrase. These enzymes are produced as a Gag-Pol precursor polyprotein, which is processed by the viral protease; the Gag-Pol precursor is produced by ribosome frameshifting near the end of gag.
Viral glycoproteins (e.g., ENV) produced as a precursor (gp160) which is processed to give a noncovalent complex of the external glycoprotein gp120 and the transmembrane glyco-protein gp41. The mature gp120-gp41 proteins are bound by non-covalent interactions and are associated as a trimer on the cell surface. A substantial amount of gp120 can be found released in the medium. gp120 contains the binding site for the CD4 receptor, and the seven transmembrane do-main chemokine receptors that serve as co-receptors for HIV-1.
The transactivator (TAT) of HIV gene expression is one of two essential viral regulatory factors (Tat and Rev) for HIV gene expression. Two forms are known, Tat-1 exon (minor form) of 72 amino acids and Tat-2 exon (major form) of 86 amino acids. Low levels of both proteins are found in persistently infected cells. Tat has been localized primarily in the nucleolus/nucleus by immunofluorescence. It acts by binding to the TAR RNA element and activating transcription initiation and elongation from the LTR promoter, preventing the LTR AATAAA polyadenylation signal from causing premature termination of transcription and polyadenylation. It is the first eukaryotic transcription factor known to interact with RNA rather than DNA and may have similarities with prokaryotic anti-termination factors. Extracellular Tat can be found and can be taken up by cells in culture.
The second necessary regulatory factor for HIV expression is REV. A 19 kDa phosphoprotein, localized primarily in the nucleolus/nucleus, Rev acts by binding to RRE and promoting the nuclear export, stabilization and utilization of the un-spliced viral mRNAs containing RRE. Rev is considered the most functionally conserved regulatory protein of lentiviruses. Rev cycles rapidly between the nucleus and the cytoplasm.
Others
Viral infectivity factor (VIF) is a basic protein of typically 23 kDa. Promotes the infectivity but not the production of viral particles. In the absence of Vif the produced viral particles are defective, while the cell-to-cell transmission of virus is not affected significantly. Found in almost all lentiviruses, Vif is a cytoplasmic protein, existing in both a soluble cytosolic form and a membrane-associated form. The latter form of Vif is a peripheral membrane protein that is tightly associated with the cytoplasmic side of cellular membranes. In 2003, it was discovered that Vif prevents the action of the cellular APOBEC-3G protein which deaminates DNA:RNA heteroduplexes in the cytoplasm.
Viral Protein R (VPR) is a 96-amino acid (14 kDa) protein, which is incorporated into the virion. It interacts with the p6 Gag part of the Pr55 Gag precursor. Vpr detected in the cell is localized to the nucleus. Proposed functions for Vpr include the targeting the nuclear import of preintegration complexes, cell growth arrest, transactivation of cellular genes, and induction of cellular differentiation. In HIV-2, SIV-SMM, SIV-RCM, SIV-MND-2 and SIV-DRL the Vpx gene is apparently the result of a Vpr gene duplication event, possibly by recombination.
Viral Protein U (VPU)) is unique to HIV-1, SIVcpz (the closest SIV relative of HIV-1), SIV-GSN, SIV-MUS, SIV-MON and SIV-DEN. There is no similar gene in HIV-2, SIV-SMM or other SIVs. Vpu is a 16 kDa (81-amino acid) type I integral membrane protein with at least two different biological functions: (a) degradation of CD4 in the endoplasmic reticulum, and (b) enhancement of virion release from the plasma membrane of HIV-1-infected cells. Env and Vpu are expressed from a bicistronic mRNA. Vpu probably possesses an N-terminal hydrophobic membrane anchor and a hydrophilic moiety. It is phosphorylated by casein kinase II at positions Ser52 and Ser56. Vpu is involved in Env maturation and is not found in the virion. Vpu has been found to increase susceptibility of HIV-1 infected cells to Fas killing.
NEF is amultifunctional 27-kDa myristylated protein produced by an ORF located at the 3 0 end of the primate lentiviruses. Other forms of Nef are known, including nonmyristylated variants. Nef is predominantly cytoplasmic and associated with the plasma membrane via the myristyl residue linked to the conserved second amino acid (Gly). Nef has also been identified in the nucleus and found associated with the cytoskeleton in some experiments. One of the first HIV proteins to be produced in infected cells, it is the most immunogenic of the accessory proteins. The nef genes of HIV and SIV are dispensable in vitro, but are essential for efficient viral spread and disease progression in vivo. Nef is necessary for the maintenance of high virus loads and for the development of AIDS in macaques, and viruses with defective Nef have been detected in some HIV-1 infected long term survivors. Nef downregulates CD4, the primary viral receptor, and MHC class I molecules, and these functions map to different parts of the protein. Nef interacts with components of host cell signal transduction and clathrin-dependent protein sorting pathways. It increases viral infectivity. Nef contains PxxP motifs that bind to SH3 domains of a subset of Src kinases and are required for the enhanced growth of HIV but not for the downregulation of CD4.
VPX is a virion protein of 12 kDa found in HIV-2, SIV-SMM, SIV-RCM, SIV-MND-2 and SIV-DRL and not in HIV-1 or other SIVs. This accessory gene is a homolog of HIV-1 vpr, and viruses with Vpx carry both vpr and vpx. Vpx function in relation to Vpr is not fully elucidated; both are incorporated into virions at levels comparable to Gag proteins through interactions with Gag p6. Vpx is necessary for efficient replication of SIV-SMM in PBMCs. Progression to AIDS and death in SIV-infected animals can occur in the absence of Vpr or Vpx. Double mutant virus lacking both vpr and vpx was attenuated, whereas the single mutants were not, suggesting a redundancy in the function of Vpr and Vpx related to virus pathogenicity.
Hepatitis A Viral Target Sequences
Hepatitis B Viral Target Sequences
Precursor Polypeptide encoding all HCV protein is produced and then spliced into functional proteins. The following are the proteins (coding regions) encoded:
Hepatitis C Viral Target Sequences
Precursor Polypeptide encoding all HCV protein is produced and then spliced into functional proteins. The following are the proteins (coding regions) encoded:
| Gene | Protein | Function/description | |
| UL1 | Glycoprotein L | Surface and membrane | |
| UL2 | UL2 | Uracil-DNA glycosylase | |
| UL3 | UL3 | unknown | |
| UL4 | UL4 | unknown | |
| UL5 | UL5 | DNA replication | |
| UL6 | Portal | Twelve of these proteins | |
| protein UL-6 | constitute the capsid | ||
| portal ring through which | |||
| DNA enters and exits the | |||
| capsid. | |||
| UL7 | UL7 | Virion maturation | |
| UL8 | UL8 | DNA helicase/primase | |
| complex-associated | |||
| protein | |||
| UL9 | UL9 | Replication origin- | |
| binding protein | |||
| UL10 | Glycoprotein M | Surface and membrane | |
| UL11 | UL11 | virion exit and secondary | |
| envelopment | |||
| UL12 | UL12 | Alkaline exonuclease | |
| UL13 | UL13 | Serine-threonine protein | |
| kinase | |||
| UL14 | UL14 | Tegument protein | |
| UL15 | Terminase | Processing and | |
| packaging of DNA | |||
| UL16 | UL16 | Tegument protein | |
| UL17 | UL17 | Processing and | |
| packaging DNA | |||
| UL18 | VP23 | Capsid protein | |
| UL19 | VP5 | Major capsid protein | |
| UL20 | UL20 | Membrane protein | |
| UL21 | UL21 | Tegument protein | |
| UL22 | Glycoprotein H | Surface and membrane | |
| UL23 | Thymidine | Peripheral to DNA | |
| kinase | replication | ||
| UL24 | UL24 | unknown | |
| UL25 | UL25 | Processing and | |
| packaging DNA | |||
| UL26 | P40; VP24; | Capsid protein | |
| VP22A | |||
| UL27 | Glycoprotein B | Surface and membrane | |
| UL28 | ICP18.5 | Processing and | |
| packaging DNA | |||
| UL29 | UL29; ICP8 | Major DNA-binding | |
| protein | |||
| UL30 | DNA | DNA replication | |
| polymerase | |||
| UL31 | UL31 | Nuclear matrix protein | |
| UL32 | UL32 | Envelope glycoprotein | |
| UL33 | UL33 | Processing and | |
| packaging DNA | |||
| UL34 | UL34 | Inner nuclear membrane | |
| protein | |||
| UL35 | VP26 | Capsid protein | |
| UL36 | UL36 | Large tegument protein | |
| UL37 | UL37 | Capsid assembly | |
| UL38 | UL38; | Capsid assembly and DNA | |
| VP19C | maturation | ||
| UL39 | UL39 | Ribonucleotide reductase | |
| (Large subunit) | |||
| UL40 | UL40 | Ribonucleotide reductase | |
| (Small subunit) | |||
| UL41 | UL41; VHS | Tegument protein; Virion | |
| host shutoff | |||
| UL42 | UL42 | DNA polymerase | |
| processivity factor | |||
| UL43 | UL43 | Membrane protein | |
| UL44 | Glycoprotein C | Surface and membrane | |
| UL45 | UL45 | Membrane protein; C-type | |
| lectin[26] | |||
| UL46 | VP11/12 | Tegument proteins | |
| UL47 | UL47; | Tegument protein | |
| VP13/14 | |||
| UL48 | VP16 | Virion maturation; activate | |
| (Alpha-TIF) | IE genes by interacting with | ||
| the cellular transcription | |||
| factors Oct-1 and HCF. | |||
| Binds to the sequence | |||
| 5′TAATGARAT3′. | |||
| UL49 | UL49A | Envelope protein | |
| UL50 | UL50 | dUTP diphosphatase | |
| UL51 | UL51 | Tegument protein | |
| UL52 | UL52 | DNA helicase/primase | |
| complex protein | |||
| UL53 | Glycoprotein K | Surface and membrane | |
| UL54 | IE63; ICP27 | Transcriptional regulation | |
| UL55 | UL55 | Unknown | |
| UL56 | UL56 | Unknown | |
| US1 | ICP22; IE68 | Viral replication | |
| US2 | US2 | Unknown | |
| US3 | US3 | Serine/threonine-protein | |
| kinase | |||
| US4 | Glycoprotein G | Surface and membrane | |
| US5 | Glycoprotein J | Surface and membrane | |
| US6 | Glycoprotein D | Surface and membrane | |
| US7 | Glycoprotein I | Surface and membrane | |
| US8 | Glycoprotein E | Surface and membrane | |
| US9 | US9 | Tegument protein | |
| US10 | US10 | Capsid/Tegument protein | |
| US11 | US11; | Binds DNA and RNA | |
| Vmw21 | |||
| US12 | ICP47; IE12 | Inhibits MHC class I | |
| pathway by preventing | |||
| binding of antigen to TAP | |||
| RS1 | ICP4; IE175 | Major transcriptional | |
| activator. Essential for | |||
| progression beyond the | |||
| immediate-early phase of | |||
| infection. IEG transcription | |||
| repressor. | |||
| ICP0 | ICP0; IE110; | E3 ubiquitin ligase that | |
| α0 | activates viral gene | ||
| transcription by opposing | |||
| chromatinization of the viral | |||
| genome and counteracts | |||
| intrinsic- and interferon- | |||
| based antiviral responses.[28] | |||
| LRP1 | LRP1 | Latency-related protein | |
| LRP2 | LRP2 | Latency-related protein | |
| RL1 | RL1; | Neurovirulence factor. | |
| ICP34.5 | Antagonizes PKR by de- | ||
| phosphorylating eIF4a. | |||
| Binds to BECN1 and | |||
| inactivates autophagy. | |||
| LAT | none | Latency-associated | |
| transcript | |||
HPV Target Sequences
| E1 | Genome replication: ATP-dependent DNA helicase |
| E2 | Genome replication, transcription, segregation, encapsidation. |
| Regulation of cellular gene expression; cell cycle and apoptosis | |
| regulation. Several isoforms of the virus replication/transcription | |
| factor E2 have also been noted for a number of HPVs. E2 has an | |
| N-terminal domain that mediates protein-protein interactions, a | |
| flexible hinge region and a C-terminal DNA binding domain. | |
| Truncated E2 proteins may be translated from alternatively spliced | |
| E2 RNAs to generate E1{circumflex over ( )}E2 and E8{circumflex over ( )}E2 protein isoforms present | |
| in HPV16 and 31-infected cells.[10-13] These E2 isoforms may act in a | |
| dominant-negative manner to modulate the function of full length | |
| E2.[10, 12, 13] For example, a full length E2/E8{circumflex over ( )}E2 dimer may bind DNA but | |
| fail to recruit E1 to initiate virus replication. Similarly, such a | |
| dimer may be unable to interact with cellular transcription factors | |
| to alter virus genome transcription. | |
| E4 | Remodels cytokeratin network; cell cycle arrest; virion assembly |
| E5 | Control of cell growth and differentiation; immune modulation |
| E6 | Inhibits apoptosis and differentiation; regulates cell shape, |
| polarity, mobility and signaling. Four mRNA isoforms (FLE6, | |
| E6*I, E6*II, E6*X) have been observed in HPV16 infected | |
| cervical epithelial cells[16] and two in HPV18 infection.[7] A role for the | |
| E6*I isoform in antagonizing FLE6 function has been suggested,[7] | |
| as has opposing roles for FLE6 and E6*I in regulation of | |
| procaspase 8 in the extrinsic apoptotic pathway.[18] More recently, a | |
| stand-alone function of the E6*I isoform has been determined in | |
| cellular protein degradation.[9 | |
| E7 | Cell cycle control; controls centrosome duplication |
| L1 | Major capsid protein |
| L2 | Minor capsid protein; recruits L1; virus assembly |
| LCR | Viral long control region (location of early promoters) |
| Keratinocyte/ | |
| auxiliary enhancer | |
| P97 Promoter | Early (E) gene promoter for subtype HPV16 |
| P105 Promoter | Early (E) gene promoter for subtype HPV18 |
| P670 Promoter | Late (L) gene promoter for HPV16 |
| P742 Promoter | Late (L) gene promoter for HPV31 |
Influenza A Target Sequences
Influenza A is the most common flu virus that infects humans. The influenza A virion is made up of 8 different single stranded RNA segments which encodes 11-14 proteins. These segments can vary in sequence, with most variation occurring in the hemagglutinin (H or HA) surface protein and neuraminidase (NA or N). The eight RNA segments (and the proteins they encode) are:
M. tuberculosis Target Sequences
The methods and composition described herein can be used to target M. tuberculosis and treat a subject suffering from an infection with M. tuberculosis.
Other
In an embodiment, the target gene is associated with multiple drug resistance (MDR), e.g., in bacterial infection. Infectious pathogens can use a number of mechanisms in attaining multi-drug resistance, e.g., no longer relying on a glycoprotein cell wall, enzymatic deactivation of antibiotics, decreased cell wall permeability to antibiotics, altered target sites of antibiotic, efflux pumps to remove antibiotics, increased mutation rate as a stress response, or a combination thereof.
Candidate Cas9 molecules, candidate gRNA molecules, and/or candidate Cas9 molecule/gRNA molecule complexes, can be used to modulate genes (e.g., mutated genes) responsible for diseases. In an embodiment, the gene is modulated by editing or correcting a target gene, e.g., as described herein. In an embodiment, the human gene is modulated by delivery of one or more regulators/effectors (e.g., as described herein) inside cells to the target gene. For example, the genes described herein can be modulated, in vitro, ex vivo, or in vivo.
| TABLE IX-1 |
| Selected Diseases in which a gene can be therapeutically targeted. |
| Kinases (cancer) |
| Energy metabolism (cancer) |
| CFTR (cystic fibrosis) |
| Color blindness |
| Hemochromatosis |
| Hemophilia |
| Phenylketonuria |
| Polycystic kidney disease |
| Sickle-cell disease |
| Tay-Sachs disease |
| Siderius X-linked mental retardation syndrome |
| Lysosomal storage disorders, e.g., Alpha-galactosidase A deficiency |
| Anderson-Fabry disease |
| Angiokeratoma Corporis Diffusum |
| CADASIL syndrome |
| Carboxylase Deficiency, Multiple, Late-Onset |
| Cerebelloretinal Angiomatosis, familial |
| Cerebral arteriopathy with subcortical infarcts and leukoencephalopathy |
| Cerebral autosomal dominant arteriopathy with subcortical infarcts and |
| leukoencephalopathy |
| Cerebroside Lipidosis syndrome |
| Choreoathetosis self-mutilation hyperuricemia syndrome |
| Classic Galactosemia |
| Crohn's disease, fibrostenosing |
| Phenylalanine Hydroxylase Deficiency disease, |
| Fabry disease |
| Hereditary coproporphyria |
| Incontinentia pigmenti |
| Microcephaly |
| Polycystic kidney disease |
| Rett's |
| Alpha-1 antitrypsin deficiency |
| Wilson's Disease |
| Tyrosinemia |
| Frameshift related diseases |
| Cystic fibrosis |
| Triplet repeat diseases (also referred herein as trinucleotide repeat |
| diseases) |
Trinucleotide repeat diseases (also known as triplet repeat disease, trinucleotide repeat expansion disorders, triplet repeat expansion disorders, or codon reiteration disorders) are a set of genetic disorders caused by trinucleotide repeat expansion, e.g., a type of mutation where trinucleotide repeats in certain genes exceed the normal and/or stable threshold. The mutation can be a subset of unstable microsatellite repeats that occur in multiple or all genomic sequences. The mutation can increase the repeat count (e.g., result in extra or expanded repeats) and result in a defective gene, e.g., producing an abnormal protein. Trinucleotide repeats can be classified as insertion mutations or as a separate class of mutations. Candidate Cas9 molecules, candidate gRNA molecules, and/or candidate Cas9 molecule/gRNA molecule complexes, can be used to modulate one or more genes (e.g., mutated genes) associated with a trinucleotide repeat disease, e.g., by reducing the number of (e.g., removing) the extra or expanded repeats, such that the normal or wild-type gene product (e.g., protein) can be produced.
Exemplary trinucleotide repeat diseases and target genes involved in trinucleotide repeat diseases are shown in Table IX-1A.
| TABLE IX-1A |
| Exemplary trinucleotide repeat diseases and target |
| genes involved in trinucleotide repeat diseases |
| Trinucleotide Repeat Diseases | Gene |
| DRPLA (Dentatorubropallidoluysian atrophy) | ATN1 or DRPLA |
| HD (Huntington's disease) | HTT (Huntingtin) |
| SBMA (Spinobulbar muscular atrophy or | Androgen receptor on the |
| Kennedy disease) | X chromosome. |
| SCA1 (Spinocerebellar ataxia Type 1) | ATXN1 |
| SCA2 (Spinocerebellar ataxia Type 2) | ATXN2 |
| SCA3 (Spinocerebellar ataxia Type 3 or | ATXN3 |
| Machado-Joseph disease) | |
| SCA6 (Spinocerebellar ataxia Type 6) | CACNA1A |
| SCA7 (Spinocerebellar ataxia Type 7) | ATXN7 |
| SCA17 (Spinocerebellar ataxia Type 17) | TBP |
| FRAXA (Fragile X syndrome) | FMR1, on the X- |
| chromosome | |
| FXTAS (Fragile X-associated tremor/ | FMR1, on the X- |
| ataxia syndrome) | chromosome |
| FRAXE (Fragile XE mental retardation) | AFF2 or FMR2, on the |
| X-chromosome | |
| FRDA (Friedreich's ataxia) | FXN or X25, (frataxin- |
| reduced expression) | |
| DM (Myotonic dystrophy) | DMPK |
| SCA8 (Spinocerebellar ataxia Type 8) | OSCA or SCA8 |
| SCA12 (Spinocerebellar ataxia Type 12) | PPP2R2B or SCA12 |
Exemplary target genes include those genes involved in various diseases or conditions, e.g., cancer (e.g., kinases), energy metabolism, cystic fibrosis (e.g., CFTR), color blindness, hemochromatosis, hemophilia, phenylketonuria, polycystic kidney disease, Sickle-cell disease, Tay-Sachs disease, Siderius X-linked mental retardation syndrome, Lysosomal storage disorders (e.g., Alpha-galactosidase A deficiency), Anderson-Fabry disease, Angiokeratoma Corporis Diffusum, CADASIL syndrome, Carboxylase Deficiency, Multiple, Late-Onset, Cerebelloretinal Angiomatosis, familial, Cerebral arteriopathy with subcortical infarcts and leukoencephalopathy, Cerebral autosomal dominant arteriopathy with subcortical infarcts and leukoencephalopathy, Cerebroside Lipidosis syndrome, Choreoathetosis self-mutilation hyperuricemia syndrome, Classic Galactosemia, Crohn's disease, fibrostenosing, Phenylalanine Hydroxylase Deficiency disease, Fabry disease, Hereditary coproporphyria, Incontinentia pigmenti, Microcephaly, Polycystic kidney disease, Rett's, Alpha-1 antitrypsin deficiency, Wilson's Disease, Tyrosinemia, Frameshift related diseases, and Triplet repeat diseases.
Additional exemplary target genes include genes associated with diseases including, e.g., Crigler-Najjer syndrome, Glycogen storage disease type IV (GSD type IV), Familial hemophagocytic lymphohistiocytosis (FHL-Perforin deficiency), Ornithine transcarbamylase deficiency (OTC deficiency) or other Urea Cycle Disorders, Primary Hyperoxaluria, Leber congenital amaurosis (LCA), Batten disease, Chronic Granulomatous Disease, Wiskott-Aldrich syndrome, Usher Syndrome, and hemoglobinoapthies.
Crigler-Najjer syndrome. Crigler-Najjer syndrome is a severe condition characterized by high levels of bilirubin in the blood (hyperbilirubinemia). Bilirubin is produced when red blood cells are broken down. This substance is removed from the body only after it undergoes a chemical reaction in the liver, which converts the toxic form of bilirubin (unconjugated bilirubin) to a nontoxic form (conjugated bilirubin). People with Crigler-Najjar syndrome have a buildup of unconjugated bilirubin in their blood (unconjugated hyperbilirubinemia). Crigler-Najjar syndrome is divided into two types. Type 1 (CN1) is very severe and Type 2 (CN2) is less severe.
Mutations in the UGT1A1 gene can cause Crigler-Najjar syndrome. This gene provides instructions for making the bilirubin uridine diphosphate glucuronosyl transferase (bilirubin-UGT) enzyme, which is found primarily in liver cells and is necessary for the removal of bilirubin from the body. The bilirubin-UGT enzyme is involved in glucuronidation, in which the enzyme transfers glucuronic acid to unconjugated bilirubin, converting it to conjugated bilirubin. Glucuronidation makes bilirubin dissolvable in water so that it can be removed from the body.
Mutations in the UGT1A1 gene that cause Crigler-Najjar syndrome result in reduced or absent function of the bilirubin-UGT enzyme. People with CN1 have no enzyme function, while people with CN2 can have less than 20 percent of normal function. The loss of bilirubin-UGT function decreases glucuronidation of unconjugated bilirubin. This toxic substance then builds up in the body, causing unconjugated hyperbilirubinemia and jaundice.
Glycogen storage disease type IV. Glycogen storage disease type IV (also known as GSD type IV, Glycogenosis type IV, Glycogen Branching Enzyme Deficiency (GBED), polyglucosan body disease, or Amylopectinosis) is an inherited disorder caused by the buildup of a complex sugar called glycogen in the body's cells. The accumulated glycogen is structurally abnormal and impairs the function of certain organs and tissues, especially the liver and muscles.
Mutations in the GBE1 gene cause GSD IV. The GBE1 gene provides instructions for making the glycogen branching enzyme. This enzyme is involved in the production of glycogen, which is a major source of stored energy in the body. GBE1 gene mutations that cause GSD IV lead to a shortage (deficiency) of the glycogen branching enzyme. As a result, glycogen is not formed properly. Abnormal glycogen molecules called polyglucosan bodies accumulate in cells, leading to damage and cell death. Polyglucosan bodies accumulate in cells throughout the body, but liver cells and muscle cells are most severely affected in GSD IV. Glycogen accumulation in the liver leads to hepatomegaly and interferes with liver functioning. The inability of muscle cells to break down glycogen for energy leads to muscle weakness and wasting.
Generally, the severity of the disorder is linked to the amount of functional glycogen branching enzyme that is produced. Individuals with the fatal perinatal neuromuscular type tend to produce less than 5 percent of usable enzyme, while those with the childhood neuromuscular type may have around 20 percent of enzyme function. The other types of GSD IV are usually associated with between 5 and 20 percent of working enzyme. These estimates, however, vary among the different types.
Familial hemophagocytic lymphohistiocytosis. Familial hemophagocytic lymphohistiocytosis (FHL) is a disorder in which the immune system produces too many activated immune cells (lymphocytes), e.g., T cells, natural killer cells, B cells, and macrophages (histiocytes). Excessive amounts of cytokines are also produced. This overactivation of the immune system causes fever and damages the liver and spleen, resulting in enlargement of these organs.
Familial hemophagocytic lymphohistiocytosis also destroys blood-producing cells in the bone marrow, a process called hemophagocytosis. The brain may also be affected in familial hemophagocytic lymphohistiocytosis. In addition to neurological problems, familial hemophagocytic lymphohistiocytosis can cause abnormalities of the heart, kidneys, and other organs and tissues. Affected individuals also have an increased risk of developing cancers of blood-forming cells (leukemia and lymphoma).
Familial hemophagocytic lymphohistiocytosis may be caused by mutations in any of several genes. These genes provide instructions for making proteins that help destroy or deactivate lymphocytes that are no longer needed. By controlling the number of activated lymphocytes, these genes help regulate immune system function.
Approximately 40 to 60 percent of cases of familial hemophagocytic lymphohistiocytosis are caused by mutations in the PRF1 or UNC13D genes. Smaller numbers of cases are caused by mutations in other known genes such as STX11 or STXBP2. The gene mutations that cause familial hemophagocytic lymphohistiocytosis can impair the body's ability to regulate the immune system. These changes result in the exaggerated immune response characteristic of this condition.
Ornithine transcarbamylase deficiency. Ornithine transcarbamylase deficiency (OTC) is an inherited disorder that causes ammonia to accumulate in the blood.
Mutations in the OTC gene cause ornithine transcarbamylase deficiency.
Ornithine transcarbamylase deficiency belongs to a class of genetic diseases called urea cycle disorders. The urea cycle is a sequence of reactions that occurs in liver cells. It processes excess nitrogen, generated when protein is used by the body, to make a compound called urea that is excreted by the kidneys.
In ornithine transcarbamylase deficiency, the enzyme that starts a specific reaction within the urea cycle is damaged or missing. The urea cycle cannot proceed normally, and nitrogen accumulates in the bloodstream in the form of ammonia.
Ammonia is especially damaging to the nervous system, so ornithine transcarbamylase deficiency causes neurological problems as well as eventual damage to the liver.
Other urea cycle disorders and associate genes include, e.g., N-Acetylglutamate synthase deficiency (NAGS), Carbamoyl phosphate synthetase I deficiency (CPS1), “AS deficiency” or citrullinemia (ASS), “AL deficiency” or argininosuccinic aciduria (ASL), and “Arginase deficiency” or argininemia (ARG).
Primary hyperoxaluria. Primary hyperoxaluria, e.g., primary hyperoxaluria type 1 (PH1), is a rare, autosomal recessive inherited genetic condition in which an error in the glyoxylate metabolism pathway in the liver leads to an overproduction of oxalate, which crystalizes in soft tissues including the kidney, bone marrow, and eyes. The disease manifests as progressive deterioration of the kidneys, and treatment is a complicated double transplant of kidney (the damaged organ) and liver (the diseased organ).
Primary hyperoxaluria is caused by the deficiency of an enzyme that normally prevents the buildup of oxalate. There are two types of primary hyperoxaluria, distinguished by the enzyme that is deficient. People with type 1 primary hyperoxaluria have a shortage of a liver enzyme called alanine-glyoxylate aminotransferase (AGXT). Type 2 primary hyperoxaluria is characterized by a shortage of an enzyme called glyoxylate reductase/hydroxypyruvate reductase (GRHPR).
Mutations in the AGXT and GRHPR genes cause primary hyperoxaluria. The breakdown and processing of certain sugars and amino acids produces a glyoxylate. Normally, glyoxylate is converted to the amino acid glycine or to glycolate through the action of two enzymes, alanine-glyoxylate aminotransferase and glyoxylate reductase/hydroxypyruvate reductase, respectively. Mutations in the AGXT or GRHPR gene cause a shortage of these enzymes, which prevents the conversion of glyoxylate to glycine or glycolate. As levels of glyoxylate build up, it is converted to oxalate. Oxalate combines with calcium to form calcium oxalate deposits, which can damage the kidneys and other organs.
In an embodiment, the genetic defect in AGXT is corrected, e.g., by homologous recombination, using the Cas9 molecule and gRNA molecule described herein. For example, the functional enzyme encoded by the corrected AGXT gene can be redirected to its proper subcellular organelle. Though >50 mutations have been identified in the gene, the most common (40% in Caucasians) is a missense G170R mutation. This mutation causes the AGT enzyme to be localized to the mitochondria rather than to the peroxisome, where it must reside to perform its function. Other common mutations include, e.g., I244T (Canary Islands), F1521, G41R, G630A (Italy), and G588A (Italy).
In an embodiment, one or more genes encoding enzymes upstream in the glyoxylate metabolism pathway are targeted, using the Cas9 molecule and gRNA molecule described herein. Exemplary targets include, e.g., glycolate oxidase (gene HAO1, OMIM ID 605023). Glycolate oxidase converts glycolate into glyoxylate, the substrate for AGT. Glycolate oxidase is only expressed in the liver and, because of its peroxisomal localization, makes it a suitable target in this metabolic pathway. In an embodiment, a double-strand break in the HAO1 gene is introduced and upon repair by NHEJ a frame-shift results in a truncated protein. In an embodiment, a transcriptional repressor (e.g., a transcriptional repressor described herein) is delivered as a payload to the HAO1 gene to reduce the expression of HAO1.
Leber congenital amaurosis. Leber congenital amaurosis (LCA) is an eye disorder that primarily affects the retina. People with this disorder typically have severe visual impairment beginning in infancy. The visual impairment tends to be stable, although it may worsen very slowly over time. At least 13 types of Leber congenital amaurosis have been described. The types are distinguished by their genetic cause, patterns of vision loss, and related eye abnormalities.
Leber congenital amaurosis can result from mutations in at least 14 genes, all of which are necessary for normal vision. These genes play a variety of roles in the development and function of the retina. For example, some of the genes associated with this disorder are necessary for the normal development of photoreceptors. Other genes are involved in phototransduction. Still other genes play a role in the function of cilia, which are necessary for the perception of several types of sensory input, including vision.
Mutations in any of the genes associated with Leber congenital amaurosis (e.g., AIPL1, CEP290, CRB1, CRX, GUCY2D, IMPDH1, LCAS, LRAT, RD3, RDH12, RPE65, RPGRIP1, SPATA7, TULP1) can disrupt the development and function of the retina, resulting in early vision loss. Mutations in the CEP290, CRB1, GUCY2D, and RPE65 genes are the most common causes of the disorder, while mutations in the other genes generally account for a smaller percentage of cases.
Batten disease. Batten disease or juvenile Batten disease is an inherited disorder that primarily affects the nervous system. After a few years of normal development, children with this condition develop progressive vision loss, intellectual and motor disability, and seizures.
Juvenile Batten disease is one of a group of disorders known as neuronal ceroid lipofuscinoses (NCLs). These disorders all affect the nervous system and typically cause progressive problems with vision, movement, and thinking ability. Some people refer to the entire group of NCLs as Batten disease, while others limit that designation to the juvenile form of the disorder. The different types of NCLs are distinguished by the age at which signs and symptoms first appear.
Most cases of juvenile Batten disease are caused by mutations in the CLN3 gene. These mutations can disrupt the function of cellular structures called lysosomes. Lysosome malfunction leads to a buildup of lipopigments within these cell structures. These accumulations occur in cells throughout the body, but neurons in the brain seem to be particularly vulnerable to the damage caused by lipopigments. The progressive death of cells, especially in the brain, leads to vision loss, seizures, and intellectual decline in people with juvenile Batten disease.
A small percentage of cases of juvenile Batten disease are caused by mutations in other genes (e.g., ATP13A2, CLN5, PPT1, TPP1). Many of these genes are involved in lysosomal function, and when mutated, can cause this or other forms of NCL.
Chronic granulomatous disease. Chronic granulomatous disease is a disorder that causes the immune system to malfunction, resulting in a form of immunodeficiency. Individuals with chronic granulomatous disease have recurrent bacterial and fungal infections. People with this condition often have areas of inflammation (granulomas) in various tissues that can be damaging to those tissues. The features of chronic granulomatous disease usually first appear in childhood, although some individuals do not show symptoms until later in life.
Mutations in the CYBA, CYBB, NCF1, NCF2, or NCF4 gene can cause chronic granulomatous disease. There are five types of this condition that are distinguished by the gene that is involved. The proteins produced from the affected genes are subunits of NADPH oxidase, which plays an important role in the immune system. Specifically, NADPH oxidase is primarily active in phagocytes. Within phagocytes, NADPH oxidase is involved in the production of superoxide, which plays a role in killing foreign invaders and preventing them from reproducing in the body and causing illness. NADPH oxidase also regulates the activity of neutrophils, which play a role in adjusting the inflammatory response to optimize healing and reduce injury to the body.
Mutations in the CYBA, CYBB, NCF1, NCF2, and NCF4 genes result in the production of proteins with little or no function or the production of no protein at all. Without any one of its subunit proteins, NADPH oxidase cannot assemble or function properly. As a result, phagocytes are unable to kill foreign invaders and neutrophil activity is not regulated. A lack of NADPH oxidase leaves affected individuals vulnerable to many types of infection and excessive inflammation.
Wiskott-Aldrich syndrome. Wiskott-Aldrich syndrome is characterized by abnormal immune system function (immune deficiency) and a reduced ability to form blood clots. This condition primarily affects males. Individuals with Wiskott-Aldrich syndrome have microthrombocytopenia, which is a decrease in the number and size of blood cells involved in clotting (platelets), which can lead to easy bruising or episodes of prolonged bleeding following minor trauma. Wiskott-Aldrich syndrome causes many types of white blood cells to be abnormal or nonfunctional, leading to an increased risk of several immune and inflammatory disorders. Many people with this condition develop eczema, an inflammatory skin disorder characterized by abnormal patches of red, irritated skin. Affected individuals also have an increased susceptibility to infection. People with Wiskott-Aldrich syndrome are at greater risk of developing autoimmune disorders. The chance of developing some types of cancer, such as cancer of the immune system cells (lymphoma), is also greater in people with Wiskott-Aldrich syndrome.
Mutations in the WAS gene cause Wiskott-Aldrich syndrome. The WAS gene provides instructions for making WASP protein, which is found in all blood cells. WASP is involved in relaying signals from the surface of blood cells to the actin cytoskeleton. WASP signaling activates the cell when it is needed and triggers its movement and attachment to other cells and tissues (adhesion). In white blood cells, this signaling allows the actin cytoskeleton to establish the interaction between cells and the foreign invaders that they target (immune synapse).
WAS gene mutations that cause Wiskott-Aldrich syndrome lead to a lack of any functional WASP. Loss of WASP signaling disrupts the function of the actin cytoskeleton in developing blood cells. White blood cells that lack WASP have a decreased ability to respond to their environment and form immune synapses. As a result, white blood cells are less able to respond to foreign invaders, causing many of the immune problems related to Wiskott-Aldrich syndrome. Similarly, a lack of functional WASP in platelets impairs their development, leading to reduced size and early cell death.
Usher syndrome. Usher syndrome is a condition characterized by hearing loss or deafness and progressive vision loss. The loss of vision is caused by retinitis pigmentosa (RP), which affects the layer of light-sensitive tissue at the back of the eye (the retina). Vision loss occurs as the light-sensing cells of the retina gradually deteriorate.
Three major types of Usher syndrome, designated as types I (subtypes IA through IG), II (subtypes IIA, IIB, and IIC), and III, have been identified. These types are distinguished by their severity and the age when signs and symptoms appear.
Mutations in the CDH23, CLRN1, GPR98, MYO7A, PCDH15, USH1C, USH1G, and USH2A genes can cause Usher syndrome. The genes related to Usher syndrome provide instructions for making proteins that play important roles in normal hearing, balance, and vision. They function in the development and maintenance of hair cells, which are sensory cells in the inner ear that help transmit sound and motion signals to the brain. In the retina, these genes are also involved in determining the structure and function of light-sensing cells called rods and cones. In some cases, the exact role of these genes in hearing and vision is unknown. Most of the mutations responsible for Usher syndrome lead to a loss of hair cells in the inner ear and a gradual loss of rods and cones in the retina. Degeneration of these sensory cells causes hearing loss, balance problems, and vision loss characteristic of this condition.
Usher syndrome type I can result from mutations in the CDH23, MYO7A, PCDH15, USH1C, or USH1G gene. Usher syndrome type II can be caused by mutations in, e.g., USH2A or GPR98 (also called VLGR1) gene. Usher syndrome type III can be caused by mutations in e.g., CLRN1.
Hemoglobinopathies. Hemoglobinopathies are a group of genetic defects that result in abnormal structure of one of the globin chains of the hemoglobin molecule. Exemplary hemoglobinopathies include, e.g., sickle cell disease, alpha thalassemia, and beta thalassemia.
In an embodiment, a genetic defect in alpha globulin or beta globulin is corrected, e.g., by homologous recombination, using the Cas9 molecule and gRNA molecule described herein.
In an embodiment, a hemoglobinopathies-associated gene is targeted, using the Cas9 molecule and gRNA molecule described herein. Exemplary targets include, e.g., genes associated with control of the gamma-globin genes. In an embodiment, the target is BCL11A.
Fetal hemoglobin (also hemoglobin F or HbF or α2γ2) is a tetramer of two adult alpha-globin polypeptides and two fetal beta-like gamma-globin polypeptides. HbF is the main oxygen transport protein in the human fetus during the last seven months of development in the uterus and in the newborn until roughly 6 months old. Functionally, fetal hemoglobin differs most from adult hemoglobin in that it is able to bind oxygen with greater affinity than the adult form, giving the developing fetus better access to oxygen from the mother's bloodstream.
In newborns, fetal hemoglobin is nearly completely replaced by adult hemoglobin by approximately 6 months postnatally. In adults, fetal hemoglobin production can be reactivated pharmacologically, which is useful in the treatment of diseases such as hemoglobinopathies. For example, in certain patients with hemoglobinopathies, higher levels of gamma-globin expression can partially compensate for defective or impaired beta-globin gene production, which can ameliorate the clinical severity in these diseases. Increased HbF levels or F-cell (HbF containing erythrocyte) numbers can ameliorate the disease severity of hemoglobinopathies, e.g., beta-thalassemia major and sickle cell anemia.
Increased HbF levels or F-cell can be associated reduced BCL11A expression in cells. The BCL11A gene encodes a multi—zinc finger transcription factor. In an embodiment, the expression of BCL11A is modulated, e.g., down-regulated. In an embodiment, the BCL11A gene is edited. In an embodiment, the cell is a hemopoietic stem cell or progenitor cell.
Sickle Cell Diseases
Sickle cell disease is a group of disorders that affects hemoglobin. People with this disorder have atypical hemoglobin molecules (hemoglobin S), which can distort red blood cells into a sickle, or crescent, shape. Characteristic features of this disorder include a low number of red blood cells (anemia), repeated infections, and periodic episodes of pain.
Mutations in the HBB gene cause sickle cell disease. The HBB gene provides instructions for making beta-globin. Various versions of beta-globin result from different mutations in the HBB gene. One particular HBB gene mutation produces an abnormal version of beta-globin known as hemoglobin S (HbS). Other mutations in the HBB gene lead to additional abnormal versions of beta-globin such as hemoglobin C (HbC) and hemoglobin E (HbE). HBB gene mutations can also result in an unusually low level of beta-globin, i.e., beta thalassemia.
In people with sickle cell disease, at least one of the beta-globin subunits in hemoglobin is replaced with hemoglobin S. In sickle cell anemia, which is a common form of sickle cell disease, hemoglobin S replaces both beta-globin subunits in hemoglobin. In other types of sickle cell disease, just one beta-globin subunit in hemoglobin is replaced with hemoglobin S. The other beta-globin subunit is replaced with a different abnormal variant, such as hemoglobin C.
For example, people with sickle-hemoglobin C (HbSC) disease have hemoglobin molecules with hemoglobin S and hemoglobin C instead of beta-globin. If mutations that produce hemoglobin S and beta thalassemia occur together, individuals have hemoglobin S-beta thalassemia (HbSBetaThal) disease.
Alpha Thalassemia
Alpha thalassemia is a blood disorder that reduces the production of hemoglobin. In people with the characteristic features of alpha thalassemia, a reduction in the amount of hemoglobin prevents enough oxygen from reaching the body's tissues. Affected individuals also have a shortage of red blood cells (anemia), which can cause pale skin, weakness, fatigue, and more serious complications.
Two types of alpha thalassemia can cause health problems. The more severe type is hemoglobin Bart hydrops fetalis syndrome or Hb Bart syndrome. The milder form is HbH disease. Hb Bart syndrome is characterized, e.g., by hydrops fetalis, a condition in which excess fluid builds up in the body before birth. HbH disease can cause, e.g., mild to moderate anemia, hepatosplenomegaly, and yellowing of the eyes and skin (jaundice).
Alpha thalassemia typically results from deletions involving the HBA1 and HBA2 genes. Both of these genes provide instructions for making alpha-globin, which is a subunit of hemoglobin. The different types of alpha thalassemia result from the loss of some or all of these alleles.
Hb Bart syndrome can result from the loss of all four alpha-globin alleles. HbH disease can be caused by a loss of three of the four alpha-globin alleles. In these two conditions, a shortage of alpha-globin prevents cells from making normal hemoglobin. Instead, cells produce abnormal forms of hemoglobin, i.e., hemoglobin Bart (Hb Bart) or hemoglobin H (HbH), which cannot effectively carry oxygen to the body's tissues. The substitution of Hb Bart or HbH for normal hemoglobin can cause anemia and the other serious health problems associated with alpha thalassemia.
Two additional variants of alpha thalassemia are related to a reduced amount of alpha-globin. A loss of two of the four alpha-globin alleles can result in alpha thalassemia trait. People with alpha thalassemia trait may have unusually small, pale red blood cells and mild anemia. A loss of one alpha-globin allele can be found in alpha thalassemia silent carriers.
Beta Thalassemia
Beta thalassemia is a blood disorder that reduces the production of hemoglobin. In people with beta thalassemia, low levels of hemoglobin lead to a lack of oxygen in many parts of the body. Affected individuals also have a shortage of red blood cells (anemia), which can cause pale skin, weakness, fatigue, and more serious complications. People with beta thalassemia are at an increased risk of developing abnormal blood clots.
Beta thalassemia is classified into two types depending on the severity of symptoms: thalassemia major (also known as Cooley's anemia) and thalassemia intermedia. Of the two types, thalassemia major is more severe.
Mutations in the HBB gene cause beta thalassemia. The HBB gene provides instructions for making beta-globin. Some mutations in the HBB gene prevent the production of any beta-globin. The absence of beta-globin is referred to as beta-zero)(B° thalassemia. Other HBB gene mutations allow some beta-globin to be produced but in reduced amounts, i.e., beta-plus (Bk) thalassemia. People with both types have been diagnosed with thalassemia major and thalassemia intermedia.
In an embodiment, a Cas9 molecule/gRNA molecule complex targeting a first gene is used to treat a disorder characterized by second gene, e.g., a mutation in a second gene. By way of example, targeting of the first gene, e.g., by editing or payload delivery, can compensate for, or inhibit further damage from, the affect of a second gene, e.g., a mutant second gene. In an embodiment the allele(s) of the first gene carried by the subject is not causative of the disorder.
| TABLE IX-3 |
| Selected Disorders and Targets for Compensatory Targeting |
| Non- | Prevention of |
| Hodgkin's | organ | ||
| lymphoma, | transplant | ||
| Chronic | rejection, |
| Age-Related Macular | Atypical Hemolytic Uremic | lymphocytic | Rheumatoid | renal cell | |
| Indication | Degeneration | Syndrome | leukemia | Arthritis | carcinoma |
| Target | Factor H | C5 | Factor H | C5 | CD20 | CD21 | mTORC1 |
| Up- | up-regulate | down-regulate | up-regulate | down-regulate | down-regulate | down-regulate | down-regulate |
| regulate/ | |||||||
| Down- | |||||||
| regulate | |||||||
| Level of | animal | Factor H | Eculizumab/ | Rituxan | Rituxan | everolimus | |
| evidence: | models | concentrate | Soliris c5Ab | (Genentech) | (Genentech) | ||
| Market | (Alexion) | CD20 | CD20 | ||||
| proxy or | successful in | antibody | antibody | ||||
| animal | decreasing | ||||||
| model | mortality |
| Comment | Muti-genetic origin. Factor H | aHUS due to fH deficiency. | |||
| deficiency is a risk factor. | C5 antibody has been shown | ||||
| Controlling the complement | to vastly improve prognosis. | ||||
| cascade, through fH | Can approach disease directly | ||||
| upregulation or C5 | through increasing fH levels | ||||
| downregulation, may have a | or controlling complement | ||||
| beneficial effect. | through C5 downregulation. | ||||
| Devices: | |||||||
| stent, | |||||||
| pacemaker, | |||||||
| hernia mesh- | Graft | orthopedics- | |||||
| local delivery | healing/wound | articular | Barrett's | ||||
| to prevent | healing/ | cartilage | esophagus, | ||||
| restenosis/ | prevention of | repair, | Parkinson's | Allergic | Stomach | ||
| Indication | fibrosis | fibrosis | arthritis | Disease | rhinitis | Epilepsy | ulcer, gastritis |
| Target | mTORC2, | VEGF | IL-11 | SNCA, | H1 | H1 receptors | H2 receptor |
| others | LRRK2, | Receptors | CNS | pylorus, | |||
| EIF4GI | nasal | esophagus | |||||
| mucosa | |||||||
| Upregulate/ | down-regulate | up-regulate | up-regulate | up-regulate | down-regulate | up-regulate | down-regulate |
| Downregulate | or fix | ||||||
| mutations | |||||||
| Level of | everolimus | VEGF local | animal model | H1-anti- | animal | H2-specific | |
| evidence: | administration | of cartilage | histamines, | models | antihistamines, | ||
| Market | aids in | repair | e.g. Zyrtec | e.g. | |||
| proxy or | tracheal | omeprazole, | |||||
| animal | transplant | etc. | |||||
| model | animal | ||||||
| models | |||||||
| Comment | Embodiments | Useful, e.g., | In an | . | In an | ||
| include, e.g., | in the | embodiments, | embodiments, | ||||
| local delivery | promoting | the subject | the subject is | ||||
| to tissue via | wound | sufferes from | treated for | ||||
| device or | healing | arthritis or is | late-stage | ||||
| injection to | (burns, etc); | in need of | barrett's. | ||||
| prevent | Embodiments | healing after | |||||
| fibrosis, | include, e.g., | injury. In | |||||
| restenosis | local delivery | embodiments, | |||||
| of growth | chondrocytes | ||||||
| factors | are targeted | ||||||
| post-injury to | |||||||
| promote | |||||||
| healing. | |||||||
In an embodiment, Cas9 molecules, gRNA molecules, and/or Cas9 molecule/gRNA molecule complexes can be used to activate genes that regulate growth factors, such as up regulation of Epo to drive RBC production.
In an embodiment, Cas9 molecules, gRNA molecules, and/or Cas9 molecule/gRNA molecule complexes can be used to target, e.g., result in repression of, knockout of, or alteration of promoter for key transcription factors, such as BCL11A and KLF1 for up-regulating of fetal hemoglobin, e.g., for cure for sickle cell anemia and thalassemia.
Candidate Cas9 molecules, candidate gRNA molecules, and/or candidate Cas9 molecule/gRNA molecule complexes, as described herein, can be used to edit/correct a target gene or to deliver a regulator/effector inside cells, e.g., as described herein, at various subcellular locations. In an embodiment, the location is in the nucleus. In an embodiment, the location is in a sub-nuclear domain, e.g., the chromosome territories, nucleolus, nuclear speckles, Cajal bodies, Gems (gemini of Cajal bodies), or promyelocytic leukemia (PML) nuclear bodies. In an embodiment, the location is in the mitochondrion.
Candidate Cas9 molecules, candidate gRNA molecules, and/or candidate Cas9 molecule/gRNA molecule complexes, as described herein, can be used to edit/correct a target gene or to deliver a regulator/effector inside cells, as described herein, at various time points
For example, the editing/correction or delivery can occur at different phases of cell cycle, e.g., G0 phase, Interphase (e.g., G1 phase, S phase, G2 phase), or M phase. As another example, the editing/correction or delivery can occur at different stages of disease progression, e.g., at latent stage or active stage of a disorder (e.g., viral infection), or at any stage or subclassification of a disorder (e.g., cancer).
Methods of the invention allow for the treatment of a disorder characterized by unwanted cell proliferation, e.g., cancer. In an embodiment, cancer cells are manipulated to make them more susceptible to treatment or to endogenous immune surveillance. In an embodiment a cancer cell is modulated to make it more susceptible to a therapeutic. In an embodiment, a cancer cell is manipulated so as to increase the expression of a gene that increases the ability of the immune system to recognize or kill the cancer cell. E.g., a Cas9 molecule/gRNA molecule complex can be used to deliver a payload, or edit a target nucleic acid so as to increase the expression of an antigen, e.g., in the case where the cancer cell has downregulated expression of the antigen. In an embodiment, a payload, e.g., a payload comprising a transcription factor or other activator of expression is delivered to the cancer cell. In an embodiment, an increase in expression is effected by cleavage of the target nucleic acid, e.g., cleavage and correction or alteration of the target nucleic acid by a template nucleic acid. In an embodiment, a payload that overrides epigenetic silencing, e.g., a modulator of methylation, is delivered.
In an embodiment, the treatment further comprises administering a second anti-cancer therapy, e.g., immunotherapy, e.g., an antibody that binds the upregulated antigen.
In an embodiment, methods described herein, e.g., targeting of a genomic signature, e.g., a somatic translocation, can be used to target the Cas9 molecule/gRNA molecule to a cancer cell.
In another aspect, the invention features a method of immunizing a subject against an antigen. The method comprises using a method described herein to promote the expression of the antigen from a cell, e.g., a blood cell, such that the antigen promotes an immune response. In an embodiment, the cell is manipulated ex vivo and then returned or introduced into the subject.
Modified nucleosides and modified nucleotides can be present in nucleic acids, e.g., particularly gRNA, but also other forms of RNA, e.g., mRNA, RNAi, or siRNA. As described herein “nucleoside” is defined as a compound containing a five-carbon sugar molecule (a pentose or ribose) or derivative thereof, and an organic base, purine or pyrimidine, or a derivative thereof. As described herein, “nucleotide” is defined as a nucleoside further comprising a phosphate group.
Modified nucleosides and nucleotides can include one or more of:
(i) alteration, e.g., replacement, of one or both of the non-linking phosphate oxygens and/or of one or more of the linking phosphate oxygens in the phosphodiester backbone linkage;
(ii) alteration, e.g., replacement, of a constituent of the ribose sugar, e.g., of the 2′ hydroxyl on the ribose sugar;
(iii) wholesale replacement of the phosphate moiety with “dephospho” linkers;
(iv) modification or replacement of a naturally occurring nucleobase;
(v) replacement or modification of the ribose-phosphate backbone;
(vi) modification of the 3′ end or 5′ end of the oligonucleotide, e.g., removal, modification or replacement of a terminal phosphate group or conjugation of a moiety; and
(vii) modification of the sugar.
The modifications listed above can be combined to provide modified nucleosides and nucleotides that can have two, three, four, or more modifications. For example, a modified nucleoside or nucleotide can have a modified sugar and a modified nucleobase. In an embodiment, every nucleotide of a gRNA or template nucleic acid is modified, e.g., all nucleotides have a modified phosphate group, e.g., all are phosphorothioate groups. In an embodiment, all, or substantially all, of the phosphate groups of a unimolecular or modular gRNA molecule or template nucleic acid are replaced with phosphorothioate groups.
In an embodiment, modified nucleotides, e.g., nucleotides having modifications as described herein, can be incorporated into a nucleic acid, e.g., a “modified nucleic acid.” In an embodiment, the modified nucleic acids comprise one, two, three or more modified nucleotides. In an embodiment, at least 5% (e.g., at least about 5%, at least about 10%, at least about 15%, at least about 20%, at least about 25%, at least about 30%, at least about 35%, at least about 40%, at least about 45%, at least about 50%, at least about 55%, at least about 60%, at least about 65%, at least about 70%, at least about 75%, at least about 80%, at least about 85%, at least about 90%, at least about 95%, or about 100%) of the positions in a modified nucleic acid are a modified nucleotides.
Unmodified nucleic acids can be prone to degradation by, e.g., cellular nucleases. For example, nucleases can hydrolyze nucleic acid phosphodiester bonds. Accordingly, in one aspect the modified nucleic acids described herein can contain one or more modified nucleosides or nucleotides, e.g., to introduce stability toward nucleases.
In an embodiment, the modified nucleosides, modified nucleotides, and modified nucleic acids described herein can exhibit a reduced innate immune response when introduced into a population of cells, both in vivo and ex vivo. The term “innate immune response” includes a cellular response to exogenous nucleic acids, including single stranded nucleic acids, generally of viral or bacterial origin, which involves the induction of cytokine expression and release, particularly the interferons, and cell death. In an embodiment, the modified nucleosides, modified nucleotides, and modified nucleic acids described herein can disrupt binding of a major groove interacting partner with the nucleic acid. In an embodiment, the modified nucleosides, modified nucleotides, and modified nucleic acids described herein can exhibit a reduced innate immune response when introduced into a population of cells, both in vivo and ex vivo, and also disrupt binding of a major groove interacting partner with the nucleic acid.
In an embodiment, a governing gRNA comprises modifications, e.g., modified nucleotides, modifications to the backbone, and other modifications described herein.
In an embodiment, a template nucleic acid comprises modifications, e.g., modified nucleotides, modifications to the backbone, and other modifications described herein. In an embodiment, the modification improves the stability of the template nucleic acid, e.g., by increasing its resistance to endonucleases and/or exonucleases.
In an embodiment, a template nucleic acid that comprises modifications is double stranded, e.g., is double stranded DNA. In such embodiment, all the modifications are confined to one strand. In an embodiment, modifications are present on both strands. Modifications may be present in the 5′ homology arm, the 3′ homology arm, or the replacement sequence, or any combination thereof. In an embodiment, modifications are present in one or both homology arms but not the replacement sequence.
In an embodiment, a template nucleic acid that comprises modifications is single stranded, e.g., is single stranded DNA.
Definitions of Chemical Groups
As used herein, “alkyl” is meant to refer to a saturated hydrocarbon group which is straight-chained or branched. Example alkyl groups include methyl (Me), ethyl (Et), propyl (e.g., n-propyl and isopropyl), butyl (e.g., n-butyl, isobutyl, t-butyl), pentyl (e.g., n-pentyl, isopentyl, neopentyl), and the like. An alkyl group can contain from 1 to about 20, from 2 to about 20, from 1 to about 12, from 1 to about 8, from 1 to about 6, from 1 to about 4, or from 1 to about 3 carbon atoms.
As used herein, “aryl” refers to monocyclic or polycyclic (e.g., having 2, 3 or 4 fused rings) aromatic hydrocarbons such as, for example, phenyl, naphthyl, anthracenyl, phenanthrenyl, indanyl, indenyl, and the like. In an embodiment, aryl groups have from 6 to about 20 carbon atoms.
As used herein, “alkenyl” refers to an aliphatic group containing at least one double bond.
As used herein, “alkynyl” refers to a straight or branched hydrocarbon chain containing 2-12 carbon atoms and characterized in having one or more triple bonds. Examples of alkynyl groups include, but are not limited to, ethynyl, propargyl, and 3-hexynyl.
As used herein, “arylalkyl” or “aralkyl” refers to an alkyl moiety in which an alkyl hydrogen atom is replaced by an aryl group. Aralkyl includes groups in which more than one hydrogen atom has been replaced by an aryl group. Examples of “arylalkyl” or “aralkyl” include benzyl, 2-phenylethyl, 3-phenylpropyl, 9-fluorenyl, benzhydryl, and trityl groups.
As used herein, “cycloalkyl” refers to a cyclic, bicyclic, tricyclic, or polycyclic non-aromatic hydrocarbon groups having 3 to 12 carbons. Examples of cycloalkyl moieties include, but are not limited to, cyclopropyl, cyclopentyl, and cyclohexyl.
As used herein, “heterocyclyl” refers to a monovalent radical of a heterocyclic ring system. Representative heterocyclyls include, without limitation, tetrahydrofuranyl, tetrahydrothienyl, pyrrolidinyl, pyrrolidonyl, piperidinyl, pyrrolinyl, piperazinyl, dioxanyl, dioxolanyl, diazepinyl, oxazepinyl, thiazepinyl, and morpholinyl.
As used herein, “heteroaryl” refers to a monovalent radical of a heteroaromatic ring system. Examples of heteroaryl moieties include, but are not limited to, imidazolyl, oxazolyl, thiazolyl, triazolyl, pyrrolyl, furanyl, indolyl, thiophenyl pyrazolyl, pyridinyl, pyrazinyl, pyridazinyl, pyrimidinyl, indolizinyl, purinyl, naphthyridinyl, quinolyl, and pteridinyl.
Phosphate Backbone Modifications The Phosphate Group In an embodiment, the phosphate group of a modified nucleotide can be modified by replacing one or more of the oxygens with a different substituent. Further, the modified nucleotide, e.g., modified nucleotide present in a modified nucleic acid, can include the wholesale replacement of an unmodified phosphate moiety with a modified phosphate as described herein. In an embodiment, the modification of the phosphate backbone can include alterations that result in either an uncharged linker or a charged linker with unsymmetrical charge distribution.
Examples of modified phosphate groups include, phosphorothioate, phosphoroselenates, borano phosphates, borano phosphate esters, hydrogen phosphonates, phosphoroamidates, alkyl or aryl phosphonates and phosphotriesters. In an embodiment, one of the non-bridging phosphate oxygen atoms in the phosphate backbone moiety can be replaced by any of the following groups: sulfur (S), selenium (Se), BR3 (wherein R can be, e.g., hydrogen, alkyl, or aryl), C (e.g., an alkyl group, an aryl group, and the like), H, NR2 (wherein R can be, e.g., hydrogen, alkyl, or aryl), or OR (wherein R can be, e.g., alkyl or aryl). The phosphorous atom in an unmodified phosphate group is achiral. However, replacement of one of the non-bridging oxygens with one of the above atoms or groups of atoms can render the phosphorous atom chiral; that is to say that a phosphorous atom in a phosphate group modified in this way is a stereogenic center. The stereogenic phosphorous atom can possess either the “R” configuration (herein Rp) or the “S” configuration (herein Sp).
Phosphorodithioates have both non-bridging oxygens replaced by sulfur. The phosphorus center in the phosphorodithioates is achiral which precludes the formation of oligoribonucleotide diastereomers. In an embodiment, modifications to one or both non-bridging oxygens can also include the replacement of the non-bridging oxygens with a group independently selected from S, Se, B, C, H, N, and OR (R can be, e.g., alkyl or aryl).
The phosphate linker can also be modified by replacement of a bridging oxygen, (i.e., the oxygen that links the phosphate to the nucleoside), with nitrogen (bridged phosphoroamidates), sulfur (bridged phosphorothioates) and carbon (bridged methylenephosphonates). The replacement can occur at either linking oxygen or at both of the linking oxygens.
Replacement of the Phosphate Group
The phosphate group can be replaced by non-phosphorus containing connectors. In an embodiment, the charge phosphate group can be replaced by a neutral moiety.
Examples of moieties which can replace the phosphate group can include, without limitation, e.g., methyl phosphonate, hydroxylamino, siloxane, carbonate, carboxymethyl, carbamate, amide, thioether, ethylene oxide linker, sulfonate, sulfonamide, thioformacetal, formacetal, oxime, methyleneimino, methylenemethylimino, methylenehydrazo, methylenedimethylhydrazo and methyleneoxymethylimino.
Replacement of the Ribophosphate Backbone
Scaffolds that can mimic nucleic acids can also be constructed wherein the phosphate linker and ribose sugar are replaced by nuclease resistant nucleoside or nucleotide surrogates. In an embodiment, the nucleobases can be tethered by a surrogate backbone. Examples can include, without limitation, the morpholino, cyclobutyl, pyrrolidine and peptide nucleic acid (PNA) nucleoside surrogates.
Sugar Modifications
The modified nucleosides and modified nucleotides can include one or more modifications to the sugar group. For example, the 2′ hydroxyl group (OH) can be modified or replaced with a number of different “oxy” or “deoxy” substituents. In an embodiment, modifications to the 2′ hydroxyl group can enhance the stability of the nucleic acid since the hydroxyl can no longer be deprotonated to form a 2′-alkoxide ion. The 2′-alkoxide can catalyze degradation by intramolecular nucleophilic attack on the linker phosphorus atom.
Examples of “oxy”-2′ hydroxyl group modifications can include alkoxy or aryloxy (OR, wherein “R” can be, e.g., alkyl, cycloalkyl, aryl, aralkyl, heteroaryl or a sugar); polyethyleneglycols (PEG), O(CH2CH2O)nCH2CH2OR wherein R can be, e.g., H or optionally substituted alkyl, and n can be an integer from 0 to 20 (e.g., from 0 to 4, from 0 to 8, from 0 to 10, from 0 to 16, from 1 to 4, from 1 to 8, from 1 to 10, from 1 to 16, from 1 to 20, from 2 to 4, from 2 to 8, from 2 to 10, from 2 to 16, from 2 to 20, from 4 to 8, from 4 to 10, from 4 to 16, and from 4 to 20). In an embodiment, the “oxy”-2′ hydroxyl group modification can include “locked” nucleic acids (LNA) in which the 2′ hydroxyl can be connected, e.g., by a C1-6 alkylene or C1-6 heteroalkylene bridge, to the 4′ carbon of the same ribose sugar, where exemplary bridges can include methylene, propylene, ether, or amino bridges; O-amino (wherein amino can be, e.g., NH2; alkylamino, dialkylamino, heterocyclyl, arylamino, diarylamino, heteroarylamino, or diheteroarylamino, ethylenediamine, or polyamino) and aminoalkoxy, O(CH2)n-amino, (wherein amino can be, e.g., NH2; alkylamino, dialkylamino, heterocyclyl, arylamino, diarylamino, heteroarylamino, or diheteroarylamino, ethylenediamine, or polyamino). In an embodiment, the “oxy”-2′ hydroxyl group modification can include the methoxyethyl group (MOE), (OCH2CH2OCH3, e.g., a PEG derivative).
“Deoxy” modifications can include hydrogen (i.e. deoxyribose sugars, e.g., at the overhang portions of partially ds RNA); halo (e.g., bromo, chloro, fluoro, or iodo); amino (wherein amino can be, e.g., NH2; alkylamino, dialkylamino, heterocyclyl, arylamino, diarylamino, heteroarylamino, diheteroarylamino, or amino acid); NH(CH2CH2NH)nCH2CH2-amino (wherein amino can be, e.g., as described herein), —NHC(O)R (wherein R can be, e.g., alkyl, cycloalkyl, aryl, aralkyl, heteroaryl or sugar), cyano; mercapto; alkyl-thio-alkyl; thioalkoxy; and alkyl, cycloalkyl, aryl, alkenyl and alkynyl, which may be optionally substituted with e.g., an amino as described herein.
The sugar group can also contain one or more carbons that possess the opposite stereochemical configuration than that of the corresponding carbon in ribose. Thus, a modified nucleic acid can include nucleotides containing e.g., arabinose, as the sugar. The nucleotide “monomer” can have an alpha linkage at the 1′ position on the sugar, e.g., alpha-nucleosides. The modified nucleic acids can also include “abasic” sugars, which lack a nucleobase at C-1′. These abasic sugars can also be further modified at one or more of the constituent sugar atoms. The modified nucleic acids can also include one or more sugars that are in the L form, e.g. L-nucleosides.
Generally, RNA includes the sugar group ribose, which is a 5-membered ring having an oxygen. Exemplary modified nucleosides and modified nucleotides can include, without limitation, replacement of the oxygen in ribose (e.g., with sulfur (S), selenium (Se), or alkylene, such as, e.g., methylene or ethylene); addition of a double bond (e.g., to replace ribose with cyclopentenyl or cyclohexenyl); ring contraction of ribose (e.g., to form a 4-membered ring of cyclobutane or oxetane); ring expansion of ribose (e.g., to form a 6- or 7-membered ring having an additional carbon or heteroatom, such as for example, anhydrohexitol, altritol, mannitol, cyclohexanyl, cyclohexenyl, and morpholino that also has a phosphoramidate backbone). In an embodiment, the modified nucleotides can include multicyclic forms (e.g., tricyclo; and “unlocked” forms, such as glycol nucleic acid (GNA) (e.g., R-GNA or S-GNA, where ribose is replaced by glycol units attached to phosphodiester bonds), threose nucleic acid (TNA, where ribose is replaced with α-L-threofuranosyl-(3′→2′)).
Modifications on the Nucleobase
The modified nucleosides and modified nucleotides described herein, which can be incorporated into a modified nucleic acid, can include a modified nucleobase. Examples of nucleobases include, but are not limited to, adenine (A), guanine (G), cytosine (C), and uracil (U). These nucleobases can be modified or wholly replaced to provide modified nucleosides and modified nucleotides that can be incorporated into modified nucleic acids. The nucleobase of the nucleotide can be independently selected from a purine, a pyrimidine, a purine or pyrimidine analog. In an embodiment, the nucleobase can include, for example, naturally-occurring and synthetic derivatives of a base.
Uracil
In an embodiment, the modified nucleobase is a modified uracil. Exemplary nucleobases and nucleosides having a modified uracil include without limitation pseudouridine (w), pyridin-4-one ribonucleoside, 5-aza-uridine, 6-aza-uridine, 2-thio-5-aza-uridine, 2-thio-uridine (s2U), 4-thio-uridine (s4U), 4-thio-pseudouridine, 2-thio-pseudouridine, 5-hydroxy-uridine (ho5U), 5-aminoallyl-uridine, 5-halo-uridine (e.g., 5-iodo-uridine or 5-bromo-uridine), 3-methyl-uridine (m3U), 5-methoxy-uridine (mo5U), uridine 5-oxyacetic acid (cmo5U), uridine 5-oxyacetic acid methyl ester (mcmo5U), 5-carboxymethyl-uridine (cm5U), 1-carboxymethyl-pseudouridine, 5-carboxyhydroxymethyl-uridine (chm5U), 5-carboxyhydroxymethyl-uridine methyl ester (mchm5U), 5-methoxycarbonylmethyl-uridine (mcm5U), 5-methoxycarbonylmethyl-2-thio-uridine (mcm5s2U), 5-aminomethyl-2-thio-uridine (nm5s2U), 5-methylaminomethyl-uridine (mnm5U), 5-methylaminomethyl-2-thio-uridine (mnm5s2U), 5-methylaminomethyl-2-seleno-uridine (mnm5se2U), 5-carbamoylmethyl-uridine (ncm5U), 5-carboxymethylaminomethyl-uridine (cmnm5U), 5-carboxymethylaminomethyl-2-thio-uridine (cmnm5s2U), 5-propynyl-uridine, 1-propynyl-pseudouridine, 5-taurinomethyl-uridine (τcm5U), 1-taurinomethyl-pseudouridine, 5-taurinomethyl-2-thio-uridine(τm5s2U), 1-taurinomethyl-4-thio-pseudouridine, 5-methyl-uridine (m5U, i.e., having the nucleobase deoxythymine), 1-methyl-pseudouridine (m1ψ), 5-methyl-2-thio-uridine (m5s2U), 1-methyl-4-thio-pseudouridine (m1s4ψ), 4-thio-1-methyl-pseudouridine, 3-methyl-pseudouridine (m3ψ), 2-thio-1-methyl-pseudouridine, 1-methyl-1-deaza-pseudouridine, 2-thio-1-methyl-1-deaza-pseudouridine, dihydrouridine (D), dihydropseudouridine, 5,6-dihydrouridine, 5-methyl-dihydrouridine (m5D), 2-thio-dihydrouridine, 2-thio-dihydropseudouridine, 2-methoxy-uridine, 2-methoxy-4-thio-uridine, 4-methoxy-pseudouridine, 4-methoxy-2-thio-pseudouridine, N1-methyl-pseudouridine, 3-(3-amino-3-carboxypropyl)uridine (acp3U), 1-methyl-3-(3-amino-3-carboxypropyl)pseudouridine (acp3ψ), 5-(isopentenylaminomethyl)uridine (inm5U), 5-(isopentenylaminomethyl)-2-thio-uridine (inm5s2U), α-thio-uridine, 2′-O-methyl-uridine (Um), 5,2′-O-dimethyl-uridine (m5Um), 2′-O-methyl-pseudouridine (ψm), 2-thio-2′-O-methyl-uridine (s2Um), 5-methoxycarbonylmethyl-2′-O-methyl-uridine (mcm 5Um), 5-carbamoylmethyl-T-O-methyl-uridine (ncm 5Um), 5-carboxymethylaminomethyl-2′-O-methyl-uridine (cmnm 5Um), 3,2′-O-dimethyl-uridine (m3Um), 5-(isopentenylaminomethyl)-2′-O-methyl-uridine (inm5Um), 1-thio-uridine, deoxythymidine, 2′-F-ara-uridine, 2′-F-uridine, 2′-OH-ara-uridine, 5-(2-carbomethoxyvinyl) uridine, 5-[3-(1-E-propenylamino)uridine, pyrazolo[3,4-d[pyrimidines, xanthine, and hypoxanthine.
Cytosine
In an embodiment, the modified nucleobase is a modified cytosine. Exemplary nucleobases and nucleosides having a modified cytosine include without limitation 5-aza-cytidine, 6-aza-cytidine, pseudoisocytidine, 3-methyl-cytidine (m3C), N4-acetyl-cytidine (act), 5-formyl-cytidine (f5C), N4-methyl-cytidine (m4C), 5-methyl-cytidine (m5C), 5-halo-cytidine (e.g., 5-iodo-cytidine), 5-hydroxymethyl-cytidine (hm5C), 1-methyl-pseudoisocytidine, pyrrolo-cytidine, pyrrolo-pseudoisocytidine, 2-thio-cytidine (s2C), 2-thio-5-methyl-cytidine, 4-thio-pseudoisocytidine, 4-thio-1-methyl-pseudoisocytidine, 4-thio-1-methyl-1-deaza-pseudoisocytidine, 1-methyl-1-deaza-pseudoisocytidine, zebularine, 5-aza-zebularine, 5-methyl-zebularine, 5-aza-2-thio-zebularine, 2-thio-zebularine, 2-methoxy-cytidine, 2-methoxy-5-methyl-cytidine, 4-methoxy-pseudoisocytidine, 4-methoxy-1-methyl-pseudoisocytidine, lysidine (k2C), α-thio-cytidine, 2′-O-methyl-cytidine (Cm), 5,2′-O-dimethyl-cytidine (m5Cm), N4-acetyl-2′-O-methyl-cytidine (ac4Cm), N4,2′-O-dimethyl-cytidine (m4Cm), 5-formyl-2′-O-methyl-cytidine (f 5Cm), N4,N4,2′-O-trimethyl-cytidine (m42Cm), 1-thio-cytidine, 2′-F-ara-cytidine, 2′-F-cytidine, and 2′-OH-ara-cytidine.
Adenine
In an embodiment, the modified nucleobase is a modified adenine. Exemplary nucleobases and nucleosides having a modified adenine include without limitation 2-amino-purine, 2,6-diaminopurine, 2-amino-6-halo-purine (e.g., 2-amino-6-chloro-purine), 6-halo-purine (e.g., 6-chloro-purine), 2-amino-6-methyl-purine, 8-azido-adenosine, 7-deaza-adenine, 7-deaza-8-aza-adenine, 7-deaza-2-amino-purine, 7-deaza-8-aza-2-amino-purine, 7-deaza-2,6-diaminopurine, 7-deaza-8-aza-2,6-diaminopurine, 1-methyl-adenosine (m1A), 2-methyl-adenine (m2A), N6-methyl-adenosine (m6A), 2-methylthio-N6-methyl-adenosine (ms2 m6A), N6-isopentenyl-adenosine (i6A), 2-methylthio-N6-isopentenyl-adenosine (ms2i6A), N6-(cis-hydroxyisopentenyl)adenosine (io6A), 2-methylthio-N6-(cis-hydroxyisopentenyl)adenosine (ms2io6A), N6-glycinylcarbamoyl-adenosine (g6A), N6-threonylcarbamoyl-adenosine (t6A), N6-methyl-N6-threonylcarbamoyl-adenosine (m6t6A), 2-methylthio-N6-threonylcarbamoyl-adenosine (ms2g6A), N6,N6-dimethyl-adenosine (m62A), N6-hydroxynorvalylcarbamoyl-adenosine (hn6A), 2-methylthio-N6-hydroxynorvalylcarbamoyl-adenosine (ms2hn6A), N6-acetyl-adenosine (ac6A), 7-methyl-adenine, 2-methylthio-adenine, 2-methoxy-adenine, α-thio-adenosine, 2′-O-methyl-adenosine (Am), N6,2′-O-dimethyl-adenosine (m6Am), N6-Methyl-T-deoxyadenosine, N6,N6,2′-O-trimethyl-adenosine (m62Am), 1,2′-O-dimethyl-adenosine (m1Am), 2′-O-ribosyladenosine (phosphate) (Ar(p)), 2-amino-N6-methyl-purine, 1-thio-adenosine, 8-azido-adenosine, 2′-F-ara-adenosine, 2′-F-adenosine, 2′-OH-ara-adenosine, and N6-(19-amino-pentaoxanonadecyl)-adenosine.
Guanine
In an embodiment, the modified nucleobase is a modified guanine. Exemplary nucleobases and nucleosides having a modified guanine include without limitation inosine (I), 1-methyl-inosine (m1I), wyosine (imG), methylwyosine (mimG), 4-demethyl-wyosine (imG-14), isowyosine (imG2), wybutosine (yW), peroxywybutosine (o2yW), hydroxywybutosine (OHyW), undermodified hydroxywybutosine (OHyW*), 7-deaza-guanosine, queuosine (Q), epoxyqueuosine (oQ), galactosyl-queuosine (galQ), mannosyl-queuosine (manQ), 7-cyano-7-deaza-guanosine (preQ0), 7-aminomethyl-7-deaza-guanosine (preQ1), archaeosine (G+), 7-deaza-8-aza-guanosine, 6-thio-guanosine, 6-thio-7-deaza-guanosine, 6-thio-7-deaza-8-aza-guanosine, 7-methyl-guanosine (m7G), 6-thio-7-methyl-guanosine, 7-methyl-inosine, 6-methoxy-guanosine, 1-methyl-guanosine (m′G), N2-methyl-guanosine (m2G), N2,N2-dimethyl-guanosine (m2 2 G), N2,7-dimethyl-guanosine (m2,7G), N2, N2,7-dimethyl-guanosine (m2,2,7G), 8-oxo-guanosine, 7-methyl-8-oxo-guanosine, 1-meth thio-guanosine, N2-methyl-6-thio-guanosine, N2,N2-dimethyl-6-thio-guanosine, α-thio-guanosine, 2′-O-methyl-guanosine (Gm), N2-methyl-2′-O-methyl-guanosine (m2Gm), N2,N2-dimethyl-2′-O-methyl-guanosine (m2 2 Gm), 1-methyl-2′-O-methyl-guanosine (m′Gm), N2,7-dimethyl-2′-O-methyl-guanosine (m2,7Gm), 2′-O-methyl-inosine (Im), 1,2′-O-dimethyl-inosine (m′Im), O6-phenyl-2′-deoxyinosine, 2′-O-ribosylguanosine (phosphate) (Gr(p)), 1-thio-guanosine, O6-methyl-guanosine, O6-Methyl-2′-deoxyguanosine, 2′-F-ara-guanosine, and 2′-F-guanosine.
Modified gRNAs
In an embodiment, the modified nucleic acids can be modified gRNAs. In an embodiment, gRNAs can be modified at the 3′ end. In this embodiment, the gRNAs can be modified at the 3′ terminal U ribose. For example, the two terminal hydroxyl groups of the U ribose can be oxidized to aldehyde groups and a concomitant opening of the ribose ring to afford a modified nucleoside as sown below:
wherein “U” can be an unmodified or modified uridine.
In another embodiment, the 3′ terminal U can be modified with a 2′3′ cyclic phosphate as shown below:
wherein “U” can be an unmodified or modified uridine.
In an embodiment, the gRNA molecules may contain 3′ nucleotides which can be stabilized against degradation, e.g., by incorporating one or more of the modified nucleotides described herein. In this embodiment, e.g., uridines can be replaced with modified uridines, e.g., 5-(2-amino)propyl uridine, and 5-bromo uridine, or with any of the modified uridines described herein; adenosines and guanosines can be replaced with modified adenosines and guanosines, e.g., with modifications at the 8-position, e.g., 8-bromo guanosine, or with any of the modified adenosines or guanosines described herein. In an embodiment, deaza nucleotides, e.g., 7-deaza-adenosine, can be incorporated into the gRNA. In an embodiment, 0- and N-alkylated nucleotides, e.g., N6-methyl andenosine, can be incorporated into the gRNA. In an embodiment, sugar-modified ribonucleotides can be incorporated, e.g., wherein the 2′ OH-group is replaced by a group selected from H, —OR, —R (wherein R can be, e.g., alkyl, cycloalkyl, aryl, aralkyl, heteroaryl or sugar), halo, —SH, —SR (wherein R can be, e.g., alkyl, cycloalkyl, aryl, aralkyl, heteroaryl or sugar), amino (wherein amino can be, e.g., NH2; alkylamino, dialkylamino, heterocyclyl, arylamino, diarylamino, heteroarylamino, diheteroarylamino, or amino acid); or cyano (—CN). In an embodiment, the phosphate backbone can be modified as described herein, e.g., with a phosphothioate group. In an embodiment, the nucleotides in the overhang region of the gRNA can each independently be a modified or unmodified nucleotide including, but not limited to 2′-sugar modified, such as, 2-F 2′-O-methyl, thymidine (T), 2′-O-methoxyethyl-5-methyluridine (Teo), 2′-O-methoxyethyladenosine (Aeo), 2′-O-methoxyethyl-5-methylcytidine (m5Ceo), and any combinations thereof.
In an embodiment, a one or more or all of the nucleotides in single stranded overhang of an RNA molecule, e.g., a gRNA molecule, are deoxynucleotides.
In an embodiment, the payload can be linked to the Cas9 molecules or the gRNA, e.g., by a covalent linker. This linker may be cleavable or non-cleavable. In an embodiment, a cleavable linker may be used to release the payload after transport to the desired target.
Linkers can comprise a direct bond or an atom such as, e.g., an oxygen (O) or sulfur (S), a unit such as —NR— wherein R is hydrogen or alkyl, —C(O)—, —C(O)O—, —C(O)NH—, SO, SO2, —SO2NH— or a chain of atoms, such as substituted or unsubstituted alkyl, substituted or unsubstituted alkenyl, substituted or unsubstituted alkynyl, arylalkyl, heteroarylalkyl. In an embodiment, one or more methylenes in the chain of atoms can be replaced with one or more of O, S, S(O), SO2, —SO2NH—, —NR—, —C(O)—, —C(O)O—, —C(O)NH—, a cleavable linking group, substituted or unsubstituted aryl, substituted or unsubstituted heteroaryl, and substituted or unsubstituted heterocyclic.
Non-Cleavable Linkages
In an embodiment, the payload is attached to the Cas9 molecule or gRNA through a linker that is itself is stable under physiological conditions, such as an alkylene chain, and does not result in release of the payload from the Cas9 molecule and/or gRNA for at least 2, 3, 4, 5, 10, 15, 24 or 48 hours or for at least 1, 2, 3, 4, 5, or 10 days when administered to a subject. In an embodiment, the payload and the Cas9 molecule and/or gRNA comprise residues of a functional groups through which reaction and linkage of the payload to the Cas9 molecule or gRNA was achieved. In an embodiment, the functional groups, which may be the same or different, terminal or internal, of the payload or Cas9molecule and/or gRNA comprise an amino, acid, imidazole, hydroxyl, thio, acyl halide, —HC═CH—, —C≡C— group, or derivative thereof. In an embodiment, the linker comprises a hydrocarbylene group wherein one or more methylene groups is optionally replaced by a group Y (provided that none of the Y groups are adjacent to each other), wherein each Y, independently for each occurrence, is selected from, substituted or unsubstituted aryl, heteroaryl, cycloalkyl, heterocycloalkyl, or —O—, —C(═X)— (wherein X is NR1, O or S), —NR1—, —NR1C(O)—, —C(O)NR1—, —S(O)n—, —NR1S(O)n—, —S(O),NR1—, —NR1C(O)—NR1—; and R1, independently for each occurrence, represents H or a lower alkyl and wherein n is 0, 1, or 2.
In an embodiment, the linker comprises an alkylene moiety or a heteroalkylene moiety (e.g., an alkylene glycol moiety such as ethylene glycol). In an embodiment, a linker comprises a poly-L-glutamic acid, polylactic acid, poly(ethyleneimine), an oligosaccharide, an amino acid (e.g., glycine), an amino acid chain, or any other suitable linkage. The linker groups can be biologically inactive, such as a PEG, polyglycolic acid, or polylactic acid chain. In an embodiment, the linker group represents a derivatized or non-derivatized amino acid (e.g., glycine).
Cleavable Linkages
A cleavable linking group is one which is sufficiently stable outside the cell, but which upon entry into a target cell is cleaved to release the two parts the linker is holding together. In one embodiment, the cleavable linking group is cleaved at least 10 times or more, or at least 100 times faster in the target cell or under a first reference condition (which can, e.g., be selected to mimic or represent intracellular conditions) than in the blood of a subject, or under a second reference condition (which can, e.g., be selected to mimic or represent conditions found in the blood or serum).
Cleavable linking groups are susceptible to cleavage agents, e.g., pH, redox potential or the presence of degradative molecules. Examples of such degradative agents include: redox agents which are selected for particular substrates or which have no substrate specificity, including, e.g., oxidative or reductive enzymes or reductive agents such as mercaptans, present in cells, that can degrade a redox cleavable linking group by reduction; esterases; endosomes or agents that can create an acidic environment, e.g., those that result in a pH of five or lower; enzymes that can hydrolyze or degrade an acid cleavable linking group by acting as a general acid, peptidases (which can be substrate specific), and phosphatases.
A cleavable linkage group, such as a disulfide bond (—S—S—) can be susceptible to pH. The pH of human serum is 7.4, while the average intracellular pH is slightly lower, ranging from about 7.1-7.3. Endosomes have a more acidic pH, in the range of 5.5-6.0, and lysosomes have an even more acidic pH at around 5.0. Some linkers will have a cleavable linking group that is cleaved at a preferred pH. A linker can include a cleavable linking group that is cleavable by a particular enzyme.
In general, the suitability of a candidate cleavable linking group can be evaluated by testing the ability of a degradative agent (or condition) to cleave the candidate linking group. The candidate cleavable linking group can also be tested for the ability to resist cleavage in the blood or when in contact with other non-target tissue. Thus one can determine the relative susceptibility to cleavage between a first and a second condition, where the first is selected to be indicative of cleavage in a target cell and the second is selected to be indicative of cleavage in other tissues or biological fluids, e.g., blood or serum. The evaluations can be carried out in cell free systems, in cells, in cell culture, in organ or tissue culture, or in whole animals. It may be useful to make initial evaluations in cell-free or culture conditions and to confirm by further evaluations in whole animals.
In an embodiment, the cleavable linkers include redox cleavable linkers, such as a disulfide group (—S—S—) and phosphate cleavable linkers, such as, e.g., —O—P(O)(OR)—O—, —O—P(S)(OR)—O—, —O—P(S)(SR)—O—, —S—P(O)(OR)—O—, —O—P(O)(OR)—S—, —S—P(O)(OR)—S—, —O—P(S)(OR)—S—, —S—P(S)(OR)—O—, —O—P(O)(R)—O—, —O—P(S)(R)—O—, —S—P(O)(R)—O—, —S—P(S)(R)—O—, —S—P(O)(R)—S—, —OP(S)(R)—S—, wherein R is hydrogen or alkyl.
Acid Cleavable Linking Groups
Acid cleavable linking groups are linking groups that are cleaved under acidic conditions. In an embodiment, acid cleavable linking groups are cleaved in an acidic environment with a pH of about 6.5 or lower (e.g., about 6.0, 5.5, 5.0, or lower), or by agents such as enzymes that can act as a general acid. Examples of acid cleavable linking groups include but are not limited to hydrazones, esters, and esters of amino acids. Acid cleavable groups can have the general formula —C(═N—)N—, —C(O)O—, or —OC(O)—.
Ester-Based Linking Groups
Ester-based cleavable linking groups are cleaved by enzymes such as esterases and amidases in cells. Examples of ester-based cleavable linking groups include but are not limited to esters of alkylene, alkenylene and alkynylene groups. Ester cleavable linking groups have the general formula —C(O)O—, or —OC(O)—.
Cas9 molecules, gRNA molecules, and in particular, Cas9 molecule/gRNA molecule complexes, can be used to target a cell by virtue of sequence specific interaction with a target nucleic acid comprising a selected genomic signature. This provides for targeted destruction of cells having a selected genomic signature. Method and compositions disclosed herein can be used to treat disorders characterized by a selected genomic signature, e.g., a genomic signature present in the germline or a genomic signature that arise as a result of a sporadic or somatic change in the genome, e.g., a germline or acquired mutation in a cancer cell, a viral infection, or other germline or acquired changes to the genome.
While not wishing to be bound by theory, it is believed that complementarity between the targeting domain of a gRNA molecule and the target sequence of a target nucleic acid mediates target sequence-specific interaction of the Cas9 molecule/gRNA molecule complex with the target sequence. This allows targeting of specific sequences or genomic signatures, e.g., rearrangements, e.g., translocations, insertions, deletions, and inversions, and other mutations. A Cas9 molecule/gRNA molecule complex can be used to target specific sequence, e.g., mutations, that are germline, mitochondrial, or somatic. Depending on the Cas9 molecule/gRNA molecule complex used, specific editing, the delivery of a payload, or both, can be effected. In an embodiment, both cleavage and delivery of a payload is effected.
In an embodiment, the Cas9 molecule/gRNA molecule complex that promotes cell death upon recognition of its target genomic sequence. In an embodiment, an eaCas9 molecule/gRNA molecule complex cleaves the target nucleic acid. In an embodiment, it does not deliver a payload. While not wishing to be bound by theory is it believed that endogenous cellular elements, e.g., elements of the DNA damage apoptosis signaling cascade promote apoptosis in these embodiments.
In an embodiment, an eaCas9 molecule/gRNA molecule complex cleaves the target nucleic acid and delivers a payload. The payload can comprises a compound that inhibits growth or cell division, or promotes apoptosis, e.g., an element of the DNA damage apoptosis signaling cascade. In an embodiment, a second Cas9 molecule/gRNA molecule complex is used to deliver a payload comprising a second compound that inhibits growth or cell division, or promotes apoptosis, e.g., an element of the DNA damage apoptosis signaling cascade. The Cas9 molecule/gRNA molecule complex that delivers the second payload can comprise an eiCas9 molecule or an eaCas9 molecule. An additional, e.g., third or fourth, Cas9 molecule/gRNA molecule complex, can be used to deliver additional payload, e.g., an additional compound that inhibits growth or cell division, or promotes apoptosis, e.g., an additional element of the DNA damage apoptosis signaling cascade promote.
In an embodiment, the Cas9 molecule/gRNA molecule complex delivers a payload comprising a compound that inhibits growth or cell division, or promotes apoptosis, e.g., an element of the DNA damage apoptosis signaling cascade, but does not cleave the target nucleic acid. While not wishing to be bound by theory is it believed that endogenous cellular elements, e.g., elements of the DNA damage apoptosis signaling cascade promote apoptosis in these embodiments.
Exemplary compounds that inhibit growth or cell division, or promote apoptosis, e.g., an element of the DNA damage apoptosis signaling cascade, are described herein, e.g., in Table XII-1.
| TABLE XII-1 |
| ATM kinases (double-strand breaks) |
| ATR kinases (single-strand breaks) |
| RF-C related protein (RAD17) |
| The 9-1-1 Complex: RAD1, RAD9, and HUS1 |
| Checkpoint proteins CHK1, CHK2 |
| P53 |
| ZIP Kinase (ZIPK) |
| Fast Death-Domain Associated Protein XX (DAXX) |
| Promyelocytic leukemia protein (PML) |
| Apoptosis-inducing factor (AIF) |
| Caspase-activated DNAse (CAD) (in the absence of its inhibitor ICAD) |
In an embodiment, a Cas9 molecule/gRNA molecule complex targets a sequence that includes or is near the breakpoint of a rearrangement, e.g., a translocation, inversion, insertion, or deletion. In an embodiment, the rearrangement confers unwanted properties, e.g., unwanted proliferation, on the cell. In an embodiment, the cell harboring the rearrangement is a cancer cell. In an embodiment, the rearrangement comprises a kinase gene and results in unwanted, increased, or constitutive expression of the kinase activity. In an embodiment, the rearrangement disrupts the expression of a tumor suppressor.
In an embodiment, the Cas9 molecule/gRNA molecule complex:
specifically targets, and e.g., cleaves, the genome of a cell comprising a rearrangement, e.g., by targeting a mutation, e.g., a breakpoint or junction of a rearrangement; or
targets, e.g., for cleavage or payload delivery, a nucleotide sequence within 200, 100, 150, 100, 50, 25, 10, or 5 nucleotides of a mutation, e.g., a rearrangement breakpoint.
The invention includes a method of manipulating a cell comprising a genomic signature, comprising:
administering a Cas9 molecule/gRNA molecule complex that targets said genomic signature, thereby manipulating said cell.
In an embodiment, manipulating comprises inhibiting the growth or division of, or killing, said cell.
In an embodiment, said cell is a cancer cell or cell having a viral infection.
In an embodiment, the method comprises treating a subject, e.g., a human subject, for a disorder characterized by a cell having said genomic signature, e.g., a cancer or a viral infection.
In an embodiment, a Cas9 molecule/gRNA molecule complex disrupts a rearrangement, e.g., by introduction of a stop codon from a template nucleic acid, e.g., a stop codon is inserted into a fusion protein, e.g., a fusion protein comprising kinase activity.
The invention includes a method of treating a cancer having a translocation of a kinase gene to a non-kinase gene, which places the kinase domain under the control of the non-kinase gene control region comprising:
administering a Cas9 molecule/gRNA molecule complex that targets the translocation. In an embodiment, the control region, e.g., the promoter, or the coding sequence, of the kinase translocation, is edited to reduce expression.
The Cas9 molecules, gRNA molecules, and in particular, Cas9 molecule/gRNA molecule complexes, can be used in combination with a second therapeutic agent, e.g., a cancer drug. In an embodiment, the second therapeutic agent (e.g., a cancer drug) and the Cas9 molecule, gRNA molecule, and in particular, Cas9 molecule/gRNA molecule complex target different (e.g., non-overlapping) pathways. In an embodiment, the second therapeutic agent (e.g., a cancer drug) and the Cas9 molecule, gRNA molecule, and in particular, Cas9 molecule/gRNA molecule complex target a same or overlapping pathway.
Exemplary combination therapies include, e.g.:
In another aspect, the invention features, a method of altering a cell, e.g., reducing or abolishing the effect of a genetic signature, e.g., a stop codon, e.g., a premature stop codon. The method comprises contacting said cell with:
a Cas9 molecule/gRNA molecule complex that cleaves at or upstream from the genetic signature, e.g., a premature stop codon,
thereby altering the cell.
While not wishing to be bound by theory it is believed that, in an embodiment, cleavage and subsequent exonuclease activity, and non-homologous end joining results in an altered sequence in which the genetic signature, e.g., a premature stop codon is eliminated, e.g., by being placed in a different frame. In an embodiment, the same series of events restores the proper reading frame to the sequence that follows the signature, e.g., premature stop codon.
When the method is carried out to correct a frameshift mutation in order to remove a premature stop codon, repair can be carried out at various sites in the DNA. One may direct cleavage at the mutation, thereby correcting the frameshift entirely and returning the protein to its wild-type (or nearly wild-type) sequence. One may also direct cleavage at or near the premature stop codon, so that all (or nearly all) amino acids of the protein C-terminal of the codon where repair was effected are wild-type. In the latter case, the resulting protein may have one or more frameshifted amino acids between the mutation and the repair site; however the protein may still be functional because it is full-length and has wild-type sequence across most of its length.
A genetic signature is a particular DNA sequence at a particular portion of the genome, that causes a phenotype (such as a genetic disease or a symptom thereof). For instance, the genetic signature may be a premature stop codon that prevents expression of a protein. In this scenario, the premature stop codon can arise from a mutation that directly creates a stop codon, or from a mutation that causes a frameshift leading to a premature stop codon being formed downstream. A genetic signature may also be a point mutation that alters the identity of an important amino acid in a protein, disrupting the protein's function.
In an embodiment, the Cas9 molecule/gRNA molecule complex mediates a double stranded break in said target nucleic acid.
In an embodiment, the genetic signature, e.g., a premature stop codon, results from a point mutation, an insertion, a deletion, or a rearrangement. In an embodiment, a mutation causes a frameshift, resulting in a genetic signature, e.g., a premature stop codon downstream of the mutation.
In an embodiment, the premature stop codon is within the target nucleic acid. In an embodiment, the target nucleic acid is upstream of the premature stop codon. The mutation may be upstream of the target nucleic acid, within the target nucleic acid, or downstream of the target nucleic acid.
In an embodiment the double stranded break is within 500, 200, 100, 50, 30, 20, 10, 5, or 2 nucleotides of the mutation. In an embodiment, the double stranded break is within 500, 200, 100, 50, 30, 20, 10, 5, or 2 nucleotides of the genetic signature, e.g., a premature stop codon.
In an embodiment, the Cas9 molecule/gRNA molecule complex mediates exonuclease digestion of the target nucleic acid. In an embodiment, the Cas9 molecule/gRNA molecule complex removes 1, 2, 3, 4, or 5 nucleotides at the double stranded break.
In an embodiment, the double stranded break is resolved by non-homologous end joining.
In an embodiment the mutation and/or genetic signature, e.g., premature stop codon is in the dystrophin gene, e.g., in exon 51, or in the intron preceding or following exon 51. The premature stop codon may also be caused by a mutation in the dystrophin gene at one or more of codons 54, 645, 773, 3335, and 3340. In an embodiment, the premature stop codon in the dystrophin gene results from a deletion of codons 2305 through 2366.
In an embodiment, contacting the cell with a Cas9 molecule/gRNA molecule complex comprises contacting the cell with a nucleic acid encoding a Cas9 molecule. In an embodiment, contacting the cell with a Cas9 molecule/gRNA molecule complex comprises transfecting the cell with a nucleic acid, e.g., a plasmid, or using a viral vector such as adeno-associated virus (AAV).
In an embodiment, the method results in increased levels of the protein in which the genetic signature, e.g., a premature stop codon, was previously located. For instance, protein levels (e.g., dystrophin levels) may be increased by at least 3%, 4%, 5%, 10%, 15%, 20%, 25%, or 30% in a cell or in a tissue. In an embodiment, the method results in increased levels of the mRNA in which the premature stop codon was previously located, for instance by preventing the mRNA from undergoing nonsense-mediated mRNA decay.
In an embodiment, one or more of the target nucleic acid, the genetic signature, e.g., premature stop codon, and the mutation are located in the dystrophin gene (which is mutated in DMD). One or more of the target nucleic acid, the genetic signature, e.g., premature stop codon, and the mutation may also be located in the COL7A1 gene (mutated in type VII-associated dystrophic epidermolysis bullosa), the FKTN gene (mutated in Fukuyama congenital muscular dystrophy), the dysferlin gene (mutated in limb-girdle muscular dystrophy type 2B), the CFTR gene (mutated in cystic fibrosis), HEXA (mutated in Tay-Sachs disease), the IDS gene (mutated in Hunter syndrome), the FVIII gene (mutated in hemophilia), the IDUA gene (mutated in Hurler syndrome), the PPT1 gene (mutated in infantile neuronal ceroid lipofuscinosis), a tumor suppressor such as the ATM gene (mutated in cancers like gliomas and B-Cell Chronic Lymphocytic Leukemia), RP2 (mutated in X-linked retinitis pigmentosa), the CTNS gene (mutated in nephropathic cystinosis), and the AVPR2 gene (mutated in Congenital nephrogenic diabetes insipidus).
In an embodiment, the method is performed in cultured cells. In an embodiment, the method further comprises administering the cell to a patient. The cell may be, for example, an induced pluripotent stem cell, a bone marrow derived progenitor, a skeletal muscle progenitor, a CD133+ cell, a mesoangioblast, or a MyoD-transduced dermal fibroblast.
In an embodiment, the method comprises contacting the cell with a template nucleic acid under conditions that allow for homology-directed repair between the target nucleic acid and the template nucleic acid to correct the mutation or the premature stop codon.
In another aspect, the invention features a method of treating a human subject having a disorder associated with a genetic signature, e.g., premature stop codon, e.g., DMD, comprising providing to the human subject:
1) a Cas9 molecule/gRNA molecule complex that cleaves at or upstream from the premature stop codon or
2) a cell that has been contacted with such complex, thereby treating the subject.
In an embodiment, the Cas9 molecule/gRNA molecule complex mediates a double stranded break in said target nucleic acid.
In an embodiment, genetic signature, e.g., premature stop codon results from a point mutation, an insertion, a deletion, or a rearrangement. In an embodiment, a mutation causes a frameshift, resulting in a premature stop codon downstream of the mutation.
In an embodiment the double stranded break is within 500, 200, 100, 50, 30, 20, 10, 5, or 2 nucleotides of the mutation. In an embodiment the double stranded break is within 500, 200, 100, 50, 30, 20, 10, 5, or 2 nucleotides of the premature stop codon.
In an embodiment, the genetic signature, e.g., premature stop codon is within the target nucleic acid of the Cas9 molecule/gRNA molecule complex. In an embodiment, the target nucleic acid is upstream of the genetic signature, e.g., premature stop codon. The mutation may be upstream of the target nucleic acid, within the target nucleic acid, or downstream of the target nucleic acid.
In an embodiment, the Cas9 molecule/gRNA molecule complex mediates exonuclease digestion of the target nucleic acid. In an embodiment, the Cas9 molecule/gRNA molecule complex removes 1, 2, 3, 4, or 5 nucleotides at the double stranded break.
In an embodiment, the double stranded break is resolved by non-homologous end joining.
In an embodiment, the mutation and/or genetic signature, e.g., premature stop codon is in the dystrophin gene, e.g., in exon 51, or in the intron preceding or following exon 51. The premature stop codon may also be caused by a mutation in the dystrophin gene at one or more of codons 54, 645, 773, 3335, and 3340. In an embodiment, the premature stop codon in the dystrophin gene results from a deletion of codons 2305 through 2366.
In an embodiment, contacting the cell with a Cas9 molecule/gRNA molecule complex comprises contacting the cell with a nucleic acid encoding a Cas9 molecule. In an embodiment, contacting the cell with a Cas9 molecule/gRNA molecule complex comprises transfecting the cell with a nucleic acid, e.g., a plasmid, or using a viral vector such as adeno-associated virus (AAV).
In an embodiment, the method results in increased levels of the protein in which the genetic signature, e.g., premature stop codon was previously located. For instance, protein levels (e.g., dystrophin levels) may be increased by at least 3%, 4%, 5%, 10%, 15%, 20%, 25%, or 30% in a cell or in a tissue. In an embodiment, the method results in increased levels of the mRNA in which the premature stop codon was previously located, for instance by preventing the mRNA from undergoing nonsense-mediated mRNA decay.
In an embodiment, one or more of the target nucleic acid, the genetic signature, e.g., premature stop codon, and the mutation are located in the dystrophin gene (which is mutated in DMD). One or more of the target nucleic acid, the genetic signature, e.g., premature stop codon, and the mutation may also be located in the COL7A1 gene (mutated in type VII-associated dystrophic epidermolysis bullosa), the FKTN gene (mutated in Fukuyama congenital muscular dystrophy), the dysferlin gene (mutated in limb-girdle muscular dystrophy type 2B), the CFTR gene (mutated in cystic fibrosis), HEXA (mutated in Tay-Sachs disease), the IDS gene (mutated in Hunter syndrome), the FVIII gene (mutated in hemophilia), the IDUA gene (mutated in Hurler syndrome), the PPT1 gene (mutated in infantile neuronal ceroid lipofuscinosis), a tumor suppressor such as the ATM gene (mutated in cancers like gliomas and B-Cell Chronic Lymphocytic Leukemia), RP2 (mutated in X-linked retinitis pigmentosa), the CTNS gene (mutated in nephropathic cystinosis), and the AVPR2 gene (mutated in Congenital nephrogenic diabetes insipidus).
In an embodiment, the method is performed in cultured cells. In an embodiment, the method further comprises administering the cell to a patient. The cell may be, for example, an induced pluripotent stem cell, a bone marrow derived progenitor, a skeletal muscle progenitor, a CD133+ cell, a mesoangioblast, or a MyoD-transduced dermal fibroblast.
In an embodiment, the method comprises contacting the cell with a template nucleic acid under conditions that allow for homology-directed repair between the target nucleic acid and the template nucleic acid to correct the mutation or the premature stop codon.
In an embodiment, the subject has a disorder selected from Duchenne Muscular Dystrophy (DMD), collagen type VII-associated dystrophic epidermolysis bullosa, Fukuyama congenital muscular dystrophy, and limb-girdle muscular dystrophy type 2B, cystic fibrosis, lysosomal storage disorders (such as Tay-Sachs disease, Hunter syndrome, and nephropathic cystinosis), hemophilia, Hurler syndrome, infantile neuronal ceroid lipofuscinosis, X-linked retinitis pigmentosa (RP2), cancers (such as gliomas and B-Cell Chronic Lymphocytic Leukemia), and Congenital nephrogenic diabetes insipidus.
XV. Treatment of Disorders Characterized by Lack of Mature Specialized Cells, e.g., Impaired Hearing, with Loss of Hair Cells, Supporting Cells, or Spiral Ganglion Neurons; or for Diabetes, with Loss of Beta Islet Cells
In another aspect, the invention features, a method of altering a cell, e.g., to promote the development of other mature specialized cells, e.g, in regeneration therapy. For example, proliferation genes can be upregulated and/or checkpoint inhibitors can be inhibited, e.g., to drive down one or more differenation pathways.
In an embodiment, the method includes induction of proliferation and specified lineage maturation.
In an embodiment, the method comprises, e.g., for restoration or improvement of hearing, contacting said cell with:
a Cas9 molecule/gRNA molecule complex that up-regulates a gene that promotes the development of hair cells, or down-regulates a gene that inhibits the development of hair cells thereby altering the cell.
In an embodiment, the Cas9 molecule/gRNA molecule delivers a payload that up-regulates a gene that promotes hair cell development.
In an embodiment, the Cas9 molecule/gRNA molecule delivers a payload that down-regulates a gene that inhibits hair growth.
In an embodiment, the Cas9 molecule/gRNA molecule complex edits the genome of a cell to up-regulate a gene that promotes hair growth. In an embodiment, a template nucleic acid is used to effect a Cas9 molecule/gRNA molecule complex alteration to the genome that up-regulates a gene that promotes hair growth.
In an embodiment, the Cas9 molecule/gRNA molecule complex edits the genome of a cell to down-regulate a gene that inhibits hair growth. In an embodiment, a template nucleic acid is used to effect a Cas9 molecule/gRNA molecule complex alteration to the genome that down-regulates a gene that promotes hair growth.
In an embodiment, said cell is an iPS cell, a native hair cell progenitor, or a mature hair cell.
In an embodiment, the Cas9 molecule/gRNA molecule and modifies expression of a gene, e.g., by modifying the structure of the gene (e.g., by editing the genome) or by delivery of a payload that modulates a gene. In an embodiment, the gene is a transcription factor or other regulatory gene.
In an embodiment, for hair cell or other mature cell regeneration, the method includes one or more or all of the following:
contacting the cell with a Cas9 molecule/gRNA molecule complex that results in up-regulation one or more of the following for cell proliferation: c-Myc, GATA3, Oct4, Sox2, Wnt, TCF3:
contacting the cell with a Cas9 molecule/gRNA molecule complex that results in down-regulation one or more of the following for check point: BCL2, BMP, Hes1, Hes5, Notch, p27, Prox1, TGFβ; and
contacting the cell with a Cas9 molecule/gRNA molecule complex that results in turning on a maturation pathway. For hair cells this would include one or more of the following: Atoh1 (Math1), Barhl1, Gfi1, Myo7a, p63. PAX2. PAX8, Pou4f3 and for neurons would include one or more of the following: NEFH, Neurod1, Neurog1, POU4F1.
In an embodiment, the method comprises generation of inner ear hair cells, outer ear hair cells, spiral ganglion neurons, and ear supporting cells.
In an embodiment, one or more growth factors can be modulated, e.g., upregulated, e.g., TPO can be upregulated for production of platelets and GCSF can be upregulated for production of neutrophils.
In another aspect, the invention provides altered cell described herein, e.g., in this Section XV.
In another aspect, the invention features a method of treating impaired hearing. The method comprises administering to said subject, an altered cell described herein, e.g., in this section XV. In an embodiment, the cell is autologous. In an embodiment, the cell is allogeneic. In an embodiment, the cell is xenogeneic.
In another aspect, the invention features a method of treating subject, e.g., for impaired hearing. The method comprises administering to said subject:
a Cas9 molecule/gRNA molecule complex that up-regulates a gene that promotes the growth of hair, or down-regulates a gene that inhibits the growth of hair thereby altering the cell.
In an embodiment, the Cas9 molecule/gRNA molecule delivers a payload that up-regulates a gene that promotes hair growth.
In an embodiment, the Cas9 molecule/gRNA molecule delivers a payload that down-regulates a gene that inhibits hair growth.
In an embodiment, the Cas9 molecule/gRNA molecule complex edits the genome of a cell to up-regulate a gene that promotes hair growth. In an embodiment, a template nucleic acid is used to effect a Cas9 molecule/gRNA molecule complex alteration to the genome that up-regulates a gene that promotes hair growth.
In an embodiment, the Cas9 molecule/gRNA molecule complex edits the genome of a cell to down-regulate a gene that inhibits hair growth. In an embodiment, a template nucleic acid is used to effect a Cas9 molecule/gRNA molecule complex alteration to the genome that down-regulates a gene that promotes hair growth.
In an embodiment, the Cas9 molecule/gRNA molecule and modifies expression of a gene, e.g., by modifying the structure of the gene (e.g., by editing the genome) or by delivery of a payload that modulates a gene. In an embodiment, the gene is a transcription factor or other regulatory gene.
In an embodiment, the method includes one or more or all of the following:
administering a Cas9 molecule/gRNA molecule complex that results in up-regulation one or more of the following: c-Myc, GATA3, Oct4, Sox2, Wnt, or TCF3;
administering a Cas9 molecule/gRNA molecule complex that results in turning on a maturation pathway. For hair cells this would include one or more of the following: Atoh1 (Math1), Barhl1, Gfi1, Myo7a. p63, PAX2, PAX8, or Pou4f3 and for neurons would include one or more of the following: NEFH, Neurod1, Neurog1, or POU4F1.
XVI. Governing gRNA Molecules and their Use to Limit the Activity of a Cas9 System
As discussed herein, methods and compositions that use, or include, a nucleic acid, e.g., DNA, that encodes a Cas9 molecule or a gRNA molecule, can, in addition, use or include a governing gRNA molecule. The governing gRNA molecule can complex with the Cas9 molecule to inactivate or silence a component of the system, e.g., the nucleic acid that encodes the Cas9 molecule or the nucleic acid that encodes the gRNA molecule. In either case, the governing gRNA, e.g., a Cas9-targeting gRNA molecule, or a gRNA targeting gRNA molecule, limits the effect of the Cas9/gRNA complex mediated gene targeting, and can place temporal limits on activity or reduce off-target activity. Governing gRNA molecules can act as to inhibit, e.g., entirely or substantially inhibit, the production of a component of the Cas9 system and thereby limit, or govern, its activity.
Typically a nucleic acid sequence encoding a governing gRNA molecule, e.g., a Cas9-targeting gRNA molecule, is under the control of a different control region, e.g., promoter, than is the component it negatively modulates, e.g., a nucleic acid encoding the Cas9 molecule. In an embodiment, different refers to simply not being under the control of one control region, e.g., promoter, that is functionally coupled to both controlled sequences. In an embodiment, different refers to different in kind or type. For example, the sequence encoding a governing gRNA molecule, e.g., a Cas9-targeting gRNA molecule, is under the control of a control region, e.g., a promoter, that has a lower level of expression, or is expressed later than the sequence which encodes the component it negatively modulates, e.g., a nucleic acid encoding the Cas9 molecule.
By way of example a sequence that encodes a governing gRNA molecule, e.g., a Cas9-targeting gRNA molecule, can be under the control of a control region (e.g., a promoter) described herein, e.g., humanU6 small nuclear promoter, or human H1 promoter. In an embodiment, a sequence that encodes the component it negatively regulates, e.g. a nucleic acid encoding the Cas9 molecule, can be under the control of a control region (e.g., a promoter) described herein, e.g., human U6 small nuclear promoter, human H1 promoter, or a PolII promoter, e.g., a CMV promoter, a CAGGS promoter, or a CB promoter.
The following Examples are merely illustrative and are not intended to limit the scope or content of the invention in any way.
Governing guide RNAs (gRNAs) targeting S. pyogenes and S. aureus Cas9s were identified using a DNA sequence searching algorithm. In addition to identifying potential gRNA sites adjacent to PAM sequences, the software also identifies all PAM adjacent sequences that differ by 1, 2, 3 or more nucleotides from the selected gRNA sites in the human genome. Genomic DNA sequence for each Cas9 gene was obtained from the UCSC Genome browser and sequences were screened for repeat elements using the publically available RepeatMasker program. RepeatMasker searches input DNA sequences for repeated elements and regions of low complexity. The output is a detailed annotation of the repeats present in a given query sequence.
Following identification, governing gRNAs were ranked into tiers based on their cleavage position within the Cas9 coding sequence, their orthogonality and presence of a 5′ G (based on identification of close matches in the human genome containing a PAM). Orthogonality refers to the number of sequences in the human genome that contain a minimum number of mismatches to the target sequence. A “high level of orthogonality” or “good orthogonality” may, for example, refer to 20-mer gRNAs that have no identical sequences in the human genome besides the intended target, nor any sequences that contain one or two mismatches in the target sequence. Targeting domains with good orthogonality are selected to minimize off-target DNA cleavage.
Tier 1 includes all gRNAs that target the first 500 nucleotides of coding sequence of Cas9, have good orthogonality, and begin with a 5′ G. Tier 2 includes all gRNAs that target the first 500 nucleotides of coding sequence of Cas9, have good orthogonality, but don't begin with a 5′ G. Tier 3 includes all gRNAs that target the first 500 nucleotides of coding sequence of Cas9, have poor orthogonality, and begin with a 5′ G. Tier 4 includes all gRNAs that target the first 500 nucleotides of coding sequence of Cas9, have poor orthogonality, but don't begin with a 5′ G. Tier 5 includes all gRNAs that target the remaining coding sequence. In the case of S. aureus, there is a 6th tier that includes all gRNAs whose targets have a non-optimal PAM of NNGRRV.
For all S. pyogenes targets, 17-mer, or 20-mer gRNAs were designed. For all S. aureus targets, 20-mer gRNAs were designed. gRNAs were identified for both single-gRNA nuclease cleavage and for a dual-gRNA paired “nickase” strategy. The designed governing gRNAs are listed in Tables E-1 to E-12.
| TABLE E-1 |
| Exemplary guide RNA pairs for S. pyogenes (SP) nickase |
| Group A | Group B | ||
| antiSPCas9-2, | antiSPCas9-3, | Group A guides can | |
| antiSPCas9-18 | antiSPCas9-24 | be paired with any | |
| from Group B. | |||
| Group C | Group D | ||
| antiSPCas9-7, | antiSPCas9-30, | Group C guides can | |
| antiSPCas9-70 | antiSPCas9-72 | be paired with any | |
| from Group D. | |||
| TABLE E-2 | ||
| First 500 bp of coding sequence | ||
| downstream of start codon, good | ||
| orthogonality, starts with G |
| S. pyogenes | Target | |||
| 1st Tier | DNA | Site | SEQ ID | |
| gRNA Name | Strand | Targeting Domain | Length | NO |
| antiSPCas9-1 | − | GCCCUCCUAUUCGAUAG | 17 | 304 |
| antiSPCas9-2 | − | GCCUGAAACGAACCGCU | 17 | 305 |
| antiSPCas9-3 | + | GCCACUAUCGAAUAGGA | 17 | 306 |
| antiSPCas9-4 | − | GCACUAAUUCCGUUGGA | 17 | 307 |
| antiSPCas9-5 | − | GAACGGCACCCCAUCUU | 17 | 308 |
| antiSPCas9-6 | − | GGUGCCCUCCUAUUCGAUAG | 20 | 309 |
| antiSPCas9-7 | − | GCCCAUAUGAUAAAGUUCCG | 20 | 310 |
| antiSPCas9-8 | + | GCCCACGGAACUUUAUCAUA | 20 | 311 |
| TABLE E-3 | ||
| First 500 bp of coding sequence | ||
| downstream of start codon, good | ||
| orthogonality, does not start with G |
| S. pyogenes | Target | |||
| 2nd Tier | DNA | Site | SEQ ID | |
| gRNA Name | Strand | Targeting Domain | Length | NO |
| antiSPCas9-9 | + | UCCGAGCGGUUCGUUUC | 17 | 312 |
| antiSPCas9-10 | − | AACGAACCGCUCGGAGA | 17 | 313 |
| antiSPCas9-ll | + | CGCCACUAUCGAAUAGG | 17 | 314 |
| antiSPCas9-12 | − | AUCGGCACUAAUUCCGU | 17 | 315 |
| antiSPCas9-13 | + | UUUCGCCACUAUCGAAU | 17 | 316 |
| antiSPCas9-14 | − | AUUCGAUAGUGGCGAAA | 17 | 317 |
| antiSPCas9-15 | − | UAGUGGCGAAACGGCAG | 17 | 318 |
| antiSPCas9-16 | + | CCGUUUCGCCACUAUCGAAU | 20 | 319 |
| antiSPCas9-17 | − | GACAUCGGCACUAAUUCCGU | 20 | 320 |
| antiSPCas9-18 | − | CUCGCCUGAAACGAACCGCU | 20 | 321 |
| antiSPCas9-19 | + | UUCUCCGAGCGGUUCGUUUC | 20 | 322 |
| antiSPCas9-20 | − | UGAAACGAACCGCUCGGAGA | 20 | 323 |
| antiSPCas9-21 | + | UUUCGCCACUAUCGAAUAGG | 20 | 324 |
| antiSPCas9-22 | − | UCGGCACUAAUUCCGUUGGA | 20 | 325 |
| antiSPCas9-23 | − | CGAUAGUGGCGAAACGGCAG | 20 | 326 |
| antiSPCas9-24 | + | UUCGCCACUAUCGAAUAGGA | 20 | 327 |
| antiSPCas9-25 | + | ACGUGUAUACCUUCUCCGAG | 20 | 328 |
| antiSPCas9-26 | − | CGGCACUAAUUCCGUUGGAU | 20 | 329 |
| antiSPCas9-27 | − | CCUAUUCGAUAGUGGCGAAA | 20 | 330 |
| antiSPCas9-28 | − | CCCAUAUGAUAAAGUUCCGU | 20 | 331 |
| TABLE E-4 | ||
| First 500 bp of coding sequence | ||
| downstream of start codon, poor | ||
| orthogonality, starts with G |
| S. pyogenes | Target | |||
| 3rd Tier | DNA | Site | SEQ ID | |
| gRNA Name | Strand | Targeting Domain | Length | NO |
| antiSPCas9-29 | + | GAAAGAAUCGUCAACUU | 17 | 332 |
| antiSPCas9-30 | + | GAGCCAAGUAGAUUAACCUC | 20 | 333 |
| antiSPCas9-31 | − | GAUAAAAAGUAUUCUAU | 17 | 334 |
| antiSPCas9-32 | + | GAUUCUUUUUAAUCGAAUGA | 20 | 335 |
| antiSPCas9-33 | + | GGAAGGACUCUUCCAAA | 17 | 336 |
| antiSPCas9-34 | − | GGACCUGAGGUUAAUCUACU | 20 | 337 |
| antiSPCas9-35 | − | GGGCACUUUCUCAUUGA | 17 | 338 |
| antiSPCas9-36 | + | GGUUAUGACAGCCCAUCCAA | 20 | 339 |
| antiSPCas9-37 | + | GUCCUCUUCGACAAGGA | 17 | 340 |
| antiSPCas9-38 | − | GUCCUUCCUUGUCGAAG | 17 | 341 |
| antiSPCas9-39 | + | GUUUCUUGUCCUCUUCGACA | 20 | 342 |
| TABLE E-5 | ||
| First 500 bp of coding sequence downstream of start | ||
| S. pyogenes | codon, poor orthogonality, does not start with G |
| 4th Tier | DNA | Target Site | SEQ | |
| gRNA Name | Strand | Targeting Domain | Length | ID NO |
| antiSPCas9-40 | - | AAACAUAGUAGAUGAGG | 17 | 343 |
| antiSPCas9-41 | + | AAAGAAAGAAUCGUCAACUU | 20 | 344 |
| antiSPCas9-42 | - | AAAGAAAUUUAAGGUGU | 17 | 345 |
| antiSPCas9-43 | + | AACACCUUAAAUUUCUUUGA | 20 | 346 |
| antiSPCas9-44 | - | AAGAAAUUUAAGGUGUU | 17 | 347 |
| antiSPCas9-45 | - | AAGAGGACAAGAAACAUGAA | 20 | 348 |
| antiSPCas9-46 | - | AAUUUUUAGCAAUGAGA | 17 | 349 |
| antiSPCas9-47 | + | ACCUUAAAUUUCUUUGA | 17 | 350 |
| antiSPCas9-48 | - | ACCUUCAAAGAAAUUUA | 17 | 351 |
| antiSPCas9-49 | + | ACGGAACUUUAUCAUAU | 17 | 352 |
| antiSPCas9-50 | + | ACUAUGUUUCCAAAGAU | 17 | 353 |
| antiSPCas9-51 | - | AGAAAUUUAAGGUGUUG | 17 | 354 |
| antiSPCas9-52 | - | AGAAAUUUUUAGCAAUGAGA | 20 | 355 |
| antiSPCas9-53 | - | AGAGUCCUUCCUUGUCGAAG | 20 | 356 |
| antiSPCas9-54 | - | AGGACAAGAAACAUGAA | 17 | 357 |
| antiSPCas9-55 | + | AGGUACUUUGUAUUCAU | 17 | 358 |
| antiSPCas9-56 | - | AGUACCUUCAAAGAAAUUUA | 20 | 359 |
| antiSPCas9-57 | + | AGUCAACUAGCUUUUUUCUG | 20 | 360 |
| antiSPCas9-58 | - | AGUUGACUCAACUGAUAAAG | 20 | 361 |
| antiSPCas9-59 | - | AUAUGAUAAAGUUCCGU | 17 | 362 |
| antiSPCas9-60 | + | AUCUACUAUGUUUCCAAAGA | 20 | 363 |
| antiSPCas9-61 | - | AUGGAUAAAAAGUAUUCUAU | 20 | 364 |
| antiSPCas9-62 | - | AUUAAAAAGAAUCUUAU | 17 | 365 |
| antiSPCas9-63 | - | CAAAGAAAUUUAAGGUGUUG | 20 | 366 |
| antiSPCas9-64 | + | CAACUAGCUUUUUUCUG | 17 | 367 |
| antiSPCas9-65 | - | CAACUGAUAAAGCGGACCUG | 20 | 368 |
| antiSPCas9-66 | + | CAAGGAAGGACUCUUCCAAA | 20 | 369 |
| antiSPCas9-67 | + | CAAUGAGAAAGUGCCCA | 17 | 370 |
| antiSPCas9-68 | + | CACGGAACUUUAUCAUA | 17 | 371 |
| antiSPCas9-69 | - | CACUAAUUCCGUUGGAU | 17 | 372 |
| antiSPCas9-70 | - | CAUAUGAUAAAGUUCCG | 17 | 373 |
| antiSPCas9-71 | - | CAUGAACGGCACCCCAUCUU | 20 | 374 |
| antiSPCas9-72 | + | CCAAGUAGAUUAACCUC | 17 | 375 |
| antiSPCas9-73 | + | CCCACGGAACUUUAUCAUAU | 20 | 376 |
| antiSPCas9-74 | - | CCGUGGGCACUUUCUCAUUG | 20 | 377 |
| antiSPCas9-75 | + | CCUCAAUGAGAAAGUGCCCA | 20 | 378 |
| antiSPCas9-76 | - | CCUGAGGUUAAUCUACU | 17 | 379 |
| antiSPCas9-77 | - | CGAUUCUUUCUUUCACCGUU | 20 | 380 |
| antiSPCas9-78 | - | CGUGGGCACUUUCUCAUUGA | 20 | 381 |
| antiSPCas9-79 | + | CUACUAUGUUUCCAAAGAUG | 20 | 382 |
| antiSPCas9-80 | + | CUAUGUUUCCAAAGAUG | 17 | 383 |
| antiSPCas9-81 | + | CUGAGGUGAUAAAUCGU | 17 | 384 |
| antiSPCas9-82 | - | CUGAUAAAGCGGACCUG | 17 | 385 |
| antiSPCas9-83 | + | CUUGUAAGUAACAUAUU | 17 | 386 |
| antiSPCas9-84 | + | CUUGUCCUCUUCGACAAGGA | 20 | 387 |
| antiSPCas9-85 | - | CUUUGGAAACAUAGUAGAUG | 20 | 388 |
| antiSPCas9-86 | + | UACUAUGUUUCCAAAGA | 17 | 389 |
| antiSPCas9-87 | + | UAUGACAGCCCAUCCAA | 17 | 390 |
| antiSPCas9-88 | - | UAUUCUAUUGGUUUAGACAU | 20 | 391 |
| antiSPCas9-89 | - | UCAAAGAAAUUUAAGGUGUU | 20 | 392 |
| antiSPCas9-90 | - | UCGAUUAAAAAGAAUCUUAU | 20 | 393 |
| antiSPCas9-91 | + | UCUACUAUGUUUCCAAAGAU | 20 | 394 |
| antiSPCas9-92 | - | UCUAUUGGUUUAGACAU | 17 | 395 |
| antiSPCas9-93 | + | UCUUGUCCUCUUCGACA | 17 | 396 |
| antiSPCas9-94 | + | UCUUUUUAAUCGAAUGA | 17 | 397 |
| antiSPCas9-95 | + | UGAAGGUACUUUGUAUUCAU | 20 | 398 |
| antiSPCas9-96 | - | UGACUCAACUGAUAAAG | 17 | 399 |
| antiSPCas9-97 | + | UGAGGUGAUAAAUCGUU | 17 | 400 |
| antiSPCas9-98 | - | UGGAAACAUAGUAGAUG | 17 | 401 |
| antiSPCas9-99 | - | UGGAAACAUAGUAGAUGAGG | 20 | 402 |
| antiSPCas9-100 | - | UGGGCACUUUCUCAUUG | 17 | 403 |
| antiSPCas9-101 | + | UGUAUACCUUCUCCGAG | 17 | 404 |
| antiSPCas9-102 | - | UUCAAAGAAAUUUAAGGUGU | 20 | 405 |
| antiSPCas9-103 | + | UUCUGAGGUGAUAAAUCGUU | 20 | 406 |
| antiSPCas9-104 | - | UUCUUUCUUUCACCGUU | 17 | 407 |
| antiSPCas9-105 | + | UUUCUGAGGUGAUAAAUCGU | 20 | 408 |
| antiSPCas9-106 | + | UUUCUUGUAAGUAACAUAUU | 20 | 409 |
| TABLE E-6 | ||
| Rest of gene |
| 5th Tier | DNA | Target Site | SEQ | |
| gRNA Name | Strand | Targeting Domain | Length | ID NO |
| antiSPCas9-107 | - | GCGUCGCUAUACGGGCU | 17 | 410 |
| antiSPCas9-108 | - | GGCGUCGCUAUACGGGC | 17 | 411 |
| antiSPCas9-109 | - | UCGAAAAACGGGUACGC | 17 | 412 |
| antiSPCas9-110 | - | CGCUCGGAUAAGAACCG | 17 | 413 |
| antiSPCas9-111 | - | CGUCGCUAUACGGGCUG | 17 | 414 |
| antiSPCas9-112 | + | GAUAAGCGUCGUGCGCA | 17 | 415 |
| antiSPCas9-113 | + | CGGGUAAUUGUGCGAUC | 17 | 416 |
| antiSPCas9-114 | - | GAUCGCGAAAAGCGAAC | 17 | 417 |
| antiSPCas9-115 | - | GCGACGGCUUCGCCAAU | 17 | 418 |
| antiSPCas9-116 | + | UAACCUUAUCGUCGAAC | 17 | 419 |
| antiSPCas9-117 | + | AGCGGAUAACGGCGCCU | 17 | 420 |
| antiSPCas9-118 | - | AAGAGGCGUCGCUAUAC | 17 | 421 |
| antiSPCas9-119 | + | AAGCGUCGUGCGCAUGG | 17 | 422 |
| antiSPCas9-120 | - | CGGAUGUUGGCUAGCGC | 17 | 423 |
| antiSPCas9-121 | - | CGAUCUCGACAAUCUAC | 17 | 424 |
| antiSPCas9-122 | + | UCGACAUCCGAGUUGUC | 17 | 425 |
| antiSPCas9-123 | + | GAGUGCGGUCCCUACGA | 17 | 426 |
| antiSPCas9-124 | - | CGCGGAAACUUAUCAAC | 17 | 427 |
| antiSPCas9-125 | - | AUCUUAAUGCCGUCGUA | 17 | 428 |
| antiSPCas9-126 | - | CUCAAUCGUUCAUCGAG | 17 | 429 |
| antiSPCas9-127 | + | UCCGCCUGCUCACGUAU | 17 | 430 |
| antiSPCas9-128 | - | UCACCUGUUCGACGAUA | 17 | 431 |
| antiSPCas9-129 | - | GCUCAUCGCUCGUAAAA | 17 | 432 |
| antiSPCas9-130 | - | GCUCGGAUAAGAACCGA | 17 | 433 |
| antiSPCas9-131 | - | UAUCUUAAUGCCGUCGU | 17 | 434 |
| antiSPCas9-132 | - | CGGCGGAGCGAGUCAAG | 17 | 435 |
| antiSPCas9-133 | - | UCGCGGAAACUUAUCAA | 17 | 436 |
| antiSPCas9-134 | - | CGAUUUAAUGCGUCACU | 17 | 437 |
| antiSPCas9-135 | - | UCGCUCGUAAAAAGGAC | 17 | 438 |
| antiSPCas9-136 | - | GACCCGAAAAAGUACGG | 17 | 439 |
| antiSPCas9-137 | + | GCCGUCGGGAUUUAGAG | 17 | 440 |
| antiSPCas9-138 | - | AAAGAGGCGUCGCUAUA | 17 | 441 |
| antiSPCas9-139 | - | CGCAUACCUUACUAUGU | 17 | 442 |
| antiSPCas9-140 | + | CGAACCGAGAGUUCCCU | 17 | 443 |
| antiSPCas9-141 | - | GGAACUCUCGGUUCGCA | 17 | 444 |
| antiSPCas9-142 | - | UGGCCGAAAACGGAUGU | 17 | 445 |
| antiSPCas9-143 | + | CGCGUCUAGCACCUCCU | 17 | 446 |
| antiSPCas9-144 | + | UCACCGUCGCGAAGUCC | 17 | 447 |
| antiSPCas9-145 | - | UAUUAAACGUCAGCUCG | 17 | 448 |
| antiSPCas9-146 | - | CGCUCGUAAAAAGGACU | 17 | 449 |
| antiSPCas9-147 | + | UUCCGCCUGCUCACGUA | 17 | 450 |
| antiSPCas9-148 | + | CUAGUGAGAGCGCUAUA | 17 | 451 |
| antiSPCas9-149 | + | CGUCGUAAUCAGAUAAA | 17 | 452 |
| antiSPCas9-150 | - | CUGAUCGCACAAUUACC | 17 | 453 |
| antiSPCas9-151 | - | UCGCAUACCUUACUAUG | 17 | 454 |
| antiSPCas9-152 | - | CGCCGGAGAGCUUCAAA | 17 | 455 |
| antiSPCas9-153 | - | GCUGGGGACGAUUGUCG | 17 | 456 |
| antiSPCas9-154 | + | CGCCUCAAGGAAGUCGA | 17 | 457 |
| antiSPCas9-155 | - | CUUAUAGCGCUCUCACU | 17 | 458 |
| antiSPCas9-156 | - | UUCUGUCGAGAUCUCCG | 17 | 459 |
| antiSPCas9-157 | - | CAUAUUGCGAAUCUUGC | 17 | 460 |
| antiSPCas9-158 | - | GGGCCGGGACUUCGCGA | 17 | 461 |
| antiSPCas9-159 | - | UAAACCCAUACGUGAGC | 17 | 462 |
| antiSPCas9-160 | + | UUUACGACUUCCUCGCU | 17 | 463 |
| antiSPCas9-161 | - | GCGCAUACAACAAGCAC | 17 | 464 |
| antiSPCas9-162 | - | GCAGGUUAUAUUGACGG | 17 | 465 |
| antiSPCas9-163 | + | UUUUCGCGAUCAUCUUA | 17 | 466 |
| antiSPCas9-164 | - | UCGUAUGGGAUAAGGGC | 17 | 467 |
| antiSPCas9-165 | + | AUAAUCCCGUGAUGGAU | 17 | 468 |
| antiSPCas9-166 | - | ACGAUACACUUCUACCA | 17 | 469 |
| antiSPCas9-167 | + | CAGUUGCUGACGGACUA | 17 | 470 |
| antiSPCas9-168 | - | GAACGAUAAGCUGAUUC | 17 | 471 |
| antiSPCas9-169 | - | UCUAAAUCCGGACAACU | 17 | 472 |
| antiSPCas9-170 | - | CAGCGGACUUUCGACAA | 17 | 473 |
| antiSPCas9-171 | - | CAUGGGACGUCACAAAC | 17 | 474 |
| antiSPCas9-172 | + | CAGGUUUUCUAGCCGUC | 17 | 475 |
| antiSPCas9-173 | - | CCGCUUCAAUGAUCAAA | 17 | 476 |
| antiSPCas9-174 | + | UAGCCAACAUCCGUUUU | 17 | 477 |
| antiSPCas9-175 | + | GGAGGAUUGCAUCGCUA | 17 | 478 |
| antiSPCas9-176 | + | CAUGCAAUUCGCCUAAG | 17 | 479 |
| antiSPCas9-177 | - | AAGUGGCGUGGAUGCGA | 17 | 480 |
| antiSPCas9-178 | - | CGUAUGGGAUAAGGGCC | 17 | 481 |
| antiSPCas9-179 | - | GACAGGUGAAAUCGUAU | 17 | 482 |
| antiSPCas9-180 | + | GAACCGAGAGUUCCCUC | 17 | 483 |
| antiSPCas9-181 | + | AAAUCGAUCUUCUACCC | 17 | 484 |
| antiSPCas9-182 | + | AAUGGGACGCUAAAUAC | 17 | 485 |
| antiSPCas9-183 | - | UAAAGUGCUUACACGCU | 17 | 486 |
| antiSPCas9-184 | - | UACGCAGGUUAUAUUGA | 17 | 487 |
| antiSPCas9-185 | - | AUUCUGUCGAGAUCUCC | 17 | 488 |
| antiSPCas9-186 | - | GAUUCUGUCGAGAUCUC | 17 | 489 |
| antiSPCas9-187 | - | GCCUCUCUAAAUCCCGA | 17 | 490 |
| antiSPCas9-188 | + | UGCAUCGCUAAGGUUUU | 17 | 491 |
| antiSPCas9-189 | + | GCAGUUGCUGACGGACU | 17 | 492 |
| antiSPCas9-190 | - | CGGGAUUAUAUGAAACU | 17 | 493 |
| antiSPCas9-191 | - | ACCCAUACGUGAGCAGG | 17 | 494 |
| antiSPCas9-192 | + | AGGGGUCCCACAUAGUA | 17 | 495 |
| antiSPCas9-193 | + | AGCCACCGUACUUUUUC | 17 | 496 |
| antiSPCas9-194 | - | AUUGGGGAUAACGAUUA | 17 | 497 |
| antiSPCas9-195 | - | UGACAAUGUUCCAAGCG | 17 | 498 |
| antiSPCas9-196 | - | GGUGUCGGACUUCAGAA | 17 | 499 |
| antiSPCas9-197 | + | UCUCCGCUUAGAAAGGC | 17 | 500 |
| antiSPCas9-198 | + | UGUAACCUUUCGCCUCA | 17 | 501 |
| antiSPCas9-199 | - | ACAGGUUUCCGGACAAG | 17 | 502 |
| antiSPCas9-200 | - | UGGGACCCGAAAAAGUA | 17 | 503 |
| antiSPCas9-201 | + | UUCAUAUAAUCCCGUGA | 17 | 504 |
| antiSPCas9-202 | - | CACAGGUUUCCGGACAA | 17 | 505 |
| antiSPCas9-203 | + | AUAGUAAGGUAUGCGAA | 17 | 506 |
| antiSPCas9-204 | + | AACUGUCACUUUGCGGU | 17 | 507 |
| antiSPCas9-205 | - | UUACUAUGUGGGACCCC | 17 | 508 |
| antiSPCas9-206 | + | AUGCGGCUGGAGCGCCG | 17 | 509 |
| antiSPCas9-207 | - | UAAGACGGAAAUCACUC | 17 | 510 |
| antiSPCas9-208 | + | CGCCACUUGCAUUUAUA | 17 | 511 |
| antiSPCas9-209 | - | CCCCAUCGACUUCCUUG | 17 | 512 |
| antiSPCas9-210 | + | GCCUCAAGGAAGUCGAU | 17 | 513 |
| antiSPCas9-211 | - | UUGAUCAGUCGAAAAAC | 17 | 514 |
| antiSPCas9-212 | + | UCGGGAUUUAGAGAGGC | 17 | 515 |
| antiSPCas9-213 | + | CAAUGAGUCCCCUUGUC | 17 | 516 |
| antiSPCas9-214 | + | UCAGGUUUUCUAGCCGU | 17 | 517 |
| antiSPCas9-215 | - | GACCGGAGGGUUUUCAA | 17 | 518 |
| antiSPCas9-216 | + | AAGCCACCGUACUUUUU | 17 | 519 |
| antiSPCas9-217 | + | CUGUUCUCCGCUUAGAA | 17 | 520 |
| antiSPCas9-218 | + | AUCAUUGAAGCGGAUAA | 17 | 521 |
| antiSPCas9-219 | - | UUCGCCAGCCAUCAAAA | 17 | 522 |
| antiSPCas9-220 | - | GCCGGAGAGCUUCAAAA | 17 | 523 |
| antiSPCas9-221 | - | AGAACGAUAAGCUGAUU | 17 | 524 |
| antiSPCas9-222 | - | GCACAGGUUUCCGGACA | 17 | 525 |
| antiSPCas9-223 | - | UCGCCAGCCAUCAAAAA | 17 | 526 |
| antiSPCas9-224 | + | AAGGUAUGCGAAAGGUU | 17 | 527 |
| antiSPCas9-225 | + | GGCAAUACUUUUUCGUU | 17 | 528 |
| antiSPCas9-226 | - | GAGGAAGUUGUCGAUAA | 17 | 529 |
| antiSPCas9-227 | + | CUGACGUUUAAUAAAUC | 17 | 530 |
| antiSPCas9-228 | - | AAACCCGCCUUUCUAAG | 17 | 531 |
| antiSPCas9-229 | - | UAUAAAUGCAAGUGGCG | 17 | 532 |
| antiSPCas9-230 | + | CCACUACUUUGACUGUC | 17 | 533 |
| antiSPCas9-231 | + | GAGAGUUCCCUCGGGCC | 17 | 534 |
| antiSPCas9-232 | + | UAUAGGUUUGUACUAAC | 17 | 535 |
| antiSPCas9-233 | - | CAUUACGAGAAGUUGAA | 17 | 536 |
| antiSPCas9-234 | - | GUAUGUUGAUCAGGAAC | 17 | 537 |
| antiSPCas9-235 | + | CGUAUUUCGUAUUCAUU | 17 | 538 |
| antiSPCas9-236 | - | UGAGGGUGAUCUAAAUC | 17 | 539 |
| antiSPCas9-237 | + | CCUCAAGGAAGUCGAUG | 17 | 540 |
| antiSPCas9-238 | - | GAAAUCGUAUGGGAUAA | 17 | 541 |
| antiSPCas9-239 | + | UGGAGUAAUCGUUUCUU | 17 | 542 |
| antiSPCas9-240 | - | UGCUAUACUUAGAAGGC | 17 | 543 |
| antiSPCas9-241 | - | CCGGAGAGCUUCAAAAG | 17 | 544 |
| antiSPCas9-242 | - | AGACAGGUGAAAUCGUA | 17 | 545 |
| antiSPCas9-243 | - | GAGCUAGUUAAGGUCAU | 17 | 546 |
| antiSPCas9-244 | + | GAGUUCCCUCGGGCCAG | 17 | 547 |
| antiSPCas9-245 | + | CUUUCAACUUCUCGUAA | 17 | 548 |
| antiSPCas9-246 | + | AGAGUUCCCUCGGGCCA | 17 | 549 |
| antiSPCas9-247 | - | AGAUCGGGAAAUGAUUG | 17 | 550 |
| antiSPCas9-248 | - | UGAGGCGAAAGGUUACA | 17 | 551 |
| antiSPCas9-249 | - | UGGCCCGAGGGAACUCU | 17 | 552 |
| antiSPCas9-250 | + | GUUUCUCGUUCUGCAAU | 17 | 553 |
| antiSPCas9-251 | + | ACGCCACUUGCAUUUAU | 17 | 554 |
| antiSPCas9-252 | + | CACUACUAGGACAGAAU | 17 | 555 |
| antiSPCas9-253 | - | AUCUACUGCGAAAGCAG | 17 | 556 |
| antiSPCas9-254 | + | GUCGGGAUUUAGAGAGG | 17 | 557 |
| antiSPCas9-255 | - | CCUAGCUGAUGCCAAUC | 17 | 558 |
| antiSPCas9-256 | + | UUCUCCGCUUAGAAAGG | 17 | 559 |
| antiSPCas9-257 | - | ACUGAGGUGCAGACCGG | 17 | 560 |
| antiSPCas9-258 | - | UGCAUGCUAUACUUAGA | 17 | 561 |
| antiSPCas9-259 | - | CUGAGGUGCAGACCGGA | 17 | 562 |
| antiSPCas9-260 | + | AUGCCCUUUUUGAUGGC | 17 | 563 |
| antiSPCas9-261 | - | AUUCACCAAUCCAUCAC | 17 | 564 |
| antiSPCas9-262 | - | UGGGACCCCUGGCCCGA | 17 | 565 |
| antiSPCas9-263 | + | UUUCAACUUCUCGUAAU | 17 | 566 |
| antiSPCas9-264 | + | GUAUUUCGUAUUCAUUC | 17 | 567 |
| antiSPCas9-265 | - | AGUGGAUGAGCUAGUUA | 17 | 568 |
| antiSPCas9-266 | + | GAGUAUGCCCUUUUUGA | 17 | 569 |
| antiSPCas9-267 | - | AUCAAACGACUCAGAAG | 17 | 570 |
| antiSPCas9-268 | + | CAUUCUCUUCGUUAUCC | 17 | 571 |
| antiSPCas9-269 | - | AUACACUUCUACCAAGG | 17 | 572 |
| antiSPCas9-270 | - | GACUUCCUUGAGGCGAA | 17 | 573 |
| antiSPCas9-271 | - | ACCCCAAUCCUUUUUGA | 17 | 574 |
| antiSPCas9-272 | + | UGAAUCGUCCUUCAAAA | 17 | 575 |
| antiSPCas9-273 | - | UACCCUCUUUGAAGAUC | 17 | 576 |
| antiSPCas9-274 | - | UCUGAACUUGACAAGGC | 17 | 577 |
| antiSPCas9-275 | + | CGAUUGUCUUUGAGGAA | 17 | 578 |
| antiSPCas9-276 | - | GGACAUGUAUGUUGAUC | 17 | 579 |
| antiSPCas9-277 | - | CGCAUACAACAAGCACA | 17 | 580 |
| antiSPCas9-278 | + | UCGAUUACAAUGUUUUC | 17 | 581 |
| antiSPCas9-279 | + | CGUCCUUCAAAAAGGAU | 17 | 582 |
| antiSPCas9-280 | + | CUUACUAAGCUGCAAUU | 17 | 583 |
| antiSPCas9-281 | - | AAGAAACGAUUACUCCA | 17 | 584 |
| antiSPCas9-282 | + | CAACUUUUGCCACUACU | 17 | 585 |
| antiSPCas9-283 | - | CUAUUCUGUCCUAGUAG | 17 | 586 |
| antiSPCas9-284 | + | CUGCAUAAAGUUCCUAU | 17 | 587 |
| antiSPCas9-285 | - | GUGGGACCCCUGGCCCG | 17 | 588 |
| antiSPCas9-286 | - | GUAUGCGGACUUAUUUU | 17 | 589 |
| antiSPCas9-287 | + | CCUAAGUGGAUUUGAUG | 17 | 590 |
| antiSPCas9-288 | - | GAUUUUCUAAAGAGCGA | 17 | 591 |
| antiSPCas9-289 | - | GGGCAGCCAGAUCUUAA | 17 | 592 |
| antiSPCas9-290 | - | CAAAUUGCAGCUUAGUA | 17 | 593 |
| antiSPCas9-291 | - | UGAAAUCGUAUGGGAUA | 17 | 594 |
| antiSPCas9-292 | - | UUUACUCUUACCAACCU | 17 | 595 |
| antiSPCas9-293 | + | GAUGCUCCUUUAAGAUC | 17 | 596 |
| antiSPCas9-294 | + | CUCUCAGUAUGUCAGAU | 17 | 597 |
| antiSPCas9-295 | + | AAAUACUUGAAUGCGGC | 17 | 598 |
| antiSPCas9-296 | - | ACUUAACUAAAGCUGAG | 17 | 599 |
| antiSPCas9-297 | - | CGAACAGGAGAUAGGCA | 17 | 600 |
| antiSPCas9-298 | - | GAUUCACCAAUCCAUCA | 17 | 601 |
| antiSPCas9-299 | - | UUUGAUCAGUCGAAAAA | 17 | 602 |
| antiSPCas9-300 | - | CUUAAAGGAGCAUCCUG | 17 | 603 |
| antiSPCas9-301 | + | CCUUUUGAUCAUUGAAG | 17 | 604 |
| antiSPCas9-302 | - | UGAGCUAGUUAAGGUCA | 17 | 605 |
| antiSPCas9-303 | - | AAACAUUGUAAUCGAGA | 17 | 606 |
| antiSPCas9-304 | + | CCAGAUUGGCAUCAGCU | 17 | 607 |
| antiSPCas9-305 | + | AAUUGGGUAUUUUCCAC | 17 | 608 |
| antiSPCas9-306 | + | UCAAACAGACUAUACUU | 17 | 609 |
| antiSPCas9-307 | - | CCACAUCAAAUCCACUU | 17 | 610 |
| antiSPCas9-308 | - | GGAUAUACAAAAGGCAC | 17 | 611 |
| antiSPCas9-309 | - | AAUCUACUGGCACAAAU | 17 | 612 |
| antiSPCas9-310 | + | UCAGUAUGUCAGAUAGG | 17 | 613 |
| antiSPCas9-311 | - | AGUUAAGUAUGUCACUG | 17 | 614 |
| antiSPCas9-312 | + | AAGUUCGACUUAAAAUU | 17 | 615 |
| antiSPCas9-313 | + | UUCUGUUCGUUAUCUUC | 17 | 616 |
| antiSPCas9-314 | - | GAGGGUAUUAAAGAACU | 17 | 617 |
| antiSPCas9-315 | - | GUUAAGUAUGUCACUGA | 17 | 618 |
| antiSPCas9-316 | + | GCUUAACUGUCACUUUG | 17 | 619 |
| antiSPCas9-317 | - | AGAUUUGUCACAGCUUG | 17 | 620 |
| antiSPCas9-318 | - | AGACUUGACACUUCUCA | 17 | 621 |
| antiSPCas9-319 | - | CCAGACAGUCAAAGUAG | 17 | 622 |
| antiSPCas9-320 | + | CCCCUUUUGAAGCUCUC | 17 | 623 |
| antiSPCas9-321 | + | UUAUCAGUUUCGCAUUU | 17 | 624 |
| antiSPCas9-322 | - | AAAUCAAACGACUCAGA | 17 | 625 |
| antiSPCas9-323 | - | AAUCGAUUCUUCCAAAA | 17 | 626 |
| antiSPCas9-324 | + | UUCCCGAUCUUCAAAGA | 17 | 627 |
| antiSPCas9-325 | - | GUCAGUCAAAGAAUUAU | 17 | 628 |
| antiSPCas9-326 | - | GAUUUGUCACAGCUUGG | 17 | 629 |
| antiSPCas9-327 | - | GAAACCAAUGGGGAGAC | 17 | 630 |
| antiSPCas9-328 | + | AGGUUAAAGAGUCAUCA | 17 | 631 |
| antiSPCas9-329 | - | AGAGGGUAUUAAAGAAC | 17 | 632 |
| antiSPCas9-330 | + | ACAGAAUAGGCAACUGU | 17 | 633 |
| antiSPCas9-331 | + | UUUCACGAUUGUCUUUG | 17 | 634 |
| antiSPCas9-332 | + | GUCCUUCAAAAAGGAUU | 17 | 635 |
| antiSPCas9-333 | + | AUGCUUUGUGAUUUGGC | 17 | 636 |
| antiSPCas9-334 | + | UGAGAAGUGUCAAGUCU | 17 | 637 |
| antiSPCas9-335 | - | UAAAGAUAAGGACUUCC | 17 | 638 |
| antiSPCas9-336 | + | UUUCUCGUUCUGCAAUU | 17 | 639 |
| antiSPCas9-337 | + | CCAUUGGUUUCAAUUAA | 17 | 640 |
| antiSPCas9-338 | + | AUCCAUCUUCUCUAAUA | 17 | 641 |
| antiSPCas9-339 | - | UAAUACUGAGAUUACCA | 17 | 642 |
| antiSPCas9-340 | + | UUCACCUGUCUCCCCAU | 17 | 643 |
| antiSPCas9-341 | - | AUAGAUUUGUCACAGCU | 17 | 644 |
| antiSPCas9-342 | - | CUUGUCUGAACUUGACA | 17 | 645 |
| antiSPCas9-343 | - | CUUAACUAAAGCUGAGA | 17 | 646 |
| antiSPCas9-344 | - | CAGUCAAAGAAUUAUUG | 17 | 647 |
| antiSPCas9-345 | + | AAAUUCACGUAUUUAGA | 17 | 648 |
| antiSPCas9-346 | - | UAGAUUUGUCACAGCUU | 17 | 649 |
| antiSPCas9-347 | + | UAAUACUUUGUCCAGAU | 17 | 650 |
| antiSPCas9-348 | + | ACUCACUUUCUAGCUUC | 17 | 651 |
| antiSPCas9-349 | - | CCUUUAAUUGAAACCAA | 17 | 652 |
| antiSPCas9-350 | - | UACUCCAUGGAAUUUUG | 17 | 653 |
| antiSPCas9-351 | + | GUCAAAAUACUUGAAUG | 17 | 654 |
| antiSPCas9-352 | + | ACUUAAAAUUUGGUGUC | 17 | 655 |
| antiSPCas9-353 | - | CUCUAUUACCUACAAAA | 17 | 656 |
| antiSPCas9-354 | - | CUCUUUAACCUUCAAAG | 17 | 657 |
| antiSPCas9-355 | + | CUUUACUAUGUUGACUU | 17 | 658 |
| antiSPCas9-356 | + | CAACAUGCUUUGUGAUU | 17 | 659 |
| antiSPCas9-357 | - | AAUUGGAGAUCAGUAUG | 17 | 660 |
| antiSPCas9-358 | + | CAUUUUGUAGGUAAUAG | 17 | 661 |
| antiSPCas9-359 | + | GACUGACUUCAGUUUCU | 17 | 662 |
| antiSPCas9-360 | - | ACUAAAGCUGAGAGGGG | 17 | 663 |
| antiSPCas9-361 | - | AAAAGCGAACAGGAGAU | 17 | 664 |
| antiSPCas9-362 | - | AACCCUAUAAAUGCAAG | 17 | 665 |
| antiSPCas9-363 | - | ACCCAUAUUAGAGAAGA | 17 | 666 |
| antiSPCas9-364 | + | GUAUUUCUUAAUGAGUG | 17 | 667 |
| antiSPCas9-365 | + | UAUGUUGACUUGGGGCA | 17 | 668 |
| antiSPCas9-366 | - | CAAAAGGCACAGGUUUC | 17 | 669 |
| antiSPCas9-367 | + | UUUCCCGAUCUUCAAAG | 17 | 670 |
| antiSPCas9-368 | - | UUACCCUCUUUGAAGAU | 17 | 671 |
| antiSPCas9-369 | - | UAUUAGAGAAGAUGGAU | 17 | 672 |
| antiSPCas9-370 | - | UUAACUAAAGCUGAGAG | 17 | 673 |
| antiSPCas9-371 | - | AGUUAAGCAAUUGAAAG | 17 | 674 |
| antiSPCas9-372 | - | AAAGUCAAAAUUGGUGU | 17 | 675 |
| antiSPCas9-373 | + | UUCAAACAACUGAUUAU | 17 | 676 |
| antiSPCas9-374 | - | GUGGCAAAAGUUGAGAA | 17 | 677 |
| antiSPCas9-375 | + | UAAAGUAAACUGUGCUU | 17 | 678 |
| antiSPCas9-376 | + | CAUUGUCACUUUUCCCU | 17 | 679 |
| antiSPCas9-377 | + | UUCCUUUGAAAACCCUC | 17 | 680 |
| antiSPCas9-378 | + | AACUCACUUUCUAGCUU | 17 | 681 |
| antiSPCas9-379 | - | ACUGCCUGAGAAAUAUA | 17 | 682 |
| antiSPCas9-380 | + | CAUGCUUUGUGAUUUGG | 17 | 683 |
| antiSPCas9-381 | - | AGUGGCAAAAGUUGAGA | 17 | 684 |
| antiSPCas9-382 | - | CUGUUUGAGUUAGAAAA | 17 | 685 |
| antiSPCas9-383 | - | UAGAAAAUGGCCGAAAA | 17 | 686 |
| antiSPCas9-384 | + | UUUACUAUGUUGACUUG | 17 | 687 |
| antiSPCas9-385 | - | AUUACCUACAAAAUGGA | 17 | 688 |
| antiSPCas9-386 | - | GAAAGUGAGUUUGUGUA | 17 | 689 |
| antiSPCas9-387 | + | UCCAUCUUCUCUAAUAU | 17 | 690 |
| antiSPCas9-388 | - | CUUUAAUUGAAACCAAU | 17 | 691 |
| antiSPCas9-389 | - | UCAGUCAAAGAAUUAUU | 17 | 692 |
| antiSPCas9-390 | - | AAUCAAACGACUCAGAA | 17 | 693 |
| antiSPCas9-391 | + | UGUCCCUUCCAUUUUGU | 17 | 694 |
| antiSPCas9-392 | - | UUUAAUUGAAACCAAUG | 17 | 695 |
| antiSPCas9-393 | + | UAAAUUCUUGUCAAAGU | 17 | 696 |
| antiSPCas9-394 | + | UUGUAUAUCCUCUUUGA | 17 | 697 |
| antiSPCas9-395 | + | CUUUAAUUAUCUUUAGG | 17 | 698 |
| antiSPCas9-396 | - | AAAUGAAGAACUAUUGG | 17 | 699 |
| antiSPCas9-397 | + | UCUUUACUAUGUUGACU | 17 | 700 |
| antiSPCas9-398 | - | CCGGAGAGAAGAAAAAU | 17 | 701 |
| antiSPCas9-399 | - | AAUCAUAGAGCAAAUUU | 17 | 702 |
| antiSPCas9-400 | - | CCCGGAGAGAAGAAAAA | 17 | 703 |
| antiSPCas9-401 | - | UUACCUACAAAAUGGAA | 17 | 704 |
| antiSPCas9-402 | + | UCUCAGGCAGUUGCUGA | 17 | 705 |
| antiSPCas9-403 | + | UCCUUCAAAAAGGAUUG | 17 | 706 |
| antiSPCas9-404 | - | UUCAAUUCUAUAAAGUU | 17 | 707 |
| antiSPCas9-405 | + | UGGUAAGAGUAAACAAA | 17 | 708 |
| antiSPCas9-406 | - | UCAAUUCUAUAAAGUUA | 17 | 709 |
| antiSPCas9-407 | - | GAAAUCACUCUGGCAAA | 17 | 710 |
| antiSPCas9-408 | + | ACUUCCUCAAAAUUCCA | 17 | 711 |
| antiSPCas9-409 | + | UUAUCACUAUUCCUUUU | 17 | 712 |
| antiSPCas9-410 | - | CACUUUAAAGUCAAAAU | 17 | 713 |
| antiSPCas9-411 | - | AUAUUAGAGAAGAUGGA | 17 | 714 |
| antiSPCas9-412 | + | CCCAUUUUUCUUCUCUC | 17 | 715 |
| antiSPCas9-413 | - | AAAAAAACAGUCGAGAG | 17 | 716 |
| antiSPCas9-414 | - | UUAUGAAACAGUUAAAG | 17 | 717 |
| antiSPCas9-415 | - | AAGAAAAAUGGGUUGUU | 17 | 718 |
| antiSPCas9-416 | + | CCAUUUUUCUUCUCUCC | 17 | 719 |
| antiSPCas9-417 | - | CAUAGUAAAGAAAACUG | 17 | 720 |
| antiSPCas9-418 | - | AUAAGAGACAAGCAAAG | 17 | 721 |
| antiSPCas9-419 | - | GAUGAAGAGAAUAGAAG | 17 | 722 |
| antiSPCas9-420 | + | GGCUGGAGCGCCGAGGU | 17 | 723 |
| antiSPCas9-421 | + | AUUUCCUUAUAUUUCUC | 17 | 724 |
| antiSPCas9-422 | + | CAGAAUAGGCAACUGUA | 17 | 725 |
| antiSPCas9-423 | - | UAUGAAUUUCUUUAAGA | 17 | 726 |
| antiSPCas9-424 | - | AGAAAAUGAAGAACUAU | 17 | 727 |
| antiSPCas9-425 | - | UUACAAGGAAGUAAAAA | 17 | 728 |
| antiSPCas9-426 | - | AGAGAAGAUGGAUGGGA | 17 | 729 |
| antiSPCas9-427 | - | AAAACUGAGGUGCAGAC | 17 | 730 |
| antiSPCas9-428 | + | UAUCUUUAAUUAUCUUU | 17 | 731 |
| antiSPCas9-429 | + | AGAAUAAAAGAAGUAUU | 17 | 732 |
| antiSPCas9-430 | - | AUGAAGAGAAUAGAAGA | 17 | 733 |
| antiSPCas9-431 | - | AAAGAUAAUUAAAGAUA | 17 | 734 |
| antiSPCas9-432 | - | UAUACUUAGAAGGCAGG | 17 | 735 |
| antiSPCas9-433 | - | CAAAGAGGAUAUACAAA | 17 | 736 |
| antiSPCas9-434 | - | CAGUCGAAAAACGGGUACGC | 20 | 737 |
| antiSPCas9-435 | - | CACGCUCGGAUAAGAACCGA | 20 | 738 |
| antiSPCas9-436 | + | UAAGAUAAGCGUCGUGCGCA | 20 | 739 |
| antiSPCas9-437 | - | CGCUCACCUGUUCGACGAUA | 20 | 740 |
| antiSPCas9-438 | + | GAUAAGCGUCGUGCGCAUGG | 20 | 741 |
| antiSPCas9-439 | - | CGAUUCUGUCGAGAUCUCCG | 20 | 742 |
| antiSPCas9-440 | - | AGAGGCGUCGCUAUACGGGC | 20 | 743 |
| antiSPCas9-441 | - | UUAAAGAGGCGUCGCUAUAC | 20 | 744 |
| antiSPCas9-442 | - | AGGCGUCGCUAUACGGGCUG | 20 | 745 |
| antiSPCas9-443 | + | CGCUUUUCGCGAUCAUCUUA | 20 | 746 |
| antiSPCas9-444 | - | AGAGCGACGGCUUCGCCAAU | 20 | 747 |
| antiSPCas9-445 | + | UGAAGCGGAUAACGGCGCCU | 20 | 748 |
| antiSPCas9-446 | - | ACACGCUCGGAUAAGAACCG | 20 | 749 |
| antiSPCas9-447 | - | GAGGCGUCGCUAUACGGGCU | 20 | 750 |
| antiSPCas9-448 | - | GAUGAUCGCGAAAAGCGAAC | 20 | 751 |
| antiSPCas9-449 | - | UAAGGGCCGGGACUUCGCGA | 20 | 752 |
| antiSPCas9-450 | + | CGUAAUGGGACGCUAAAUAC | 20 | 753 |
| antiSPCas9-451 | + | CUCCGGGUAAUUGUGCGAUC | 20 | 754 |
| antiSPCas9-452 | - | UGUCGCGGAAACUUAUCAAC | 20 | 755 |
| antiSPCas9-453 | + | CGCUAGCCAACAUCCGUUUU | 20 | 756 |
| antiSPCas9-454 | + | AAUGAGUGCGGUCCCUACGA | 20 | 757 |
| antiSPCas9-455 | - | UACGCAGGUUAUAUUGACGG | 20 | 758 |
| antiSPCas9-456 | - | UGACGAUCUCGACAAUCUAC | 20 | 759 |
| antiSPCas9-457 | - | GUUAAAGAGGCGUCGCUAUA | 20 | 760 |
| antiSPCas9-458 | + | CGACGUCGUAAUCAGAUAAA | 20 | 761 |
| antiSPCas9-459 | + | UCAUAACCUUAUCGUCGAAC | 20 | 762 |
| antiSPCas9-460 | - | GCUUAUCUUAAUGCCGUCGU | 20 | 763 |
| antiSPCas9-461 | - | AAACGGAUGUUGGCUAGCGC | 20 | 764 |
| antiSPCas9-462 | + | UUGUCGACAUCCGAGUUGUC | 20 | 765 |
| antiSPCas9-463 | - | CAGCUCAAUCGUUCAUCGAG | 20 | 766 |
| antiSPCas9-464 | - | GAUCGAUUUAAUGCGUCACU | 20 | 767 |
| antiSPCas9-465 | - | CUUAUCUUAAUGCCGUCGUA | 20 | 768 |
| antiSPCas9-466 | - | UGACGGCGGAGCGAGUCAAG | 20 | 769 |
| antiSPCas9-467 | + | CUAGCCGUCGGGAUUUAGAG | 20 | 770 |
| antiSPCas9-468 | - | UCAUCGCUCGUAAAAAGGAC | 20 | 771 |
| antiSPCas9-469 | - | CGAGAACGAUAAGCUGAUUC | 20 | 772 |
| antiSPCas9-470 | + | AUGCGAACCGAGAGUUCCCU | 20 | 773 |
| antiSPCas9-471 | - | UAAGCUCAUCGCUCGUAAAA | 20 | 774 |
| antiSPCas9-472 | - | UUGUCGCGGAAACUUAUCAA | 20 | 775 |
| antiSPCas9-473 | - | UCGAUUCUGUCGAGAUCUCC | 20 | 776 |
| antiSPCas9-474 | + | UGUCGCGUCUAGCACCUCCU | 20 | 777 |
| antiSPCas9-475 | - | UGGGACCCGAAAAAGUACGG | 20 | 778 |
| antiSPCas9-476 | + | GGCCUAGUGAGAGCGCUAUA | 20 | 779 |
| antiSPCas9-477 | - | GGAUAAACCCAUACGUGAGC | 20 | 780 |
| antiSPCas9-478 | + | CCGUCGGGAUUUAGAGAGGC | 20 | 781 |
| antiSPCas9-479 | + | UUUUCCGCCUGCUCACGUAU | 20 | 782 |
| antiSPCas9-480 | - | CAUCGCUCGUAAAAAGGACU | 20 | 783 |
| antiSPCas9-481 | - | AACCUUAUAGCGCUCUCACU | 20 | 784 |
| antiSPCas9-482 | - | AUCGACUUCCUUGAGGCGAA | 20 | 785 |
| antiSPCas9-483 | + | CGAUCAGGUUUUCUAGCCGU | 20 | 786 |
| antiSPCas9-484 | + | CGUCGUAUUUCGUAUUCAUU | 20 | 787 |
| antiSPCas9-485 | + | UCGAAGCCACCGUACUUUUU | 20 | 788 |
| antiSPCas9-486 | + | UGCGAACCGAGAGUUCCCUC | 20 | 789 |
| antiSPCas9-487 | - | UAGCGCCGGAGAGCUUCAAA | 20 | 790 |
| antiSPCas9-488 | - | AACCUGAUCGCACAAUUACC | 20 | 791 |
| antiSPCas9-489 | - | GGGUACGCAGGUUAUAUUGA | 20 | 792 |
| antiSPCas9-490 | - | GAGGGAACUCUCGGUUCGCA | 20 | 793 |
| antiSPCas9-491 | - | ACGAGAACGAUAAGCUGAUU | 20 | 794 |
| antiSPCas9-492 | - | CCCGCCUCUCUAAAUCCCGA | 20 | 795 |
| antiSPCas9-493 | - | CGGGCUGGGGACGAUUGUCG | 20 | 796 |
| antiSPCas9-494 | - | CGUAAACCCGCCUUUCUAAG | 20 | 797 |
| antiSPCas9-495 | + | CAUAUAAUCCCGUGAUGGAU | 20 | 798 |
| antiSPCas9-496 | - | UUCGAUUCUGUCGAGAUCUC | 20 | 799 |
| antiSPCas9-497 | + | CGAAGCCACCGUACUUUUUC | 20 | 800 |
| antiSPCas9-498 | - | CCGAAGAAACGAUUACUCCA | 20 | 801 |
| antiSPCas9-499 | + | GUCGUAUUUCGUAUUCAUUC | 20 | 802 |
| antiSPCas9-500 | - | AGCGCCGGAGAGCUUCAAAA | 20 | 803 |
| antiSPCas9-501 | + | UUCUCACCGUCGCGAAGUCC | 20 | 804 |
| antiSPCas9-502 | - | UGAUCUAAAUCCGGACAACU | 20 | 805 |
| antiSPCas9-503 | + | GAUCAGGUUUUCUAGCCGUC | 20 | 806 |
| antiSPCas9-504 | - | GGUUCGCCAGCCAUCAAAAA | 20 | 807 |
| antiSPCas9-505 | + | UUCGCCUCAAGGAAGUCGAU | 20 | 808 |
| antiSPCas9-506 | + | UCGCCUAAGUGGAUUUGAUG | 20 | 809 |
| antiSPCas9-507 | - | UGGUUCGCCAGCCAUCAAAA | 20 | 810 |
| antiSPCas9-508 | + | UCGCCUCAAGGAAGUCGAUG | 20 | 811 |
| antiSPCas9-509 | + | ACCGAGAGUUCCCUCGGGCC | 20 | 812 |
| antiSPCas9-510 | + | AUAGGAGGAUUGCAUCGCUA | 20 | 813 |
| antiSPCas9-511 | + | GCCGUCGGGAUUUAGAGAGG | 20 | 814 |
| antiSPCas9-512 | - | CAAUAAAGUGCUUACACGCU | 20 | 815 |
| antiSPCas9-513 | + | AUUUUCCGCCUGCUCACGUA | 20 | 816 |
| antiSPCas9-514 | - | GAACCCCAUCGACUUCCUUG | 20 | 817 |
| antiSPCas9-515 | - | GCGCCGGAGAGCUUCAAAAG | 20 | 818 |
| antiSPCas9-516 | - | ACGAUACACUUCUACCAAGG | 20 | 819 |
| antiSPCas9-517 | - | AAAUGGCCGAAAACGGAUGU | 20 | 820 |
| antiSPCas9-518 | + | UAGCAUGCAAUUCGCCUAAG | 20 | 821 |
| antiSPCas9-519 | - | UAAGCGCAUACAACAAGCAC | 20 | 822 |
| antiSPCas9-520 | + | UUUCGCCUCAAGGAAGUCGA | 20 | 823 |
| antiSPCas9-521 | + | UGAAUGCGGCUGGAGCGCCG | 20 | 824 |
| antiSPCas9-522 | + | GUGCAAUGAGUCCCCUUGUC | 20 | 825 |
| antiSPCas9-523 | - | UGCAAGUGGCGUGGAUGCGA | 20 | 826 |
| antiSPCas9-524 | - | AAGCAGCGGACUUUCGACAA | 20 | 827 |
| antiSPCas9-525 | - | UAAACCCAUACGUGAGCAGG | 20 | 828 |
| antiSPCas9-526 | - | CCCUAUAAAUGCAAGUGGCG | 20 | 829 |
| antiSPCas9-527 | - | UUUCGCAUACCUUACUAUGU | 20 | 830 |
| antiSPCas9-528 | + | GCGUUAUCAGUUUCGCAUUU | 20 | 831 |
| antiSPCas9-529 | - | GGUCAUGGGACGUCACAAAC | 20 | 832 |
| antiSPCas9-530 | + | CGAGAGUUCCCUCGGGCCAG | 20 | 833 |
| antiSPCas9-531 | + | UUCUUUACGACUUCCUCGCU | 20 | 834 |
| antiSPCas9-532 | - | CAAACGAUACACUUCUACCA | 20 | 835 |
| antiSPCas9-533 | - | ACCUUACUAUGUGGGACCCC | 20 | 836 |
| antiSPCas9-534 | + | GAUUGCAUCGCUAAGGUUUU | 20 | 837 |
| antiSPCas9-535 | - | CUUUCGCAUACCUUACUAUG | 20 | 838 |
| antiSPCas9-536 | + | UUGAUCAUUGAAGCGGAUAA | 20 | 839 |
| antiSPCas9-537 | - | CUCGAUUUUCUAAAGAGCGA | 20 | 840 |
| antiSPCas9-538 | + | UCGAAGUUCGACUUAAAAUU | 20 | 841 |
| antiSPCas9-539 | + | AGGCAGUUGCUGACGGACUA | 20 | 842 |
| antiSPCas9-540 | - | UAUCCGCUUCAAUGAUCAAA | 20 | 843 |
| antiSPCas9-541 | - | GACUGGGACCCGAAAAAGUA | 20 | 844 |
| antiSPCas9-542 | + | CCGAGAGUUCCCUCGGGCCA | 20 | 845 |
| antiSPCas9-543 | - | GCAUGCUAUACUUAGAAGGC | 20 | 846 |
| antiSPCas9-544 | - | AAUCGUAUGGGAUAAGGGCC | 20 | 847 |
| antiSPCas9-545 | + | GUCCUUACUAAGCUGCAAUU | 20 | 848 |
| antiSPCas9-546 | + | UGUUCUCCGCUUAGAAAGGC | 20 | 849 |
| antiSPCas9-547 | - | CGACCUUUAAUUGAAACCAA | 20 | 850 |
| antiSPCas9-548 | - | AAAUCGUAUGGGAUAAGGGC | 20 | 851 |
| antiSPCas9-549 | - | GAACAUAUUGCGAAUCUUGC | 20 | 852 |
| antiSPCas9-550 | + | GAGCUGACGUUUAAUAAAUC | 20 | 853 |
| antiSPCas9-551 | + | CUUAACUGUCACUUUGCGGU | 20 | 854 |
| antiSPCas9-552 | + | AUUAAAUCGAUCUUCUACCC | 20 | 855 |
| antiSPCas9-553 | - | GGCACAGGUUUCCGGACAAG | 20 | 856 |
| antiSPCas9-554 | + | CACAUAGUAAGGUAUGCGAA | 20 | 857 |
| antiSPCas9-555 | + | AGUAAGGUAUGCGAAAGGUU | 20 | 858 |
| antiSPCas9-556 | + | CCAUGGAGUAAUCGUUUCUU | 20 | 859 |
| antiSPCas9-557 | + | CGGGUAUUUCUUAAUGAGUG | 20 | 860 |
| antiSPCas9-558 | - | UAUGUGGGACCCCUGGCCCG | 20 | 861 |
| antiSPCas9-559 | + | CCUUGUAACCUUUCGCCUCA | 20 | 862 |
| antiSPCas9-560 | + | UCCACGCCACUUGCAUUUAU | 20 | 863 |
| antiSPCas9-561 | - | UCCCAUUACGAGAAGUUGAA | 20 | 864 |
| antiSPCas9-562 | - | AUUGGUGUCGGACUUCAGAA | 20 | 865 |
| antiSPCas9-563 | + | AGUUUCAUAUAAUCCCGUGA | 20 | 866 |
| antiSPCas9-564 | - | GGUGAAAUCGUAUGGGAUAA | 20 | 867 |
| antiSPCas9-565 | - | AUUAUUGGGGAUAACGAUUA | 20 | 868 |
| antiSPCas9-566 | - | UCACGGGAUUAUAUGAAACU | 20 | 869 |
| antiSPCas9-567 | - | AAGUGACAAUGUUCCAAGCG | 20 | 870 |
| antiSPCas9-568 | - | GCGAAAAGCGAACAGGAGAU | 20 | 871 |
| antiSPCas9-569 | - | GGAGACAGGUGAAAUCGUAU | 20 | 872 |
| antiSPCas9-570 | + | ACCUUUCAACUUCUCGUAAU | 20 | 873 |
| antiSPCas9-571 | - | GCAGACCGGAGGGUUUUCAA | 20 | 874 |
| antiSPCas9-572 | + | UGCCACUACUAGGACAGAAU | 20 | 875 |
| antiSPCas9-573 | + | CCACGCCACUUGCAUUUAUA | 20 | 876 |
| antiSPCas9-574 | - | AUUUAUUAAACGUCAGCUCG | 20 | 877 |
| antiSPCas9-575 | + | AACCUUUCAACUUCUCGUAA | 20 | 878 |
| antiSPCas9-576 | - | CGAAAAUCAAACGACUCAGA | 20 | 879 |
| antiSPCas9-577 | - | UCUUUGAUCAGUCGAAAAAC | 20 | 880 |
| antiSPCas9-578 | + | CGGUAAAUUCUUGUCAAAGU | 20 | 881 |
| antiSPCas9-579 | - | AUGUGGGACCCCUGGCCCGA | 20 | 882 |
| antiSPCas9-580 | - | CGGAUAGAUUUGUCACAGCU | 20 | 883 |
| antiSPCas9-581 | + | UCGACUUAAAAUUUGGUGUC | 20 | 884 |
| antiSPCas9-582 | - | CAUCCUAGCUGAUGCCAAUC | 20 | 885 |
| antiSPCas9-583 | + | CAUCCACUACUUUGACUGUC | 20 | 886 |
| antiSPCas9-584 | - | AGGCACAGGUUUCCGGACAA | 20 | 887 |
| antiSPCas9-585 | + | GCCAGGGGUCCCACAUAGUA | 20 | 888 |
| antiSPCas9-586 | + | UCGUAAAGUAAACUGUGCUU | 20 | 889 |
| antiSPCas9-587 | + | CAGGCAGUUGCUGACGGACU | 20 | 890 |
| antiSPCas9-588 | - | CUGAUUCACCAAUCCAUCAC | 20 | 891 |
| antiSPCas9-589 | - | UGCCUAUUCUGUCCUAGUAG | 20 | 892 |
| antiSPCas9-590 | - | GAUGAGCUAGUUAAGGUCAU | 20 | 893 |
| antiSPCas9-591 | + | AGUAUGCCCUUUUUGAUGGC | 20 | 894 |
| antiSPCas9-592 | - | GGGAGACAGGUGAAAUCGUA | 20 | 895 |
| antiSPCas9-593 | + | GAUUGAAUCGUCCUUCAAAA | 20 | 896 |
| antiSPCas9-594 | + | CUGUUCUCCGCUUAGAAAGG | 20 | 897 |
| antiSPCas9-595 | - | AAGAUCUACUGCGAAAGCAG | 20 | 898 |
| antiSPCas9-596 | - | UUGUCUGAACUUGACAAGGC | 20 | 899 |
| antiSPCas9-597 | + | UGCGGCUGGAGCGCCGAGGU | 20 | 900 |
| antiSPCas9-598 | - | CAUGUAUGUUGAUCAGGAAC | 20 | 901 |
| antiSPCas9-599 | - | GACAAUCUACUGGCACAAAU | 20 | 902 |
| antiSPCas9-600 | - | CCUUGAGGCGAAAGGUUACA | 20 | 903 |
| antiSPCas9-601 | + | GCUUAAUACUUUGUCCAGAU | 20 | 904 |
| antiSPCas9-602 | - | AGGUGAAAUCGUAUGGGAUA | 20 | 905 |
| antiSPCas9-603 | - | AAGGCACAGGUUUCCGGACA | 20 | 906 |
| antiSPCas9-604 | + | AUCGUCCUUCAAAAAGGAUU | 20 | 907 |
| antiSPCas9-605 | + | CAGCUGCAUAAAGUUCCUAU | 20 | 908 |
| antiSPCas9-606 | - | GAUCUUAAAGGAGCAUCCUG | 20 | 909 |
| antiSPCas9-607 | + | GUACCUUUUGAUCAUUGAAG | 20 | 910 |
| antiSPCas9-608 | - | UGAAGAUCGGGAAAUGAUUG | 20 | 911 |
| antiSPCas9-609 | - | UGCCAAAUUGCAGCUUAGUA | 20 | 912 |
| antiSPCas9-610 | - | GGAUGAGCUAGUUAAGGUCA | 20 | 913 |
| antiSPCas9-611 | + | CGAUUCCUUUGAAAACCCUC | 20 | 914 |
| antiSPCas9-612 | + | CUUCUGUUCUCCGCUUAGAA | 20 | 915 |
| antiSPCas9-613 | - | UUUGAGGAAGUUGUCGAUAA | 20 | 916 |
| antiSPCas9-614 | + | UCAAAAUACUUGAAUGCGGC | 20 | 917 |
| antiSPCas9-615 | - | ACUGGGCAGCCAGAUCUUAA | 20 | 918 |
| antiSPCas9-616 | - | GAUAGAUUUGUCACAGCUUG | 20 | 919 |
| antiSPCas9-617 | + | CCUUGAGAAGUGUCAAGUCU | 20 | 920 |
| antiSPCas9-618 | + | AUCUCGAUUACAAUGUUUUC | 20 | 921 |
| antiSPCas9-619 | + | UCACGAUUGUCUUUGAGGAA | 20 | 922 |
| antiSPCas9-620 | + | CUGGAGUAUGCCCUUUUUGA | 20 | 923 |
| antiSPCas9-621 | + | AAAGUUUCUCGUUCUGCAAU | 20 | 924 |
| antiSPCas9-622 | - | UUGUUUACUCUUACCAACCU | 20 | 925 |
| antiSPCas9-623 | - | AAGCGCAUACAACAAGCACA | 20 | 926 |
| antiSPCas9-624 | + | AAUCGUCCUUCAAAAAGGAU | 20 | 927 |
| antiSPCas9-625 | + | UGCAAUUGGGUAUUUUCCAC | 20 | 928 |
| antiSPCas9-626 | + | CUCUCAGUAUGUCAGAUAGG | 20 | 929 |
| antiSPCas9-627 | + | UGCUUCUGUUCGUUAUCUUC | 20 | 930 |
| antiSPCas9-628 | - | GGAUAGAUUUGUCACAGCUU | 20 | 931 |
| antiSPCas9-629 | - | UGUACCCCAAUCCUUUUUGA | 20 | 932 |
| antiSPCas9-630 | - | UGGCUUGUCUGAACUUGACA | 20 | 933 |
| antiSPCas9-631 | - | AAGGGACAUGUAUGUUGAUC | 20 | 934 |
| antiSPCas9-632 | + | GAUUUCACCUGUCUCCCCAU | 20 | 935 |
| antiSPCas9-633 | + | UUAGGCAAUACUUUUUCGUU | 20 | 936 |
| antiSPCas9-634 | + | UAACUCUCAGUAUGUCAGAU | 20 | 937 |
| antiSPCas9-635 | + | GUUCCCCUUUUGAAGCUCUC | 20 | 938 |
| antiSPCas9-636 | - | UCAGUAUGCGGACUUAUUUU | 20 | 939 |
| antiSPCas9-637 | + | UCUCAACUUUUGCCACUACU | 20 | 940 |
| antiSPCas9-638 | + | GAUUAUAGGUUUGUACUAAC | 20 | 941 |
| antiSPCas9-639 | - | GACCUUUAAUUGAAACCAAU | 20 | 942 |
| antiSPCas9-640 | - | AGGAAUCGAUUCUUCCAAAA | 20 | 943 |
| antiSPCas9-641 | - | CUUUAAGACGGAAAUCACUC | 20 | 944 |
| antiSPCas9-642 | + | AAGUUUCUCGUUCUGCAAUU | 20 | 945 |
| antiSPCas9-643 | + | GUGCAACAUGCUUUGUGAUU | 20 | 946 |
| antiSPCas9-644 | - | AUUGAAACCAAUGGGGAGAC | 20 | 947 |
| antiSPCas9-645 | - | ACUCCAGACAGUCAAAGUAG | 20 | 948 |
| antiSPCas9-646 | - | AAUUGCAUGCUAUACUUAGA | 20 | 949 |
| antiSPCas9-647 | + | AACUCAAACAGACUAUACUU | 20 | 950 |
| antiSPCas9-648 | - | GAUUACUCCAUGGAAUUUUG | 20 | 951 |
| antiSPCas9-649 | - | GGAAAACAUUGUAAUCGAGA | 20 | 952 |
| antiSPCas9-650 | - | AGUAGUGGAUGAGCUAGUUA | 20 | 953 |
| antiSPCas9-651 | + | CAGGAUGCUCCUUUAAGAUC | 20 | 954 |
| antiSPCas9-652 | - | CAUUGAGGGUGAUCUAAAUC | 20 | 955 |
| antiSPCas9-653 | - | CCAAGACUUGACACUUCUCA | 20 | 956 |
| antiSPCas9-654 | + | UCCCCAUUGGUUUCAAUUAA | 20 | 957 |
| antiSPCas9-655 | - | AUAACUUAACUAAAGCUGAG | 20 | 958 |
| antiSPCas9-656 | + | CCCAUCCAUCUUCUCUAAUA | 20 | 959 |
| antiSPCas9-657 | - | GAGAACCCUAUAAAUGCAAG | 20 | 960 |
| antiSPCas9-658 | - | AAAACUGAGGUGCAGACCGG | 20 | 961 |
| antiSPCas9-659 | - | GGCAAAAAAACAGUCGAGAG | 20 | 962 |
| antiSPCas9-660 | + | AGGAAAUUCACGUAUUUAGA | 20 | 963 |
| antiSPCas9-661 | - | AAGCGAACAGGAGAUAGGCA | 20 | 964 |
| antiSPCas9-662 | - | UCUUACCCUCUUUGAAGAUC | 20 | 965 |
| antiSPCas9-663 | - | CCCUGGCCCGAGGGAACUCU | 20 | 966 |
| antiSPCas9-664 | - | CGAAAUCAUAGAGCAAAUUU | 20 | 967 |
| antiSPCas9-665 | - | UUCUUUGAUCAGUCGAAAAA | 20 | 968 |
| antiSPCas9-666 | - | UGACUCUUUAACCUUCAAAG | 20 | 969 |
| antiSPCas9-667 | + | AGGACAGAAUAGGCAACUGU | 20 | 970 |
| antiSPCas9-668 | - | AGUUAAUACUGAGAUUACCA | 20 | 971 |
| antiSPCas9-669 | - | ACCUUUAAUUGAAACCAAUG | 20 | 972 |
| antiSPCas9-670 | - | AUUCCACAUCAAAUCCACUU | 20 | 973 |
| antiSPCas9-671 | + | AGCUUAUCACUAUUCCUUUU | 20 | 974 |
| antiSPCas9-672 | + | UGUCCAGAUUGGCAUCAGCU | 20 | 975 |
| antiSPCas9-673 | - | GAAAGUUAAGUAUGUCACUG | 20 | 976 |
| antiSPCas9-674 | + | AACAUGCUUUGUGAUUUGGC | 20 | 977 |
| antiSPCas9-675 | + | CAUUUCCCGAUCUUCAAAGA | 20 | 978 |
| antiSPCas9-676 | - | CCAUAUUAGAGAAGAUGGAU | 20 | 979 |
| antiSPCas9-677 | - | UACCUCUAUUACCUACAAAA | 20 | 980 |
| antiSPCas9-678 | - | AUAGAUUUGUCACAGCUUGG | 20 | 981 |
| antiSPCas9-679 | + | GGUUGGUAAGAGUAAACAAA | 20 | 982 |
| antiSPCas9-680 | + | UCAUUUCCCGAUCUUCAAAG | 20 | 983 |
| antiSPCas9-681 | - | ACGGAAAUCACUCUGGCAAA | 20 | 984 |
| antiSPCas9-682 | + | UGAAGGUUAAAGAGUCAUCA | 20 | 985 |
| antiSPCas9-683 | + | CUCUUCAAACAACUGAUUAU | 20 | 986 |
| antiSPCas9-684 | + | CUUCAUUCUCUUCGUUAUCC | 20 | 987 |
| antiSPCas9-685 | - | AUACAAAAGGCACAGGUUUC | 20 | 988 |
| antiSPCas9-686 | - | GUAGUGGCAAAAGUUGAGAA | 20 | 989 |
| antiSPCas9-687 | - | AGUCAGUCAAAGAAUUAUUG | 20 | 990 |
| antiSPCas9-688 | - | GCAACUGCCUGAGAAAUAUA | 20 | 991 |
| antiSPCas9-689 | - | CUAGAAAGUGAGUUUGUGUA | 20 | 992 |
| antiSPCas9-690 | + | GAACAUUGUCACUUUUCCCU | 20 | 993 |
| antiSPCas9-691 | - | CCCAUAUUAGAGAAGAUGGA | 20 | 994 |
| antiSPCas9-692 | + | CAACAUGCUUUGUGAUUUGG | 20 | 995 |
| antiSPCas9-693 | + | ACAUGUCCCUUCCAUUUUGU | 20 | 996 |
| antiSPCas9-694 | - | CUCUUACCCUCUUUGAAGAU | 20 | 997 |
| antiSPCas9-695 | - | ACAAAUUGGAGAUCAGUAUG | 20 | 998 |
| antiSPCas9-696 | - | AAACUGAGGUGCAGACCGGA | 20 | 999 |
| antiSPCas9-697 | - | UACCCGGAGAGAAGAAAAAU | 20 | 1000 |
| antiSPCas9-698 | - | UUAACUAAAGCUGAGAGGGG | 20 | 1001 |
| antiSPCas9-699 | - | GAAGUCAGUCAAAGAAUUAU | 20 | 1002 |
| antiSPCas9-700 | - | AAAGUUAAGUAUGUCACUGA | 20 | 1003 |
| antiSPCas9-701 | - | UCUAUUACCUACAAAAUGGA | 20 | 1004 |
| antiSPCas9-702 | - | AACUUAACUAAAGCUGAGAG | 20 | 1005 |
| antiSPCas9-703 | - | AAUUAAAGAUAAGGACUUCC | 20 | 1006 |
| antiSPCas9-704 | - | AGUAGUGGCAAAAGUUGAGA | 20 | 1007 |
| antiSPCas9-705 | - | AGAGGAUAUACAAAAGGCAC | 20 | 1008 |
| antiSPCas9-706 | + | UCUUUUCACGAUUGUCUUUG | 20 | 1009 |
| antiSPCas9-707 | - | CAAACCCAUAUUAGAGAAGA | 20 | 1010 |
| antiSPCas9-708 | + | UGUGUCAAAAUACUUGAAUG | 20 | 1011 |
| antiSPCas9-709 | - | GACAGUUAAGCAAUUGAAAG | 20 | 1012 |
| antiSPCas9-710 | - | GAAGAGGGUAUUAAAGAACU | 20 | 1013 |
| antiSPCas9-711 | + | UUCCAUUUUGUAGGUAAUAG | 20 | 1014 |
| antiSPCas9-712 | - | GCGGAUGAAGAGAAUAGAAG | 20 | 1015 |
| antiSPCas9-713 | - | CUAUUACCUACAAAAUGGAA | 20 | 1016 |
| antiSPCas9-714 | + | AUUGCUUAACUGUCACUUUG | 20 | 1017 |
| antiSPCas9-715 | - | AGUCUGUUUGAGUUAGAAAA | 20 | 1018 |
| antiSPCas9-716 | + | ACAAACUCACUUUCUAGCUU | 20 | 1019 |
| antiSPCas9-717 | - | AAAAUCAAACGACUCAGAAG | 20 | 1020 |
| antiSPCas9-718 | - | AGAAGAGGGUAUUAAAGAAC | 20 | 1021 |
| antiSPCas9-719 | + | CAAACUCACUUUCUAGCUUC | 20 | 1022 |
| antiSPCas9-720 | - | UUACCCGGAGAGAAGAAAAA | 20 | 1023 |
| antiSPCas9-721 | + | AUUUCUCAGGCAGUUGCUGA | 20 | 1024 |
| antiSPCas9-722 | - | AGUUAGAAAAUGGCCGAAAA | 20 | 1025 |
| antiSPCas9-723 | - | UAACUUAACUAAAGCUGAGA | 20 | 1026 |
| antiSPCas9-724 | + | GGACAGAAUAGGCAACUGUA | 20 | 1027 |
| antiSPCas9-725 | - | AAGUCAGUCAAAGAAUUAUU | 20 | 1028 |
| antiSPCas9-726 | - | AGGUUAUGAAACAGUUAAAG | 20 | 1029 |
| antiSPCas9-727 | + | UUUGACUGACUUCAGUUUCU | 20 | 1030 |
| antiSPCas9-728 | + | CAACCCAUUUUUCUUCUCUC | 20 | 1031 |
| antiSPCas9-729 | + | UCGUCCUUCAAAAAGGAUUG | 20 | 1032 |
| antiSPCas9-730 | + | UACUAUGUUGACUUGGGGCA | 20 | 1033 |
| antiSPCas9-731 | - | UGCUAUACUUAGAAGGCAGG | 20 | 1034 |
| antiSPCas9-732 | + | ACAACUUCCUCAAAAUUCCA | 20 | 1035 |
| antiSPCas9-733 | - | UUUAAAGUCAAAAUUGGUGU | 20 | 1036 |
| antiSPCas9-734 | - | CGGAUGAAGAGAAUAGAAGA | 20 | 1037 |
| antiSPCas9-735 | + | CUUUUGUAUAUCCUCUUUGA | 20 | 1038 |
| antiSPCas9-736 | + | AACCCAUUUUUCUUCUCUCC | 20 | 1039 |
| antiSPCas9-737 | + | CCAUCCAUCUUCUCUAAUAU | 20 | 1040 |
| antiSPCas9-738 | - | AUUAGAGAAGAUGGAUGGGA | 20 | 1041 |
| antiSPCas9-739 | - | ACUGAUUCACCAAUCCAUCA | 20 | 1042 |
| antiSPCas9-740 | - | CCUAAAGAUAAUUAAAGAUA | 20 | 1043 |
| antiSPCas9-741 | - | GGGAUAAGAGACAAGCAAAG | 20 | 1044 |
| antiSPCas9-742 | + | UUCUUUACUAUGUUGACUUG | 20 | 1045 |
| antiSPCas9-743 | - | GAAAAUCAAACGACUCAGAA | 20 | 1046 |
| antiSPCas9-744 | + | UUUCUUUACUAUGUUGACUU | 20 | 1047 |
| antiSPCas9-745 | + | CCUUAUCUUUAAUUAUCUUU | 20 | 1048 |
| antiSPCas9-746 | - | AAUCACUUUAAAGUCAAAAU | 20 | 1049 |
| antiSPCas9-747 | - | AGAAAAUGAAGAACUAUUGG | 20 | 1050 |
| antiSPCas9-748 | + | GUUAGAAUAAAAGAAGUAUU | 20 | 1051 |
| antiSPCas9-749 | - | CAACAUAGUAAAGAAAACUG | 20 | 1052 |
| antiSPCas9-750 | - | AGGUUACAAGGAAGUAAAAA | 20 | 1053 |
| antiSPCas9-751 | + | UAUCUUUAAUUAUCUUUAGG | 20 | 1054 |
| antiSPCas9-752 | - | GAGAAGAAAAAUGGGUUGUU | 20 | 1055 |
| antiSPCas9-753 | - | CAUUAUGAAUUUCUUUAAGA | 20 | 1056 |
| antiSPCas9-754 | + | UUUUCUUUACUAUGUUGACU | 20 | 1057 |
| antiSPCas9-755 | - | AUUUUCAAUUCUAUAAAGUU | 20 | 1058 |
| antiSPCas9-756 | + | AAUAUUUCCUUAUAUUUCUC | 20 | 1059 |
| antiSPCas9-757 | - | UUUUCAAUUCUAUAAAGUUA | 20 | 1060 |
| antiSPCas9-758 | - | UAAAGAAAAUGAAGAACUAU | 20 | 1061 |
| antiSPCas9-759 | - | AAGAAAACUGAGGUGCAGAC | 20 | 1062 |
| antiSPCas9-760 | - | CUUCAAAGAGGAUAUACAAA | 20 | 1063 |
| TABLE E-7 |
| Exemplary guide RNA pairs for S. aureus (SA) nickase |
| Group A | Group B | ||
| antiSACas9-8, | antiSACas9-5 | Group A guides can be | |
| antiSACas9-9 | antiSACas9-2 | paired with any from | |
| Group B. | |||
| Group C | Group D | ||
| antiSACas9-7 | antiSACas9-11 | Group C guides can be | |
| paired with any from | |||
| Group D. | |||
| TABLE E-8 | ||
| First 500 bp of coding sequence downstream of | ||
| S. aureus | start codon, good orthogonality, starts with G |
| 1st Tier | DNA | Target Site | SEQ | |
| gRNA Name | Strand | Targeting Domain | Length | ID NO |
| antiSACas9-1 | - | GGACAUCGGGAUUACAAGCG | 20 | 1064 |
| antiSACas9-2 | + | GUAAUCCCGAUGUCCAGCCC | 20 | 1065 |
| antiSACas9-5 | - | GGAAUUAAUCCUUAUGAAGC | 20 | 1068 |
| antiSACas9-6 | + | GCCUUUCACCCUGGCUUCAU | 20 | 1069 |
| TABLE E-9 | ||
| First 500 bp of coding sequence downstream of start | ||
| S. aureus | codon, good orthogonality, does not start with G |
| 2nd Tier | DNA | Target Site | SEQ | |
| gRNA Name | Strand | Targeting Domain | Length | ID NO |
| antiSACas9-7 | - | CUGCACCUGGCUAAGCGCCG | 20 | 1070 |
| antiSACas9-8 | - | ACCGACCAUUCUGAGCUGAG | 20 | 1071 |
| antiSACas9-9 | - | UGCUGACCGACCAUUCUGAG | 20 | 1072 |
| antiSACas9-10 | + | AACAGCAGUUUCUUCACCCU | 20 | 1073 |
| antiSACas9-ll | + | AGGAUUAAUUCCACUCAGCU | 20 | 1074 |
| antiSACas9-12 | - | UACAUUCUGGGGCUGGACAU | 20 | 1075 |
| antiSACas9-13 | - | AUGAAGCCAGGGUGAAAGGC | 20 | 1076 |
| antiSACas9-14 | - | CUGAAACGACGGAGAAGGCA | 20 | 1079 |
| antiSACas9-15 | - | CGGAGAAGGCACAGAAUCCA | 20 | 1080 |
| TABLE E-10 | ||
| First 500 bp of coding sequence downstream of | ||
| S. aureus | start codon, poor orthogonality, starts with G |
| 3rd Tier | DNA | Target Site | SEQ | |
| gRNA Name | Strand | Targeting Domain | Length | ID NO |
| antiSACas9-16 | - | GAGUCAGAAGCUGUCAGAGG | 20 | 1081 |
| antiSACas9-17 | - | GAAGAAAGAUGGCGAGGUGA | 20 | 1082 |
| antiSACas9-18 | - | GGGAUUACAAGCGUGGGGUA | 20 | 1083 |
| TABLE E-11 | ||
| S. aureus | Rest of gene |
| 5th Tier | DNA | Target Site | SEQ | |
| gRNA Name | Strand | Targeting Domain | Length | ID NO |
| antiSACas9-19 | - | GAUACGCUACUCGCGGCCUG | 20 | 1084 |
| antiSACas9-20 | + | AUGAUCGACCUCGUAGUUGA | 20 | 1085 |
| antiSACas9-21 | - | AUGAAUGAUAAGCGCCCCCC | 20 | 1086 |
| antiSACas9-22 | - | ACGCAGAUCUGUACAACGCC | 20 | 1087 |
| antiSACas9-23 | - | ACUACAAGUACUCUCACCGG | 20 | 1088 |
| antiSACas9-24 | + | CGCCGUUGUCCAGAUAGACA | 20 | 1089 |
| antiSACas9-25 | - | UCAUUGAGAACGCCGAACUG | 20 | 1090 |
| antiSACas9-26 | + | UAAUAUGAUCGACCUCGUAG | 20 | 1091 |
| antiSACas9-27 | + | GCGUUCUCUUUCCCGGUAGU | 20 | 1092 |
| antiSACas9-28 | - | GGCGAACUGUAUAGGGUCAU | 20 | 1093 |
| antiSACas9-29 | - | GCCCGAAAUCGAGACAGAAC | 20 | 1094 |
| antiSACas9-30 | - | AUCUGCUGAACCGCAUUGAA | 20 | 1095 |
| antiSACas9-31 | + | CCGUUCAGAUUGUUCACAAU | 20 | 1096 |
| antiSACas9-32 | + | UCGGAGCUCUGGUAGAUAGU | 20 | 1097 |
| antiSACas9-33 | + | GACCACCUUGUUGCGACUGU | 20 | 1098 |
| antiSACas9-34 | + | UUUGUAUGCCACAGCUCAUC | 20 | 1099 |
| antiSACas9-35 | + | GGGCUUUUUAUCCACCCGGU | 20 | 1100 |
| antiSACas9-36 | + | GUUGAGUACUUUUUGAUACU | 20 | 1101 |
| antiSACas9-37 | - | AAGAUCAAUGGCGAACUGUA | 20 | 1102 |
| antiSACas9-38 | - | GAAAGUCAAGUCCAUCAACG | 20 | 1103 |
| antiSACas9-39 | + | GGUCCCUCAUAGUAGGUUCU | 20 | 1104 |
| antiSACas9-40 | - | CCUAUUUCCGGGUGAACAAU | 20 | 1105 |
| antiSACas9-41 | + | CGCAGCAGAUUCAUCAGGCC | 20 | 1106 |
| antiSACas9-42 | + | CAGGUUUCCCAGAAUGUCGG | 20 | 1107 |
| antiSACas9-43 | - | CGAACAGAUUAGUAAUCUGA | 20 | 1108 |
| antiSACas9-44 | + | CCAGAUUGUUCACCCGGAAA | 20 | 1109 |
| antiSACas9-45 | + | AAAUCGUCCACCAGUGUGGU | 20 | 1110 |
| antiSACas9-46 | - | CUUCGGAUGGAAAGACAUCA | 20 | 1111 |
| antiSACas9-47 | - | AAAUGCCGACUUCAUCUUUA | 20 | 1112 |
| antiSACas9-48 | - | UCAACAGAUUCUCCGUCCAG | 20 | 1113 |
| antiSACas9-49 | + | GCGUUGAUCACUUUGAUGCU | 20 | 1114 |
| antiSACas9-50 | - | AAGGACUACAAGUACUCUCA | 20 | 1115 |
| antiSACas9-51 | + | CUCCGCUUGACCACGGGUGA | 20 | 1116 |
| antiSACas9-52 | - | GGUGACAAGCACUGGAAAAC | 20 | 1117 |
| antiSACas9-53 | - | ACCUGACCAAGUAUAGCAAA | 20 | 1118 |
| antiSACas9-54 | + | GGAUGAAGCUCCGCUUGACC | 20 | 1119 |
| antiSACas9-55 | - | CCGCAUCAGCAAGACCAAAA | 20 | 1120 |
| antiSACas9-56 | - | UCCAGAAGGAUUUUAUUAAC | 20 | 1121 |
| antiSACas9-57 | + | UUGAUAUGCUUGAUCUGGUG | 20 | 1122 |
| antiSACas9-58 | - | UGUAUAAAUUUGUGACUGUC | 20 | 1123 |
| antiSACas9-59 | - | CUCACCAGAUCAAGCAUAUC | 20 | 1124 |
| antiSACas9-60 | - | UGCAGAAGGCUUACCACCAG | 20 | 1125 |
| antiSACas9-61 | + | UUGAUGUCCUCUUCGUUGAC | 20 | 1126 |
| antiSACas9-62 | + | CUAAUCUGUUCGAUCUCUUC | 20 | 1127 |
| antiSACas9-63 | + | GACCAGCACCUUGUUGUUAA | 20 | 1128 |
| antiSACas9-64 | - | GAAGAGGACAUCAAGGGCUA | 20 | 1129 |
| antiSACas9-65 | + | UAAUAAAAUCCUUCUGGACG | 20 | 1130 |
| antiSACas9-66 | - | UGGUCCCAAAAAAGGUGGAC | 20 | 1131 |
| antiSACas9-67 | + | CUCUUCAUAGUACUUAUACA | 20 | 1132 |
| antiSACas9-68 | - | AAUCUGCUGCGAUCCUAUUU | 20 | 1133 |
| antiSACas9-69 | + | GAACUAGACAGGUACUGGAA | 20 | 1134 |
| antiSACas9-70 | + | AAAGGUUUCGUAAGAGAUCU | 20 | 1135 |
| antiSACas9-71 | + | CCCUUUCCUUUGGCCAGAUU | 20 | 1136 |
| antiSACas9-72 | + | UCGUCUUUUCUUGUACUAUA | 20 | 1137 |
| antiSACas9-73 | + | AGGAGUCCUAUUGCCCUUUU | 20 | 1138 |
| antiSACas9-74 | - | UAUGAUUGACAUCACUUACC | 20 | 1139 |
| antiSACas9-75 | + | UUCACCUCAUACAGGUUUCC | 20 | 1140 |
| antiSACas9-76 | + | CUCCAGGGGGAUGGCCUCCA | 20 | 1141 |
| antiSACas9-77 | - | UGAAAGCUAUCAAUCUGAUU | 20 | 1142 |
| antiSACas9-78 | - | UCAAGUACUAUGGGAACAAG | 20 | 1143 |
| antiSACas9-79 | - | UGAACAACCUGGUCAUCACC | 20 | 1144 |
| antiSACas9-80 | + | UUGUUCAGCAGGUCCUCCAG | 20 | 1145 |
| antiSACas9-81 | - | ACCGAGAGUAUCUGGAAAAC | 20 | 1146 |
| antiSACas9-82 | - | GUUUAAAAAGGAGCGCAACA | 20 | 1147 |
| antiSACas9-83 | + | CUUCAGUUUCUGAUAUGUCU | 20 | 1148 |
| antiSACas9-84 | - | AAACAAUUGCCUCUAAGACU | 20 | 1149 |
| antiSACas9-85 | - | GAAAAAGAUUAGCAACCAGG | 20 | 1150 |
| antiSACas9-86 | - | CAGGGAUGAAAACGAGAAAC | 20 | 1151 |
| antiSACas9-87 | + | UUCAGGUUAGUCAGCUCUUC | 20 | 1152 |
| antiSACas9-88 | + | UUGUCGAAGGACACGCUUCU | 20 | 1153 |
| antiSACas9-89 | - | AAACCUUUAAAAAGCACAUU | 20 | 1154 |
| antiSACas9-90 | - | ACCAGGAGAAGGGAGCCCCU | 20 | 1155 |
| antiSACas9-91 | - | GUACAAGAAAAGACGAUAAG | 20 | 1156 |
| antiSACas9-92 | - | GAUGUUCGAAGAGAAGCAGG | 20 | 1157 |
| antiSACas9-93 | - | AAAAGGAGAACUACUAUGAA | 20 | 1158 |
| antiSACas9-94 | - | AAUUUGUGACUGUCAAGAAU | 20 | 1159 |
| TABLE E-12 | ||
| S. aureus | Suboptimal PAM-NNGRRV |
| 6th Tier | DNA | Target Site | SEQ | |
| gRNA Name | Strand | Targeting Domain | Length | ID NO |
| antiSACas9-95 | + | GAAGCAGGCCGAAUCUAUGC | 20 | 1160 |
| antiSACas9-96 | + | AGGAAUGGUACGAGAUGCUG | 20 | 1161 |
| antiSACas9-97 | + | UCCGGGUGAACAAUCUGGAU | 20 | 1162 |
| antiSACas9-98 | + | AGACUCGGAGAACCUACUAU | 20 | 1163 |
| antiSACas9-99 | + | GGACGCACAGAAGAUGAUCA | 20 | 1164 |
| antiSACas9-100 | - | UCACAUCCAGAUUGUUCACC | 20 | 1165 |
| antiSACas9-101 | + | GGAGAAGGGAGCCCCUUCGG | 20 | 1166 |
| antiSACas9-102 | + | CCGGCAACGAGCUGUCUACA | 20 | 1167 |
| antiSACas9-103 | + | AAGUACUCAACCGACAUUCU | 20 | 1168 |
| antiSACas9-104 | + | AAUGACACCCUGUAUAGUAC | 20 | 1169 |
| antiSACas9-105 | + | ACUGUUCAAGGAGGCCAACG | 20 | 1170 |
| antiSACas9-106 | + | CCGACUUCAUCUUUAAGGAG | 20 | 1171 |
| antiSACas9-107 | - | GAAUCUGAACUAGACAGGUA | 20 | 1172 |
| antiSACas9-108 | + | CGGGUGGAUAAAAAGCCCAA | 20 | 1173 |
| antiSACas9-109 | + | ACCAGAGCUCCGAGGACAUC | 20 | 1174 |
| antiSACas9-110 | - | GGUGGUACAUCAGCAGCUUC | 20 | 1175 |
| antiSACas9-lll | + | CCGGAACACACAACCUGUCC | 20 | 1176 |
| antiSACas9-112 | - | GUGCUUUUUAAAGGUUUCGU | 20 | 1177 |
| antiSACas9-113 | - | UUCACAUCCAGAUUGUUCAC | 20 | 1178 |
| antiSACas9-114 | - | UUCCAGAGCUUUGCUAUUGC | 20 | 1179 |
| antiSACas9-115 | + | ACAUCUUUUCUGAGGCGCAA | 20 | 1180 |
| antiSACas9-116 | + | AAAGCUGAUCAACAAAAGUC | 20 | 1181 |
| antiSACas9-117 | + | GAAUCUGGAUGUCAUCAAAA | 20 | 1182 |
| antiSACas9-118 | + | UAUAAGUACUAUGAAGAGAC | 20 | 1183 |
| antiSACas9-119 | + | CAUCACUUACCGAGAGUAUC | 20 | 1184 |
| antiSACas9-120 | + | UAUCAUUAUCGAGCUGGCUA | 20 | 1185 |
| antiSACas9-121 | + | CAAGGUGCUGGUCAAGCAGG | 20 | 1186 |
| antiSACas9-122 | + | AAAGUACUCAACCGACAUUC | 20 | 1187 |
| antiSACas9-123 | - | AUUGUCGAAGGACACGCUUC | 20 | 1188 |
| antiSACas9-124 | + | GAGUGCAUAACGUCAAUGAG | 20 | 1189 |
| antiSACas9-125 | + | AGUAUGUCGCAGAGCUGCAG | 20 | 1190 |
| antiSACas9-126 | - | GAAAUCGUCCACCAGUGUGG | 20 | 1191 |
| antiSACas9-127 | + | ACCAUGAUCCUCAGACAUAU | 20 | 1192 |
| antiSACas9-128 | - | CUUGACGCUUCUCAGCUCUU | 20 | 1193 |
| antiSACas9-129 | + | GUAUAAGUACUAUGAAGAGA | 20 | 1194 |
| antiSACas9-130 | + | GGGGUAUGGGAUUAUUGACU | 20 | 1195 |
| antiSACas9-131 | + | CCCACUGUAUAAGUACUAUG | 20 | 1196 |
| antiSACas9-132 | + | UCGAAAACGUGUUUAAGCAG | 20 | 1197 |
| antiSACas9-133 | + | AGACCAAAAAGGAGUACCUG | 20 | 1198 |
| antiSACas9-134 | - | UUAAACACGUUUUCGAUGAU | 20 | 1199 |
| antiSACas9-135 | - | GCUUGACCACGGGUGACAGA | 20 | 1200 |
| antiSACas9-136 | - | UUAAACUUCCAUUUGCGCCU | 20 | 1201 |
| antiSACas9-137 | + | AUGAGGGACGGAGAAGCAAG | 20 | 1202 |
| antiSACas9-138 | - | CUGACUCAGGUCCACCUUUU | 20 | 1203 |
| antiSACas9-139 | + | GAAAGACAUCAAGGAAUGGU | 20 | 1204 |
| antiSACas9-140 | + | UAAGGACAUCACAGCACGGA | 20 | 1205 |
| antiSACas9-141 | + | AAAAGGUGGACCUGAGUCAG | 20 | 1206 |
| antiSACas9-142 | + | AAUAUGAUUGACAUCACUUA | 20 | 1207 |
| antiSACas9-143 | + | GAGAAGGGAGCCCCUUCGGA | 20 | 1208 |
| antiSACas9-144 | + | GAUUAUCCGAACUACCGGGA | 20 | 1209 |
| antiSACas9-145 | + | UCAAAGAAGCCAAGCAGCUG | 20 | 1210 |
| antiSACas9-146 | - | GGUGAGAGUACUUGUAGUCC | 20 | 1211 |
| antiSACas9-147 | + | ACCUGAACAGCGAGCUGACC | 20 | 1212 |
| antiSACas9-148 | + | GACCGACCAUUCUGAGCUGA | 20 | 1213 |
| antiSACas9-149 | - | GCUUGAUCUGGUGAGGAGUG | 20 | 1214 |
| antiSACas9-150 | - | UGACCAGCACCUUGUUGUUA | 20 | 1215 |
| antiSACas9-151 | + | CAAGCUGCACGAUAUGCAGG | 20 | 1216 |
| antiSACas9-152 | - | UAAAGGUUUCGUAAGAGAUC | 20 | 1217 |
| antiSACas9-153 | + | GCACCUAUUUUCCAGAAGAG | 20 | 1218 |
| antiSACas9-154 | + | AAACGAGAAACUGGAAUACU | 20 | 1219 |
| antiSACas9-155 | + | UGAAGAGAUUAUCCGAACUA | 20 | 1220 |
| antiSACas9-156 | + | GGCUGAAGAAAGAUGGCGAG | 20 | 1221 |
| antiSACas9-157 | + | GUCCAGAAGGAUUUUAUUAA | 20 | 1222 |
| antiSACas9-158 | + | GAACAGCGAGCUGACCCAGG | 20 | 1223 |
| antiSACas9-159 | + | AGAACCUACUAUGAGGGACC | 20 | 1224 |
| antiSACas9-160 | - | AGCCAGGUGCAGCAGAGCUG | 20 | 1225 |
| antiSACas9-161 | + | CUACUAUGAGGGACCAGGAG | 20 | 1226 |
| antiSACas9-162 | + | GAAAACCAGAGUUCACCAAU | 20 | 1227 |
| antiSACas9-163 | + | ACAACAAGGUGCUGGUCAAG | 20 | 1228 |
| antiSACas9-164 | + | GCAGACCAAUGAACGCAUUG | 20 | 1229 |
| antiSACas9-165 | + | GGAAAAAGCUGGACAAAGCC | 20 | 1230 |
| antiSACas9-166 | + | UUCAGAUUCCAAGAUCUCUU | 20 | 1231 |
| antiSACas9-167 | + | AGCUGCAGCUGGAACGGCUG | 20 | 1232 |
| antiSACas9-168 | + | GAUUAUGGAGCAGUACGGCG | 20 | 1233 |
| antiSACas9-169 | - | AGAAUCAGAUUGAUAGCUUU | 20 | 1234 |
| antiSACas9-170 | - | UCCUCCAGGGGGAUGGCCUC | 20 | 1235 |
| antiSACas9-171 | + | GGGAUUAUUGACUAUGAAAC | 20 | 1236 |
| antiSACas9-172 | + | UCUCACGCAAUAGCAAAGCU | 20 | 1237 |
| antiSACas9-173 | + | ACGUGGAAAACAAUGAGGGA | 20 | 1238 |
| antiSACas9-174 | - | UUGACGCUUCUCAGCUCUUC | 20 | 1239 |
| antiSACas9-175 | + | GAUAUCAUUAUCGAGCUGGC | 20 | 1240 |
| antiSACas9-176 | - | GUUAAUAAAAUCCUUCUGGA | 20 | 1241 |
| antiSACas9-177 | + | CAACCUGGUCAUCACCAGGG | 20 | 1242 |
| antiSACas9-178 | + | GCACAUUCUGAAUCUGGCCA | 20 | 1243 |
| antiSACas9-179 | + | GGUGGACCUGAGUCAGCAGA | 20 | 1244 |
| antiSACas9-180 | + | AUAUUAAGGACAUCACAGCA | 20 | 1245 |
| antiSACas9-181 | + | CUACAUUCUGGGGCUGGACA | 20 | 1246 |
| antiSACas9-182 | + | GCAAGAGGGGAGCCAGGCGC | 20 | 1247 |
| antiSACas9-183 | + | CCAGGGAUGAAAACGAGAAA | 20 | 1248 |
| antiSACas9-184 | - | UAGCCAGGUGCAGCAGAGCU | 20 | 1249 |
| antiSACas9-185 | + | GGGCUACCGGGUGACAAGCA | 20 | 1250 |
| antiSACas9-186 | + | GGUCAUCACCAGGGAUGAAA | 20 | 1251 |
| antiSACas9-187 | + | GAGCCAGGCGCCUGAAACGA | 20 | 1252 |
| antiSACas9-188 | + | GCUACGAAGAGGCUAAAAAG | 20 | 1253 |
| antiSACas9-189 | + | GGACAAAGCCAAGAAAGUGA | 20 | 1254 |
| antiSACas9-190 | - | UUGGGCUUUUUAUCCACCCG | 20 | 1255 |
| antiSACas9-191 | + | GACUGUUCAAGGAGGCCAAC | 20 | 1256 |
| antiSACas9-192 | + | AAAAGUACUCAACCGACAUU | 20 | 1257 |
| antiSACas9-193 | + | UAGUAAUCUGAAGGGGUACA | 20 | 1258 |
| antiSACas9-194 | + | GGCCGAAUCUAUGCCCGAAA | 20 | 1259 |
| antiSACas9-195 | + | UCAAGCUGCACGAUAUGCAG | 20 | 1260 |
| antiSACas9-196 | + | CUGAACAACCUGGUCAUCAC | 20 | 1261 |
| antiSACas9-197 | + | GGCACAGAAUCCAGAGGGUG | 20 | 1262 |
| antiSACas9-198 | + | ACGCAAUAGCAAAGCUCUGG | 20 | 1263 |
| antiSACas9-199 | + | AGAGAACGCAAAGUACCUGA | 20 | 1264 |
| antiSACas9-200 | + | UCAUCACCAGGGAUGAAAAC | 20 | 1265 |
| antiSACas9-201 | + | AAGGAGUACCUGCUGGAAGA | 20 | 1266 |
| antiSACas9-202 | + | AGCAGAAGAAAAAGCCUACA | 20 | 1267 |
| antiSACas9-203 | + | ACAUCACUUACCGAGAGUAU | 20 | 1268 |
| antiSACas9-204 | + | CACAGCACGGAAAGAAAUCA | 20 | 1269 |
| antiSACas9-205 | + | AGAAGAUGAUCAAUGAGAUG | 20 | 1270 |
| antiSACas9-206 | + | AAGCUGCACGAUAUGCAGGA | 20 | 1271 |
| antiSACas9-207 | - | AUUGUUCAGCAGGUCCUCCA | 20 | 1272 |
| antiSACas9-208 | + | GAUAUUAAGGACAUCACAGC | 20 | 1273 |
| antiSACas9-209 | + | CUAUGAGAAGUUCCAGAUCA | 20 | 1274 |
| antiSACas9-210 | + | GAAGAGAUUAUCCGAACUAC | 20 | 1275 |
| antiSACas9-211 | + | UACACUGAAACAGAUUGCUA | 20 | 1276 |
| antiSACas9-212 | + | AGUACAAGAAAAGACGAUAA | 20 | 1277 |
| antiSACas9-213 | + | CGGGAUUACAAGCGUGGGGU | 20 | 1278 |
| antiSACas9-214 | + | GGCUACCGGGUGACAAGCAC | 20 | 1279 |
| antiSACas9-215 | + | AUAUCGACCUGCUGGAGACU | 20 | 1280 |
| antiSACas9-216 | + | UUAAUCCUUAUGAAGCCAGG | 20 | 1281 |
| antiSACas9-217 | + | CGAGACAGAACAGGAGUACA | 20 | 1282 |
| antiSACas9-218 | + | GAUCAAGAAGAUCAAGUACU | 20 | 1283 |
| antiSACas9-219 | + | GCCGACUUCAUCUUUAAGGA | 20 | 1284 |
| antiSACas9-220 | + | AAGAGAUUAUCCGAACUACC | 20 | 1285 |
| antiSACas9-221 | + | AUGAUCAAUGAGAUGCAGAA | 20 | 1286 |
| antiSACas9-222 | + | AGGCCAACGUGGAAAACAAU | 20 | 1287 |
| antiSACas9-223 | + | AUCAAGAAGAUCAAGUACUA | 20 | 1288 |
| antiSACas9-224 | + | CACAUUCUGAAUCUGGCCAA | 20 | 1289 |
| antiSACas9-225 | + | ACGACAAAGAUAAUGACAAG | 20 | 1290 |
| antiSACas9-226 | - | AAUCUGAACUAGACAGGUAC | 20 | 1291 |
| antiSACas9-227 | + | GCCUGAGUCAGAAGCUGUCA | 20 | 1292 |
| antiSACas9-228 | + | CGAUACUUAUAUCGACCUGC | 20 | 1293 |
| antiSACas9-229 | + | UAGUACAAGAAAAGACGAUA | 20 | 1294 |
| antiSACas9-230 | + | CCUUCGGAUGGAAAGACAUC | 20 | 1295 |
| antiSACas9-231 | + | GAUGGAGAACCAGAUGUUCG | 20 | 1296 |
| antiSACas9-232 | - | CGGCGCUUAGCCAGGUGCAG | 20 | 1297 |
| antiSACas9-233 | + | AGUAAUCUGAAGGGGUACAC | 20 | 1298 |
| antiSACas9-234 | + | CGACCUGAUUAAGAUCAAUG | 20 | 1299 |
| antiSACas9-235 | + | AGCUAUCAAUCUGAUUCUGG | 20 | 1300 |
| antiSACas9-236 | + | AAAGGAACUACAUUCUGGGG | 20 | 1301 |
| antiSACas9-237 | + | GGCCAACGUGGAAAACAAUG | 20 | 1302 |
| antiSACas9-238 | + | UCUUUAAGGAGUGGAAAAAG | 20 | 1303 |
| antiSACas9-239 | + | AGGAGUACCUGCUGGAAGAG | 20 | 1304 |
| antiSACas9-240 | + | UGACUAUCUACCAGAGCUCC | 20 | 1305 |
| antiSACas9-241 | - | GUGGUACAUCAGCAGCUUCU | 20 | 1306 |
| antiSACas9-242 | + | AGGAGAUCCUGGUCAACGAA | 20 | 1307 |
| antiSACas9-243 | - | UGUUGUUAAAGGAAUUGUCG | 20 | 1308 |
| antiSACas9-244 | + | ACAUUGCACCUAUUUUCCAG | 20 | 1309 |
| antiSACas9-245 | + | GAGAACUCUAAAAAGGGCAA | 20 | 1310 |
| antiSACas9-246 | + | AGAGCUGACUAACCUGAACA | 20 | 1311 |
| antiSACas9-247 | + | CAUACAGAUUCGAUGUCUAU | 20 | 1312 |
| antiSACas9-248 | + | UUCUGAAUCUGGCCAAAGGA | 20 | 1313 |
| antiSACas9-249 | - | UGACUCAGGUCCACCUUUUU | 20 | 1314 |
| antiSACas9-250 | + | AACUGUAUAGGGUCAUCGGG | 20 | 1315 |
| antiSACas9-251 | - | GAAUCAGAUUGAUAGCUUUC | 20 | 1316 |
| antiSACas9-252 | + | UGGCUAGGGAGAAGAACAGC | 20 | 1317 |
| antiSACas9-253 | + | UCCAGGAAGAGCUGACUAAC | 20 | 1318 |
| antiSACas9-254 | - | CUUUGACGUAGUCGCUUGUC | 20 | 1319 |
| antiSACas9-255 | + | AUAAGUACUAUGAAGAGACU | 20 | 1320 |
| antiSACas9-256 | - | UUCCGGUUAAUAAAAUCCUU | 20 | 1321 |
| antiSACas9-257 | + | UGAAGCUGGUCCCAAAAAAG | 20 | 1322 |
| antiSACas9-258 | - | UAGAUUCGGCCUGCUUCUCU | 20 | 1323 |
| antiSACas9-259 | + | UCAAGAAGAUCAAGUACUAU | 20 | 1324 |
| antiSACas9-260 | + | AUUUUAUUAACCGGAAUCUG | 20 | 1325 |
| antiSACas9-261 | + | UGGGAAACCUGUAUGAGGUG | 20 | 1326 |
| antiSACas9-262 | + | UCAGAAACUGAAGCUGAUUA | 20 | 1327 |
| antiSACas9-263 | + | AGGCUUACCACCAGCUGGAU | 20 | 1328 |
| antiSACas9-264 | + | UGCUGCGAUCCUAUUUCCGG | 20 | 1329 |
| antiSACas9-265 | + | AUAACGUCAAUGAGGUGGAA | 20 | 1330 |
| antiSACas9-266 | + | GAACGCAUUGAAGAGAUUAU | 20 | 1331 |
| antiSACas9-267 | + | UUCUGUCACCCGUGGUCAAG | 20 | 1332 |
| antiSACas9-268 | + | GCGCAAAUGGAAGUUUAAAA | 20 | 1333 |
| antiSACas9-269 | - | UAAACACGUUUUCGAUGAUC | 20 | 1334 |
| antiSACas9-270 | - | GUACUUGAUCUUCUUGAUCA | 20 | 1335 |
| antiSACas9-271 | - | AAGUCGGCAUUUGCGAUAAU | 20 | 1336 |
| antiSACas9-272 | + | CGAGCUGACCCAGGAAGAGA | 20 | 1337 |
| antiSACas9-273 | + | UCAAGCAUAUCAAGGAUUUC | 20 | 1338 |
| antiSACas9-274 | + | AGGUGCUGGUCAAGCAGGAA | 20 | 1339 |
| antiSACas9-275 | + | CUCUGGAGGCCAUCCCCCUG | 20 | 1340 |
| antiSACas9-276 | + | ACUAUGAGGGACCAGGAGAA | 20 | 1341 |
| antiSACas9-277 | + | GAGCUCCGAGGACAUCCAGG | 20 | 1342 |
| antiSACas9-278 | + | CAAAAAGGAGUACCUGCUGG | 20 | 1343 |
| antiSACas9-279 | + | AUACCCUGAUUGUGAACAAU | 20 | 1344 |
| antiSACas9-280 | + | UCUGGAAGAGAAGUAUGUCG | 20 | 1345 |
| antiSACas9-281 | + | AUAAGGGGAAUACCCUGAUU | 20 | 1346 |
| antiSACas9-282 | - | CCAGCUCGAUAAUGAUAUCA | 20 | 1347 |
| antiSACas9-283 | + | GGAUUAUUGACUAUGAAACA | 20 | 1348 |
| antiSACas9-284 | + | GAGGGACGGAGAAGCAAGAG | 20 | 1349 |
| antiSACas9-285 | - | CAGCUCUUCCUGGAUGUCCU | 20 | 1350 |
| antiSACas9-286 | + | GAAAGAAAUCAUUGAGAACG | 20 | 1351 |
| antiSACas9-287 | + | CAGCACGGAAAGAAAUCAUU | 20 | 1352 |
| antiSACas9-288 | + | GACUCGGAGAACCUACUAUG | 20 | 1353 |
| antiSACas9-289 | - | AAGAUGUGAACCCGCCGUUG | 20 | 1354 |
| antiSACas9-290 | + | GGUGGAUAAAAAGCCCAACA | 20 | 1355 |
| antiSACas9-291 | + | UCGGGGUGAACAAUGAUCUG | 20 | 1356 |
| antiSACas9-292 | + | UGUACAACGCCCUGAAUGAC | 20 | 1357 |
| antiSACas9-293 | - | ACUCCUGUUCUGUCUCGAUU | 20 | 1358 |
| antiSACas9-294 | + | AUCUAUGCCCGAAAUCGAGA | 20 | 1359 |
| antiSACas9-295 | + | GGAACAAGCUGAAUGCCCAU | 20 | 1360 |
| antiSACas9-296 | - | ACCAGGUUGUUCAGGUCAUU | 20 | 1361 |
| antiSACas9-297 | + | ACAAAGCCAAGAAAGUGAUG | 20 | 1362 |
| antiSACas9-298 | + | CAACCUGCUGACCGACCAUU | 20 | 1363 |
| antiSACas9-299 | + | AUCUGGAUGUCAUCAAAAAG | 20 | 1364 |
| antiSACas9-300 | + | CCAUCCCCCUGGAGGACCUG | 20 | 1365 |
| antiSACas9-301 | - | GGUCGGUCAGCAGGUUGUAA | 20 | 1366 |
| antiSACas9-302 | + | UGAAAGUGUAUCACGAUAUU | 20 | 1367 |
| antiSACas9-303 | + | CUAAGAUCCUGACUAUCUAC | 20 | 1368 |
| antiSACas9-304 | + | UGGUCAAGCGGAGCUUCAUC | 20 | 1369 |
| antiSACas9-305 | + | CGGCAACGAGCUGUCUACAA | 20 | 1370 |
| antiSACas9-306 | + | AGCAGGAAGAGAACUCUAAA | 20 | 1371 |
| antiSACas9-307 | + | GAAACGAAACCGGCAGACCA | 20 | 1372 |
| antiSACas9-308 | - | CUUGAUGUCUUUCCAUCCGA | 20 | 1373 |
| antiSACas9-309 | + | CCUGAUUGUGAACAAUCUGA | 20 | 1374 |
| antiSACas9-310 | + | UUAUCGAGCUGGCUAGGGAG | 20 | 1375 |
| antiSACas9-311 | - | CGUGAUACACUUUCAGAUUG | 20 | 1376 |
| antiSACas9-312 | + | AAGAGAUCCCAACCACACUG | 20 | 1377 |
| antiSACas9-313 | - | UUCGUAAGAGAUCUUGGAAU | 20 | 1378 |
| antiSACas9-314 | + | CCUGCCCAAUGAUAUCAUUA | 20 | 1379 |
| antiSACas9-315 | + | AUCGACCUGCUGGAGACUCG | 20 | 1380 |
| antiSACas9-316 | - | UGUCAUUGAUCAGCUCUCUG | 20 | 1381 |
| antiSACas9-317 | + | UGGAGCAGUACGGCGACGAG | 20 | 1382 |
| antiSACas9-318 | - | AUUUGCGCCUCAGAAAAGAU | 20 | 1383 |
| antiSACas9-319 | - | UGUUUUCCACGUUGGCCUCC | 20 | 1384 |
| antiSACas9-320 | - | CGUUGUUGUAAAAGGAGGCG | 20 | 1385 |
| antiSACas9-321 | + | AGCACCCUCAGAUUAUCAAA | 20 | 1386 |
| antiSACas9-322 | - | UCUGCGACAUACUUCUCUUC | 20 | 1387 |
| antiSACas9-323 | + | GGAAUGGUACGAGAUGCUGA | 20 | 1388 |
| antiSACas9-324 | + | GUAUGUCGCAGAGCUGCAGC | 20 | 1389 |
| antiSACas9-325 | + | UGGUCAACGAAGAGGACAUC | 20 | 1390 |
| antiSACas9-326 | + | GGUGGAAGAGGACACCGGCA | 20 | 1391 |
| antiSACas9-327 | - | UAAUCGUCUGUGAUGUCCAG | 20 | 1392 |
| antiSACas9-328 | + | UUAUCCGAACUACCGGGAAA | 20 | 1393 |
| antiSACas9-329 | - | AAUUGUUUUGAUAAUUCGAG | 20 | 1394 |
| antiSACas9-330 | + | GACCAAAAAGGAGUACCUGC | 20 | 1395 |
| antiSACas9-331 | + | CAUCAAAAAGGAGAACUACU | 20 | 1396 |
| antiSACas9-332 | + | AGUGAAUAGCAAGUGCUACG | 20 | 1397 |
| antiSACas9-333 | + | CGACAUUCUGGGAAACCUGU | 20 | 1398 |
| antiSACas9-334 | + | CCGAGGAGUGCAUAACGUCA | 20 | 1399 |
| antiSACas9-335 | + | AGGCCUGAGUCAGAAGCUGU | 20 | 1400 |
| antiSACas9-336 | + | GCAAUAGCAAAGCUCUGGAA | 20 | 1401 |
| antiSACas9-337 | + | ACCUAUUUUCCAGAAGAGCU | 20 | 1402 |
| antiSACas9-338 | - | UCAGCUCUUCCUGGAUGUCC | 20 | 1403 |
| antiSACas9-339 | - | GCAGGUCGAUAUAAGUAUCG | 20 | 1404 |
| antiSACas9-340 | - | CUUGAUAUGCUUGAUCUGGU | 20 | 1405 |
| antiSACas9-341 | + | AGUGCAUAACGUCAAUGAGG | 20 | 1406 |
| antiSACas9-342 | - | AGCUUCAGUUUCUGAUAUGU | 20 | 1407 |
| antiSACas9-343 | - | GGCAAUUGUUUUGAUAAUUC | 20 | 1408 |
| antiSACas9-344 | + | CAACAAGGUGCUGGUCAAGC | 20 | 1409 |
| antiSACas9-345 | + | AGUGAUGGAGAACCAGAUGU | 20 | 1410 |
| antiSACas9-346 | + | GGGAAAGUGUCUGUAUUCUC | 20 | 1411 |
| antiSACas9-347 | + | AGGGAAAGUGUCUGUAUUCU | 20 | 1412 |
| antiSACas9-348 | + | AGAUCGAACAGAUUAGUAAU | 20 | 1413 |
| antiSACas9-349 | - | GAUUGUUCAGCAGGUCCUCC | 20 | 1414 |
| antiSACas9-350 | + | AAUCAAGCUGCACGAUAUGC | 20 | 1415 |
| antiSACas9-351 | + | GUGGAAAACAAUGAGGGACG | 20 | 1416 |
| antiSACas9-352 | + | GCCAGGCGCCUGAAACGACG | 20 | 1417 |
| antiSACas9-353 | + | UCGAUACUUAUAUCGACCUG | 20 | 1418 |
| antiSACas9-354 | + | AGGAUAAUGGCCCCGUGAUC | 20 | 1419 |
| antiSACas9-355 | + | UCAUUAUCGAGCUGGCUAGG | 20 | 1420 |
| antiSACas9-356 | + | AACCUACUAUGAGGGACCAG | 20 | 1421 |
| antiSACas9-357 | + | ACAAUGAGGGACGGAGAAGC | 20 | 1422 |
| antiSACas9-358 | + | UGAAGUGAAUAGCAAGUGCU | 20 | 1423 |
| antiSACas9-359 | + | AUUCUCUGGAGGCCAUCCCC | 20 | 1424 |
| antiSACas9-360 | + | CUGAAGAAAGAUGGCGAGGU | 20 | 1425 |
| antiSACas9-361 | + | UGGCGAACUGUAUAGGGUCA | 20 | 1426 |
| antiSACas9-362 | + | UACUAUGAGGGACCAGGAGA | 20 | 1427 |
| antiSACas9-363 | - | CAAUUGUUUUGAUAAUUCGA | 20 | 1428 |
| antiSACas9-364 | + | GCUGAGUGGAAUUAAUCCUU | 20 | 1429 |
| antiSACas9-365 | + | CUGCUGCACCUGGCUAAGCG | 20 | 1430 |
| antiSACas9-366 | + | CCAGAGCUCCGAGGACAUCC | 20 | 1431 |
| antiSACas9-367 | - | AAUUGUCGAAGGACACGCUU | 20 | 1432 |
| antiSACas9-368 | + | UAUAUCGACCUGCUGGAGAC | 20 | 1433 |
| antiSACas9-369 | + | AGCUGAUCAACAAAAGUCCC | 20 | 1434 |
| antiSACas9-370 | + | AGAAGAACAGCAAGGACGCA | 20 | 1435 |
| antiSACas9-371 | + | UGGAGAACCAGAUGUUCGAA | 20 | 1436 |
| antiSACas9-372 | + | AGAUUGCAAUCUUUAACCGG | 20 | 1437 |
| antiSACas9-373 | + | UUCUCUGGAGGCCAUCCCCC | 20 | 1438 |
| antiSACas9-374 | + | AAUGAGGGACGGAGAAGCAA | 20 | 1439 |
| antiSACas9-375 | - | UCCUUGAUAUGCUUGAUCUG | 20 | 1440 |
| antiSACas9-376 | + | GGGACAUUGCACCUAUUUUC | 20 | 1441 |
| antiSACas9-377 | + | AAGUGAUCAACGCCAUCAUC | 20 | 1442 |
| antiSACas9-378 | + | GCUGCACCUGGCUAAGCGCC | 20 | 1443 |
| antiSACas9-379 | + | GGAACGGCUGAAGAAAGAUG | 20 | 1444 |
| antiSACas9-380 | - | CCUUGAUGUCUUUCCAUCCG | 20 | 1445 |
| antiSACas9-381 | + | GGAGGCCAACGUGGAAAACA | 20 | 1446 |
| antiSACas9-382 | + | ACGGCGGGUUCACAUCUUUU | 20 | 1447 |
| antiSACas9-383 | + | GAGGUCGAUCAUAUUAUCCC | 20 | 1448 |
| antiSACas9-384 | + | UCGAACAGAUUAGUAAUCUG | 20 | 1449 |
| antiSACas9-385 | + | CAAUGAUCUGCUGAACCGCA | 20 | 1450 |
| antiSACas9-386 | + | CCUGACUAUCUACCAGAGCU | 20 | 1451 |
| antiSACas9-387 | + | ACGAGAAACUGGAAUACUAU | 20 | 1452 |
| antiSACas9-388 | + | CGCAGGCGUCAGACUGUUCA | 20 | 1453 |
| antiSACas9-389 | - | AUUCCUUGAUGUCUUUCCAU | 20 | 1454 |
| antiSACas9-390 | + | CCGGCAGACCAAUGAACGCA | 20 | 1455 |
| antiSACas9-391 | + | AGAAUCUGGAUGUCAUCAAA | 20 | 1456 |
| antiSACas9-392 | + | UGCUAAGGAGAUCCUGGUCA | 20 | 1457 |
| antiSACas9-393 | - | AGUACUUGAUCUUCUUGAUC | 20 | 1458 |
| antiSACas9-394 | + | AUAUCAUUAUCGAGCUGGCU | 20 | 1459 |
| antiSACas9-395 | + | AAAUCAAGCUGCACGAUAUG | 20 | 1460 |
| antiSACas9-396 | + | CAGAGCUGCAGCUGGAACGG | 20 | 1461 |
| antiSACas9-397 | + | GAACCCACUGUAUAAGUACU | 20 | 1462 |
| antiSACas9-398 | - | UGAUCACUUUGAUGCUCUGG | 20 | 1463 |
| antiSACas9-399 | + | GCUGAACAAUCCAUUCAACU | 20 | 1464 |
| antiSACas9-400 | + | CAUCUUUUCUGAGGCGCAAA | 20 | 1465 |
| antiSACas9-401 | + | GCCGCAUCAGCAAGACCAAA | 20 | 1466 |
| antiSACas9-402 | + | AUCAGAAACUGAAGCUGAUU | 20 | 1467 |
| antiSACas9-403 | + | AUCCUCAGACAUAUCAGAAA | 20 | 1468 |
| antiSACas9-404 | + | ACGCAGGCGUCAGACUGUUC | 20 | 1469 |
| antiSACas9-405 | - | CCUUGUUGUUAAAGGAAUUG | 20 | 1470 |
| antiSACas9-406 | + | CUCACGCAAUAGCAAAGCUC | 20 | 1471 |
| antiSACas9-407 | + | CAAAUGCCGACUUCAUCUUU | 20 | 1472 |
| antiSACas9-408 | + | UUAUGGAGCAGUACGGCGAC | 20 | 1473 |
| antiSACas9-409 | - | GCUUUUUCCACUCCUUAAAG | 20 | 1474 |
| antiSACas9-410 | + | UCAUCGAAAACGUGUUUAAG | 20 | 1475 |
| antiSACas9-411 | + | CCAGGGUGAAAGGCCUGAGU | 20 | 1476 |
| antiSACas9-412 | - | GGUUAAUAAAAUCCUUCUGG | 20 | 1477 |
| antiSACas9-413 | + | ACAAGGUGGUCAAGCUGUCA | 20 | 1478 |
| antiSACas9-414 | + | GAGAACCUACUAUGAGGGAC | 20 | 1479 |
| antiSACas9-415 | + | CAAAGGGUACAAGCACCAUG | 20 | 1480 |
| antiSACas9-416 | + | AACGUGGAAAACAAUGAGGG | 20 | 1481 |
| antiSACas9-417 | + | UUCUGGGAAACCUGUAUGAG | 20 | 1482 |
| antiSACas9-418 | + | UGAGGGACGGAGAAGCAAGA | 20 | 1483 |
| antiSACas9-419 | + | CAAGACAAGCGACUACGUCA | 20 | 1484 |
| antiSACas9-420 | + | GGAGCCAGGCGCCUGAAACG | 20 | 1485 |
| antiSACas9-421 | + | ACAUCAACAGAUUCUCCGUC | 20 | 1486 |
| antiSACas9-422 | - | UGAACUAGACAGGUACUGGA | 20 | 1487 |
| antiSACas9-423 | + | CUACACUGAAACAGAUUGCU | 20 | 1488 |
| antiSACas9-424 | + | GACGGAGAAGGCACAGAAUC | 20 | 1489 |
| antiSACas9-425 | - | CUUUUUGAUACUCUGAGUCU | 20 | 1490 |
| antiSACas9-426 | + | UGGACAAAGCCAAGAAAGUG | 20 | 1491 |
| antiSACas9-427 | + | AUUCUGUCACCCGUGGUCAA | 20 | 1492 |
| antiSACas9-428 | + | AUAGUACAAGAAAAGACGAU | 20 | 1493 |
| antiSACas9-429 | + | CCUGAACAGCGAGCUGACCC | 20 | 1494 |
| antiSACas9-430 | - | GAGGCAAUUGUUUUGAUAAU | 20 | 1495 |
| antiSACas9-431 | - | AAUCAGGUCGUUGUUGUAAA | 20 | 1496 |
| antiSACas9-432 | - | GCAAUUGUUUUGAUAAUUCG | 20 | 1497 |
| antiSACas9-433 | + | GGCGCAAAUGGAAGUUUAAA | 20 | 1498 |
| antiSACas9-434 | + | UCGAGACAGAACAGGAGUAC | 20 | 1499 |
| antiSACas9-435 | + | CCAAGCAGCUGCUGAAAGUG | 20 | 1500 |
| antiSACas9-436 | + | UGGACAUCGGGAUUACAAGC | 20 | 1501 |
| antiSACas9-437 | + | GAAGGCACAGAAUCCAGAGG | 20 | 1502 |
| antiSACas9-438 | + | UAAGGAGAUCCUGGUCAACG | 20 | 1503 |
| antiSACas9-439 | - | UAAUCAGGUCGUUGUUGUAA | 20 | 1504 |
| antiSACas9-440 | - | GGAUUGUUCAGCAGGUCCUC | 20 | 1505 |
| antiSACas9-441 | + | GCAUAACGUCAAUGAGGUGG | 20 | 1506 |
| antiSACas9-442 | + | GGAGACUCGGAGAACCUACU | 20 | 1507 |
| antiSACas9-443 | + | CCUGAGUCAGAAGCUGUCAG | 20 | 1508 |
| antiSACas9-444 | + | UGCCCGAAAUCGAGACAGAA | 20 | 1509 |
In this study, 293T cells (120,000 cells per well in a 24 well plate) were transfected with 750 ng of a plasmid expressing epitope-tagged (3× Flag-tagged) S. pyogenes Cas9 together with 125 ng of a construct expressing a gRNA targeting the VEGF gene (gRNA sequence GGTGAGUGAGUGUGUGCGUG (SEQ ID NO: 1510), see the 20mer of VEGFA Site 3 (Target Site 3) from FIG. 1d of Fu et al, Improving CIRSPR-Cas nuclease specificity using truncated guide RNAs. Nat Biotechnol 32, 279-284 (2014)). Simultaneously, the cells were transfected with 125 ng of one of three gRNA expression constructs: a construct expressing a gRNA targeting the CCR5 gene (serving as a control), a construct expressing governing gRNA anti-SPCas9-175 (see Example 1) targeting S. pyogenes Cas9, or a construct expressing governing gRNA anti-SPCas9-1 (see Example 1) targeting S. pyogenes Cas9. Cells were harvested for analysis one day, two days, three days, six days and nine days after transfection. To quantify mutation rates of the endogenous VEGF and plasmid-borne Cas9 genes, total genomic DNA was isolated at each time point, and regions encompassing the VEGF gRNA and Cas9 governing gRNA targeting sequences were amplified by PCR. Amplified PCR products were denatured and re-annealed, followed by treatment with T7E1 nuclease. Mutation rates (indel frequency) were measured using a capillary electrophoresis instrument as described in Reyon, D. et al, FLASH assembly of TALENs for high-throughput genome editing. Nat Biotechnol 30, 460-465 (2012). Mutation frequencies (% indels±standard deviation) of VEGF and Cas9 for the three treatment groups are shown in Table E-13. These results confirm that both Cas9-targeted governing gRNAs induce mutations in the Cas9 gene, and that the endogenous VEGF locus is mutated to a similar extent in the presence or absence of a co-transfected Cas9-targeted governing gRNA.
To assess levels of Cas9 protein during the time course of the experiment, total protein lysates were prepared from each treatment group at each time point. Protein samples (15 ug) were separated by SDS-PAGE, blotted to PVDF membrane, and probed with an antibody specific for the 3×Flag epitope tag. An antibody specific for cytoskeletal actin was used as a loading control. As shown in FIG. 7, co-transfection with each of the Cas9-targeted governing gRNAs leads to reduced levels of Cas9 protein, especially at six and nine days following transfection.
| TABLE E-13 |
| VEGF and Cas9 mutation rates |
| Co- | |||||
| transfected | target | ||||
| Group | gRNA | locus | time point | % indel | std. dev. |
| 1 | CCR5 | VEGF | day 1 | 14.6 | 0.39 |
| (control) | day 2 | 30.6 | 5.16 | ||
| day 3 | 23.4 | 1.38 | |||
| day 6 | 25.7 | n.d. | |||
| day 9 | 15.9 | 1.37 | |||
| Cas9 | day 1 | n.a. | n.a. | ||
| day 2 | n.a. | n.a. | |||
| day 3 | n.a. | n.a. | |||
| day 6 | n.a. | n.a. | |||
| day 9 | n.a. | n.a. | |||
| 2 | Cas9 | VEGF | day 1 | 9.7 | 1.33 |
| governing | day 2 | 21.6 | 9.76 | ||
| gRNA (anti- | day 3 | 23.5 | 0.77 | ||
| SPCas9-175) | day 6 | 25.5 | 2.37 | ||
| day 9 | 15.6 | n.d. | |||
| Cas9 | day 1 | 6.6 | 0.83 | ||
| day 2 | 7.4 | n.d. | |||
| day 3 | 11.7 | 1.19 | |||
| day 6 | 29.1 | 4.19 | |||
| day 9 | 24.0 | ||||
| 3 | Cas9 | VEGF | day 1 | 13.2 | 2.84 |
| governing | day 2 | 18.2 | 3.35 | ||
| gRNA (anti- | day 3 | 26.9 | 2.13 | ||
| SPCas9-1) | day 6 | 16.8 | 0.49 | ||
| day 9 | 22.4 | 0.48 | |||
| Cas9 | day 1 | 0 | 0 | ||
| day 2 | 10.1 | 1.15 | |||
| day 3 | 11.7 | n.d. | |||
| day 6 | 16.5 | 0.99 | |||
| day 9 | 21.4 | 1.44 | |||
In this study, HEK-293T cells stably expressing GFP were co-transfected with constructs expressing gRNAs with targeting domains of various lengths (from 15-20 nucleotides) together with a construct expressing S. aureus Cas9. The gRNAs targeted several different genes: VEGF (total of 22 gRNAs), CCR5 (total of 15 gRNAs) and GFP (total of 10 gRNAs). The targeting domains of all the tested gRNAs initiated with a G nucleotide, and all of the gRNA target sites were associated with NNGRRT PAM sequences.
To quantify activity of the VEGF and CCR5 targeting gRNAs, total genomic DNA was isolated from cells two days following transfection and regions encompassing the VEGF and
CCR5 gRNA target sites were amplified by PCR. Amplified PCR products were denatured and re-annealed, followed by treatment with T7E1 nuclease. Mutation rates (indel frequency) were measured using a capillary electrophoresis instrument as described in Reyon, D. et al., FLASH assembly of TALENs for high-throughput genome editing. Nat Biotechnol 30, 460-465 (2012). To quantify activity of the GFP targeting gRNAs, cells were harvested three days following transfection and the percentage of GFP-negative cells (indicating mutation of the GFP gene) were measured by flow cytometry. The mean activity of all gRNAs of each targeting domain length was calculated and compared to the mean activity of the gRNAs with 20 nucleotide targeting domains. As shown in Table E-14, gRNAs with shorter targeting domains have lower average activity than those with 20 nucleotide targeting domains.
| TABLE E-14 |
| Mean activity of S. aureus gRNAs with various length targeting |
| domains compared to gRNAs with 20 nucleotide targeting domains. |
| Targeting Domain | Mean Activity Compared to | |
| Length | 20 nt Targeting Domain | st. dev. |
| 20 | 1 | 0.179 |
| 19 | 0.395 | 0.126 |
| 18 | 0.244 | 0.087 |
| 17 | 0.028 | 0.014 |
| 16 | 0.012 | 0.005 |
| 15 | 0.005 | 0.004 |
All publications, patents, and patent applications mentioned herein are hereby incorporated by reference in their entirety as if each individual publication, patent or patent application was specifically and individually indicated to be incorporated by reference. In case of conflict, the present application, including any definitions herein, will control.
Those skilled in the art will recognize, or be able to ascertain using no more than routine experimentation, many equivalents to the specific embodiments of the invention described herein. While this invention has been disclosed with reference to specific aspects, it is apparent that other aspects and variations of this invention may be devised by others skilled in the art without departing from the true spirit and scope of the invention. The appended claims are intended to be construed to include all such aspects and equivalent variations.
Other embodiments are within the following claims.
1. A method of altering a eukaryotic cell or a target nucleic acid of a eukaryotic cell, the method comprising:
contacting the eukaryotic cell or target nucleic acid of the eukaryotic cell with:
a) a nucleic acid encoding a first guide RNA (gRNA) molecule;
b) a Cas9 molecule, or a nucleic acid encoding a Cas9 molecule; and
c) a payload comprising an inhibitor of a transcription factor, a post-translational modification enzyme, or a post-transcriptional modification enzyme, or a drug that binds to the Cas9 molecule or the gRNA that activates or inhibits activity of the Cas9 molecule or the gRNA.
2. The method of claim 1, wherein the inhibitor is a siRNA, a shRNA, a ribozyme, an antisense-oligonucleotide, an antibody, or an aptamer.
3. The method of claim 1, wherein the inhibitor is a siRNA.
4. The method of claim 1, wherein the inhibitor is a shRNA.
5. The method of claim 1, wherein the inhibitor is a ribozyme.
6. The method of claim 1, wherein the inhibitor is an antisense-oligonucleotide.
7. The method of claim 1, wherein the inhibitor is an antibody.
8. The method of claim 1, wherein the inhibitor is an aptamer.
9. The method claim 1, wherein the drug is an entity that alters enzymatic activity, transcriptional activity, or translational activity of the Cas9 molecule or the gRNA.
10. The method of claim 1, wherein the drug is an entity that alters the amount, distribution, or structure of the Cas9 molecule or the gRNA.
11. The method of claim 1, wherein the drug is an entity that breaks a covalent or non-covalent bond in the Cas9 molecule or the gRNA.
12. The method of claim 1, wherein the drug is an entity that attaches a moiety to the Cas9 molecule or the gRNA.
13. The method of claim 1, wherein the drug is an entity that alters the three dimensional, secondary, tertiary, or quaternary structure, of the Cas9 molecule or the gRNA.
14. The method of claim 1, wherein the drug is an entity that increases or decreases 3′ polyadenylation of the gRNA.
15. The method of claim 1, wherein the drug is polyadenylate polymerase, cleavage and polyadenylation specificity factor (CPSF), or a poly(A) binding protein.
16. The method of claim 1, wherein the drug is inhibitor of DNA binding 1 (ID1), inhibitor of DNA binding 2 (ID2), inhibitor of DNA binding 3 (ID3), or inhibitor of DNA binding 4 (ID4).
17. The method of claim 1, wherein the Cas9 molecule is an S. aureus Cas9 molecule.
18. The method of claim 1, wherein the Cas9 molecule is an S. pyogenes Cas9 molecule.